Guide to the Human Genome
Home | Table of Contents | Search text | Search genes | Search sequences | Purchase | FAQ | Blog | Help

Search of human proteins with 188536004

BLASTP 2.2.11 [Jun-05-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|188536004 zinc finger protein 469 [Homo sapiens]
         (3925 letters)

Database: hs.faa 
           37,866 sequences; 18,247,518 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|188536004 zinc finger protein 469 [Homo sapiens]                  8143   0.0  
gi|163965366 nascent polypeptide-associated complex alpha subuni...   143   4e-33
gi|239751637 PREDICTED: hypothetical protein FLJ22184 [Homo sapi...   115   9e-25
gi|110735435 collagen, type V, alpha 3 preproprotein [Homo sapiens]   107   2e-22
gi|239757130 PREDICTED: hypothetical protein FLJ22184 [Homo sapi...   107   3e-22
gi|4502951 collagen type III alpha 1 preproprotein [Homo sapiens]     105   7e-22
gi|110349772 alpha 1 type I collagen preproprotein [Homo sapiens]     103   4e-21
gi|4502955 type IV collagen alpha 5 isoform 1 precursor [Homo sa...   103   4e-21
gi|148536825 alpha 1 type IV collagen preproprotein [Homo sapiens]    102   6e-21
gi|15890086 type IV collagen alpha 5 isoform 2 precursor [Homo s...   102   1e-20
gi|15890088 type IV collagen alpha 5 isoform 3 precursor [Homo s...   101   1e-20
gi|91208420 bassoon protein [Homo sapiens]                             99   6e-20
gi|239746149 PREDICTED: hypothetical protein LOC80164 [Homo sapi...    99   1e-19
gi|111118976 collagen, type II, alpha 1 isoform 1 precursor [Hom...    95   2e-18
gi|111118974 collagen, type II, alpha 1 isoform 2 precursor [Hom...    95   2e-18
gi|95147555 microtubule-associated protein 1A [Homo sapiens]           94   2e-18
gi|148762969 myeloid/lymphoid or mixed-lineage leukemia 2 [Homo ...    94   3e-18
gi|163914392 glioma tumor suppressor candidate region gene 1 [Ho...    94   3e-18
gi|89142737 alpha 3 type IV collagen isoform 5 precursor [Homo s...    94   3e-18
gi|89363017 alpha 2 type V collagen preproprotein [Homo sapiens]       92   1e-17
gi|89142735 alpha 3 type IV collagen isoform 4 precursor [Homo s...    91   2e-17
gi|89142733 alpha 3 type IV collagen isoform 2 precursor [Homo s...    91   2e-17
gi|89142730 alpha 3 type IV collagen isoform 1 precursor [Homo s...    91   2e-17
gi|89276751 alpha 1 type V collagen preproprotein [Homo sapiens]       91   3e-17
gi|239743293 PREDICTED: mucin 12 [Homo sapiens]                        89   7e-17
gi|160707881 formin 2 [Homo sapiens]                                   88   2e-16
gi|146219843 Snf2-related CBP activator protein [Homo sapiens]         88   2e-16
gi|189181724 proteoglycan 4 isoform D [Homo sapiens]                   86   6e-16
gi|189181722 proteoglycan 4 isoform C [Homo sapiens]                   86   6e-16
gi|189181720 proteoglycan 4 isoform B [Homo sapiens]                   86   6e-16

>gi|188536004 zinc finger protein 469 [Homo sapiens]
          Length = 3925

 Score = 8143 bits (21130), Expect = 0.0
 Identities = 3925/3925 (100%), Positives = 3925/3925 (100%)

Query: 1    MPGERPRGAPPPTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQAMEL 60
            MPGERPRGAPPPTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQAMEL
Sbjct: 1    MPGERPRGAPPPTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQAMEL 60

Query: 61   PEAQPRQARDGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRY 120
            PEAQPRQARDGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRY
Sbjct: 61   PEAQPRQARDGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRY 120

Query: 121  ILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAEELGF 180
            ILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAEELGF
Sbjct: 121  ILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAEELGF 180

Query: 181  HRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPAAE 240
            HRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPAAE
Sbjct: 181  HRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPAAE 240

Query: 241  NSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNG 300
            NSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNG
Sbjct: 241  NSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNG 300

Query: 301  PLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGA 360
            PLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGA
Sbjct: 301  PLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGA 360

Query: 361  AHSAPRPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSP 420
            AHSAPRPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSP
Sbjct: 361  AHSAPRPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSP 420

Query: 421  GPPDTELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSA 480
            GPPDTELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSA
Sbjct: 421  GPPDTELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSA 480

Query: 481  PLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKLPAVRSS 540
            PLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKLPAVRSS
Sbjct: 481  PLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKLPAVRSS 540

Query: 541  QGGSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNT 600
            QGGSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNT
Sbjct: 541  QGGSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNT 600

Query: 601  AGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTH 660
            AGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTH
Sbjct: 601  AGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTH 660

Query: 661  YQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLS 720
            YQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLS
Sbjct: 661  YQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLS 720

Query: 721  SASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAP 780
            SASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAP
Sbjct: 721  SASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAP 780

Query: 781  RVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLPASDLDMEDDAKL 840
            RVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLPASDLDMEDDAKL
Sbjct: 781  RVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLPASDLDMEDDAKL 840

Query: 841  DSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAGVTPESKAPPP 900
            DSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAGVTPESKAPPP
Sbjct: 841  DSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAGVTPESKAPPP 900

Query: 901  LPAATPDPQTPRPGDRGCPARGRPKTRSLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDS 960
            LPAATPDPQTPRPGDRGCPARGRPKTRSLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDS
Sbjct: 901  LPAATPDPQTPRPGDRGCPARGRPKTRSLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDS 960

Query: 961  GGAAEGSGSGGGGRASGLRPRRNDGLGERPPPRPRRPRTQAPGSRADPAPRVPRAAALPE 1020
            GGAAEGSGSGGGGRASGLRPRRNDGLGERPPPRPRRPRTQAPGSRADPAPRVPRAAALPE
Sbjct: 961  GGAAEGSGSGGGGRASGLRPRRNDGLGERPPPRPRRPRTQAPGSRADPAPRVPRAAALPE 1020

Query: 1021 ETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRG 1080
            ETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRG
Sbjct: 1021 ETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRG 1080

Query: 1081 PGFRGRRGRGEKRKEVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRS 1140
            PGFRGRRGRGEKRKEVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRS
Sbjct: 1081 PGFRGRRGRGEKRKEVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRS 1140

Query: 1141 PQARGPSRSLETGAAAREGGPKCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEP 1200
            PQARGPSRSLETGAAAREGGPKCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEP
Sbjct: 1141 PQARGPSRSLETGAAAREGGPKCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEP 1200

Query: 1201 ETAEESAPDSTEFTEALRSPPAACAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTA 1260
            ETAEESAPDSTEFTEALRSPPAACAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTA
Sbjct: 1201 ETAEESAPDSTEFTEALRSPPAACAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTA 1260

Query: 1261 PHGSSPTPGVGSLLGGPGGTQAPVSHNSKDPPARQPGEFLAPVANPSSTACPKPSVLSSK 1320
            PHGSSPTPGVGSLLGGPGGTQAPVSHNSKDPPARQPGEFLAPVANPSSTACPKPSVLSSK
Sbjct: 1261 PHGSSPTPGVGSLLGGPGGTQAPVSHNSKDPPARQPGEFLAPVANPSSTACPKPSVLSSK 1320

Query: 1321 ISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSELFLGPKDLAGCFLEELHPKPSARDAP 1380
            ISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSELFLGPKDLAGCFLEELHPKPSARDAP
Sbjct: 1321 ISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSELFLGPKDLAGCFLEELHPKPSARDAP 1380

Query: 1381 PASSSCLCQDGEDAGSLEPQLPRSPPGTAETEPGRAASPPTLESSSLFPDLPVDRFDPPL 1440
            PASSSCLCQDGEDAGSLEPQLPRSPPGTAETEPGRAASPPTLESSSLFPDLPVDRFDPPL
Sbjct: 1381 PASSSCLCQDGEDAGSLEPQLPRSPPGTAETEPGRAASPPTLESSSLFPDLPVDRFDPPL 1440

Query: 1441 YGSLSANRDSGLPFACADPPQKTVPSDPPYPSFLLLEEVSPMLPSHFPDLSGGKVLSKTC 1500
            YGSLSANRDSGLPFACADPPQKTVPSDPPYPSFLLLEEVSPMLPSHFPDLSGGKVLSKTC
Sbjct: 1441 YGSLSANRDSGLPFACADPPQKTVPSDPPYPSFLLLEEVSPMLPSHFPDLSGGKVLSKTC 1500

Query: 1501 PPERTVVPGAAPSLPGKGSGCSVALMSHLSEDELEIQKLVTELESQLQRSKDTRGAPREL 1560
            PPERTVVPGAAPSLPGKGSGCSVALMSHLSEDELEIQKLVTELESQLQRSKDTRGAPREL
Sbjct: 1501 PPERTVVPGAAPSLPGKGSGCSVALMSHLSEDELEIQKLVTELESQLQRSKDTRGAPREL 1560

Query: 1561 AEAESVGRVELGTGTEPPSQRRTCQATVPHEDTFSAADLTRVGESTAHREGAESAVATVE 1620
            AEAESVGRVELGTGTEPPSQRRTCQATVPHEDTFSAADLTRVGESTAHREGAESAVATVE
Sbjct: 1561 AEAESVGRVELGTGTEPPSQRRTCQATVPHEDTFSAADLTRVGESTAHREGAESAVATVE 1620

Query: 1621 AVQGRPGGTWPCPASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQPVQKAGASKTGLC 1680
            AVQGRPGGTWPCPASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQPVQKAGASKTGLC
Sbjct: 1621 AVQGRPGGTWPCPASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQPVQKAGASKTGLC 1680

Query: 1681 QAEGDSRPPQDVCLPEPSKQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRLL 1740
            QAEGDSRPPQDVCLPEPSKQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRLL
Sbjct: 1681 QAEGDSRPPQDVCLPEPSKQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRLL 1740

Query: 1741 PCEQRGGFLPEPGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPS 1800
            PCEQRGGFLPEPGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPS
Sbjct: 1741 PCEQRGGFLPEPGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPS 1800

Query: 1801 HAAQGHSAGRAGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPACVSNTH 1860
            HAAQGHSAGRAGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPACVSNTH
Sbjct: 1801 HAAQGHSAGRAGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPACVSNTH 1860

Query: 1861 PSRRSQDPALSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNPSGLEGGTVEGG 1920
            PSRRSQDPALSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNPSGLEGGTVEGG
Sbjct: 1861 PSRRSQDPALSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNPSGLEGGTVEGG 1920

Query: 1921 KVACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTANQLQPENGVS 1980
            KVACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTANQLQPENGVS
Sbjct: 1921 KVACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTANQLQPENGVS 1980

Query: 1981 PGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPTPSPPSPNRESLAL 2040
            PGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPTPSPPSPNRESLAL
Sbjct: 1981 PGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPTPSPPSPNRESLAL 2040

Query: 2041 ALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAPSVGDLAACAPSPTSAAHMPCSLG 2100
            ALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAPSVGDLAACAPSPTSAAHMPCSLG
Sbjct: 2041 ALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAPSVGDLAACAPSPTSAAHMPCSLG 2100

Query: 2101 PLPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQLLACSPAWAPLEEADGVQATTDTG 2160
            PLPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQLLACSPAWAPLEEADGVQATTDTG
Sbjct: 2101 PLPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQLLACSPAWAPLEEADGVQATTDTG 2160

Query: 2161 AEDSPVAPPSLTTSPCDPKEALAGCLLQGEGSPLEDPSSWPPGSVSAVTCTHSGDTPKDS 2220
            AEDSPVAPPSLTTSPCDPKEALAGCLLQGEGSPLEDPSSWPPGSVSAVTCTHSGDTPKDS
Sbjct: 2161 AEDSPVAPPSLTTSPCDPKEALAGCLLQGEGSPLEDPSSWPPGSVSAVTCTHSGDTPKDS 2220

Query: 2221 TLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRATGLSSTPTGDEAQAGRGLPGPDP 2280
            TLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRATGLSSTPTGDEAQAGRGLPGPDP
Sbjct: 2221 TLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRATGLSSTPTGDEAQAGRGLPGPDP 2280

Query: 2281 QSRGAPPHTNPDRMPRGHSSYSPSNTARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEG 2340
            QSRGAPPHTNPDRMPRGHSSYSPSNTARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEG
Sbjct: 2281 QSRGAPPHTNPDRMPRGHSSYSPSNTARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEG 2340

Query: 2341 EMGTSSKEPEDPGTPETGRSGATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRN 2400
            EMGTSSKEPEDPGTPETGRSGATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRN
Sbjct: 2341 EMGTSSKEPEDPGTPETGRSGATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRN 2400

Query: 2401 ASHQTPQGDPLGPQDLKQRSRGYKKKPASTENGQWKGQAPHGPVTCEVCAASFRSGPGLS 2460
            ASHQTPQGDPLGPQDLKQRSRGYKKKPASTENGQWKGQAPHGPVTCEVCAASFRSGPGLS
Sbjct: 2401 ASHQTPQGDPLGPQDLKQRSRGYKKKPASTENGQWKGQAPHGPVTCEVCAASFRSGPGLS 2460

Query: 2461 RHKARKHRPHPGAPAEPSPAALPAQQPLEPLAQKCQPPRKKSHRVSGKERPNHSRGDPSH 2520
            RHKARKHRPHPGAPAEPSPAALPAQQPLEPLAQKCQPPRKKSHRVSGKERPNHSRGDPSH
Sbjct: 2461 RHKARKHRPHPGAPAEPSPAALPAQQPLEPLAQKCQPPRKKSHRVSGKERPNHSRGDPSH 2520

Query: 2521 VTQPPPAQGSKEVLRAPGSPHSQQLHPPSPTEHEVDVKTPASKPRPDQAREDELHPKQAE 2580
            VTQPPPAQGSKEVLRAPGSPHSQQLHPPSPTEHEVDVKTPASKPRPDQAREDELHPKQAE
Sbjct: 2521 VTQPPPAQGSKEVLRAPGSPHSQQLHPPSPTEHEVDVKTPASKPRPDQAREDELHPKQAE 2580

Query: 2581 KREGRRWRREPTVDSPSHSEGKSNKKRGKLRGRRLREESILPVSADVISDGRGSRPSPAM 2640
            KREGRRWRREPTVDSPSHSEGKSNKKRGKLRGRRLREESILPVSADVISDGRGSRPSPAM
Sbjct: 2581 KREGRRWRREPTVDSPSHSEGKSNKKRGKLRGRRLREESILPVSADVISDGRGSRPSPAM 2640

Query: 2641 ASYAASPSHCLSVEGGPEADGEQPPRLATLGPGVMEGAAETDQEALCAGETGAQKPPGDR 2700
            ASYAASPSHCLSVEGGPEADGEQPPRLATLGPGVMEGAAETDQEALCAGETGAQKPPGDR
Sbjct: 2641 ASYAASPSHCLSVEGGPEADGEQPPRLATLGPGVMEGAAETDQEALCAGETGAQKPPGDR 2700

Query: 2701 MLCPGRMDGAALGEQPTGQKGASARGFWGPRETKALGVCKESGSEPAEDSSRAHSRSEEG 2760
            MLCPGRMDGAALGEQPTGQKGASARGFWGPRETKALGVCKESGSEPAEDSSRAHSRSEEG
Sbjct: 2701 MLCPGRMDGAALGEQPTGQKGASARGFWGPRETKALGVCKESGSEPAEDSSRAHSRSEEG 2760

Query: 2761 VWEENTPPLGPLGFPETSSSPADSTTSSCLQGLPDNPDTQGGVQGPEGPTPDASGSSAKD 2820
            VWEENTPPLGPLGFPETSSSPADSTTSSCLQGLPDNPDTQGGVQGPEGPTPDASGSSAKD
Sbjct: 2761 VWEENTPPLGPLGFPETSSSPADSTTSSCLQGLPDNPDTQGGVQGPEGPTPDASGSSAKD 2820

Query: 2821 PPSLFDDEVSFSQLFPPGGRLTRKRNPHVYGKRCEKPVLPLPTQPSFEEGGDPTLGPARL 2880
            PPSLFDDEVSFSQLFPPGGRLTRKRNPHVYGKRCEKPVLPLPTQPSFEEGGDPTLGPARL
Sbjct: 2821 PPSLFDDEVSFSQLFPPGGRLTRKRNPHVYGKRCEKPVLPLPTQPSFEEGGDPTLGPARL 2880

Query: 2881 PTDLSDSSSLCLCHEDPWEDEDPAGLPESFLLDGFLNSRVPGIDPWAPGLSLWALEPSRE 2940
            PTDLSDSSSLCLCHEDPWEDEDPAGLPESFLLDGFLNSRVPGIDPWAPGLSLWALEPSRE
Sbjct: 2881 PTDLSDSSSLCLCHEDPWEDEDPAGLPESFLLDGFLNSRVPGIDPWAPGLSLWALEPSRE 2940

Query: 2941 AGAEKLPSHCPEDDRPEAIPELHMVPAAWRGLEMPAPADDSSSSLGDVSPEPPSLERERC 3000
            AGAEKLPSHCPEDDRPEAIPELHMVPAAWRGLEMPAPADDSSSSLGDVSPEPPSLERERC
Sbjct: 2941 AGAEKLPSHCPEDDRPEAIPELHMVPAAWRGLEMPAPADDSSSSLGDVSPEPPSLERERC 3000

Query: 3001 DGGLPGNTHLLPLRATDFEVLSTKFEMQDLCFLGPFEDPVGLPGPSFLDFEGTASSQGPQ 3060
            DGGLPGNTHLLPLRATDFEVLSTKFEMQDLCFLGPFEDPVGLPGPSFLDFEGTASSQGPQ
Sbjct: 3001 DGGLPGNTHLLPLRATDFEVLSTKFEMQDLCFLGPFEDPVGLPGPSFLDFEGTASSQGPQ 3060

Query: 3061 SRRTEEAAGAGRAQGRGRPAKGRRASYKCKVCFQRFRSLGELDLHKLAHTPAPPPTCYMC 3120
            SRRTEEAAGAGRAQGRGRPAKGRRASYKCKVCFQRFRSLGELDLHKLAHTPAPPPTCYMC
Sbjct: 3061 SRRTEEAAGAGRAQGRGRPAKGRRASYKCKVCFQRFRSLGELDLHKLAHTPAPPPTCYMC 3120

Query: 3121 VERRFGSRELLRGHLQERHAQSKAGPWACGMCLKEVADVWMYNEHLREHAVRFARRGQAR 3180
            VERRFGSRELLRGHLQERHAQSKAGPWACGMCLKEVADVWMYNEHLREHAVRFARRGQAR
Sbjct: 3121 VERRFGSRELLRGHLQERHAQSKAGPWACGMCLKEVADVWMYNEHLREHAVRFARRGQAR 3180

Query: 3181 RSLGDLPGGLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPG 3240
            RSLGDLPGGLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPG
Sbjct: 3181 RSLGDLPGGLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPG 3240

Query: 3241 ERAKPRARSTPSNPDGAATPDSASATALADAGSPGPPRTTPSPSPDPWAGGEPLLQATPV 3300
            ERAKPRARSTPSNPDGAATPDSASATALADAGSPGPPRTTPSPSPDPWAGGEPLLQATPV
Sbjct: 3241 ERAKPRARSTPSNPDGAATPDSASATALADAGSPGPPRTTPSPSPDPWAGGEPLLQATPV 3300

Query: 3301 HEACKDPSRDCHHCGKRFPKPFKLQRHLAVHSPQRVYLCPRCPRVYPEHGELLAHLGGAH 3360
            HEACKDPSRDCHHCGKRFPKPFKLQRHLAVHSPQRVYLCPRCPRVYPEHGELLAHLGGAH
Sbjct: 3301 HEACKDPSRDCHHCGKRFPKPFKLQRHLAVHSPQRVYLCPRCPRVYPEHGELLAHLGGAH 3360

Query: 3361 GLLERPELQHTPLYACELCATVMRIIKKSFACSSCNYTFAKKEQFDRHMNKHLRGGRQPF 3420
            GLLERPELQHTPLYACELCATVMRIIKKSFACSSCNYTFAKKEQFDRHMNKHLRGGRQPF
Sbjct: 3361 GLLERPELQHTPLYACELCATVMRIIKKSFACSSCNYTFAKKEQFDRHMNKHLRGGRQPF 3420

Query: 3421 AFRGVRRPGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPAL 3480
            AFRGVRRPGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPAL
Sbjct: 3421 AFRGVRRPGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPAL 3480

Query: 3481 LHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGD 3540
            LHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGD
Sbjct: 3481 LHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGD 3540

Query: 3541 CALDGALERPENEASPGSPGPLLQQALPLGASLPRPGARGQDAEGKRAPLVFSGKRRAPG 3600
            CALDGALERPENEASPGSPGPLLQQALPLGASLPRPGARGQDAEGKRAPLVFSGKRRAPG
Sbjct: 3541 CALDGALERPENEASPGSPGPLLQQALPLGASLPRPGARGQDAEGKRAPLVFSGKRRAPG 3600

Query: 3601 ARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSAAST 3660
            ARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSAAST
Sbjct: 3601 ARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSAAST 3660

Query: 3661 PSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTKTGGGS 3720
            PSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTKTGGGS
Sbjct: 3661 PSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTKTGGGS 3720

Query: 3721 QPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPK 3780
            QPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPK
Sbjct: 3721 QPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPK 3780

Query: 3781 EKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQATPSRVLPTKPKPNSQN 3840
            EKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQATPSRVLPTKPKPNSQN
Sbjct: 3781 EKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQATPSRVLPTKPKPNSQN 3840

Query: 3841 KPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPPKRGTAVHGAEPAEPHTHRTAEAQ 3900
            KPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPPKRGTAVHGAEPAEPHTHRTAEAQ
Sbjct: 3841 KPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPPKRGTAVHGAEPAEPHTHRTAEAQ 3900

Query: 3901 SDLLSQLFGQRLTGFKIPLKKDASE 3925
            SDLLSQLFGQRLTGFKIPLKKDASE
Sbjct: 3901 SDLLSQLFGQRLTGFKIPLKKDASE 3925


>gi|163965366 nascent polypeptide-associated complex alpha subunit
            isoform a [Homo sapiens]
          Length = 2078

 Score =  143 bits (360), Expect = 4e-33
 Identities = 273/1060 (25%), Positives = 359/1060 (33%), Gaps = 246/1060 (23%)

Query: 6    PRGAPPPTMTGDLQPRQVASSPGHPSQP-----PLEDNTPATRTTKGAREAGGQAQAMEL 60
            P+GAP P+    L P+ V   P     P     P     PAT   K       QA A+ +
Sbjct: 861  PKGAPTPSAVTPLSPKGVTLPPKETPTPSVVNLPFPKEGPATPAPK-------QAPALSM 913

Query: 61   PEAQPRQARDGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRY 120
              + P++AR      P+ +G  P+S P  +G+P TPP  +P   PS   G A  SP    
Sbjct: 914  TSSSPKKAR----ATPAPKG-IPAS-PSPKGAP-TPPAATP---PSPKGGPATPSPKW-- 961

Query: 121  ILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQ----GPGT----GAPLRPGL--PRTE 170
                  + T P+    P  P  + A  P   TP     GP T    GAP  P +  P  +
Sbjct: 962  -APTPPAATPPSPKGGPATPSPKGAPTPPAATPPSPKGGPATPSPKGAPTPPAVTPPSPK 1020

Query: 171  AQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQAS 230
              PAA    F +    PP++   +   SP+ATP P    P     T P   G        
Sbjct: 1021 GSPAATP--FPKGASTPPAATPPSPKGSPAATPLPKG-APTTPAATLPSPKGGPATPSLK 1077

Query: 231  GADSWPPAAENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPF-- 288
            GA + PPAA    P      P  +  P+P  + P  SP+G       P   GA T P   
Sbjct: 1078 GAPT-PPAATPPSPKGGPATPSPKGAPMPPAATP-PSPKG---GLATPPHKGAPTTPAAT 1132

Query: 289  -PADVAGHAF---TNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPGG 344
             P+   G A       P   A   P    P+  + T P    PT PA +P        GG
Sbjct: 1133 PPSPKGGLATPPPKGAPTTPAATPPS---PKGGLATPPPKGAPTTPAATP----PSPKGG 1185

Query: 345  LNRHSDLSGALSSPGAAHSAPR-PFSDSLHKSLTKILPERPPSAQDGL------GSTRGP 397
            L   S   GA ++P A   +P+   +    K         PPS + GL      G+   P
Sbjct: 1186 LATPSP-KGAPTTPAATPPSPKGGLATPSPKGAPTTPAATPPSPKGGLATPSPKGAPTTP 1244

Query: 398  PSSLPQRHFPGQAYRASGVDTSPG--PPDTELAAPGPPPARLPQLWDPTAAPYPTPPGGP 455
             ++ P            G  T P   PP  +     PP    P   +P     P+P GGP
Sbjct: 1245 AATPPSPKGGPATPPPKGAPTPPAATPPSLKGGLATPPHKGAP---NPAVVTPPSPKGGP 1301

Query: 456  L------AATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPTARPSPHGMEML-SRLPFPA 508
                   A T        P        P+ AP P P V P   PSP G   L +  P   
Sbjct: 1302 ATSPPKGAPTPPAATPPSPKGSPGTPPPKGAPTP-PAVTP---PSPKGTPTLPATTPSSK 1357

Query: 509  GGPEWQGGSQGAL---------GTAGKTPGPREKLPAVRSSQGG--SPALF--------- 548
            GGP      +G           G    TP   ++ PA+ S +G   SPA+          
Sbjct: 1358 GGPTTPSSKEGPTPPAATPSHKGGPAMTPPSPKRGPAIPSPKGDPTSPAVIPLSPKKAPA 1417

Query: 549  -----------TYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPP-------PRVVGASPSE 590
                       +   +T P   P+    A    +P G P+ P        P V   SP E
Sbjct: 1418 TPVTREGAATPSKGDLTPPAVTPVSLKKAPATSAPKGGPATPSSKGDPTLPAVTPPSPKE 1477

Query: 591  SPLP-----------SPATNT--AGSTCSSLSPMSSS--PANPSSEESQL---------- 625
             P P           +PAT       T  ++ P S    PA PSS    +          
Sbjct: 1478 PPAPKQVATSSSPKKAPATPAPMGAPTLPAVIPSSPKEVPATPSSRRDPIAPTATLLSKK 1537

Query: 626  -PGPLGPSAFFHPP--THPQETGSP-FPSPE-------------PPHSLPTHYQ--PEPA 666
             P  L P     PP  T P    +P  P+P+             PP   P+ Y+  P P 
Sbjct: 1538 TPATLAPKEALIPPAMTVPSPKKTPAIPTPKEAPATPSSKEASSPPAVTPSTYKGAPSPK 1597

Query: 667  KAFPFPA--DGLGAEGAFQCLEETPFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLSSASL 724
            +    PA       E         P P +GP       +G P +PP  P+   SL  +  
Sbjct: 1598 ELLIPPAVTSPSPKEAPTPPAVTPPSPEKGP--ATPAPKGTPTSPPVTPS---SLKDSPT 1652

Query: 725  DQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGL------PSPPA 778
                V  TC+                   G  + +A  G     GP  L      P+P +
Sbjct: 1653 SPASV--TCKM------------------GATVPQASKGLPAKKGPTALKEVLVAPAPES 1692

Query: 779  APRVPADAHAG---LLSHAKTFLLAGDAQAE-GKDDPLRTGFLPSLAATPFPLPASDLDM 834
             P + A    G     S A +  +  D  A+ G   PL T         P PL     D 
Sbjct: 1693 TPIITAPTRKGPQTKKSSATSPPICPDPSAKNGSKGPLST-------VAPAPLLPVQKDS 1745

Query: 835  EDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAGVTPE 894
               AK          G +                A   P GP  P             PE
Sbjct: 1746 SKTAK----------GKD----------------ASHSPKGPLAP-------------PE 1766

Query: 895  SKAPPPLPAATPDPQTPRPGDRGCPARGRPKTRSLGLAPT 934
            SKA  PL AA  +   P+P      A   P   SL LAP+
Sbjct: 1767 SKASTPLTAAAFEKVLPKPESASVSAAPSPPV-SLPLAPS 1805



 Score =  136 bits (342), Expect = 5e-31
 Identities = 418/1845 (22%), Positives = 606/1845 (32%), Gaps = 321/1845 (17%)

Query: 1095 EVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGA 1154
            E EL Q P+ +    P  +A       G P  P  P    P P + P +           
Sbjct: 13   EQELPQ-PQAETAVLPMSSALSVTAALGQPG-PTLPPPCSPAPQQCPLS----------- 59

Query: 1155 AAREGGPKCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFT 1214
            AA +  P     PS     PL+VP              FPQ +        +AP++  F 
Sbjct: 60   AANQASP--FPSPSTIASTPLEVP--------------FPQSSSGTALPLGTAPEAPTFL 103

Query: 1215 EALRSPPAACAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSLA--NTAPHG--------- 1263
              L  PP + A    ASP ++ P          GTP  S  LA    APH          
Sbjct: 104  PNLIGPPISPAALALASP-MIAPTL-------KGTPSSSAPLALVALAPHSVQKSSAFPP 155

Query: 1264 ---SSPTPGVGSLLGGPGGTQAPVSHNS-KDPPARQPGEFLAPVANPSSTACPKPSVLS- 1318
               +SP     +  G      AP++ +  K    + P E    V NP  T  P P ++S 
Sbjct: 156  NLLTSPPSVAVAESGSVITLSAPIAPSEPKTNLNKVPSEV---VPNPKGTPSP-PCIVST 211

Query: 1319 ------SKISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSELFLGPKDLAGCFLEELHP 1372
                  + ++S     A   +      +A   PQ   +  S + + P++     L+    
Sbjct: 212  VPYHCVTPMASIQSGVASLPQTTPTTTLAIASPQVKDTTISSVLISPQNPGSLSLKGPVS 271

Query: 1373 KPSARDAPPASSSCLCQDGEDAGSLEPQLPRSPPGTAETEPGRAASPPTLESSSLFPDLP 1432
             P+A      S   +    + AG      P +PP             P    S L P   
Sbjct: 272  PPAALSLSTQSLPVVTSSQKTAG------PNTPPDF-----------PISLGSHLAP--- 311

Query: 1433 VDRFDPPLYGSLSANRDSGLPFACADPPQKTVPSD---------------PPYPSFLLLE 1477
                    +GS+     +G P A +DP  KT+  D               PP PS     
Sbjct: 312  ---LHQSSFGSVQLLGQTG-PSALSDPTVKTISVDHSSTGASYPSQRSVIPPLPS---RN 364

Query: 1478 EVSPMLPSHFP------DLSGGKVLSKTCPPERTVVPGAAPSLPGKGSGCSVALMSHLSE 1531
            EV P   + FP      D     + S TC P  ++    + SL       + +L+   S 
Sbjct: 365  EVVPATVAAFPVVAPSVDKGPSTISSITCSPSGSLNVATSFSL-----SPTTSLILKSSP 419

Query: 1532 DELEIQKLVTELE-SQLQRSKDTRGAPRELAEAESVGRVELGTGTEPPSQRRTCQATVPH 1590
            +      LV ++  S +  +      P  +A A +    E+ T   PP       ++ P 
Sbjct: 420  NATYHYPLVAQMPVSSVGTTPLVVTNPCTIAAAPTT-TFEVATCVSPP------MSSGPI 472

Query: 1591 EDTFSAADLTRVGESTAHREGAESAVATVEAVQGRPGGTWPCPASFHPGHAALLPCAQED 1650
             +    +    V    A +E   + VAT   +   P    P      P    +    Q+D
Sbjct: 473  SNIEPTSPAALVMAPVAPKE-PSTQVATTLRIPVSPPLPDPEDLKNLPSSVLVKFPTQKD 531

Query: 1651 L------VSGAPFSPRGANFHFQPVQKAGASKTGLCQAEGDSRPPQDVCLPEPSKQPGPQ 1704
            L      + GAPFSP  A        K   +   L QA   + P        P     P+
Sbjct: 532  LQTVPASLEGAPFSPAQAGL----TTKKDPTVLPLVQAAPKNSPSFQSTSSSPEIPLSPE 587

Query: 1705 LDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRLLPCEQRGGFLPEPGTADQPHRGAPA 1764
                +LAK S  + L   K    ASS  S      L        +     A     G   
Sbjct: 588  ---ATLAKKSLGEPLPIGK---PASSMTSP-----LGVNSSASVIKTDSYAGPDSAGPLL 636

Query: 1765 PEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPSHAAQGHSAGRAGGHLHPTAGRPGF 1824
              +  +P V            A PL++  P G +P+ A         G   + T   P  
Sbjct: 637  KSSLITPTV-----------AAFPLESADPAGVAPTTA--------KGTSTYTTTASPFL 677

Query: 1825 EGN-EFAPAG-----ASSLTAPRGREAWLVPVPSPACVSNTHPSRRSQDPA---LSPPIR 1875
            EG    AP        +  T P      LVP  S  C     P       A   L+P I 
Sbjct: 678  EGTVSLAPKNHPVKEGTLTTLP------LVPTASENCPVAPSPQNTCAPLATLVLAPEIP 731

Query: 1876 QLQLPGPGV--------AKSKDGILGLQELTPAAQSPPRVNPSGLEGGTVEGGKVACGPA 1927
            +  +P P +         K  DGI     L P A SP                K      
Sbjct: 732  K-SVPSPSLPPAGTPPGTKKVDGISHTSALAPVASSPKECPTEDSGASATASSKGTLTYL 790

Query: 1928 QGSPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTANQLQPENGVS-PGGTDN 1986
              SP  + V+  P          + G    +G          A+ L PEN +S  G  D+
Sbjct: 791  ADSPSPLGVSVSPQTKRPPTKKGSAGPDTPIGNLSSPVSPVEASFL-PENSLSFQGSKDS 849

Query: 1987 HASVNA-SPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPTPS----------PPSP-N 2034
             A+ ++ +P +    PT  AV     KG    ++L  +  PTPS          P +P  
Sbjct: 850  PATTHSPTPPSPKGAPTPSAVTPLSPKG----VTLPPKETPTPSVVNLPFPKEGPATPAP 905

Query: 2035 RESLALALTAAHSRSGSEGRTPE--RASSPGLNKPLLATGDSPAPSVGDLAACAPSPTSA 2092
            +++ AL++T++  +       P+   AS      P       P+P  G      PSP  A
Sbjct: 906  KQAPALSMTSSSPKKARATPAPKGIPASPSPKGAPTPPAATPPSPKGG---PATPSPKWA 962

Query: 2093 AHMPCSLGPLPREDPLT------------SPSRAQGGLGGQLPASPSCRDPPGPQQLLAC 2140
               P +  P P+  P T            +P   +GG     PA+PS +  P P  +   
Sbjct: 963  PTPPAATPPSPKGGPATPSPKGAPTPPAATPPSPKGG-----PATPSPKGAPTPPAVTPP 1017

Query: 2141 SPAWAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCDPKEALAGCLLQGEGSPLEDPSSW 2200
            SP  +P        A+T          PP+ T  P  PK + A   L  +G+P    ++ 
Sbjct: 1018 SPKGSPAATPFPKGAST----------PPAAT--PPSPKGSPAATPLP-KGAPTTPAATL 1064

Query: 2201 P-PGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRA-- 2257
            P P    A        TP  +T   P   +      SP  A  PP A   SP   +    
Sbjct: 1065 PSPKGGPATPSLKGAPTPPAAT---PPSPKGGPATPSPKGAPMPPAATPPSPKGGLATPP 1121

Query: 2258 -TGLSSTPTGDEAQAGRGLPGPDPQSRGAPPHTNPDRMPRGHSSYSPSNTARLGHREGQA 2316
              G  +TP         GL  P P+     P   P   P+G  +  P         +G  
Sbjct: 1122 HKGAPTTPAATPPSPKGGLATPPPKGAPTTPAATPP-SPKGGLATPPP--------KGAP 1172

Query: 2317 VTAVPTEPPTLQGAGPDSPACLEGEMGTSSKEPEDP--GTPETGRSGATKMPRVTCPSTG 2374
             T   T P    G    SP   +G   T +  P  P  G       GA   P  T PS  
Sbjct: 1173 TTPAATPPSPKGGLATPSP---KGAPTTPAATPPSPKGGLATPSPKGAPTTPAATPPSPK 1229

Query: 2375 LGLGRTTAPSSTASDFQSDSPQSHRNASHQTPQGDPLGPQDLKQRSRGYKKKPASTENGQ 2434
             GL  T +P    +   +  P         +P+G P  P       +G    PA+T    
Sbjct: 1230 GGLA-TPSPKGAPTTPAATPP---------SPKGGPATPP-----PKGAPTPPAATPPSL 1274

Query: 2435 WKGQA--PH--GPVTCEVCAASFRSGPGLSRHKARKHRPHPGAPAEPSPAALPAQQPLE- 2489
              G A  PH   P    V   S + GP  S  K     P P A   PSP   P   P + 
Sbjct: 1275 KGGLATPPHKGAPNPAVVTPPSPKGGPATSPPKG---APTPPAATPPSPKGSPGTPPPKG 1331

Query: 2490 -PLAQKCQPPRKKSHRVSGKERPNHSRGDPSHVTQPPPAQGSKEVLRAPGSPHSQQLHPP 2548
             P      PP  K         P+ S+G P   T P   +G       P       + PP
Sbjct: 1332 APTPPAVTPPSPKGTPTLPATTPS-SKGGP---TTPSSKEGPTPPAATPSHKGGPAMTPP 1387

Query: 2549 SPTEHEVDVKTPASKPRPDQAREDELHPKQAEKREGRRWRREPTVDSPSHSEGKSNKKRG 2608
            SP         P+ K  P       L PK+A               +P   EG +   +G
Sbjct: 1388 SPKRGPA---IPSPKGDPTSPAVIPLSPKKAPA-------------TPVTREGAATPSKG 1431

Query: 2609 KLRGRRLREESILPVSADVISDGRGSRPS-------PAMASYAASPSHCLSVEGGPEADG 2661
             L    +   S+    A     G  + PS       PA+   +              +  
Sbjct: 1432 DLTPPAVTPVSLKKAPATSAPKGGPATPSSKGDPTLPAVTPPSPKEPPAPKQVATSSSPK 1491

Query: 2662 EQPPRLATLGPGVMEGAAETDQEALCAGETGAQKPPGDRMLCPGRMDGAALGEQPTGQKG 2721
            + P   A +G   +     +  + + A  +  + P         +   A L   P     
Sbjct: 1492 KAPATPAPMGAPTLPAVIPSSPKEVPATPSSRRDPIAPTATLLSKKTPATLA--PKEALI 1549

Query: 2722 ASARGFWGPRETKALGVCKESGSEPAEDSSRAHSRSEEGVWEENTPPLGPLGFPE-TSSS 2780
              A     P++T A+   KE+ + P+   + +        ++    P   L  P  TS S
Sbjct: 1550 PPAMTVPSPKKTPAIPTPKEAPATPSSKEASSPPAVTPSTYKGAPSPKELLIPPAVTSPS 1609

Query: 2781 PADSTTSSCLQGLPDNPDTQGGVQGPEG-PT-PDASGSSAKDPPS 2823
            P ++ T   +   P +P+       P+G PT P  + SS KD P+
Sbjct: 1610 PKEAPTPPAV--TPPSPEKGPATPAPKGTPTSPPVTPSSLKDSPT 1652



 Score =  131 bits (329), Expect = 2e-29
 Identities = 351/1592 (22%), Positives = 528/1592 (33%), Gaps = 223/1592 (14%)

Query: 1141 PQARGPSRSLE-TGAAAREGGPKCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKE 1199
            P + GP  ++E T  AA    P     PS      L++P +        P L  P++ K 
Sbjct: 466  PMSSGPISNIEPTSPAALVMAPVAPKEPSTQVATTLRIPVS--------PPLPDPEDLKN 517

Query: 1200 -PETAEESAPDSTEFTEALRSPPAACAGE--MGASPGLLIPEQPPPSRHDTGTPKPSGSL 1256
             P +     P   +    L++ PA+  G     A  GL   + P         PK S S 
Sbjct: 518  LPSSVLVKFPTQKD----LQTVPASLEGAPFSPAQAGLTTKKDPTVLPLVQAAPKNSPSF 573

Query: 1257 ANTAPHGSSPTPGVGSLLGGPGGTQAPVSHNSKDPPARQPGEFLAPVANPSSTACP---- 1312
             +T+     P     +L     G   P+   +    +       A V    S A P    
Sbjct: 574  QSTSSSPEIPLSPEATLAKKSLGEPLPIGKPASSMTSPLGVNSSASVIKTDSYAGPDSAG 633

Query: 1313 ---KPSVLSSKISSFGCDPAGFNRDPLGV-PVAKKGPQPYSSPHSELFLGPKDLAGCFLE 1368
               K S+++  +++F  + A    DP GV P   KG   Y++  S    G   LA     
Sbjct: 634  PLLKSSLITPTVAAFPLESA----DPAGVAPTTAKGTSTYTTTASPFLEGTVSLA----P 685

Query: 1369 ELHPKPSARDA-----PPASSSCLCQDGEDAGS-------LEPQLPRSPPGT----AETE 1412
            + HP            P AS +C                 L P++P+S P      A T 
Sbjct: 686  KNHPVKEGTLTTLPLVPTASENCPVAPSPQNTCAPLATLVLAPEIPKSVPSPSLPPAGTP 745

Query: 1413 PGRAASPPTLESSSLFPDLPVDRFDPP----------LYGSLSANRDSGLPFACA----- 1457
            PG         +S+L P     +  P             G+L+   DS  P   +     
Sbjct: 746  PGTKKVDGISHTSALAPVASSPKECPTEDSGASATASSKGTLTYLADSPSPLGVSVSPQT 805

Query: 1458 -DPPQKTVPSDPPYPSFLLLEEVSPMLPSHFPDLSGGKVLSKTCP----------PERTV 1506
              PP K   + P  P   L   VSP+  S  P+ S     SK  P          P+   
Sbjct: 806  KRPPTKKGSAGPDTPIGNLSSPVSPVEASFLPENSLSFQGSKDSPATTHSPTPPSPKGAP 865

Query: 1507 VPGAAPSLPGKG-----------SGCSVALMSHLSEDELEIQKLVTELESQLQRSKDTRG 1555
             P A   L  KG           S  ++             Q     + S   +      
Sbjct: 866  TPSAVTPLSPKGVTLPPKETPTPSVVNLPFPKEGPATPAPKQAPALSMTSSSPKKARATP 925

Query: 1556 APRELAEAESVGRVELGTGTEPPSQRRTCQATVPH---EDTFSAADLTRVGESTAHREGA 1612
            AP+ +  + S           PPS +       P        +     + G +T   +GA
Sbjct: 926  APKGIPASPSPKGAPTPPAATPPSPKGGPATPSPKWAPTPPAATPPSPKGGPATPSPKGA 985

Query: 1613 ESA-VATVEAVQGRPGGTWPCPASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQPVQK 1671
             +   AT  + +G P    P  A   P   A+ P + +   +  PF P+GA+    P   
Sbjct: 986  PTPPAATPPSPKGGPATPSPKGAPTPP---AVTPPSPKGSPAATPF-PKGAST--PPAAT 1039

Query: 1672 AGASKTGLCQAEGDSRPPQDVCLPEPSKQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQ 1731
              + K            P       PS + GP   A    K +P    + P + +   + 
Sbjct: 1040 PPSPKGSPAATPLPKGAPTTPAATLPSPKGGP---ATPSLKGAPTPPAATPPSPKGGPAT 1096

Query: 1732 ESEDSLRLLPCEQRGGFLPEPGTADQPHRGAP---------------APEAFGSPAVHLA 1776
             S     + P        P+ G A  PH+GAP                P   G+P    A
Sbjct: 1097 PSPKGAPMPPAATPPS--PKGGLATPPHKGAPTTPAATPPSPKGGLATPPPKGAPTTPAA 1154

Query: 1777 PDLAFQGDGA--PPLDA-TWPFGASPSHAAQGHSAGRAGGHLHPTAGRPGFEGNEFAPAG 1833
               + +G  A  PP  A T P    PS      +    G    P A  P  +G    P+ 
Sbjct: 1155 TPPSPKGGLATPPPKGAPTTPAATPPSPKGGLATPSPKGAPTTPAATPPSPKGGLATPSP 1214

Query: 1834 ASSLTAPRGREAWLVPVPSP-ACVSNTHPSRRSQDPALSPPIRQLQLPGPGVAKSKDGIL 1892
              + T P          PSP   ++   P      PA +PP  +    GP     K    
Sbjct: 1215 KGAPTTPAATP------PSPKGGLATPSPKGAPTTPAATPPSPK---GGPATPPPK---- 1261

Query: 1893 GLQELTPAAQSPPRVNPSGLEGG-TVEGGKVACGPA---QGSPGGVQVTTLPAVAGHQLG 1948
                    A +PP   P  L+GG      K A  PA     SP G   T+ P  A     
Sbjct: 1262 -------GAPTPPAATPPSLKGGLATPPHKGAPNPAVVTPPSPKGGPATSPPKGAPTPPA 1314

Query: 1949 LEADGHWGLLGQAEKTQGQGTANQLQPENGVSPGGTDNHASVNASPKTALTGPTEGAVLL 2008
                   G  G     +G  T   + P    SP GT    +   S K   T P+      
Sbjct: 1315 ATPPSPKGSPG-TPPPKGAPTPPAVTPP---SPKGTPTLPATTPSSKGGPTTPS------ 1364

Query: 2009 EKCKGSRAAMSLQEEAEPTPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPL 2068
             K   +  A +   +  P  +PPSP R     +     +       +P++A +  + +  
Sbjct: 1365 SKEGPTPPAATPSHKGGPAMTPPSPKRGPAIPSPKGDPTSPAVIPLSPKKAPATPVTREG 1424

Query: 2069 LATGDSPAPSVGDLAACAPSPTSAAHMPCSLGPLPREDPLTSPSRAQGGLGGQLPASPSC 2128
             AT     PS GDL   A +P S    P +    P+  P T  S+    L    P SP  
Sbjct: 1425 AAT-----PSKGDLTPPAVTPVSLKKAPAT--SAPKGGPATPSSKGDPTLPAVTPPSP-- 1475

Query: 2129 RDPPGPQQL-LACSPAWAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCDPKEALAGCLL 2187
            ++PP P+Q+  + SP  AP   A     T       SP   P+  +S  DP    A  L 
Sbjct: 1476 KEPPAPKQVATSSSPKKAPATPAPMGAPTLPAVIPSSPKEVPATPSSRRDPIAPTATLLS 1535

Query: 2188 QGEGSPLEDPSSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAG 2247
            +   + L    +  P    A+T      TP   T       ++     S   A+SPP   
Sbjct: 1536 KKTPATLAPKEALIP---PAMTVPSPKKTPAIPT------PKEAPATPSSKEASSPP--- 1583

Query: 2248 AVSPSVAVRATGLSSTPTGDEAQAGRGLPGPDPQSRGAPPHTNPDRMPRGHSSYSPSNTA 2307
            AV+PS           P+  E      +  P P+    PP   P    +G ++ +P  T 
Sbjct: 1584 AVTPST------YKGAPSPKELLIPPAVTSPSPKEAPTPPAVTPPSPEKGPATPAPKGTP 1637

Query: 2308 RLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSSKEPEDPGTPETGRSGATKMPR 2367
                      T+ P  P +L+ + P SPA +  +MG +  +    G P   + G T +  
Sbjct: 1638 ----------TSPPVTPSSLKDS-PTSPASVTCKMGATVPQ-ASKGLP--AKKGPTALKE 1683

Query: 2368 VTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRNASHQTPQGDPLGPQDLKQRS--RGYKK 2425
            V            TAP+      +  S  S       + +    GP      +     +K
Sbjct: 1684 VLVAPAPESTPIITAPTRKGPQTKKSSATSPPICPDPSAKNGSKGPLSTVAPAPLLPVQK 1743

Query: 2426 KPASTENGQWKGQAPHGPVTCEVCAASFRSGPGLSRHKARKHRPHPGAPAEPSPAALPAQ 2485
              + T  G+    +P GP+      AS      L+     K  P P + +  +  + P  
Sbjct: 1744 DSSKTAKGKDASHSPKGPLAPPESKAS----TPLTAAAFEKVLPKPESASVSAAPSPPVS 1799

Query: 2486 QPLEPLAQKCQPPRKKSHRVS--------GKERPNHSRGDPSHVTQPPPAQGS---KEVL 2534
             PL P      PP+++    S         K        +   +  P P  G    + VL
Sbjct: 1800 LPLAPSPVPTLPPKQQFLPSSPGLVLESPSKPLAPADEDELLPLIPPEPISGGVPFQSVL 1859

Query: 2535 RAPGSPHSQQLHPPSPTEHEVDVK----------TPASKPRPDQAREDELHPKQAEKREG 2584
                +P S  +  P+P+  +   K          +  S P  ++    +   +QA+    
Sbjct: 1860 VNMPTPKSAGIPVPTPSAKQPVTKNNKGSGTESDSDESVPELEEQDSTQATTQQAQLAAA 1919

Query: 2585 RRWRREPTVDS-PSHSEGKSNKKRGKLRGRRL 2615
                 EP   +  S SE K+ K   KL  R++
Sbjct: 1920 AEIDEEPVSKAKQSRSEKKARKAMSKLGLRQV 1951



 Score =  114 bits (286), Expect = 1e-24
 Identities = 378/1660 (22%), Positives = 554/1660 (33%), Gaps = 313/1660 (18%)

Query: 1135 PGPGRSPQARGPSRSLETGAAAREGGPKCADRPSVAPKDPLQVPTNTETSEETRPSLDFP 1194
            P P R+        +    A + + GP      + +P   L V T+   S  T   L   
Sbjct: 359  PLPSRNEVVPATVAAFPVVAPSVDKGPSTISSITCSPSGSLNVATSFSLSPTTSLIL--- 415

Query: 1195 QEAKEPETAEESAPDSTEFTEALRSPPAACAGEMGASPGLLIPEQP------PPSRHDTG 1248
                      +S+P++T     +   P +    +G +P  L+   P      P +  +  
Sbjct: 416  ----------KSSPNATYHYPLVAQMPVS---SVGTTP--LVVTNPCTIAAAPTTTFEVA 460

Query: 1249 T----PKPSGSLANTAPHGSSPTPGVGSLLGGPGGTQAPVSHNSKDPPARQPGEFLAPVA 1304
            T    P  SG ++N  P  +SP   V           APV+   K+P  +       PV+
Sbjct: 461  TCVSPPMSSGPISNIEP--TSPAALV----------MAPVA--PKEPSTQVATTLRIPVS 506

Query: 1305 NPSSTACPKPSVLSSKISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSELFLGPKDLAG 1364
             P        ++ SS +  F        +D   VP + +G  P+S   + L    KD   
Sbjct: 507  PPLPDPEDLKNLPSSVLVKFPTQ-----KDLQTVPASLEGA-PFSPAQAGLTT-KKDPTV 559

Query: 1365 CFLEELHPKPSARDAPPASSSCLCQDGEDA---GSLEPQLPRSPPGTAETEP-------- 1413
              L +  PK S      +SS  +    E      SL   LP   P ++ T P        
Sbjct: 560  LPLVQAAPKNSPSFQSTSSSPEIPLSPEATLAKKSLGEPLPIGKPASSMTSPLGVNSSAS 619

Query: 1414 --------GRAASPPTLESSSLFPDL---PVDRFDPPLYGSLSANRDSGLPFACADPPQK 1462
                    G  ++ P L+SS + P +   P++  DP      +A   S      +   + 
Sbjct: 620  VIKTDSYAGPDSAGPLLKSSLITPTVAAFPLESADPAGVAPTTAKGTSTYTTTASPFLEG 679

Query: 1463 TV---PSDPPYPSFLLLEEVSPMLPSHFPDLSGGKVLSKTCPPERTVVPGA-------AP 1512
            TV   P + P     L     P++P+   +         TC P  T+V          +P
Sbjct: 680  TVSLAPKNHPVKEGTLT--TLPLVPTASENCPVAPSPQNTCAPLATLVLAPEIPKSVPSP 737

Query: 1513 SLPGKGSGCSVALMSHLSEDEL------EIQKLVTELESQLQRSKDTRGAPRELAEAESV 1566
            SLP  G+      +  +S            ++  TE +S    +  ++G    LA++ S 
Sbjct: 738  SLPPAGTPPGTKKVDGISHTSALAPVASSPKECPTE-DSGASATASSKGTLTYLADSPS- 795

Query: 1567 GRVELGTGTEPPSQRRTCQATVPHEDTFSAADLTRVGESTAHREGAESAVATVEAVQGRP 1626
                LG    P ++R       P     SA   T +G  ++     E++     ++  + 
Sbjct: 796  ---PLGVSVSPQTKR-------PPTKKGSAGPDTPIGNLSSPVSPVEASFLPENSLSFQ- 844

Query: 1627 GGTWPCPASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQPVQKAGASKTGLCQAEGDS 1686
             G+   PA+ H               S  P SP+GA     P      S  G+     ++
Sbjct: 845  -GSKDSPATTH---------------SPTPPSPKGAP---TPSAVTPLSPKGVTLPPKET 885

Query: 1687 RPPQDVCLPEPSKQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRLLPCEQRG 1746
              P  V LP P +  GP   A              PK   A S   S       P + R 
Sbjct: 886  PTPSVVNLPFPKE--GPATPA--------------PKQAPALSMTSSS------PKKARA 923

Query: 1747 GFLPEPGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPSHAAQGH 1806
               P+   A    +GAP P A   P+    P        +P    T P    PS      
Sbjct: 924  TPAPKGIPASPSPKGAPTPPAATPPSPKGGP-----ATPSPKWAPTPPAATPPSPKGGPA 978

Query: 1807 SAGRAGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPACVSNTHPSRRSQ 1866
            +    G    P A  P  +G    P+   + T P    A   P P  +  +   P   S 
Sbjct: 979  TPSPKGAPTPPAATPPSPKGGPATPSPKGAPTPP----AVTPPSPKGSPAATPFPKGAST 1034

Query: 1867 DPALSPPIRQ-----------------LQLPGPGVAKSKDGILGLQELTPAAQSPPRVNP 1909
             PA +PP  +                   LP P    +   + G    TP A +PP  +P
Sbjct: 1035 PPAATPPSPKGSPAATPLPKGAPTTPAATLPSPKGGPATPSLKGAP--TPPAATPP--SP 1090

Query: 1910 SGLEGGTVEGGKVACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGT 1969
             G             GPA  SP G  +         + GL    H G    A  T     
Sbjct: 1091 KG-------------GPATPSPKGAPMPPAATPPSPKGGLATPPHKG----APTTPA--- 1130

Query: 1970 ANQLQPENGVSP----GGTDNHASVNASPKTALT------GPTEGAVLLEKCKGSRAAMS 2019
            A    P+ G++     G     A+   SPK  L        PT  A      KG  A  S
Sbjct: 1131 ATPPSPKGGLATPPPKGAPTTPAATPPSPKGGLATPPPKGAPTTPAATPPSPKGGLATPS 1190

Query: 2020 LQ-EEAEPTPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAPS 2078
             +     P  +PPSP             +    +G     A++P   K  LAT  SP  +
Sbjct: 1191 PKGAPTTPAATPPSPK---------GGLATPSPKGAPTTPAATPPSPKGGLAT-PSPKGA 1240

Query: 2079 VGDLAACAPSPTSAAHMPCSLG-PLPREDPLTSPSRAQGGLGG---QLPASPSCRDPPGP 2134
                AA  PSP      P   G P P   P  +P   +GGL     +   +P+   PP P
Sbjct: 1241 PTTPAATPPSPKGGPATPPPKGAPTP---PAATPPSLKGGLATPPHKGAPNPAVVTPPSP 1297

Query: 2135 QQLLACSPAWAPLEEADGVQATTDTGAEDSPVAPPSL------TTSPCDPK--EALAGCL 2186
            +      PA +P + A    A T    + SP  PP          +P  PK    L    
Sbjct: 1298 KG----GPATSPPKGAPTPPAATPPSPKGSPGTPPPKGAPTPPAVTPPSPKGTPTLPATT 1353

Query: 2187 LQGEGSPLEDPSSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSP--- 2243
               +G P   PSS    +  A T +H G       +  P   R   +    G  TSP   
Sbjct: 1354 PSSKGGPTT-PSSKEGPTPPAATPSHKGGP----AMTPPSPKRGPAIPSPKGDPTSPAVI 1408

Query: 2244 PLAGAVSPSVAVRATGLSSTPTGD---------------EAQAGRGLPGPDPQSRGAP-- 2286
            PL+   +P+  V   G ++   GD                  A +G P   P S+G P  
Sbjct: 1409 PLSPKKAPATPVTREGAATPSKGDLTPPAVTPVSLKKAPATSAPKGGPAT-PSSKGDPTL 1467

Query: 2287 PHTNPDRMPRGHSSYSPSNTARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSS 2346
            P   P   P      +P   A     +    T  P   PTL    P SP     E+  + 
Sbjct: 1468 PAVTP---PSPKEPPAPKQVATSSSPKKAPATPAPMGAPTLPAVIPSSPK----EVPATP 1520

Query: 2347 KEPEDPGTPETGRSGATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRNASHQTP 2406
                DP  P T    + K P    P   L       P+ T        P   +  +  TP
Sbjct: 1521 SSRRDPIAP-TATLLSKKTPATLAPKEAL-----IPPAMTV-------PSPKKTPAIPTP 1567

Query: 2407 QGDPLGPQDLKQRSRGYKKKPASTENGQWKGQAPHGPVTCEVCAASFRSGPGLSRHKARK 2466
            +  P  P   +  S      P +     +KG AP  P    +  A     P  +      
Sbjct: 1568 KEAPATPSSKEASS------PPAVTPSTYKG-AP-SPKELLIPPAVTSPSPKEAPTPPAV 1619

Query: 2467 HRPHPG-APAEPSPAALPAQQPLEPLAQKCQPPRKKSHRVS-GKERPNHSRGDPSHVTQP 2524
              P P   PA P+P   P   P+ P + K  P    S     G   P  S+G P+   + 
Sbjct: 1620 TPPSPEKGPATPAPKGTPTSPPVTPSSLKDSPTSPASVTCKMGATVPQASKGLPAK--KG 1677

Query: 2525 PPAQGSKEVLRAPGSPHSQQLHPPSPTEHEVDVKTPASKPR-PDQAREDELHPKQAEKRE 2583
            P A   KEVL AP    +  +  P+    +    +  S P  PD +       K   K  
Sbjct: 1678 PTAL--KEVLVAPAPESTPIITAPTRKGPQTKKSSATSPPICPDPSA------KNGSKGP 1729

Query: 2584 GRRWRREPTV----DSPSHSEGK--SNKKRGKLRGRRLREESILPVSADVISDGRGSRPS 2637
                   P +    DS   ++GK  S+  +G L     +  + L  +A          P 
Sbjct: 1730 LSTVAPAPLLPVQKDSSKTAKGKDASHSPKGPLAPPESKASTPLTAAAF-----EKVLPK 1784

Query: 2638 PAMASYAASPSHCLSVEGGPEADGEQPPRLATL--GPGVM 2675
            P  AS +A+PS  +S+   P      PP+   L   PG++
Sbjct: 1785 PESASVSAAPSPPVSLPLAPSPVPTLPPKQQFLPSSPGLV 1824



 Score =  113 bits (282), Expect = 4e-24
 Identities = 392/1692 (23%), Positives = 563/1692 (33%), Gaps = 372/1692 (21%)

Query: 22   QVASSPGHPSQPPLED-----NTPATRTTKGAREAGGQAQAMELPEA--QPRQARDGELK 74
            QVA++   P  PPL D     N P++   K   +   Q     L  A   P QA     K
Sbjct: 496  QVATTLRIPVSPPLPDPEDLKNLPSSVLVKFPTQKDLQTVPASLEGAPFSPAQAGLTTKK 555

Query: 75   PPS---LRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRYILGIASSRTKP 131
             P+   L   AP ++P  + +  +P    PL   + LA ++ G P    I   ASS T P
Sbjct: 556  DPTVLPLVQAAPKNSPSFQSTSSSP--EIPLSPEATLAKKSLGEPLP--IGKPASSMTSP 611

Query: 132  TLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPG---LPRTEAQP--AAEELGFHRCFQE 186
                +       +A + + D+  GP +  PL       P   A P  +A+  G      +
Sbjct: 612  LGVNS-------SASVIKTDSYAGPDSAGPLLKSSLITPTVAAFPLESADPAGVAPTTAK 664

Query: 187  PPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWP--PAAENSF- 243
              S++T+T       T        P   GT    P        + +++ P  P+ +N+  
Sbjct: 665  GTSTYTTTASPFLEGTVSLAPKNHPVKEGTLTTLP-----LVPTASENCPVAPSPQNTCA 719

Query: 244  PGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLV 303
            P A   + P  P+ +P                  P+L  A T P    V G + T+    
Sbjct: 720  PLATLVLAPEIPKSVPS-----------------PSLPPAGTPPGTKKVDGISHTSA--- 759

Query: 304  FAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGAAHS 363
                                 P+ + P   P      +  G +  +   G L+       
Sbjct: 760  -------------------LAPVASSPKECPT-----EDSGASATASSKGTLTYLA---D 792

Query: 364  APRPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPP 423
            +P P   S+         +RPP+ +     + GP + +     P     AS +      P
Sbjct: 793  SPSPLGVSVSPQT-----KRPPTKK----GSAGPDTPIGNLSSPVSPVEASFL------P 837

Query: 424  DTELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCL-PQSAPL 482
            +  L+  G   +       P     PTPP             G P+P     L P+   L
Sbjct: 838  ENSLSFQGSKDS-------PATTHSPTPPSP----------KGAPTPSAVTPLSPKGVTL 880

Query: 483  PWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQG-ALGTAGKTPGPREKLPAVRSSQ 541
            P     P   P+P     +  LPFP  GP      Q  AL     +P      PA +   
Sbjct: 881  P-----PKETPTPS----VVNLPFPKEGPATPAPKQAPALSMTSSSPKKARATPAPK--- 928

Query: 542  GGSPALFTYNGM-TDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNT 600
             G PA  +  G  T P A P          SP G P+ P P+     P+ +P PSP    
Sbjct: 929  -GIPASPSPKGAPTPPAATP---------PSPKGGPATPSPKWAPTPPAATP-PSPKGGP 977

Query: 601  AG-STCSSLSPMSSSPANPSSEESQLPGPLG---PSAFFHPPTHPQETGSPFP--SPEPP 654
            A  S   + +P +++P +P    +  P P G   P A   P        +PFP  +  PP
Sbjct: 978  ATPSPKGAPTPPAATPPSPKGGPAT-PSPKGAPTPPAVTPPSPKGSPAATPFPKGASTPP 1036

Query: 655  HSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGFPRAP---PP 711
             + P   +  PA A P P        A       P P  GP      L+G P  P   PP
Sbjct: 1037 AATPPSPKGSPA-ATPLPKGAPTTPAA-----TLPSPKGGPATP--SLKGAPTPPAATPP 1088

Query: 712  YPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKD-----GHQR 766
             P    +  S     +    T         S    LA     G     A       G   
Sbjct: 1089 SPKGGPATPSPKGAPMPPAATP-------PSPKGGLATPPHKGAPTTPAATPPSPKGGLA 1141

Query: 767  SPGPPGLPSPPAAPRVPADAHAGLLSHAK-----TFLLAGDAQAEGKDDPLRTGFLPSLA 821
            +P P G P+ PAA   P     GL +        T      +   G   P   G   + A
Sbjct: 1142 TPPPKGAPTTPAA--TPPSPKGGLATPPPKGAPTTPAATPPSPKGGLATPSPKGAPTTPA 1199

Query: 822  ATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSS 881
            ATP P P   L                                    A   P G     +
Sbjct: 1200 ATP-PSPKGGL------------------------------------ATPSPKGAPTTPA 1222

Query: 882  GHPLKSKAGV-TPESKAPPPLPAATPD-----PQTPRPGDRGCPARGRPKTRSLGLA-PT 934
              P   K G+ TP  K  P  PAATP      P TP P     P    P +   GLA P 
Sbjct: 1223 ATPPSPKGGLATPSPKGAPTTPAATPPSPKGGPATPPPKGAPTPPAATPPSLKGGLATPP 1282

Query: 935  EADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPP-R 993
               AP+            +       GG A     G     +   P      G  PP   
Sbjct: 1283 HKGAPNPA----------VVTPPSPKGGPATSPPKGAPTPPAATPPSPKGSPGTPPPKGA 1332

Query: 994  PRRPRTQAPGSRADPA-PRVPRAAALPEETRSSRRRRLPPRKDPRKRKA---------RG 1043
            P  P    P  +  P  P    ++     T SS+    PP   P  +           RG
Sbjct: 1333 PTPPAVTPPSPKGTPTLPATTPSSKGGPTTPSSKEGPTPPAATPSHKGGPAMTPPSPKRG 1392

Query: 1044 -------GAWGKELILKIVQQK---NRLREYDFASESEEDEQPPP-------RGPGFRGR 1086
                   G      ++ +  +K     +     A+ S+ D  PP        + P     
Sbjct: 1393 PAIPSPKGDPTSPAVIPLSPKKAPATPVTREGAATPSKGDLTPPAVTPVSLKKAPATSAP 1452

Query: 1087 RG-------RGEKRKEVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGR 1139
            +G       +G+          P+E  P  P++ A   +    APA P  P G+   P  
Sbjct: 1453 KGGPATPSSKGDPTLPAVTPPSPKE--PPAPKQVATSSSPKK-APATPA-PMGAPTLPAV 1508

Query: 1140 SPQARGPSRSLETGAAAREGGPKCADRPS------VAPKDPLQVPTNTETSEETRPSLDF 1193
             P +  P     T ++ R+     A   S      +APK+ L  P  T  S +  P++  
Sbjct: 1509 IPSS--PKEVPATPSSRRDPIAPTATLLSKKTPATLAPKEALIPPAMTVPSPKKTPAIPT 1566

Query: 1194 PQEAKEPETAEESAPDSTEFTEALRSPPAACAGEMGASPG---LLIPEQPPPSRHDTGTP 1250
            P+EA    +++E++           SPPA        +P    LLIP             
Sbjct: 1567 PKEAPATPSSKEAS-----------SPPAVTPSTYKGAPSPKELLIP---------PAVT 1606

Query: 1251 KPSGSLANTAPHGSSPTPGVGSLLGGPGG--TQAPVSHNS-KDPPARQPG-----EFLAP 1302
             PS   A T P  + P+P  G     P G  T  PV+ +S KD P              P
Sbjct: 1607 SPSPKEAPTPPAVTPPSPEKGPATPAPKGTPTSPPVTPSSLKDSPTSPASVTCKMGATVP 1666

Query: 1303 VANPSSTACPKPSVLSSKISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSELFLGP--- 1359
             A+    A   P+ L   + +    PA     P+     +KGPQ   S  +   + P   
Sbjct: 1667 QASKGLPAKKGPTALKEVLVA----PAP-ESTPIITAPTRKGPQTKKSSATSPPICPDPS 1721

Query: 1360 -KDLAGCFLEELHPKPSARDAPPASSSCLCQDGEDAGSLEPQLPRSPPGTAETEPGRAAS 1418
             K+ +   L  + P P     P    S     G+DA S  P+ P +PP +  + P  AA+
Sbjct: 1722 AKNGSKGPLSTVAPAPL---LPVQKDSSKTAKGKDA-SHSPKGPLAPPESKASTPLTAAA 1777

Query: 1419 ------PPTLESSSLFPDLPVDRFDPPLYGSLSANRDSGLPFACADPPQKTVPSDP---- 1468
                   P   S S  P  PV     PL  S         P     P Q+ +PS P    
Sbjct: 1778 FEKVLPKPESASVSAAPSPPVSL---PLAPS---------PVPTLPPKQQFLPSSPGLVL 1825

Query: 1469 PYPSFLLL----EEVSPMLPSHFPDLSGG----KVLSKTCPPERTVVPGAAPSLP----- 1515
              PS  L     +E+ P++P     +SGG     VL     P+   +P   PS       
Sbjct: 1826 ESPSKPLAPADEDELLPLIPPE--PISGGVPFQSVLVNMPTPKSAGIPVPTPSAKQPVTK 1883

Query: 1516 -GKGSGCSVALMSHLSEDELEIQKLVTELESQLQRSKDTRGAPRELAEAESVGRVELGTG 1574
              KGSG            E +  + V ELE Q      T+ A  +LA A  +    +   
Sbjct: 1884 NNKGSG-----------TESDSDESVPELEEQDSTQATTQQA--QLAAAAEIDEEPVSKA 1930

Query: 1575 TEPPSQRRTCQA 1586
             +  S+++  +A
Sbjct: 1931 KQSRSEKKARKA 1942



 Score =  111 bits (278), Expect = 1e-23
 Identities = 285/1249 (22%), Positives = 415/1249 (33%), Gaps = 264/1249 (21%)

Query: 1633 PASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQPVQKAGASKT----GLCQAEGDSRP 1688
            PA   PG   +   +    ++    SP+       P + +GAS T    G      DS  
Sbjct: 741  PAGTPPGTKKVDGISHTSALAPVASSPKEC-----PTEDSGASATASSKGTLTYLADSPS 795

Query: 1689 PQDVCLPEPSKQP-------GPQLDAGSLAKCSPDQELSF-PKNKEAASSQESEDSLRLL 1740
            P  V +   +K+P       GP    G+L+      E SF P+N  + S Q S+DS    
Sbjct: 796  PLGVSVSPQTKRPPTKKGSAGPDTPIGNLSSPVSPVEASFLPEN--SLSFQGSKDS---- 849

Query: 1741 PCEQRGGFLPEPGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPS 1800
            P        P P       +GAP P A           L+ +G   PP +   P   +  
Sbjct: 850  PATTHSPTPPSP-------KGAPTPSA--------VTPLSPKGVTLPPKETPTPSVVNLP 894

Query: 1801 HAAQGHSAGRAGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPACVSNTH 1860
               +G                P     + APA + + ++P+   A   P   PA  S   
Sbjct: 895  FPKEG----------------PATPAPKQAPALSMTSSSPKKARATPAPKGIPASPS--- 935

Query: 1861 PSRRSQDPALSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNPSGLEGGTVEGG 1920
            P      PA +PP  +    GP     K         TP A +PP  +P G         
Sbjct: 936  PKGAPTPPAATPPSPK---GGPATPSPK------WAPTPPAATPP--SPKG--------- 975

Query: 1921 KVACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTANQLQPENGVS 1980
                GPA  SP G    T PA                            A    P+ G +
Sbjct: 976  ----GPATPSPKGAP--TPPA----------------------------ATPPSPKGGPA 1001

Query: 1981 PGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAE--PTPSPPSPNRESL 2038
                        SPK A   PT  AV     KGS AA    + A   P  +PPSP     
Sbjct: 1002 ----------TPSPKGA---PTPPAVTPPSPKGSPAATPFPKGASTPPAATPPSPKGSPA 1048

Query: 2039 ALAL------TAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAPSVGDLAACAPSPTSA 2092
            A  L      T A +    +G  P   S  G   P  AT   P+P  G      PSP  A
Sbjct: 1049 ATPLPKGAPTTPAATLPSPKGG-PATPSLKGAPTPPAAT--PPSPKGGP---ATPSPKGA 1102

Query: 2093 AHMPCSLGPLPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQLLACSPAWAPLEEADG 2152
               P +  P P+    T P +         P SP       P +    +PA  P     G
Sbjct: 1103 PMPPAATPPSPKGGLATPPHKGAPTTPAATPPSPKGGLATPPPKGAPTTPAATPPSPKGG 1162

Query: 2153 VQATTDTGAEDSPVAPPSLTTSPCDPKEALAGCLLQGEGSPLEDPSSWPPGSVSAVTCTH 2212
            +      GA  +P A      +P  PK  LA      +G+P   P++ PP     +    
Sbjct: 1163 LATPPPKGAPTTPAA------TPPSPKGGLA--TPSPKGAP-TTPAATPPSPKGGLATPS 1213

Query: 2213 SGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRATGLSSTPTGDEAQAG 2272
                P                  +P      P  G  +PS      G  +TP        
Sbjct: 1214 PKGAP-----------------TTPAATPPSPKGGLATPS----PKGAPTTPAATPPSPK 1252

Query: 2273 RGLPGPDPQSRGAPPHTNPDRMPRG-----HSSYSPSNTARLGHREGQAVTAVPTEPPTL 2327
             G   P P+    PP   P  +  G     H              +G   T+ P   PT 
Sbjct: 1253 GGPATPPPKGAPTPPAATPPSLKGGLATPPHKGAPNPAVVTPPSPKGGPATSPPKGAPTP 1312

Query: 2328 QGAGPDSPACLEGEMGTSSKE--PEDPGTPETGRSGATKMPRVT-----CPSTGLGLGRT 2380
              A P SP   +G  GT   +  P  P        G   +P  T      P+T       
Sbjct: 1313 PAATPPSP---KGSPGTPPPKGAPTPPAVTPPSPKGTPTLPATTPSSKGGPTTPSSKEGP 1369

Query: 2381 TAPSSTASDFQSDS---PQSHRNASHQTPQGDPLGPQDLKQRSRGYKKKPASTENGQWKG 2437
            T P++T S     +   P   R  +  +P+GDP  P  +       KK PA+    +   
Sbjct: 1370 TPPAATPSHKGGPAMTPPSPKRGPAIPSPKGDPTSPAVIPLSP---KKAPATPVTREGAA 1426

Query: 2438 QAPHGPVT-CEVCAASFRSGPGLSRHKARKHRPHPGAPAEPSPAALPAQQPLEPLAQKCQ 2496
                G +T   V   S +  P  S  K        G PA PS    P    + P + K +
Sbjct: 1427 TPSKGDLTPPAVTPVSLKKAPATSAPK--------GGPATPSSKGDPTLPAVTPPSPK-E 1477

Query: 2497 PPRKKSHRVSGKERPNHSRGDPSHVTQPP-PAQGSKEVLRAPGSPHSQQLHPPSPTEHEV 2555
            PP  K  +V+    P  +   P+ +  P  PA         P +P S++  P +PT   +
Sbjct: 1478 PPAPK--QVATSSSPKKAPATPAPMGAPTLPAVIPSSPKEVPATPSSRR-DPIAPTATLL 1534

Query: 2556 DVKTPAS-KPR----------PDQAREDEL-HPKQAEKREGRRWRREPTVDSPSHSEGKS 2603
              KTPA+  P+          P   +   +  PK+A      +    P   +PS  +G  
Sbjct: 1535 SKKTPATLAPKEALIPPAMTVPSPKKTPAIPTPKEAPATPSSKEASSPPAVTPSTYKGAP 1594

Query: 2604 NKKRGKLRGRRLREESILPVSADVISDGRGSRPSPAMASYAASPSHCLSVEGGPEADGEQ 2663
            + K           E ++P +  V S      P+P     A +P    S E GP     +
Sbjct: 1595 SPK-----------ELLIPPA--VTSPSPKEAPTPP----AVTPP---SPEKGPATPAPK 1634

Query: 2664 -PPRLATLGPGVMEGAAETDQEALCAGETGAQKPPGDRMLCPGRMDGAALGE-----QPT 2717
              P    + P  ++ +  +     C  + GA  P   + L P +    AL E      P 
Sbjct: 1635 GTPTSPPVTPSSLKDSPTSPASVTC--KMGATVPQASKGL-PAKKGPTALKEVLVAPAPE 1691

Query: 2718 GQKGASARGFWGPRETKALG----VCKESGSE-------------PAEDSSRAHSRSEEG 2760
                 +A    GP+  K+      +C +  ++             P     +  S++ +G
Sbjct: 1692 STPIITAPTRKGPQTKKSSATSPPICPDPSAKNGSKGPLSTVAPAPLLPVQKDSSKTAKG 1751

Query: 2761 VWEENTPPLGPLGFPETSSSPADSTTSSCLQGLPDNPDTQGGVQGPEGP 2809
              + +  P GPL  PE+ +S     T++  + +   P++      P  P
Sbjct: 1752 K-DASHSPKGPLAPPESKAS--TPLTAAAFEKVLPKPESASVSAAPSPP 1797



 Score =  108 bits (270), Expect = 1e-22
 Identities = 177/710 (24%), Positives = 242/710 (34%), Gaps = 119/710 (16%)

Query: 6    PRGAP------PPTMTGDLQPRQVASSPGHPSQ-PPLEDNTPATRTTKGAREAGGQAQAM 58
            P+GAP      PP+  G L       +P  P+  PP      AT + KGA          
Sbjct: 1168 PKGAPTTPAATPPSPKGGLATPSPKGAPTTPAATPPSPKGGLATPSPKGAPTT------- 1220

Query: 59   ELPEAQPRQARDGELKPPSLRGQ--APSSTP-GKRGSPQTPPGRSPLQAPSRLAGRAEGS 115
              P A P   + G L  PS +G    P++TP   +G P TPP   P  AP+         
Sbjct: 1221 --PAATPPSPKGG-LATPSPKGAPTTPAATPPSPKGGPATPP---PKGAPT--------- 1265

Query: 116  PPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAA 175
            PP         + T P+L      P  + A  P V TP  P  G    P  P+    P A
Sbjct: 1266 PP---------AATPPSLKGGLATPPHKGAPNPAVVTPPSPKGGPATSP--PKGAPTPPA 1314

Query: 176  EELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQ------A 229
                       PPS   S     P   P PPA  PP  +GT P  P + P  +      +
Sbjct: 1315 AT---------PPSPKGSPGTPPPKGAPTPPAVTPPSPKGT-PTLPATTPSSKGGPTTPS 1364

Query: 230  SGADSWPPAAENSFPGANFGVPPAEPE----PIPKG--SRPGGSPRGVSFQFPFPALHGA 283
            S     PPAA  S  G     PP+       P PKG  + P   P         P     
Sbjct: 1365 SKEGPTPPAATPSHKGGPAMTPPSPKRGPAIPSPKGDPTSPAVIPLSPKKAPATPVTREG 1424

Query: 284  STKPFPADVAGHAFTNGPL--VFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQ 341
            +  P   D+   A T   L    A   P+G     +    P  P  T P+P   P  +  
Sbjct: 1425 AATPSKGDLTPPAVTPVSLKKAPATSAPKGGPATPSSKGDPTLPAVTPPSPKEPPAPKQV 1484

Query: 342  PGGLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSSL 401
                          SSP  A + P P       ++    P+  P+          P ++L
Sbjct: 1485 -----------ATSSSPKKAPATPAPMGAPTLPAVIPSSPKEVPATPSSRRDPIAPTATL 1533

Query: 402  PQRHFPGQAYRASGVDTSPGPPDTELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRS 461
              +  P        +     PP   + +P   PA +P   +  A P       P A T S
Sbjct: 1534 LSKKTPATLAPKEALI----PPAMTVPSPKKTPA-IPTPKEAPATPSSKEASSPPAVTPS 1588

Query: 462  MFFNGQPSPGQRLCLPQSAPLPWPQVLPTARP-SPHGMEMLSRLPFPAGGPEWQGGSQGA 520
             +  G PSP + L +P +   P P+  PT    +P   E     P P G P     +  +
Sbjct: 1589 TY-KGAPSP-KELLIPPAVTSPSPKEAPTPPAVTPPSPEKGPATPAPKGTPTSPPVTPSS 1646

Query: 521  LGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPP 580
            L  +  +P       +V    G +    +       G   L   +  P  +P  TP +  
Sbjct: 1647 LKDSPTSPA------SVTCKMGATVPQASKGLPAKKGPTALKEVLVAP--APESTPIITA 1698

Query: 581  PRVVGASPSESPLPSP-------ATNTAGSTCSSLSPMSSSPANPSSEE-------SQLP 626
            P   G    +S   SP       A N +    S+++P    P    S +       S  P
Sbjct: 1699 PTRKGPQTKKSSATSPPICPDPSAKNGSKGPLSTVAPAPLLPVQKDSSKTAKGKDASHSP 1758

Query: 627  -GPLGP----------SAFFHPPTHPQETGSPFPSPEPPHSLPTHYQPEP 665
             GPL P          +A F       E+ S   +P PP SLP    P P
Sbjct: 1759 KGPLAPPESKASTPLTAAAFEKVLPKPESASVSAAPSPPVSLPLAPSPVP 1808



 Score = 89.7 bits (221), Expect = 5e-17
 Identities = 295/1336 (22%), Positives = 419/1336 (31%), Gaps = 229/1336 (17%)

Query: 899  PPLPAATPDPQTPRPGDRGCPARGRPKTRSL-GLAPTEADAPSQGRQQRRGKQLKLFRKD 957
            P +P + P P  P       PA   P T+ + G++ T A AP     +    +       
Sbjct: 728  PEIPKSVPSPSLP-------PAGTPPGTKKVDGISHTSALAPVASSPKECPTE------- 773

Query: 958  LDSGGAAEGSGSGG-GGRASGLRPRRNDGLGERPPPRPRRPRTQAPGSRADP------AP 1010
             DSG +A  S  G     A    P     LG    P+ +RP T+   +  D       +P
Sbjct: 774  -DSGASATASSKGTLTYLADSPSP-----LGVSVSPQTKRPPTKKGSAGPDTPIGNLSSP 827

Query: 1011 RVP-RAAALPEETRSSRRRRLPPRK--DPRKRKARGGAWGKELILKIVQQKNRLREYDFA 1067
              P  A+ LPE + S +  +  P     P     +G A     +  +  +   L   +  
Sbjct: 828  VSPVEASFLPENSLSFQGSKDSPATTHSPTPPSPKG-APTPSAVTPLSPKGVTLPPKETP 886

Query: 1068 SESEEDEQPPPRGPGFRGRRGRGEKRKEVELTQGPREDEPQKPRKAARQEAGGDGAPANP 1127
            + S  +   P  GP     +            Q P         K AR      G PA+P
Sbjct: 887  TPSVVNLPFPKEGPATPAPK------------QAPALSMTSSSPKKARATPAPKGIPASP 934

Query: 1128 EEPGGSRPGPGRSPQARG----PS-RSLETGAAAREGGPKCADRPSVAPKDPLQVPTNTE 1182
               G   P     P  +G    PS +   T  AA    PK     + +PK     P  T 
Sbjct: 935  SPKGAPTPPAATPPSPKGGPATPSPKWAPTPPAATPPSPK-GGPATPSPKGAPTPPAATP 993

Query: 1183 TSEETRPSLDFPQEAKEPET----AEESAPDSTEFTEALRSPPAACAGEMGASPGLLIPE 1238
             S +  P+   P+ A  P      + + +P +T F +   +PPAA               
Sbjct: 994  PSPKGGPATPSPKGAPTPPAVTPPSPKGSPAATPFPKGASTPPAAT-------------- 1039

Query: 1239 QPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSLLGGPGGTQAPVSHNSKDPPARQPGE 1298
              PPS        P GS A T     +PT    +L    GG   P    +  PPA  P  
Sbjct: 1040 --PPS--------PKGSPAATPLPKGAPTTPAATLPSPKGGPATPSLKGAPTPPAATPPS 1089

Query: 1299 FLAPVANPSSTACPKPSVLSSKISSFGC---DPAGFNRDPLGVPVAKKG----PQPYSSP 1351
                 A PS    P P   +      G       G    P   P + KG    P P  +P
Sbjct: 1090 PKGGPATPSPKGAPMPPAATPPSPKGGLATPPHKGAPTTPAATPPSPKGGLATPPPKGAP 1149

Query: 1352 HSELFLGPKDLAGCFLEELHPKPSARDAPPASSSCLCQDGEDAGSLEPQLPRSPPGTAET 1411
             +     P    G       P P      PA++          G L    P+  P T   
Sbjct: 1150 TTPAATPPSPKGGL----ATPPPKGAPTTPAAT-----PPSPKGGLATPSPKGAPTTPAA 1200

Query: 1412 EPGRAASPPTLESSSLFPDLPVDRFDPPLYGSLSANRDSGLPF--ACADPPQKTVPSDPP 1469
             P          S    P  P     P   G L+     G P   A   P  K  P+ PP
Sbjct: 1201 TPPSPKGGLATPSPKGAPTTPA-ATPPSPKGGLATPSPKGAPTTPAATPPSPKGGPATPP 1259

Query: 1470 YPSFLLLEEVSPMLPSHFPDLSGGKVLSKTCPPERTVVPGAAPSLPGKGSGCSVALMSHL 1529
                      +P      P L GG       PP +     A  + P    G         
Sbjct: 1260 PKGAPTPPAATP------PSLKGG----LATPPHKGAPNPAVVTPPSPKGG--------- 1300

Query: 1530 SEDELEIQKLVTELESQLQRSKDTRGAPRELAEAESVGRVELGTGTEPPSQRRTCQATVP 1589
                                +   +GAP     A +    +   GT PP    T  A  P
Sbjct: 1301 ------------------PATSPPKGAP--TPPAATPPSPKGSPGTPPPKGAPTPPAVTP 1340

Query: 1590 HE----DTFSAADLTRVGEST--AHREGAESAVATVEAVQGRPGGTWPCPASFHPGHAAL 1643
                   T  A   +  G  T  + +EG     AT  + +G P  T P P          
Sbjct: 1341 PSPKGTPTLPATTPSSKGGPTTPSSKEGPTPPAAT-PSHKGGPAMTPPSPK-----RGPA 1394

Query: 1644 LPCAQEDLVSGA--PFSPRGANFHFQPVQKAGASKTGLCQAEGDSRPPQDVCLPEPSKQP 1701
            +P  + D  S A  P SP+ A     PV + GA+      ++GD  PP    +   S + 
Sbjct: 1395 IPSPKGDPTSPAVIPLSPKKA--PATPVTREGAA----TPSKGDLTPP---AVTPVSLKK 1445

Query: 1702 GPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRLL--PCEQRGGFLPEPGTADQPH 1759
             P   A              PK   A  S + + +L  +  P  +      +  T+  P 
Sbjct: 1446 APATSA--------------PKGGPATPSSKGDPTLPAVTPPSPKEPPAPKQVATSSSPK 1491

Query: 1760 RGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPSHAAQGHSAGRAGGH--LHP 1817
            +    P   G+P +      + +   A P     P   + +  ++   A  A     + P
Sbjct: 1492 KAPATPAPMGAPTLPAVIPSSPKEVPATPSSRRDPIAPTATLLSKKTPATLAPKEALIPP 1551

Query: 1818 TAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPACVSNTHPSRRSQDPALSPPIRQL 1877
                P  +     P    +   P  +EA   P  +P    +T+    S    L PP   +
Sbjct: 1552 AMTVPSPKKTPAIPTPKEAPATPSSKEASSPPAVTP----STYKGAPSPKELLIPP--AV 1605

Query: 1878 QLPGPGVAKSKDGIL-GLQELTPAAQSP------PRVNPSGLEGGTVEGGKVACGPAQGS 1930
              P P  A +   +     E  PA  +P      P V PS L+        V C      
Sbjct: 1606 TSPSPKEAPTPPAVTPPSPEKGPATPAPKGTPTSPPVTPSSLKDSPTSPASVTCKMGATV 1665

Query: 1931 PGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTANQLQPENGVSPGGTDNHASV 1990
            P   +   LPA  G     E      L+  A ++    TA   +         T      
Sbjct: 1666 PQASK--GLPAKKGPTALKEV-----LVAPAPESTPIITAPTRKGPQTKKSSATSPPICP 1718

Query: 1991 NASPKTALTGP---TEGAVLLEKCKGSRAAMSLQEEAEPTPSPPSPNRESLALALTAAHS 2047
            + S K    GP      A LL   K S      ++ +     P +P     +  LTAA  
Sbjct: 1719 DPSAKNGSKGPLSTVAPAPLLPVQKDSSKTAKGKDASHSPKGPLAPPESKASTPLTAAAF 1778

Query: 2048 RS---GSEGRTPERASSPGLNKPLLATGDSPAPSVGDLAACAP-SPTSAAHMPCS-LGPL 2102
                   E  +   A SP ++ PL     SP P++       P SP      P   L P 
Sbjct: 1779 EKVLPKPESASVSAAPSPPVSLPL---APSPVPTLPPKQQFLPSSPGLVLESPSKPLAPA 1835

Query: 2103 PRED--PLTSPSRAQGGLGGQ-----LPA---------SPSCRDP-----PGPQQLLACS 2141
              ++  PL  P    GG+  Q     +P          +PS + P      G        
Sbjct: 1836 DEDELLPLIPPEPISGGVPFQSVLVNMPTPKSAGIPVPTPSAKQPVTKNNKGSGTESDSD 1895

Query: 2142 PAWAPLEEADGVQATT 2157
             +   LEE D  QATT
Sbjct: 1896 ESVPELEEQDSTQATT 1911



 Score = 87.0 bits (214), Expect = 3e-16
 Identities = 375/1612 (23%), Positives = 528/1612 (32%), Gaps = 311/1612 (19%)

Query: 65   PRQARDGELKPPSLRGQAPSSTPGKRGS------PQTP--PGRSPLQAPSRLAGRAEGSP 116
            P   +     PP+L    PS    + GS      P  P  P  +  + PS +    +G+P
Sbjct: 144  PHSVQKSSAFPPNLLTSPPSVAVAESGSVITLSAPIAPSEPKTNLNKVPSEVVPNPKGTP 203

Query: 117  PQRYIL----------------GIAS-SRTKPTLDETPENPQLEAAQLPEV-DTPQGPGT 158
                I+                G+AS  +T PT      +PQ++   +  V  +PQ PG+
Sbjct: 204  SPPCIVSTVPYHCVTPMASIQSGVASLPQTTPTTTLAIASPQVKDTTISSVLISPQNPGS 263

Query: 159  GAPLRPGLPRTEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGT-- 216
             +   P  P     PAA  L      Q  P   TS+  T+   TP    P  P S G+  
Sbjct: 264  LSLKGPVSP-----PAALSLST----QSLPV-VTSSQKTAGPNTP----PDFPISLGSHL 309

Query: 217  SPLQPGSYPEYQASGADSWPPA----------AENSFPGANFGVPPAEPEPIPKGSRPGG 266
            +PL   S+   Q  G  + P A           ++S  GA++    +   P+P  SR   
Sbjct: 310  APLHQSSFGSVQLLG-QTGPSALSDPTVKTISVDHSSTGASYPSQRSVIPPLP--SRNEV 366

Query: 267  SPRGVSFQFPFPA---------LHGASTKPFPADVAGHAFTNGPLVF---------AFHQ 308
             P  V+  FP  A         +   +  P  +     +F+  P             +H 
Sbjct: 367  VPATVA-AFPVVAPSVDKGPSTISSITCSPSGSLNVATSFSLSPTTSLILKSSPNATYHY 425

Query: 309  PQGA-WPEEAVGTGPAYPL-PTQPAPSPLPCYQ-----GQPGGLNRHSDLSGALSSPGAA 361
            P  A  P  +VGT P     P   A +P   ++       P      S++    +SP A 
Sbjct: 426  PLVAQMPVSSVGTTPLVVTNPCTIAAAPTTTFEVATCVSPPMSSGPISNIEP--TSPAAL 483

Query: 362  HSAP-RPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSP 420
              AP  P   S   + T  +P  PP         +  PSS+  + FP Q       D   
Sbjct: 484  VMAPVAPKEPSTQVATTLRIPVSPPLPDPE--DLKNLPSSVLVK-FPTQK------DLQT 534

Query: 421  GPPDTELAAPGPPPARLPQLWDPTAAPY--PTPPGGPLAATRSMFFNGQPSPGQRLCLPQ 478
             P   E A   P  A L    DPT  P     P   P   + S       SP   L    
Sbjct: 535  VPASLEGAPFSPAQAGLTTKKDPTVLPLVQAAPKNSPSFQSTSSSPEIPLSPEATL---- 590

Query: 479  SAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKLPAVR 538
             A     + LP  +P+       S +  P G       S  ++       GP    P ++
Sbjct: 591  -AKKSLGEPLPIGKPA-------SSMTSPLGV-----NSSASVIKTDSYAGPDSAGPLLK 637

Query: 539  SSQ-GGSPALFTYNGMTDPGAQPL-------FFGVAQPQVSPHGTPSLPP---------- 580
            SS    + A F        G  P        +   A P +   GT SL P          
Sbjct: 638  SSLITPTVAAFPLESADPAGVAPTTAKGTSTYTTTASPFLE--GTVSLAPKNHPVKEGTL 695

Query: 581  ---PRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHP 637
               P V  AS +    PSP      +TC+ L+ +  +P  P S    +P P  P A   P
Sbjct: 696  TTLPLVPTASENCPVAPSPQ-----NTCAPLATLVLAPEIPKS----VPSPSLPPAGTPP 746

Query: 638  PTHPQE----TGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFP-- 691
             T   +    T +  P    P   PT      A A         ++G    L ++P P  
Sbjct: 747  GTKKVDGISHTSALAPVASSPKECPTEDSGASATA--------SSKGTLTYLADSPSPLG 798

Query: 692  -HEGPEVGRGGLQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHR 750
                P+  R   +    A P  P  + S   + ++                  A+FL   
Sbjct: 799  VSVSPQTKRPPTKK-GSAGPDTPIGNLSSPVSPVE------------------ASFLPEN 839

Query: 751  QFCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDD 810
                     +  G + SP     P+PP+    P  +    LS     L   +        
Sbjct: 840  SL-------SFQGSKDSPATTHSPTPPSPKGAPTPSAVTPLSPKGVTLPPKETPTPSV-- 890

Query: 811  PLRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFAD 870
             +   F     ATP P  A  L M   +   +  T A  G+   S +P+   +       
Sbjct: 891  -VNLPFPKEGPATPAPKQAPALSMTSSSPKKARATPAPKGIP-ASPSPKGAPTPPAATPP 948

Query: 871  EEPSGPRGPS--------SGHPLKSKAG-VTPESKAPPPLPAATPDPQTPRPGDRGCPAR 921
                GP  PS        +  P   K G  TP  K  P  PAATP      P  +G PA 
Sbjct: 949  SPKGGPATPSPKWAPTPPAATPPSPKGGPATPSPKGAPTPPAATP------PSPKGGPAT 1002

Query: 922  GRPKTRSLGLAPTEADAPSQGRQQRRGKQLKL-FRKDLDSGGAAEGSGSGGGGRASGL-R 979
              PK      APT    P+      +G      F K   +  AA      G   A+ L +
Sbjct: 1003 PSPKG-----APT---PPAVTPPSPKGSPAATPFPKGASTPPAATPPSPKGSPAATPLPK 1054

Query: 980  PRRNDGLGERPPPR-----------PRRPRTQAPGSRADPAPRVPRAAAL-PEETRSSRR 1027
                      P P+           P  P    P  +  PA   P+ A + P  T  S +
Sbjct: 1055 GAPTTPAATLPSPKGGPATPSLKGAPTPPAATPPSPKGGPATPSPKGAPMPPAATPPSPK 1114

Query: 1028 RRL--PPRKDPRKRKA------RGGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPR 1079
              L  PP K      A      +GG       L     K        A  +     P P+
Sbjct: 1115 GGLATPPHKGAPTTPAATPPSPKGG-------LATPPPKG-------APTTPAATPPSPK 1160

Query: 1080 GPGFRGRRGRGEKRKEVELTQGPR--------EDEPQKPRKAARQEAGG------DGAPA 1125
            G G      +G           P+        +  P  P        GG       GAP 
Sbjct: 1161 G-GLATPPPKGAPTTPAATPPSPKGGLATPSPKGAPTTPAATPPSPKGGLATPSPKGAPT 1219

Query: 1126 NPEEPGGSRPGPGRSPQARGPSRSLETGAAAREGGPKCADRPSVAPKDPLQVPTNTETSE 1185
             P     S  G   +P  +G   +      + +GGP     P  AP  P   P + +   
Sbjct: 1220 TPAATPPSPKGGLATPSPKGAPTTPAATPPSPKGGP-ATPPPKGAPTPPAATPPSLKGGL 1278

Query: 1186 ETRPSLDFPQEAKEPETAEESAPDSTEFTEALRSPPAACAGEMGASPGLLIPEQPPPSRH 1245
             T P    P  A     + +  P +T   +   +PPAA       SPG      PPP   
Sbjct: 1279 ATPPHKGAPNPAVVTPPSPKGGP-ATSPPKGAPTPPAATPPSPKGSPG-----TPPPK-- 1330

Query: 1246 DTGTPKPSGSLANTAPHGSSPTPGVGSLLGGPGGTQAPVSHNSKDPPARQPGEFLAPVAN 1305
              G P P  ++   +P G+   P   +     GG   P S     PPA  P     P   
Sbjct: 1331 --GAPTPP-AVTPPSPKGTPTLP--ATTPSSKGGPTTPSSKEGPTPPAATPSHKGGPAMT 1385

Query: 1306 PSSTACPK--PSVLSSKISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSELFLGPKDLA 1363
            P S   PK  P++ S K       PA     P   P      +  ++P S+  L P  + 
Sbjct: 1386 PPS---PKRGPAIPSPK--GDPTSPAVIPLSPKKAPATPVTREGAATP-SKGDLTPPAVT 1439

Query: 1364 GCFLEELHPKPSARDAPPASSSCLCQDGEDAGSLEPQLPRSPP-----GTAETEPGRAAS 1418
               L++  P  SA    PA+ S   +      ++ P  P+ PP      T+ +     A+
Sbjct: 1440 PVSLKKA-PATSAPKGGPATPS--SKGDPTLPAVTPPSPKEPPAPKQVATSSSPKKAPAT 1496

Query: 1419 P-----PTL-----ESSSLFPDLPVDRFDP--PLYGSLSANRDSGL-PFACADPPQKTVP 1465
            P     PTL      S    P  P  R DP  P    LS    + L P     PP  TVP
Sbjct: 1497 PAPMGAPTLPAVIPSSPKEVPATPSSRRDPIAPTATLLSKKTPATLAPKEALIPPAMTVP 1556

Query: 1466 SDPPYPSFLLLEEVSPMLPSHFPDLSGGKVLSKTC----PPERTVVPGAAPS 1513
            S    P+    +E +P  PS     S   V   T      P+  ++P A  S
Sbjct: 1557 SPKKTPAIPTPKE-APATPSSKEASSPPAVTPSTYKGAPSPKELLIPPAVTS 1607



 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 239/1058 (22%), Positives = 354/1058 (33%), Gaps = 162/1058 (15%)

Query: 1961 AEKTQGQGTANQLQPENGVSPGGTDNHASVNASPKTALTGPTEGAVLLEKC--KGSRAAM 2018
            A+K+ G+         +  SP G ++ ASV  +   A  GP     LL+      + AA 
Sbjct: 591  AKKSLGEPLPIGKPASSMTSPLGVNSSASVIKTDSYA--GPDSAGPLLKSSLITPTVAAF 648

Query: 2019 SLQEEAEPTPSPPSPNRESLALALTAAHSRSGSEGRTPER---ASSPGLNKPLLATGDSP 2075
             L E A+P    P+  + +     TA+    G+    P+            PL+ T    
Sbjct: 649  PL-ESADPAGVAPTTAKGTSTYTTTASPFLEGTVSLAPKNHPVKEGTLTTLPLVPTASEN 707

Query: 2076 APSVGDLAACAPSPTSAAHMPCSLGPLPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQ 2135
             P        APSP +    P +   L  E P + PS          P+ P    PPG +
Sbjct: 708  CP-------VAPSPQNTC-APLATLVLAPEIPKSVPS----------PSLPPAGTPPGTK 749

Query: 2136 QL--LACSPAWAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCDPKEALAGCLLQGEGSP 2193
            ++  ++ + A AP+  +     T D+GA  +  +  +LT     P         Q +  P
Sbjct: 750  KVDGISHTSALAPVASSPKECPTEDSGASATASSKGTLTYLADSPSPLGVSVSPQTKRPP 809

Query: 2194 LEDPSSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRK-EKLWESPGRA---TSPPLAGAV 2249
             +  S+ P   +  ++   S  +P +++  +PE+S   +   +SP      T P   GA 
Sbjct: 810  TKKGSAGPDTPIGNLS---SPVSPVEASF-LPENSLSFQGSKDSPATTHSPTPPSPKGAP 865

Query: 2250 SPSVAVRAT--GLSSTPTGDEAQAGRGLPGPDPQSRGAPPHTNPDRMPR-GHSSYSPSNT 2306
            +PS     +  G++  P      +   LP P    +  P    P + P    +S SP   
Sbjct: 866  TPSAVTPLSPKGVTLPPKETPTPSVVNLPFP----KEGPATPAPKQAPALSMTSSSPKKA 921

Query: 2307 ARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSSKEPEDPGTPETGRSGATKMP 2366
                  +G   +  P   PT   A P SP     + G ++  P+   TP      + K  
Sbjct: 922  RATPAPKGIPASPSPKGAPTPPAATPPSP-----KGGPATPSPKWAPTPPAATPPSPKGG 976

Query: 2367 RVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRNASHQTP---QGDPLGPQDLKQRSRGY 2423
              T    G        P S      + SP+        TP   +G P      K  S   
Sbjct: 977  PATPSPKGAPTPPAATPPSPKGGPATPSPKGAPTPPAVTPPSPKGSPAATPFPKGASTPP 1036

Query: 2424 KKKPASTENGQWKGQAPHGPVTCEVCAASFRSGPGLSRHKARKHRPHPGAPAEPSPAALP 2483
               P S +        P G  T    AA+  S  G     + K  P P A   PSP   P
Sbjct: 1037 AATPPSPKGSPAATPLPKGAPTTP--AATLPSPKGGPATPSLKGAPTPPAATPPSPKGGP 1094

Query: 2484 AQQPLE--PLAQKCQPPRKKSHRVSGKERPNHSRGDPSHVTQPPPAQGSKEVLRAPGSPH 2541
            A    +  P+     PP  K     G   P H     +    PP  +G        G+P 
Sbjct: 1095 ATPSPKGAPMPPAATPPSPKG----GLATPPHKGAPTTPAATPPSPKGGLATPPPKGAPT 1150

Query: 2542 SQQLHPPSPTEHEVDVKTPASKPRPDQAREDELHPKQAEKREGRRWRREPTVDSPSHSEG 2601
            +    PPSP   +  + TP  K  P         PK        +        +P+    
Sbjct: 1151 TPAATPPSP---KGGLATPPPKGAPTTPAATPPSPKGGLATPSPK-------GAPTTPAA 1200

Query: 2602 KSNKKRGKLRGRRLREESILPVSADVISDGRGSRPSP--AMASYAASPSHCLSVEGGPEA 2659
                 +G L     +     P +      G  + PSP  A  + AA+P         P  
Sbjct: 1201 TPPSPKGGLATPSPKGAPTTPAATPPSPKGGLATPSPKGAPTTPAATPPSPKGGPATPPP 1260

Query: 2660 DGEQPPRLATLGPGVMEGAAETDQEALCAGETGAQKPPGDRMLCPGRMDGAALGEQPTGQ 2719
             G   P  AT  P  ++G   T          GA  P    ++ P    G      P G 
Sbjct: 1261 KGAPTPPAAT--PPSLKGGLATPPHK------GAPNPA---VVTPPSPKGGPATSPPKGA 1309

Query: 2720 KGASARGFWGPRETKALGVCKESGSEPAEDSSRAHSRSEEGVWEENTPPLGPLGFPETSS 2779
                A     P+ +      K + + PA                  TPP  P G P   +
Sbjct: 1310 PTPPAATPPSPKGSPGTPPPKGAPTPPAV-----------------TPP-SPKGTP---T 1348

Query: 2780 SPADSTTSSCLQGLPDNPDTQGGVQGPEGPTPDASGSSAKDPPSLFDDEVSFSQLFPPGG 2839
             PA + +S   +G P  P ++      EGPTP A+  S K  P+          + PP  
Sbjct: 1349 LPATTPSS---KGGPTTPSSK------EGPTPPAATPSHKGGPA----------MTPP-- 1387

Query: 2840 RLTRKRNPHV---YGKRCEKPVLPL-----PTQPSFEEG-GDPTLG----PARLPTDLSD 2886
              + KR P +    G      V+PL     P  P   EG   P+ G    PA  P  L  
Sbjct: 1388 --SPKRGPAIPSPKGDPTSPAVIPLSPKKAPATPVTREGAATPSKGDLTPPAVTPVSLKK 1445

Query: 2887 SSSLCLCHEDPWEDEDPAGLPESFLLDGFLNSRVPGIDPWAPGLSLWALEP--SREAGAE 2944
            + +             P G P +    G  +  +P + P +P       EP   ++    
Sbjct: 1446 APA----------TSAPKGGPATPSSKG--DPTLPAVTPPSP------KEPPAPKQVATS 1487

Query: 2945 KLPSHCPEDDRPEAIPELHMVPAAWRGLEMPAPADDSS 2982
              P   P    P   P L   PA         PA  SS
Sbjct: 1488 SSPKKAPATPAPMGAPTL---PAVIPSSPKEVPATPSS 1522



 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 122/483 (25%), Positives = 154/483 (31%), Gaps = 66/483 (13%)

Query: 3419 PFAFRGVRRPGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLP 3478
            PF   G   P      A ++  + P K R    P   P      P P+G+       + P
Sbjct: 894  PFPKEGPATPAPKQAPALSMTSSSPKKARATPAPKGIPAS----PSPKGAP------TPP 943

Query: 3479 ALLHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGR 3538
            A         P + KG P T      P T P      P      P P  +P P A     
Sbjct: 944  A-------ATPPSPKGGPATPSPKWAP-TPPAATPPSPKGGPATPSPKGAPTPPAATP-- 993

Query: 3539 GDCALDGALERPENEASPGSPGPLLQQALPLGASLPRPGARGQDAEGKRAPLVFSGKRRA 3598
                       P  +  P +P P        GA  P P       +G  A   F      
Sbjct: 994  -----------PSPKGGPATPSPK-------GAPTP-PAVTPPSPKGSPAATPFPKGAST 1034

Query: 3599 PGARGRCAPDHFQEDHLLQKEKEVSSSHMVS--EGGPRGTFHKGSATKPAGCQSSSKDRS 3656
            P A    +P        L K    + +  +   +GGP     KG+ T PA    S K   
Sbjct: 1035 PPAATPPSPKGSPAATPLPKGAPTTPAATLPSPKGGPATPSLKGAPTPPAATPPSPKGGP 1094

Query: 3657 AASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRP-GTK 3715
            A  +P  A   P+ P     S   G LA     G  P TP A P     G  +P P G  
Sbjct: 1095 ATPSPKGA---PMPPAATPPS-PKGGLATPPHKGA-PTTPAATPPSPKGGLATPPPKGAP 1149

Query: 3716 TGGGSQPQPASGQLQSETATTPAK--PSFPSRSPAPERLPARAQAKSCTKGPREAGEQGP 3773
            T   + P    G L    AT P K  P+ P+ +P     P    A    KG        P
Sbjct: 1150 TTPAATPPSPKGGL----ATPPPKGAPTTPAATPPS---PKGGLATPSPKGAPTTPAATP 1202

Query: 3774 HGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQATPSRVLPTK 3833
                 P  KG  +T   KG    PA +      G A  +P   P TP       +  P  
Sbjct: 1203 -----PSPKGGLATPSPKGAPTTPAATPPSPKGGLATPSPKGAPTTPAATPPSPKGGPAT 1257

Query: 3834 PKPNSQNKP---RPPPSEQRKAEPGHTQRKDR--LGKAFPQGRPLLRPPKRGTAVHGAEP 3888
            P P     P    PP  +   A P H    +   +    P+G P   PPK       A P
Sbjct: 1258 PPPKGAPTPPAATPPSLKGGLATPPHKGAPNPAVVTPPSPKGGPATSPPKGAPTPPAATP 1317

Query: 3889 AEP 3891
              P
Sbjct: 1318 PSP 1320



 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 109/462 (23%), Positives = 153/462 (33%), Gaps = 49/462 (10%)

Query: 3453 GSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSE----VAPSTTKGWPETLERPVDPVTH 3508
            G A  P +  P P  ++P   +G L    H  +     V P + KG P T   P    T 
Sbjct: 1254 GPATPPPKGAPTPPAATPPSLKGGLATPPHKGAPNPAVVTPPSPKGGPAT-SPPKGAPTP 1312

Query: 3509 PIRGCELPSNHQECPPPSLSPFPAALADGRGDCALDGALERPENEASPGSPGPLLQQALP 3568
            P      P      PPP  +P P A+               P ++  P +P        P
Sbjct: 1313 PAATPPSPKGSPGTPPPKGAPTPPAVTPPSPKGTPTLPATTPSSKGGPTTPSSKEGPTPP 1372

Query: 3569 LGASLPRPGARGQDAEGKRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMV 3628
                  + G        KR P +       P  +G    D      +    K+  ++ + 
Sbjct: 1373 AATPSHKGGPAMTPPSPKRGPAI-------PSPKG----DPTSPAVIPLSPKKAPATPVT 1421

Query: 3629 SEGGPRGTFHKGSATKPAGCQSSSKDRSAASTPSKALKFP----------VHPRKAVGSL 3678
             EG    T  KG  T PA    S K   A S P      P          V P       
Sbjct: 1422 REGA--ATPSKGDLTPPAVTPVSLKKAPATSAPKGGPATPSSKGDPTLPAVTPPSPKEPP 1479

Query: 3679 APGELARGTENGMKPATPKAKPGPSSQG--SGSPR--PGTKTGGGSQPQPASGQLQSETA 3734
            AP ++A  +     PATP     P+       SP+  P T +       P +  L  +T 
Sbjct: 1480 APKQVATSSSPKKAPATPAPMGAPTLPAVIPSSPKEVPATPSSRRDPIAPTATLLSKKTP 1539

Query: 3735 TT--PAKPSFPSRS--PAPERLPARAQAKSCTKGPREAGEQGPHGSLGPKEKGESSTKRK 3790
             T  P +   P     P+P++ PA    K     P       P        KG  S K  
Sbjct: 1540 ATLAPKEALIPPAMTVPSPKKTPAIPTPKEAPATPSSKEASSPPAVTPSTYKGAPSPKEL 1599

Query: 3791 --KGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQATPSR--VLPT--KPKPNS------ 3838
                 V  P+  E+       P +P+K P TP  + TP+   V P+  K  P S      
Sbjct: 1600 LIPPAVTSPSPKEAPTPPAVTPPSPEKGPATPAPKGTPTSPPVTPSSLKDSPTSPASVTC 1659

Query: 3839 -QNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPPKR 3879
                  P  S+   A+ G T  K+ L    P+  P++  P R
Sbjct: 1660 KMGATVPQASKGLPAKKGPTALKEVLVAPAPESTPIITAPTR 1701



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 180/753 (23%), Positives = 241/753 (32%), Gaps = 131/753 (17%)

Query: 3206 PAPKHHRGKRSAGKAAGSPG-DPWGQEGEAKKDSPGERAKPRARSTPSNPDGAATPDSAS 3264
            PAPK      S   A   P   P   +G     SP     P A + PS   G ATP    
Sbjct: 925  PAPKGIPASPSPKGAPTPPAATPPSPKGGPATPSPKWAPTPPAATPPSPKGGPATP---- 980

Query: 3265 ATALADAGSPGPPRTTPSPSPDPWAG-GEPLLQATPVHEACKDPSRDCHHCGKRFPKPFK 3323
                +  G+P PP  TP   P P  G   P  +  P   A   PS         FPK   
Sbjct: 981  ----SPKGAPTPPAATP---PSPKGGPATPSPKGAPTPPAVTPPSPKGSPAATPFPKGAS 1033

Query: 3324 LQRHLAVHSPQRVYLCPRCPRVYPEHGELLAHLGGAHGLLERPELQHTPLYACELCATVM 3383
                    SP+        P+  P      A L    G    P L+  P        +  
Sbjct: 1034 TPPAATPPSPKGSPAATPLPKGAPT--TPAATLPSPKGGPATPSLKGAPTPPAATPPSP- 1090

Query: 3384 RIIKKSFACSSCNYTFAKKEQFDRHMNKHLRGGRQPFAFRGVRRPGA---PGQKARALEG 3440
                                          +GG    + +G   P A   P  K      
Sbjct: 1091 ------------------------------KGGPATPSPKGAPMPPAATPPSPKGGL--A 1118

Query: 3441 TLPSKRRRVAMPGSAPGP--GEDRPPPRGSSPILSEGSLPALLHLCSEVAPSTTKGWPET 3498
            T P K        + P P  G   PPP+G +P     + P+       +A    KG P T
Sbjct: 1119 TPPHKGAPTTPAATPPSPKGGLATPPPKG-APTTPAATPPSPK---GGLATPPPKGAPTT 1174

Query: 3499 LERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGDCALDGALERPENEASPGS 3558
               P      P  G   PS   +  P + +  P +   G    +  GA   P   A+P S
Sbjct: 1175 ---PAATPPSPKGGLATPS--PKGAPTTPAATPPSPKGGLATPSPKGAPTTP--AATPPS 1227

Query: 3559 PGPLLQQALPLGASLPRPGARGQDAEGKRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQK 3618
            P   L    P GA    P A     +G  A     G    P A     P   +       
Sbjct: 1228 PKGGLATPSPKGAP-TTPAATPPSPKGGPATPPPKGAPTPPAA----TPPSLKGGLATPP 1282

Query: 3619 EKEVSSSHMVS----EGGPRGTFHKGSATKPAGCQSSSKDRSAASTPSKALKFP--VHPR 3672
             K   +  +V+    +GGP  +  KG+ T PA    S K  S  + P K    P  V P 
Sbjct: 1283 HKGAPNPAVVTPPSPKGGPATSPPKGAPTPPAATPPSPKG-SPGTPPPKGAPTPPAVTPP 1341

Query: 3673 KAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTKTGGG-SQPQPASGQLQS 3731
               G+         ++ G  P TP +K GP+   +    P  K G   + P P  G    
Sbjct: 1342 SPKGTPTLPATTPSSKGG--PTTPSSKEGPTPPAA---TPSHKGGPAMTPPSPKRG---- 1392

Query: 3732 ETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQGPHGSLGP------------ 3779
                 PA PS      +P  +P   +    T   RE       G L P            
Sbjct: 1393 -----PAIPSPKGDPTSPAVIPLSPKKAPATPVTREGAATPSKGDLTPPAVTPVSLKKAP 1447

Query: 3780 ---KEKGESSTKRKKGQVPGPARSESVGSFGRAP------SAPDKPPRTPRKQATPS--R 3828
                 KG  +T   KG    PA +        AP      S+P K P TP     P+   
Sbjct: 1448 ATSAPKGGPATPSSKGDPTLPAVTPPSPKEPPAPKQVATSSSPKKAPATPAPMGAPTLPA 1507

Query: 3829 VLPTKPK-----PNSQNKP-RPPPSEQRKAEPGHTQRKDRL-----GKAFPQGRPLLRPP 3877
            V+P+ PK     P+S+  P  P  +   K  P     K+ L         P+  P +  P
Sbjct: 1508 VIPSSPKEVPATPSSRRDPIAPTATLLSKKTPATLAPKEALIPPAMTVPSPKKTPAIPTP 1567

Query: 3878 KRGTAVHGAEPAE------PHTHRTAEAQSDLL 3904
            K   A   ++ A       P T++ A +  +LL
Sbjct: 1568 KEAPATPSSKEASSPPAVTPSTYKGAPSPKELL 1600



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 104/442 (23%), Positives = 139/442 (31%), Gaps = 44/442 (9%)

Query: 3464 PPRGSSPILSEGSLPALLHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECP 3523
            P   S    +  S   L +L    +P      P+T +RP  P      G + P  +   P
Sbjct: 771  PTEDSGASATASSKGTLTYLADSPSPLGVSVSPQT-KRP--PTKKGSAGPDTPIGNLSSP 827

Query: 3524 PPSLSPFPAALADGRGDCALDGALERPENEASPGSPGPLLQQALPLGASLPRPGARGQDA 3583
               +SP  A+        +  G+ + P    SP  P P   +  P  +++     +G   
Sbjct: 828  ---VSPVEASFLP-ENSLSFQGSKDSPATTHSPTPPSP---KGAPTPSAVTPLSPKGVTL 880

Query: 3584 EGKRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVS--EGGPRGTFHKGS 3641
              K  P         P   G   P   Q   L         +      +G P     KG+
Sbjct: 881  PPKETPTPSVVNLPFP-KEGPATPAPKQAPALSMTSSSPKKARATPAPKGIPASPSPKGA 939

Query: 3642 ATKPAGCQSSSKDRSAASTPSKALKFPVH--PRKAVGSLAPGELARGTENGMKPATPKAK 3699
             T PA    S K   A  +P  A   P    P    G   P      T     P +PK  
Sbjct: 940  PTPPAATPPSPKGGPATPSPKWAPTPPAATPPSPKGGPATPSPKGAPTPPAATPPSPKGG 999

Query: 3700 PGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETATTPAK-PSFPSRSPAPERLPARA-- 3756
            P   S   G+P P   T    +  PA+       +T PA  P  P  SPA   LP  A  
Sbjct: 1000 PATPSP-KGAPTPPAVTPPSPKGSPAATPFPKGASTPPAATPPSPKGSPAATPLPKGAPT 1058

Query: 3757 -------QAKSCTKGPREAGEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRA 3809
                     K     P   G   P  +  P  KG  +T   KG    PA +         
Sbjct: 1059 TPAATLPSPKGGPATPSLKGAPTPPAATPPSPKGGPATPSPKGAPMPPAAT--------- 1109

Query: 3810 PSAPDKPPRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQ 3869
            P +P     TP  +  P+    T P P  +     PP +     P  T    + G A P 
Sbjct: 1110 PPSPKGGLATPPHKGAPTTPAATPPSP--KGGLATPPPKGAPTTPAATPPSPKGGLATP- 1166

Query: 3870 GRPLLRPPKRGTAVHGAEPAEP 3891
                  PPK       A P  P
Sbjct: 1167 ------PPKGAPTTPAATPPSP 1182



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 114/494 (23%), Positives = 165/494 (33%), Gaps = 74/494 (14%)

Query: 3464 PPRGSSPILS-EGSLPALLHLCSEVAPSTTKGWPETLERPVDP-VTHPIRGCELPSN--- 3518
            PP  S PI + E + PA L +        +     TL  PV P +  P     LPS+   
Sbjct: 465  PPMSSGPISNIEPTSPAALVMAPVAPKEPSTQVATTLRIPVSPPLPDPEDLKNLPSSVLV 524

Query: 3519 ------HQECPPPSL-----SPFPAALADGRGDCALDGALERPEN----EASPGSPG-PL 3562
                    +  P SL     SP  A L   +    L      P+N    +++  SP  PL
Sbjct: 525  KFPTQKDLQTVPASLEGAPFSPAQAGLTTKKDPTVLPLVQAAPKNSPSFQSTSSSPEIPL 584

Query: 3563 LQQALPLGASLPRPGARGQDAEGKRAPLVFSGKRRAPGARGRCAPDH---FQEDHLLQKE 3619
              +A     SL  P   G+ A    +PL  +             PD      +  L+   
Sbjct: 585  SPEATLAKKSLGEPLPIGKPASSMTSPLGVNSSASVIKTDSYAGPDSAGPLLKSSLITPT 644

Query: 3620 KEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSAASTPSKALK------FPVHPRK 3673
                        G   T  KG++T         +   + +  +  +K       P+ P  
Sbjct: 645  VAAFPLESADPAGVAPTTAKGTSTYTTTASPFLEGTVSLAPKNHPVKEGTLTTLPLVPTA 704

Query: 3674 A----VGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTKTGGG---------- 3719
            +    V        A      + P  PK+ P PS   +G+P PGTK   G          
Sbjct: 705  SENCPVAPSPQNTCAPLATLVLAPEIPKSVPSPSLPPAGTP-PGTKKVDGISHTSALAPV 763

Query: 3720 -SQPQ--PASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQGPHGS 3776
             S P+  P      S TA++    ++ + SP+P  +    Q K   + P + G  GP   
Sbjct: 764  ASSPKECPTEDSGASATASSKGTLTYLADSPSPLGVSVSPQTK---RPPTKKGSAGPDTP 820

Query: 3777 LGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKP-PRTPRKQATPSRVLPTKPK 3835
            +G      S  +        P  S S      +P+    P P +P+   TPS V P  PK
Sbjct: 821  IGNLSSPVSPVEASF----LPENSLSFQGSKDSPATTHSPTPPSPKGAPTPSAVTPLSPK 876

Query: 3836 -----------PNSQNKPRP---PPSEQRKAEPGHTQRKDRLGKA----FPQGRPLLRPP 3877
                       P+  N P P   P +   K  P  +       KA     P+G P    P
Sbjct: 877  GVTLPPKETPTPSVVNLPFPKEGPATPAPKQAPALSMTSSSPKKARATPAPKGIPASPSP 936

Query: 3878 KRGTAVHGAEPAEP 3891
            K       A P  P
Sbjct: 937  KGAPTPPAATPPSP 950



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 142/634 (22%), Positives = 199/634 (31%), Gaps = 123/634 (19%)

Query: 3245 PRARSTPSNPDGAATPDSASATALADAGSPGPPRTTPSPSPD----PWAGGEPLLQAT-- 3298
            P+     S P GA TP +A  T  +  GSPG P    +P+P     P   G P L AT  
Sbjct: 1297 PKGGPATSPPKGAPTPPAA--TPPSPKGSPGTPPPKGAPTPPAVTPPSPKGTPTLPATTP 1354

Query: 3299 -----PVHEACKD----PSRDCHHCGKRFPKPFKLQRHLAVHSPQRVYLCPRCPRVYPEH 3349
                 P   + K+    P+    H G     P   +R  A+ SP+     P  P V P  
Sbjct: 1355 SSKGGPTTPSSKEGPTPPAATPSHKGGPAMTPPSPKRGPAIPSPKGD---PTSPAVIP-- 1409

Query: 3350 GELLAHLGGAHGLLERPELQHTPLYACELCATVMRIIKKSFACSSCNYTFAKKEQFDRHM 3409
                         L   +   TP            + ++  A  S               
Sbjct: 1410 -------------LSPKKAPATP------------VTREGAATPS--------------- 1429

Query: 3410 NKHLRGGRQPFAFRGVRRPGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSS 3469
                +G   P A   V    AP   A       PS +    +P   P   ++ P P+  +
Sbjct: 1430 ----KGDLTPPAVTPVSLKKAPATSAPKGGPATPSSKGDPTLPAVTPPSPKEPPAPKQVA 1485

Query: 3470 PILSEGSLPAL-----LHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPP 3524
               S    PA            V PS+ K  P T     DP+                P 
Sbjct: 1486 TSSSPKKAPATPAPMGAPTLPAVIPSSPKEVPATPSSRRDPI---------------APT 1530

Query: 3525 PSL--SPFPAALADGRGDCALDGALERPENEASPGSPGPLLQQALPLGASLPRPGARGQD 3582
             +L     PA LA    +  +  A+  P  + +P  P P    A P       P A    
Sbjct: 1531 ATLLSKKTPATLAP--KEALIPPAMTVPSPKKTPAIPTPKEAPATPSSKEASSPPA---- 1584

Query: 3583 AEGKRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSA 3642
                  P  + G   AP  +    P         +     + +    E GP     KG+ 
Sbjct: 1585 ----VTPSTYKG---APSPKELLIPPAVTSPSPKEAPTPPAVTPPSPEKGPATPAPKGTP 1637

Query: 3643 TKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKP-- 3700
            T P    SS KD S  S  S   K      +A   L   +     +  +    P++ P  
Sbjct: 1638 TSPPVTPSSLKD-SPTSPASVTCKMGATVPQASKGLPAKKGPTALKEVLVAPAPESTPII 1696

Query: 3701 -GPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAK 3759
              P+ +G     P TK    + P          +A   +K    + +PAP  LP +  + 
Sbjct: 1697 TAPTRKG-----PQTKKSSATSPPIC----PDPSAKNGSKGPLSTVAPAP-LLPVQKDSS 1746

Query: 3760 SCTKGPREAGEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPPRT 3819
               KG  +     P G L P E  ++ST                 S   APS P   P  
Sbjct: 1747 KTAKG--KDASHSPKGPLAPPE-SKASTPLTAAAFEKVLPKPESASVSAAPSPPVSLPLA 1803

Query: 3820 PRKQAT---PSRVLPTKP--KPNSQNKPRPPPSE 3848
            P    T     + LP+ P     S +KP  P  E
Sbjct: 1804 PSPVPTLPPKQQFLPSSPGLVLESPSKPLAPADE 1837



 Score = 42.7 bits (99), Expect = 0.007
 Identities = 89/367 (24%), Positives = 129/367 (35%), Gaps = 48/367 (13%)

Query: 321 GPAYPLPTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKIL 380
           GP  P P  PAP   P            ++ +    SP    S P         S T + 
Sbjct: 42  GPTLPPPCSPAPQQCPL---------SAANQASPFPSPSTIASTPLEVPFPQSSSGTALP 92

Query: 381 PERPPSAQDGLGSTRGPPSSLPQRHF--PGQAYRASGVDTSPGPPDTELAAPGPPPARLP 438
               P A   L +  GPP S        P  A    G  +S  P    L A  P   +  
Sbjct: 93  LGTAPEAPTFLPNLIGPPISPAALALASPMIAPTLKGTPSSSAP--LALVALAPHSVQKS 150

Query: 439 QLWDPTAAPYPTPPGGPLAATRSMFFNGQP-SPGQRLCLPQSAPLPWPQVLPTARPSPHG 497
             + P      +PP   +A + S+     P +P +        P    +V+P  + +P  
Sbjct: 151 SAFPPNL--LTSPPSVAVAESGSVITLSAPIAPSEPKTNLNKVP---SEVVPNPKGTPSP 205

Query: 498 MEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKL----PAVRSSQGGSPALFTYNGM 553
             ++S +P+    P      Q  + +  +T  P   L    P V+ +   S  +   N  
Sbjct: 206 PCIVSTVPYHCVTP--MASIQSGVASLPQTT-PTTTLAIASPQVKDTTISSVLISPQN-- 260

Query: 554 TDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSS 613
             PG+  L   V+ P      T SLP    V  S  ++  P+   +   S  S L+P+  
Sbjct: 261 --PGSLSLKGPVSPPAALSLSTQSLP----VVTSSQKTAGPNTPPDFPISLGSHLAPLHQ 314

Query: 614 SPANPSSEESQLPGPLGPSAFFHPPTHP-----QETGSPFPSPE---PPHSLPTHYQPEP 665
           S    S    QL G  GPSA   P           TG+ +PS     PP  LP+  +  P
Sbjct: 315 S----SFGSVQLLGQTGPSALSDPTVKTISVDHSSTGASYPSQRSVIPP--LPSRNEVVP 368

Query: 666 AKAFPFP 672
           A    FP
Sbjct: 369 ATVAAFP 375



 Score = 38.5 bits (88), Expect = 0.13
 Identities = 36/113 (31%), Positives = 45/113 (39%), Gaps = 8/113 (7%)

Query: 3204 TEPAPKHHRGKRSAGKAAGSPG-DPWGQEGEAKKDSPGERAKPRARSTPSNPDGAATPD- 3261
            T P+PK      S   A  +P   P   +G     SP       A + PS   G ATP  
Sbjct: 1178 TPPSPKGGLATPSPKGAPTTPAATPPSPKGGLATPSPKGAPTTPAATPPSPKGGLATPSP 1237

Query: 3262 -SASATALADAGSP--GPPRTTPSPSPDPWAGGEPLLQ---ATPVHEACKDPS 3308
              A  T  A   SP  GP    P  +P P A   P L+   ATP H+   +P+
Sbjct: 1238 KGAPTTPAATPPSPKGGPATPPPKGAPTPPAATPPSLKGGLATPPHKGAPNPA 1290



 Score = 37.4 bits (85), Expect = 0.30
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 6/52 (11%)

Query: 3233 EAKKDSPGERAKPRARSTPSNPDGAATPDSASATALADAGSPGPPRTTPSPS 3284
            +  KDSP     P    TP +P GA TP  ++ T L+  G   PP+ TP+PS
Sbjct: 844  QGSKDSPATTHSP----TPPSPKGAPTP--SAVTPLSPKGVTLPPKETPTPS 889



 Score = 37.4 bits (85), Expect = 0.30
 Identities = 31/105 (29%), Positives = 39/105 (37%), Gaps = 7/105 (6%)

Query: 3204 TEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPGERAKPRARSTPSNPDGAATPDSA 3263
            T P+PK   G  +     G+P  P      + K SP     P+  STP      +   S 
Sbjct: 992  TPPSPK---GGPATPSPKGAPTPP-AVTPPSPKGSPAATPFPKGASTPPAATPPSPKGSP 1047

Query: 3264 SATALADAGSPGPPRTTPSPSPDPWAGGEPLLQATPVHEACKDPS 3308
            +AT L       P  T PSP   P     P L+  P   A   PS
Sbjct: 1048 AATPLPKGAPTTPAATLPSPKGGP---ATPSLKGAPTPPAATPPS 1089



 Score = 33.5 bits (75), Expect = 4.3
 Identities = 43/149 (28%), Positives = 47/149 (31%), Gaps = 5/149 (3%)

Query: 3206 PAPKHHRGKRSAGKAAGSPGDPWGQEG--EAKKDSPGE-RAKPRARSTPSNPDGAATPDS 3262
            PAPK      S  KA  +P  P G          SP E  A P +R  P  P        
Sbjct: 1479 PAPKQVATSSSPKKAPATPA-PMGAPTLPAVIPSSPKEVPATPSSRRDPIAPTATLLSKK 1537

Query: 3263 ASATALADAGSPGPPRTTPSPSPDPWAGGEPLLQATPVHEACKDPSRDCHHCGKRFPKPF 3322
              AT         P  T PSP   P         ATP  +    P        K  P P 
Sbjct: 1538 TPATLAPKEALIPPAMTVPSPKKTPAIPTPKEAPATPSSKEASSPPAVTPSTYKGAPSPK 1597

Query: 3323 KLQRHLAVHSPQRVYLCPRCPRVYPEHGE 3351
            +L    AV SP      P  P V P   E
Sbjct: 1598 ELLIPPAVTSPSPKE-APTPPAVTPPSPE 1625



 Score = 33.1 bits (74), Expect = 5.6
 Identities = 28/97 (28%), Positives = 36/97 (37%), Gaps = 2/97 (2%)

Query: 3204 TEPAPKHHRGKRSAGKAAGSPG-DPWGQEGEAKKDSPGERAKPRARSTPSNPDGAATPDS 3262
            T P+PK      S   A   P   P   +G     SP     P A + PS   G ATP  
Sbjct: 946  TPPSPKGGPATPSPKWAPTPPAATPPSPKGGPATPSPKGAPTPPAATPPSPKGGPATPSP 1005

Query: 3263 ASATALADAGSPGPPRTTPSPSPDPWAGGEPLLQATP 3299
              A     A +P  P+ +P+ +P P     P     P
Sbjct: 1006 KGAPT-PPAVTPPSPKGSPAATPFPKGASTPPAATPP 1041


>gi|239751637 PREDICTED: hypothetical protein FLJ22184 [Homo sapiens]
          Length = 1124

 Score =  115 bits (288), Expect = 9e-25
 Identities = 266/1055 (25%), Positives = 337/1055 (31%), Gaps = 244/1055 (23%)

Query: 8    GAPPPTMTGDLQPRQVASSPGHPSQPPLEDNTPATR-TTKGAREAGGQAQAMELPEAQPR 66
            G P P M    + R   +  G P   P     P T    K    A   +     P A+ R
Sbjct: 170  GTPSPAMAR--RSRAAGTEVGLPRPAPSARPRPPTEGPRKSVSSASEHSTTEPSPAARRR 227

Query: 67   QARDGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRYILGIAS 126
             +  G L+ P+ R  + S+TP    +   P  R   +AP+         P Q    G+ +
Sbjct: 228  PSAGGGLQRPASRSLSSSATPLSSPARSGPSARGTPRAPAH--------PSQPKPKGLQA 279

Query: 127  SR----TKPTLDETPENPQLEAAQLPEVDTPQGPGTGA-PLRPGLPRTEAQPAAEELGFH 181
             R    T P  D  P    L ++ L    TP   GT A P+ P  P   A P    L   
Sbjct: 280  LRPPQVTPPRKDAAPALGPLSSSPLA---TPSPSGTKARPVPP--PDNAATPLPATL--- 331

Query: 182  RCFQEPPSSFTSTNYTSPSATP---RPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPA 238
                 PPS         P ATP    PP+P  P S  T P  P + P  QA  + + PP 
Sbjct: 332  -----PPSP--------PLATPLPLAPPSPSAPPSLQTLPSPPATPPS-QAPPSMTTPPM 377

Query: 239  AENSFPGANFGVPPAE-PEPIPKGS-RPGGSPRGVSFQFPFPALHGASTKPFPADVAGHA 296
                 P +   +PP + P  +   S +   SP  +S      +L   ++   P   A H+
Sbjct: 378  QA---PPSLQTIPPIQVPHSLTSPSLQAPPSPLALS------SLQATTSLGSPTLQATHS 428

Query: 297  FTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPGGLNRHSDLSGALS 356
            F    L  +  Q Q +       T P+ P  T P   PL      P      + LS A+S
Sbjct: 429  F----LTMSPRQTQASL------TSPSRPASTPPDSPPLQAPLSLPASPPLQTSLSPAVS 478

Query: 357  --------------SPGAAHSAPRPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSSLP 402
                          S  A+HS   P S  +   L       PPS Q    S   PP    
Sbjct: 479  PLSSPLTIHPLQALSSLASHSPQAPLSSLIMPPLETQSSLAPPSLQTPPASLTTPPLENL 538

Query: 403  QRHFPGQAYRASGVDTSPG----------------------PPDTELAAPGPPPARLPQL 440
                P     AS   T+P                       PP+T  +   PPP   P L
Sbjct: 539  PSLAPPPLQTASAPLTTPHLETPPCPAPCPLQAPPSPLTTPPPETPSSIATPPPQAPPAL 598

Query: 441  WDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPTARPSPHGMEM 500
              P     P+PP  PLA          P     L LP   PL  P       PSP     
Sbjct: 599  ASPPLQGLPSPPLSPLATP-------PPQAPPXLALP---PLQAP-------PSPPASPP 641

Query: 501  LSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTDPGAQP 560
            LS L  P+  P+        L  A  +P P                         P  Q 
Sbjct: 642  LSPLATPS--PQAPNALAVHLLQAPFSPPP------------------------SPPVQA 675

Query: 561  LFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSS 620
             F   A P VSP  TP    P  + A P + P PSP                  PA+P  
Sbjct: 676  PFSPPASPPVSPSATPPSQAPPSLAAPPLQVP-PSP------------------PASPPM 716

Query: 621  EESQLPGPLGPSAFFHPPTH--PQETGSP--FPSPEPPHSLPTHYQPEPAKAFPFPADGL 676
              S  P P  P     PP    P    SP   PS  PP  +P      P +  P P   L
Sbjct: 717  SPSATPPPQAPPPLAAPPLQVPPSPPASPPMSPSATPPPRVPPLLAAPPLQVPPSPPASL 776

Query: 677  GAEGAFQCLEETPFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCRQC 736
                  +     P P   P +    LQ  P  P  +P       SASL    +     Q 
Sbjct: 777  PMSPLAK-----PPPQAPPALATPPLQALPSPPASFPGQAPFSPSASLPMSPLATPPPQA 831

Query: 737  DRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKT 796
                  LAA L                 Q  P PP  P+  A  R P       +S  + 
Sbjct: 832  P---PVLAAPLL----------------QVPPSPPASPTLQAPRRPPTPGPDTSVSGPRL 872

Query: 797  FLLAGDAQAEGKDDPLRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSD 856
             L    A A G   P            P   P+S L   D A   S  T     +     
Sbjct: 873  TL----ALAPGPPPP------------PSRSPSSTLSGPDLAGHSSSATSTPEELRGYDS 916

Query: 857  NPEIDSSF-----IDVFADEEPSGPRGPSSGHPLKSKAGVTPESKAPPPLPAAT------ 905
             PE  ++       ++ A    +  RGP+     +   G      AP P P AT      
Sbjct: 917  GPEGGAAASPPPDAELAACHPAAWSRGPAPPLAFRGAPG------APLPWPPATGPGSAD 970

Query: 906  ----------PDPQTPRPG--DRG-CPARGRPKTRSLGLAPTEADAPSQ--------GRQ 944
                      P+  TP PG  D G  P     K  +   A   + +P Q        G  
Sbjct: 971  GLCTIYETEGPESATPAPGALDPGPSPGTSGGKAAAGAGAGASSRSPKQARLGELPLGAL 1030

Query: 945  QRRGKQLKLFRKDL--DSGGAAEGSGSGGGGRASG 977
            Q    Q  L R  L   + GAA GSG G GG   G
Sbjct: 1031 QASVVQHLLSRTLLLAAAEGAAGGSGGGPGGAEGG 1065



 Score =  103 bits (258), Expect = 3e-21
 Identities = 277/1118 (24%), Positives = 361/1118 (32%), Gaps = 212/1118 (18%)

Query: 144  AAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATP 203
            AA+ P + TP+ PG+  P  P  P      A   LG        P +  +      +   
Sbjct: 18   AARAPGLLTPRPPGSPRPPPPVTPA-----ALRVLGAAGAVGRKPLAERAGGIGGATIPE 72

Query: 204  RPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPAAENSFPGANFGVPPAEPEPIPKGSR 263
              P  GP +S GTS   P S P   ASG     P A+N+ PG     P + P      +R
Sbjct: 73   SAPRAGPTRSAGTSSRNPASRP--PASGRGERAPPAKNTSPG-----PVSSPGRASGTTR 125

Query: 264  PGG-SPRGVSFQFPFPALHGAST---KPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVG 319
            PG    +G+          G +T   K           T+GP       P  A    A G
Sbjct: 126  PGPLGQKGLRISAEETVARGKATEAPKRSALSAGARRDTSGPTP-GTPSPAMARRSRAAG 184

Query: 320  TGPAYPLPTQPAPSPLPCYQGQPGGLNRHSDLS------GALSSPGAAHSAPRPFSDSLH 373
            T    P P  P+  P P  +G    ++  S+ S       A   P A     RP S SL 
Sbjct: 185  TEVGLPRPA-PSARPRPPTEGPRKSVSSASEHSTTEPSPAARRRPSAGGGLQRPASRSLS 243

Query: 374  KSLTKI-LPERP-PSAQ--------------DGLGSTRGPPSSLPQRH-FPGQAYRASGV 416
             S T +  P R  PSA+               GL + R P  + P++   P     +S  
Sbjct: 244  SSATPLSSPARSGPSARGTPRAPAHPSQPKPKGLQALRPPQVTPPRKDAAPALGPLSSSP 303

Query: 417  DTSPGPPDTELAAPGPPPARLPQLWDPTAAPYPT--PPGGPLAATRSMFFNGQPSPGQRL 474
              +P P  T+ A P PPP       D  A P P   PP  PLA    +     PSP    
Sbjct: 304  LATPSPSGTK-ARPVPPP-------DNAATPLPATLPPSPPLATPLPL---APPSPSAPP 352

Query: 475  CLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKL 534
             L Q+ P P P   P+  P       +   P     P  Q        +    P P    
Sbjct: 353  SL-QTLPSP-PATPPSQAPPSMTTPPMQAPPSLQTIPPIQVPHSLTSPSLQAPPSPLALS 410

Query: 535  PAVRSSQGGSPAL---FTYNGMTDPGAQPLFFGVAQPQVSPHGTP------SLP--PPRV 583
                ++  GSP L    ++  M+    Q      ++P  +P  +P      SLP  PP  
Sbjct: 411  SLQATTSLGSPTLQATHSFLTMSPRQTQASLTSPSRPASTPPDSPPLQAPLSLPASPPLQ 470

Query: 584  VGASPSESPLPSPATNTAGSTCSSL------SPMSSSPANPSSEESQLPGP---LGPSAF 634
               SP+ SPL SP T       SSL      +P+SS    P   +S L  P     P++ 
Sbjct: 471  TSLSPAVSPLSSPLTIHPLQALSSLASHSPQAPLSSLIMPPLETQSSLAPPSLQTPPASL 530

Query: 635  FHPPTH--------PQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLE 686
              PP          P +T S  P   P    P    P P +A P P      E       
Sbjct: 531  TTPPLENLPSLAPPPLQTASA-PLTTPHLETPPCPAPCPLQAPPSPLTTPPPETPSSI-- 587

Query: 687  ETPFPHEGPEVGRGGLQGFP-------RAPPPYPTHHFSL-------SSASLDQLDVLLT 732
             TP P   P +    LQG P         PPP      +L       S  +   L  L T
Sbjct: 588  ATPPPQAPPALASPPLQGLPSPPLSPLATPPPQAPPXLALPPLQAPPSPPASPPLSPLAT 647

Query: 733  CRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLP-----SPPAAPRVPADAH 787
                 +  ++LA  L    F              SP PP  P     SPPA+P V   A 
Sbjct: 648  --PSPQAPNALAVHLLQAPF--------------SP-PPSPPVQAPFSPPASPPVSPSA- 689

Query: 788  AGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEA 847
                           +QA            PSLAA P  +P S       +   +   +A
Sbjct: 690  ------------TPPSQAP-----------PSLAAPPLQVPPSPPASPPMSPSATPPPQA 726

Query: 848  LNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLK-SKAGVTPESKAPPPLPAATP 906
                      P + +  + V      S P  PS+  P +       P  + PP  PA+ P
Sbjct: 727  ---------PPPLAAPPLQVPPSPPASPPMSPSATPPPRVPPLLAAPPLQVPPSPPASLP 777

Query: 907  DPQTPRPGDRGCPARGRPKTRSLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEG 966
                 +P  +  PA   P  ++L   P  A  P Q                     +A  
Sbjct: 778  MSPLAKPPPQAPPALATPPLQALPSPP--ASFPGQA----------------PFSPSASL 819

Query: 967  SGSGGGGRASGLRPRRNDGLGERPPPRPRRPRTQAPGSRADPAPRVPRAAALPEETRSSR 1026
              S          P     L + PP  P  P  QAP  R  P P    + + P  T +  
Sbjct: 820  PMSPLATPPPQAPPVLAAPLLQVPPSPPASPTLQAP--RRPPTPGPDTSVSGPRLTLA-- 875

Query: 1027 RRRLPPRKDPRKRKARGGAWGKELI---LKIVQQKNRLREYDFASESEEDEQPPP----- 1078
                P    P  R       G +L             LR YD   E      PPP     
Sbjct: 876  --LAPGPPPPPSRSPSSTLSGPDLAGHSSSATSTPEELRGYDSGPEGGAAASPPPDAELA 933

Query: 1079 --------RGP----GFRGRRGRGEKRKEVELTQGPREDEPQKPRKAARQEAGGDGAPAN 1126
                    RGP     FRG  G         L   P              E   +G  + 
Sbjct: 934  ACHPAAWSRGPAPPLAFRGAPG-------APLPWPPATGPGSADGLCTIYET--EGPESA 984

Query: 1127 PEEPGGSRPGPGRSPQARGPSRSLETGAAAREGGPKCA 1164
               PG   PGP  SP   G   +   GA A    PK A
Sbjct: 985  TPAPGALDPGP--SPGTSGGKAAAGAGAGASSRSPKQA 1020



 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 181/744 (24%), Positives = 241/744 (32%), Gaps = 122/744 (16%)

Query: 3   GERPRGAPPPTMTGDLQPRQVASSPGHPSQPPL---EDNTPATRTTKGAREAGGQAQAME 59
           G + R  PPP       P  +  SP   +  PL     + P +  T  +  A   +QA  
Sbjct: 311 GTKARPVPPPDNAATPLPATLPPSPPLATPLPLAPPSPSAPPSLQTLPSPPATPPSQAPP 370

Query: 60  LPEAQPRQARDGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQR 119
                P QA      PPSL+   P   P    SP      SPL   S  A  + GSP  +
Sbjct: 371 SMTTPPMQA------PPSLQTIPPIQVPHSLTSPSLQAPPSPLALSSLQATTSLGSPTLQ 424

Query: 120 Y---ILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAE 176
                L ++  +T+ +L  +P  P       P +  P       PL+  L      P + 
Sbjct: 425 ATHSFLTMSPRQTQASLT-SPSRPASTPPDSPPLQAPLSLPASPPLQTSLSPA-VSPLSS 482

Query: 177 ELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWP 236
            L  H     P  + +S    SP A P      PP    +S L P   P  Q   A    
Sbjct: 483 PLTIH-----PLQALSSLASHSPQA-PLSSLIMPPLETQSS-LAP---PSLQTPPASLTT 532

Query: 237 PAAENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPF---PADVA 293
           P  EN        +P   P P+   S P  +P   +   P P    A   P    P +  
Sbjct: 533 PPLEN--------LPSLAPPPLQTASAPLTTPHLETPPCPAPCPLQAPPSPLTTPPPETP 584

Query: 294 GHAFTNGPLVF-AFHQPQGAWPEEAVGTGPAYPLPTQPAPSP----LPCYQGQPGGLNRH 348
               T  P    A   P    P + + + P  PL T P  +P    LP  Q  P      
Sbjct: 585 SSIATPPPQAPPALASP----PLQGLPSPPLSPLATPPPQAPPXLALPPLQAPP------ 634

Query: 349 SDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPG 408
           S  +    SP A  S   P + ++H       P   P  Q        PP S P    P 
Sbjct: 635 SPPASPPLSPLATPSPQAPNALAVHLLQAPFSPPPSPPVQAPFSPPASPPVS-PSATPPS 693

Query: 409 QA---YRASGVDTSPGPPDTELAAPG--PPPARLPQLWDPTAAPYPTPPGGPLAATRSMF 463
           QA     A  +   P PP +   +P   PPP   P L  P     P+PP  P      M 
Sbjct: 694 QAPPSLAAPPLQVPPSPPASPPMSPSATPPPQAPPPLAAPPLQVPPSPPASP-----PMS 748

Query: 464 FNGQPSP-------GQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGG 516
            +  P P          L +P S P   P + P A+P P     L+  P  A        
Sbjct: 749 PSATPPPRVPPLLAAPPLQVPPSPPASLP-MSPLAKPPPQAPPALATPPLQA-------- 799

Query: 517 SQGALGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTDPGAQPLFFG-VAQPQVSPHGT 575
                      P P    P        +    +      P A P+    + Q   SP  +
Sbjct: 800 ----------LPSPPASFPGQAPFSPSASLPMSPLATPPPQAPPVLAAPLLQVPPSPPAS 849

Query: 576 PSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFF 635
           P+L  PR         P P P T+ +G   +        P    S  S L GP       
Sbjct: 850 PTLQAPR-------RPPTPGPDTSVSGPRLTLALAPGPPPPPSRSPSSTLSGPDLAGHSS 902

Query: 636 HPPTHPQE--------TGSPFPSPEPPHSL--------------PTHYQPEPAKAFPF-P 672
              + P+E         G    SP P   L              P  ++  P    P+ P
Sbjct: 903 SATSTPEELRGYDSGPEGGAAASPPPDAELAACHPAAWSRGPAPPLAFRGAPGAPLPWPP 962

Query: 673 ADGLGAEGAFQCLEETPFPHEGPE 696
           A G G+      + ET    EGPE
Sbjct: 963 ATGPGSADGLCTIYET----EGPE 982



 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 114/407 (28%), Positives = 137/407 (33%), Gaps = 59/407 (14%)

Query: 2   PGERPRGAPPPTMTGDLQPRQVASSPGHPSQPPLED-NTPATRTTKGAREAGGQA----- 55
           P   P   PPP     L    + + P  P+ PPL    TP+ +          QA     
Sbjct: 609 PPLSPLATPPPQAPPXLALPPLQAPPSPPASPPLSPLATPSPQAPNALAVHLLQAPFSPP 668

Query: 56  -----QAMELPEAQP---RQARDGELKPPSLRG---QAPSSTPGKRGSPQTPPGRSPLQA 104
                QA   P A P     A      PPSL     Q P S P     P +P    P QA
Sbjct: 669 PSPPVQAPFSPPASPPVSPSATPPSQAPPSLAAPPLQVPPSPPA--SPPMSPSATPPPQA 726

Query: 105 PSRLAGRAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRP 164
           P  LA      PP       AS    P+    P  P L AA  P +  P  P    P+ P
Sbjct: 727 PPPLAAPPLQVPPS----PPASPPMSPSATPPPRVPPLLAA--PPLQVPPSPPASLPMSP 780

Query: 165 -GLPRTEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSAT------PRPPAPGPPQSRG-- 215
              P  +A PA       +    PP+SF      SPSA+        PP   PP      
Sbjct: 781 LAKPPPQAPPALATPPL-QALPSPPASFPGQAPFSPSASLPMSPLATPPPQAPPVLAAPL 839

Query: 216 -TSPLQPGSYPEYQASGADSWP-PAAENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSF 273
              P  P + P  QA      P P    S P     + P  P P      P  SP   + 
Sbjct: 840 LQVPPSPPASPTLQAPRRPPTPGPDTSVSGPRLTLALAPGPPPP------PSRSPSS-TL 892

Query: 274 QFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQ-----GAWPEEAVGTGPAYPL-- 326
             P  A H +S    P ++ G  + +GP   A   P       A    A   GPA PL  
Sbjct: 893 SGPDLAGHSSSATSTPEELRG--YDSGPEGGAAASPPPDAELAACHPAAWSRGPAPPLAF 950

Query: 327 ---PTQPAPSPLPCYQGQPGGLNRHSDLSG---ALSSPGAAHSAPRP 367
              P  P P P     G   GL    +  G   A  +PGA    P P
Sbjct: 951 RGAPGAPLPWPPATGPGSADGLCTIYETEGPESATPAPGALDPGPSP 997



 Score = 73.6 bits (179), Expect = 4e-12
 Identities = 241/1046 (23%), Positives = 324/1046 (30%), Gaps = 191/1046 (18%)

Query: 877  RGPSSGHPLKSKAGVTPESKAPPPLPAATPDPQ--TPRPGDRGCPARGRPKTRSLGLAPT 934
            R P+S  P   +    P +K   P P ++P     T RPG  G         + L ++  
Sbjct: 88   RNPASRPPASGRGERAPPAKNTSPGPVSSPGRASGTTRPGPLG--------QKGLRISAE 139

Query: 935  EADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLG-ERPPPR 993
            E  A        RGK  +  ++   S GA   +     G  S    RR+   G E   PR
Sbjct: 140  ETVA--------RGKATEAPKRSALSAGARRDTSGPTPGTPSPAMARRSRAAGTEVGLPR 191

Query: 994  PRRPRTQAPGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELILK 1053
            P      AP +R  P    PR +     + +S      P    R+R + GG   +     
Sbjct: 192  P------APSARPRPPTEGPRKSV----SSASEHSTTEPSPAARRRPSAGGGLQRP---- 237

Query: 1054 IVQQKNRLREYDFASESEEDEQPPPRGPGFRGRRGRGEKRKEVELTQGPREDEPQKPRKA 1113
                         AS S      P   P   G   RG  R                    
Sbjct: 238  -------------ASRSLSSSATPLSSPARSGPSARGTPR-------------------- 264

Query: 1114 ARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGAAAREGGPKCADRPSVAPKD 1173
                     APA+P +P        R PQ   P +            P     PS     
Sbjct: 265  ---------APAHPSQPKPKGLQALRPPQVTPPRKDAAPALGPLSSSPLATPSPSGTKAR 315

Query: 1174 PLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEALRSPPAACAGEMGASPG 1233
            P+  P N  T                P T   S P +T    A  SP A  + +   SP 
Sbjct: 316  PVPPPDNAATPL--------------PATLPPSPPLATPLPLAPPSPSAPPSLQTLPSPP 361

Query: 1234 LLIPEQPPPSR--------------------HDTGTPK----PS----GSLANTAPHGSS 1265
               P Q PPS                     H   +P     PS     SL  T   GS 
Sbjct: 362  ATPPSQAPPSMTTPPMQAPPSLQTIPPIQVPHSLTSPSLQAPPSPLALSSLQATTSLGSP 421

Query: 1266 PTPGVGSLLG-GPGGTQAPVSHNSK---DPPARQPGEFLAPVANPSSTACPKPSVLSSKI 1321
                  S L   P  TQA ++  S+    PP   P    AP++ P+S   P  + LS  +
Sbjct: 422  TLQATHSFLTMSPRQTQASLTSPSRPASTPPDSPP--LQAPLSLPASP--PLQTSLSPAV 477

Query: 1322 SSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSELFLGPKDLAGCFL-EELHPKPSARDAP 1380
            S     P   +       +A   PQ   +P S L + P +         L   P++   P
Sbjct: 478  SPLS-SPLTIHPLQALSSLASHSPQ---APLSSLIMPPLETQSSLAPPSLQTPPASLTTP 533

Query: 1381 P----ASSSCLCQDGEDAGSLEPQLPRSP---PGTAETEPGRAASPPTLESSSLF---PD 1430
            P     S +        A    P L   P   P   +  P    +PP    SS+    P 
Sbjct: 534  PLENLPSLAPPPLQTASAPLTTPHLETPPCPAPCPLQAPPSPLTTPPPETPSSIATPPPQ 593

Query: 1431 LPVDRFDPPLYG------SLSANRDSGLPFACADPPQKTVPSDPPYPSFLLLEEVSPMLP 1484
             P     PPL G      S  A      P   A PP +  PS P  P    L   SP  P
Sbjct: 594  APPALASPPLQGLPSPPLSPLATPPPQAPPXLALPPLQAPPSPPASPPLSPLATPSPQAP 653

Query: 1485 SHFP-DLSGGKVLSKTCPP-ERTVVPGAAPSLPGKGSGCSVALMSHLSEDELEIQKLVTE 1542
            +     L          PP +    P A+P +    +  S A  S L+   L++      
Sbjct: 654  NALAVHLLQAPFSPPPSPPVQAPFSPPASPPVSPSATPPSQAPPS-LAAPPLQVPPSPPA 712

Query: 1543 LESQLQRSKDTRGAPRELA------EAESVGRVELGTGTEPPSQRRTCQATVPHEDTFSA 1596
                   +     AP  LA               +     PP +     A  P +   S 
Sbjct: 713  SPPMSPSATPPPQAPPPLAAPPLQVPPSPPASPPMSPSATPPPRVPPLLAAPPLQVPPSP 772

Query: 1597 ADLTRVGESTAHREGAESAVATVEAVQGRPGGTWPCPASFHPGHAALLPCAQEDLVSGAP 1656
                 +         A  A+AT       P    P P +  PG A   P A   +   A 
Sbjct: 773  PASLPMSPLAKPPPQAPPALAT------PPLQALPSPPASFPGQAPFSPSASLPMSPLAT 826

Query: 1657 FSPRGANFHFQPVQKAGASKTGLCQAEGDSRPP---QDVCLPEP----SKQPGPQLDAGS 1709
              P+       P+ +   S       +   RPP    D  +  P    +  PGP      
Sbjct: 827  PPPQAPPVLAAPLLQVPPSPPASPTLQAPRRPPTPGPDTSVSGPRLTLALAPGPPPPPSR 886

Query: 1710 LAKCSPDQELSFPK-NKEAASSQESEDSLRLLPCEQRGGFLPEPGTADQPHRGAPAPEAF 1768
                SP   LS P     ++S+  + + LR       GG    P    +     PA  + 
Sbjct: 887  ----SPSSTLSGPDLAGHSSSATSTPEELRGYDSGPEGGAAASPPPDAELAACHPAAWSR 942

Query: 1769 GSPAVHLAPDLAFQGDGAPPLDATWPFGASPSHA--------AQG-HSAGRAGGHLH--P 1817
            G      AP LAF+  GAP     WP    P  A         +G  SA  A G L   P
Sbjct: 943  GP-----APPLAFR--GAPGAPLPWPPATGPGSADGLCTIYETEGPESATPAPGALDPGP 995

Query: 1818 TAGRPGFEGNEFAPAGASSLTAPRGR 1843
            + G  G +    A AGASS +  + R
Sbjct: 996  SPGTSGGKAAAGAGAGASSRSPKQAR 1021



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 269/1144 (23%), Positives = 371/1144 (32%), Gaps = 196/1144 (17%)

Query: 1639 GHAALLPCAQED--LVSGAPFSPRGANFHFQPVQKAGASKTGLCQAEGDSRPPQ------ 1690
            G AA  P A+    L    P SPR       PV  A     G   A G     +      
Sbjct: 11   GAAARTPAARAPGLLTPRPPGSPRPP----PPVTPAALRVLGAAGAVGRKPLAERAGGIG 66

Query: 1691 DVCLPEPSKQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRLLPCEQRGGFLP 1750
               +PE + + GP   AG+ ++    +  +  + + A  ++ +                 
Sbjct: 67   GATIPESAPRAGPTRSAGTSSRNPASRPPASGRGERAPPAKNTS---------------- 110

Query: 1751 EPGTADQPHR--GAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPSHAAQGHSA 1808
             PG    P R  G   P   G   + ++ +       A           +P  +A   SA
Sbjct: 111  -PGPVSSPGRASGTTRPGPLGQKGLRISAEETVARGKATE---------APKRSAL--SA 158

Query: 1809 GRAGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPACVSNTHPSRRSQDP 1868
            G       PT G P       + A  + +  PR       P PS      T   R+S   
Sbjct: 159  GARRDTSGPTPGTPSPAMARRSRAAGTEVGLPR-------PAPSARPRPPTEGPRKSVSS 211

Query: 1869 AL-------SPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNPSGLEGGTVEGGK 1921
            A        SP  R+    G G+ +     L     TP + SP R  PS    GT    +
Sbjct: 212  ASEHSTTEPSPAARRRPSAGGGLQRPASRSLS-SSATPLS-SPARSGPSAR--GTP---R 264

Query: 1922 VACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTANQLQPENGVSP 1981
                P+Q  P G+Q    P V   +   +A    G L  +       +  + +P      
Sbjct: 265  APAHPSQPKPKGLQALRPPQVTPPRK--DAAPALGPLSSSPLATPSPSGTKARPVPPPDN 322

Query: 1982 GGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPTPSPPSPNRESLALA 2041
              T   A++  SP  A   P              A  SLQ    P  +PPS    S+   
Sbjct: 323  AATPLPATLPPSPPLATPLPLAPP-------SPSAPPSLQTLPSPPATPPSQAPPSMTTP 375

Query: 2042 LTAAHS--RSGSEGRTPERASSPGLNKPLLATGDSPAP-SVGDLAACAP--SPT-SAAHM 2095
               A    ++    + P   +SP L  P       P+P ++  L A     SPT  A H 
Sbjct: 376  PMQAPPSLQTIPPIQVPHSLTSPSLQAP-------PSPLALSSLQATTSLGSPTLQATHS 428

Query: 2096 PCSLGPLPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQLLACSPAWAPLEE---ADG 2152
              ++ P   +  LTSPSR         P       P  P    + SPA +PL        
Sbjct: 429  FLTMSPRQTQASLTSPSRPASTPPDSPPLQAPLSLPASPPLQTSLSPAVSPLSSPLTIHP 488

Query: 2153 VQATTDTGAEDSPVAP-PSLTTSPCDPKEALAGCLLQGEGS-----PLED-PSSWPP--G 2203
            +QA +   A  SP AP  SL   P + + +LA   LQ   +     PLE+ PS  PP   
Sbjct: 489  LQALSSL-ASHSPQAPLSSLIMPPLETQSSLAPPSLQTPPASLTTPPLENLPSLAPPPLQ 547

Query: 2204 SVSAVTCTHSGDTP----------KDSTLRIPEDSRKEKLWESPGRA----TSPPLAGAV 2249
            + SA   T   +TP            S L  P       +   P +A     SPPL G  
Sbjct: 548  TASAPLTTPHLETPPCPAPCPLQAPPSPLTTPPPETPSSIATPPPQAPPALASPPLQGLP 607

Query: 2250 SPSVAVRATGLSSTPTGDEAQAGRGLPGPDPQSRGAPPHTNPDRMPRG------HSSYSP 2303
            SP ++  AT     P        +  P P      +P  T   + P         + +SP
Sbjct: 608  SPPLSPLATPPPQAPPXLALPPLQAPPSPPASPPLSPLATPSPQAPNALAVHLLQAPFSP 667

Query: 2304 SNTARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSSKEPEDPGTPETGRSGAT 2363
              +  +     QA  + P  PP    A P S A            P  P +P    S AT
Sbjct: 668  PPSPPV-----QAPFSPPASPPVSPSATPPSQAPPSLAAPPLQVPPSPPASPPMSPS-AT 721

Query: 2364 KMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRNASHQTPQGDPLGPQDLKQRSRGY 2423
              P+   P     L     PS  AS   S S       +   P+  PL      Q     
Sbjct: 722  PPPQAPPPLAAPPL--QVPPSPPASPPMSPS-------ATPPPRVPPLLAAPPLQVP--- 769

Query: 2424 KKKPASTENGQWKGQAPHGPVTCEVCAASFRSGPGLSRHKARKHRPHPGAPAEPS-PAAL 2482
               PAS          P  P             P L+          P   A PS PA+ 
Sbjct: 770  PSPPASLPMSPLAKPPPQAP-------------PALAT---------PPLQALPSPPASF 807

Query: 2483 PAQQPLEPLAQKCQPPRKKSHRVSGKERPNHSRGDPSHVTQPPPAQGSKEVLRAPGSPHS 2542
            P Q P  P A     P            P       + + Q PP+  +   L+AP     
Sbjct: 808  PGQAPFSPSASLPMSP-------LATPPPQAPPVLAAPLLQVPPSPPASPTLQAP----- 855

Query: 2543 QQLHPPSPTEHEVDVKTPASKPRPDQAREDELHPKQAEKREGRRWRREPTVDSPSHSEGK 2602
                PP+P        T  S PR   A      P     R        P  D   HS   
Sbjct: 856  --RRPPTP-----GPDTSVSGPRLTLALAP--GPPPPPSRSPSSTLSGP--DLAGHSSSA 904

Query: 2603 SNKKRGKLRGRRLREESILPVSADVISDGRGSRPSPAMASYAASPSHCLSVEGGPEADGE 2662
            ++    +LRG     E     S    ++     P    A+++  P+  L+  G P A   
Sbjct: 905  TSTPE-ELRGYDSGPEGGAAASPPPDAELAACHP----AAWSRGPAPPLAFRGAPGAPLP 959

Query: 2663 QPPRLATLGPGVMEGAAETDQEALCAGETGAQKPPGDRMLCPGRMDGAALGEQPTGQ-KG 2721
             PP     GPG  +G     +     G   A   PG   L PG   G + G+   G   G
Sbjct: 960  WPP---ATGPGSADGLCTIYE---TEGPESATPAPG--ALDPGPSPGTSGGKAAAGAGAG 1011

Query: 2722 ASAR 2725
            AS+R
Sbjct: 1012 ASSR 1015



 Score = 68.9 bits (167), Expect = 9e-11
 Identities = 105/410 (25%), Positives = 137/410 (33%), Gaps = 79/410 (19%)

Query: 2020 LQEEAEPTPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSP--AP 2077
            LQ    P PSPP      +    +   S   S   TP   + P L  P L    SP  +P
Sbjct: 661  LQAPFSPPPSPP------VQAPFSPPASPPVSPSATPPSQAPPSLAAPPLQVPPSPPASP 714

Query: 2078 SVGDLAACAP-SPTSAAHMPCSLGPLPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQ 2136
             +   A   P +P   A  P  + P P   P  SPS         L A+P  + PP P  
Sbjct: 715  PMSPSATPPPQAPPPLAAPPLQVPPSPPASPPMSPSATPPPRVPPLLAAPPLQVPPSPPA 774

Query: 2137 LLACSPAWAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCDPKEALAGCLLQGEGSPLED 2196
             L  SP                  A+  P APP+L T P           LQ   SP   
Sbjct: 775  SLPMSPL-----------------AKPPPQAPPALATPP-----------LQALPSP--- 803

Query: 2197 PSSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVSP--SVA 2254
            P+S+P            G  P   +  +P         ++P    +P L    SP  S  
Sbjct: 804  PASFP------------GQAPFSPSASLPMSPLATPPPQAPPVLAAPLLQVPPSPPASPT 851

Query: 2255 VRATGLSSTPTGDEAQAGRGL-----PGPDPQSRGAPPHTNPDRMPRGHSSYSPSNTARL 2309
            ++A     TP  D + +G  L     PGP P    +P  T       GHSS + S    L
Sbjct: 852  LQAPRRPPTPGPDTSVSGPRLTLALAPGPPPPPSRSPSSTLSGPDLAGHSSSATSTPEEL 911

Query: 2310 -GHREGQAVTAVPTEPPTLQGA---------GPDSPACLEGEMGTSSKEP--EDPGTPE- 2356
             G+  G    A  + PP  + A         GP  P    G  G     P    PG+ + 
Sbjct: 912  RGYDSGPEGGAAASPPPDAELAACHPAAWSRGPAPPLAFRGAPGAPLPWPPATGPGSADG 971

Query: 2357 -------TGRSGATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHR 2399
                    G   AT  P    P    G     A +   +   S SP+  R
Sbjct: 972  LCTIYETEGPESATPAPGALDPGPSPGTSGGKAAAGAGAGASSRSPKQAR 1021



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 259/1167 (22%), Positives = 357/1167 (30%), Gaps = 201/1167 (17%)

Query: 1109 KPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQAR---GPSRSL-ETGAAAREGGPKCA 1164
            K   AAR  A        P  PG  RP P  +P A    G + ++     A R GG   A
Sbjct: 9    KAGAAARTPAARAPGLLTPRPPGSPRPPPPVTPAALRVLGAAGAVGRKPLAERAGGIGGA 68

Query: 1165 DRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEALRSPPAAC 1224
              P  AP+     PT +  +    P+   P   +      E AP +   +    S P   
Sbjct: 69   TIPESAPRAG---PTRSAGTSSRNPASRPPASGRG-----ERAPPAKNTSPGPVSSPGRA 120

Query: 1225 AGEMGASP----GLLIPEQPPPSRHD-TGTPKPSGSLANTAPHGSSPTPGVGS------- 1272
            +G     P    GL I  +   +R   T  PK S   A      S PTPG  S       
Sbjct: 121  SGTTRPGPLGQKGLRISAEETVARGKATEAPKRSALSAGARRDTSGPTPGTPSPAMARRS 180

Query: 1273 -LLGGPGGTQAPVSHNSKDPPARQPGEFLAPVANPSSTACPKPSVLSSKISSFGCDPAGF 1331
               G   G   P       PP   P + ++  +  S+T   +PS  + +  S G    G 
Sbjct: 181  RAAGTEVGLPRPAPSARPRPPTEGPRKSVSSASEHSTT---EPSPAARRRPSAG---GGL 234

Query: 1332 NRDPLGVPVAKKGPQPYSSPHSELFLGPKDLAGCFLEELHPKPSARDAPPASSSCLCQDG 1391
             R P    ++     P SSP                      PSAR  P A +       
Sbjct: 235  QR-PASRSLSSSAT-PLSSP------------------ARSGPSARGTPRAPA------- 267

Query: 1392 EDAGSLEPQLPRSPPGTAETEPGRAASPPTLESSSLFPDLPVDRFDPPLYGSLSANRDSG 1451
                   P  P+ P G     P +  +PP  +++     L       P      A R   
Sbjct: 268  ------HPSQPK-PKGLQALRPPQV-TPPRKDAAPALGPLSSSPLATPSPSGTKA-RPVP 318

Query: 1452 LPFACADPPQKTVPSDPPYPSFLLLEEVSPMLPSHFPDL-SGGKVLSKTCPPERTVVPGA 1510
             P   A P   T+P  PP  + L L   SP  P     L S         PP  T  P  
Sbjct: 319  PPDNAATPLPATLPPSPPLATPLPLAPPSPSAPPSLQTLPSPPATPPSQAPPSMTTPPMQ 378

Query: 1511 AP---------------------SLPGKGSGCSVALMSHLSEDELE-IQKLVTELESQLQ 1548
            AP                     + P   +  S+   + L    L+     +T    Q Q
Sbjct: 379  APPSLQTIPPIQVPHSLTSPSLQAPPSPLALSSLQATTSLGSPTLQATHSFLTMSPRQTQ 438

Query: 1549 RSKDTRGAPRELAEAESVGRVELGTGTEPPSQRRTCQATVPHEDTFSAADLTRVGESTAH 1608
             S  +   P          +  L     PP Q     A  P     +   L  +    +H
Sbjct: 439  ASLTSPSRPASTPPDSPPLQAPLSLPASPPLQTSLSPAVSPLSSPLTIHPLQALSSLASH 498

Query: 1609 REGAESAVATVEAVQGRPGGTWPCPASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQP 1668
               A  +   +  ++ +       P S     A+L     E+L S AP           P
Sbjct: 499  SPQAPLSSLIMPPLETQSS---LAPPSLQTPPASLTTPPLENLPSLAP----------PP 545

Query: 1669 VQKAGAS------KTGLCQAEGD-SRPPQDVCLP---EPSKQPGPQLDAGSLAKCSPDQE 1718
            +Q A A       +T  C A      PP  +  P    PS    P   A       P Q 
Sbjct: 546  LQTASAPLTTPHLETPPCPAPCPLQAPPSPLTTPPPETPSSIATPPPQAPPALASPPLQG 605

Query: 1719 LSFPKNKEAASSQESEDSLRLLPCEQRGGFLPEPGTADQPHRGAPAPEAFGSPAVHLAPD 1778
            L  P     A+          LP  Q       P +        P+P+A  + AVHL   
Sbjct: 606  LPSPPLSPLATPPPQAPPXLALPPLQAPP--SPPASPPLSPLATPSPQAPNALAVHLL-Q 662

Query: 1779 LAFQGDGAPPLDATWPFGASPSHAAQGHSAGRAGGHLHPTAGRPGFEGNEFAPAGASSLT 1838
              F    +PP+ A +   ASP  +       +A     P+   P  +     P  AS   
Sbjct: 663  APFSPPPSPPVQAPFSPPASPPVSPSATPPSQA----PPSLAAPPLQVPPSPP--ASPPM 716

Query: 1839 APRGREAWLVPVP---SPACVSNTHPSRRSQDPALSPPIR---QLQLPGPGVAKSKDGIL 1892
            +P        P P    P  V  + P+     P+ +PP R    L  P   V  S    L
Sbjct: 717  SPSATPPPQAPPPLAAPPLQVPPSPPASPPMSPSATPPPRVPPLLAAPPLQVPPSPPASL 776

Query: 1893 GLQELT-PAAQSPPRVNPSGLEGGTVEGGKVACGPAQGSPGGVQVTTLPAVAGHQLGLEA 1951
             +  L  P  Q+PP +    L+            P    PG    +   ++    L    
Sbjct: 777  PMSPLAKPPPQAPPALATPPLQ--------ALPSPPASFPGQAPFSPSASLPMSPLATPP 828

Query: 1952 DGHWGLLGQAEKTQGQGTANQLQPENGVSPGGTDNHASVNASPKTALTGPTEGAVLLEKC 2011
                 +L             Q+ P    SP            P T+++GP          
Sbjct: 829  PQAPPVLA--------APLLQVPPSPPASPTLQAPRRPPTPGPDTSVSGP---------- 870

Query: 2012 KGSRAAMSLQEEAEPTPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLAT 2071
               R  ++L     P P PP     S  L+       S S   TPE       + P    
Sbjct: 871  ---RLTLAL----APGPPPPPSRSPSSTLSGPDLAGHSSSATSTPEELRGYD-SGPEGGA 922

Query: 2072 GDSPAPSVGDLAACAPSPTSAAHMPCSLGPLPREDPLTSPSRAQGGLGGQLPASPSCRDP 2131
              SP P   +LAAC P+  S        GP P       P   +G  G  LP  P+    
Sbjct: 923  AASPPPD-AELAACHPAAWSR-------GPAP-------PLAFRGAPGAPLPWPPA---- 963

Query: 2132 PGPQQLLACSPAWAPLEEADGVQATTDT-GAEDSPVAPPSLTTSPCDPKEALAGCLLQGE 2190
             GP               ADG+    +T G E +  AP +L   P             G 
Sbjct: 964  TGP-------------GSADGLCTIYETEGPESATPAPGALDPGPSPGTSGGKAAAGAGA 1010

Query: 2191 GSPLEDP-----SSWPPGSVSAVTCTH 2212
            G+    P        P G++ A    H
Sbjct: 1011 GASSRSPKQARLGELPLGALQASVVQH 1037



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 95/375 (25%), Positives = 137/375 (36%), Gaps = 76/375 (20%)

Query: 3523 PPPSLSPFPAALADGRGDCALDGALERPENEASPGSPGPLLQQALP-------LGASLPR 3575
            PPP ++P    +    G         +P  E + G  G  + ++ P        G S   
Sbjct: 35   PPPPVTPAALRVLGAAGAVG-----RKPLAERAGGIGGATIPESAPRAGPTRSAGTSSRN 89

Query: 3576 PGARGQ-DAEGKRAPLVFSGKRRAPG---ARGRCAPDHFQEDHLLQKEKEVSSSHMVSEG 3631
            P +R      G+RAP     K  +PG   + GR A    +   L QK   +S+   V+  
Sbjct: 90   PASRPPASGRGERAP---PAKNTSPGPVSSPGR-ASGTTRPGPLGQKGLRISAEETVA-- 143

Query: 3632 GPRGTFHKGSATK-PAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENG 3690
                   +G AT+ P     S+  R   S P+     P   R++         A GTE G
Sbjct: 144  -------RGKATEAPKRSALSAGARRDTSGPTPGTPSPAMARRS--------RAAGTEVG 188

Query: 3691 MKPATPKAKPGPSSQG------------SGSPRPGTK---TGGGSQPQPASGQLQSETAT 3735
            +    P A+P P ++G            +  P P  +   + GG   +PAS  L S    
Sbjct: 189  LPRPAPSARPRPPTEGPRKSVSSASEHSTTEPSPAARRRPSAGGGLQRPASRSLSSSATP 248

Query: 3736 -------------TPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPKEK 3782
                         TP  P+ PS+ P P+ L A    +        A   GP  S      
Sbjct: 249  LSSPARSGPSARGTPRAPAHPSQ-PKPKGLQALRPPQVTPPRKDAAPALGPLSSSPLATP 307

Query: 3783 GESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQATPSRVLPTKPKPNSQNKP 3842
              S TK +   VP P   ++  +   A   P  P  TP   A PS   P+ P P+ Q  P
Sbjct: 308  SPSGTKAR--PVPPP---DNAATPLPATLPPSPPLATPLPLAPPS---PSAP-PSLQTLP 358

Query: 3843 RPPPSEQRKAEPGHT 3857
             PP +   +A P  T
Sbjct: 359  SPPATPPSQAPPSMT 373



 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 139/611 (22%), Positives = 190/611 (31%), Gaps = 117/611 (19%)

Query: 428 AAPGPPPARLPQLWD--PTAAPYPTPPGGPLAATRSMFFNGQPSPGQR-----------L 474
           AA   P AR P L    P  +P P PP  P AA R +   G  + G++            
Sbjct: 12  AAARTPAARAPGLLTPRPPGSPRPPPPVTP-AALRVLGAAG--AVGRKPLAERAGGIGGA 68

Query: 475 CLPQSAPLPWP-------QVLPTARPSPHGM-----EMLSRLPFPAGGPEWQGGS--QGA 520
            +P+SAP   P          P +RP   G         +  P P   P    G+   G 
Sbjct: 69  TIPESAPRAGPTRSAGTSSRNPASRPPASGRGERAPPAKNTSPGPVSSPGRASGTTRPGP 128

Query: 521 LGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTD-----PG-----------AQPLFFG 564
           LG  G      E +   ++++    +  +     D     PG           A     G
Sbjct: 129 LGQKGLRISAEETVARGKATEAPKRSALSAGARRDTSGPTPGTPSPAMARRSRAAGTEVG 188

Query: 565 VAQPQVSPHGTPSLPPPR--VVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEE 622
           + +P  S    P    PR  V  AS   +  PSPA     S    L   +S   + S+  
Sbjct: 189 LPRPAPSARPRPPTEGPRKSVSSASEHSTTEPSPAARRRPSAGGGLQRPASRSLSSSATP 248

Query: 623 SQLPGPLGPSAFFHP--PTHPQE----------------------------TGSPFPSPE 652
              P   GPSA   P  P HP +                            + SP  +P 
Sbjct: 249 LSSPARSGPSARGTPRAPAHPSQPKPKGLQALRPPQVTPPRKDAAPALGPLSSSPLATPS 308

Query: 653 PPHS--------------LPTHYQPEPAKAFPFP--ADGLGAEGAFQCLEE---TPFPHE 693
           P  +              LP    P P  A P P       A  + Q L     TP    
Sbjct: 309 PSGTKARPVPPPDNAATPLPATLPPSPPLATPLPLAPPSPSAPPSLQTLPSPPATPPSQA 368

Query: 694 GPEVGRGGLQGFP--RAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQ 751
            P +    +Q  P  +  PP    H SL+S SL      L         S  +  L    
Sbjct: 369 PPSMTTPPMQAPPSLQTIPPIQVPH-SLTSPSLQAPPSPLALSSLQATTSLGSPTLQATH 427

Query: 752 FCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDP 811
               +  R       SP  P   +PP +P + A          +T L    +        
Sbjct: 428 SFLTMSPRQTQASLTSPSRPA-STPPDSPPLQAPLSLPASPPLQTSLSPAVSPLSSPLTI 486

Query: 812 LRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADE 871
                L SLA+     P S L M       SL   +L         P +++         
Sbjct: 487 HPLQALSSLASHSPQAPLSSLIMPPLETQSSLAPPSLQTPPASLTTPPLENL-------P 539

Query: 872 EPSGPRGPSSGHPLKSKAGVTPESKAP-----PPLPAATPDPQTP----RPGDRGCPARG 922
             + P   ++  PL +    TP   AP     PP P  TP P+TP     P  +  PA  
Sbjct: 540 SLAPPPLQTASAPLTTPHLETPPCPAPCPLQAPPSPLTTPPPETPSSIATPPPQAPPALA 599

Query: 923 RPKTRSLGLAP 933
            P  + L   P
Sbjct: 600 SPPLQGLPSPP 610



 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 92/369 (24%), Positives = 124/369 (33%), Gaps = 59/369 (15%)

Query: 3416 GRQPFAFRGVRRPGAPGQKARALEGTLPSKRRRVAMPGSAP---GPGEDRPPPRGSSPIL 3472
            GR+P A R     GA   ++    G   S       P S P   G GE  PP + +SP  
Sbjct: 54   GRKPLAERAGGIGGATIPESAPRAGPTRSAGTSSRNPASRPPASGRGERAPPAKNTSP-- 111

Query: 3473 SEGSLPALLHLCSEVAPSTTKGWPETLERPV---DPVTHPIRGCELPSNHQECPPPSLSP 3529
               S P      +   P   KG   + E  V        P R        ++   P+   
Sbjct: 112  GPVSSPGRASGTTRPGPLGQKGLRISAEETVARGKATEAPKRSALSAGARRDTSGPTPGT 171

Query: 3530 FPAALADGRGDCALDGALERPENEASPGSP--GP--LLQQALPLGASLPRPGARGQDAEG 3585
               A+A        +  L RP   A P  P  GP   +  A     + P P AR + + G
Sbjct: 172  PSPAMARRSRAAGTEVGLPRPAPSARPRPPTEGPRKSVSSASEHSTTEPSPAARRRPSAG 231

Query: 3586 KRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSS---SHMVSEGGPRGTFHKGSA 3642
                    G  + P +R            L      +SS   S   + G PR   H  S 
Sbjct: 232  --------GGLQRPASRS-----------LSSSATPLSSPARSGPSARGTPRAPAHP-SQ 271

Query: 3643 TKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGP 3702
             KP G Q+    R    TP +    P     A+G L+   LA  +     P+  KA+P P
Sbjct: 272  PKPKGLQAL---RPPQVTPPRKDAAP-----ALGPLSSSPLATPS-----PSGTKARPVP 318

Query: 3703 SSQGSGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFP---SRSPAPERLPARAQAK 3759
                + +P P T         P S  L +     P  PS P      P+P   P      
Sbjct: 319  PPDNAATPLPAT--------LPPSPPLATPLPLAPPSPSAPPSLQTLPSPPATPPSQAPP 370

Query: 3760 SCTKGPREA 3768
            S T  P +A
Sbjct: 371  SMTTPPMQA 379



 Score = 42.7 bits (99), Expect = 0.007
 Identities = 62/241 (25%), Positives = 88/241 (36%), Gaps = 46/241 (19%)

Query: 3671 PRKAVGSLAPGELARGTENGMKPATPKAK---PGPSS---QGSGSPRPG----------- 3713
            P ++ G+ +    +R   +G     P AK   PGP S   + SG+ RPG           
Sbjct: 79   PTRSAGTSSRNPASRPPASGRGERAPPAKNTSPGPVSSPGRASGTTRPGPLGQKGLRISA 138

Query: 3714 --TKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKG-PREAGE 3770
              T   G +   P    L +      + P+  + SPA  R   R++A     G PR A  
Sbjct: 139  EETVARGKATEAPKRSALSAGARRDTSGPTPGTPSPAMAR---RSRAAGTEVGLPRPAPS 195

Query: 3771 QGPHGSLGPKEKGESSTKRKKGQVPGPA--RSESVGSFGRAPSAPDKPPRTPRKQATPSR 3828
              P        K  SS        P PA  R  S G   + P++     R+    ATP  
Sbjct: 196  ARPRPPTEGPRKSVSSASEHSTTEPSPAARRRPSAGGGLQRPAS-----RSLSSSATPLS 250

Query: 3829 VLPTKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPPKRGTAVHGAEP 3888
              P +  P+++  PR P      A P   +         P+G   LRPP+       A P
Sbjct: 251  S-PARSGPSARGTPRAP------AHPSQPK---------PKGLQALRPPQVTPPRKDAAP 294

Query: 3889 A 3889
            A
Sbjct: 295  A 295



 Score = 42.0 bits (97), Expect = 0.012
 Identities = 86/334 (25%), Positives = 103/334 (30%), Gaps = 62/334 (18%)

Query: 3452 PGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEVAPSTTKGWPETLERPVDPVTHPIR 3511
            P + P P    PPP  + P+    S PA   +     P      P  L  P   V  P  
Sbjct: 718  PSATPPP--QAPPPLAAPPLQVPPSPPASPPMSPSATPPPRV--PPLLAAPPLQVP-PSP 772

Query: 3512 GCELPSNHQECPPPSLSP---------FPAALADGRGDCALDGA-------LERPENEAS 3555
               LP +    PPP   P          P+  A   G      +       L  P  +A 
Sbjct: 773  PASLPMSPLAKPPPQAPPALATPPLQALPSPPASFPGQAPFSPSASLPMSPLATPPPQAP 832

Query: 3556 PGSPGPLLQ-----QALPLGASLPRPGARGQDAE--GKRAPLVFSGKRRAPGARGRCAPD 3608
            P    PLLQ      A P   +  RP   G D    G R  L  +     P +R      
Sbjct: 833  PVLAAPLLQVPPSPPASPTLQAPRRPPTPGPDTSVSGPRLTLALAPGPPPPPSR------ 886

Query: 3609 HFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPA----GCQSSSKDRSAASTPSKA 3664
                          S S  +S  GP    H  SAT       G  S  +  +AAS P  A
Sbjct: 887  --------------SPSSTLS--GPDLAGHSSSATSTPEELRGYDSGPEGGAAASPPPDA 930

Query: 3665 LKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQG------SGSPRPGTKTGG 3718
                 HP       AP    RG      P  P   PG S+ G      +  P   T   G
Sbjct: 931  ELAACHPAAWSRGPAPPLAFRGAPGAPLPWPPATGPG-SADGLCTIYETEGPESATPAPG 989

Query: 3719 GSQPQPASGQLQSETATTPAKPSFPSRSPAPERL 3752
               P P+ G      A   A     SRSP   RL
Sbjct: 990  ALDPGPSPG-TSGGKAAAGAGAGASSRSPKQARL 1022



 Score = 41.2 bits (95), Expect = 0.020
 Identities = 102/467 (21%), Positives = 143/467 (30%), Gaps = 63/467 (13%)

Query: 3418 QPFAFRGVRRPGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSL 3477
            +P   + +R P     +  A     P     +A P  +       PPP  ++  L   +L
Sbjct: 273  KPKGLQALRPPQVTPPRKDAAPALGPLSSSPLATPSPSGTKARPVPPPDNAATPLP-ATL 331

Query: 3478 PALLHLCSEV--APSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALA 3535
            P    L + +  AP +    P     P  P T P +     +      PPSL   P    
Sbjct: 332  PPSPPLATPLPLAPPSPSAPPSLQTLPSPPATPPSQAPPSMTTPPMQAPPSLQTIPP--- 388

Query: 3536 DGRGDCALDGALERPENEASPG---SPGPLLQQALPLGASLPRPGARGQDAEGKRAPLVF 3592
                       ++ P +  SP     P PL   +L    SL  P  +   +    +P   
Sbjct: 389  -----------IQVPHSLTSPSLQAPPSPLALSSLQATTSLGSPTLQATHSFLTMSPRQT 437

Query: 3593 SGKRRAPGARGRCAPDH--FQEDHLLQKEK--EVSSSHMVSEGGPRGTFHKGSATKPAGC 3648
                 +P       PD    Q    L      + S S  VS      T H   A      
Sbjct: 438  QASLTSPSRPASTPPDSPPLQAPLSLPASPPLQTSLSPAVSPLSSPLTIHPLQALSSLAS 497

Query: 3649 QS----------------SSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMK 3692
             S                SS    +  TP  +L  P  P + + SLAP  L   +     
Sbjct: 498  HSPQAPLSSLIMPPLETQSSLAPPSLQTPPASLTTP--PLENLPSLAPPPLQTASAPLTT 555

Query: 3693 P--ATP--------KAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETAT-TPAKPS 3741
            P   TP        +A P P +    +P P T +   + P  A   L S      P+ P 
Sbjct: 556  PHLETPPCPAPCPLQAPPSPLT----TPPPETPSSIATPPPQAPPALASPPLQGLPSPPL 611

Query: 3742 FPSRSPAPERLPARAQAK-SCTKGPREAGEQGPHGSLGPKEKGESSTKRKKGQVPGPARS 3800
             P  +P P+  P  A         P  +    P  +  P+     +    +     P   
Sbjct: 612  SPLATPPPQAPPXLALPPLQAPPSPPASPPLSPLATPSPQAPNALAVHLLQAPFSPPPSP 671

Query: 3801 ESVGSFGRAPSAPDKPPRTPRKQATPSRVLPTKPKPNSQNKPRPPPS 3847
                 F    S P  P  TP  QA PS   P       Q  P PP S
Sbjct: 672  PVQAPFSPPASPPVSPSATPPSQAPPSLAAPPL-----QVPPSPPAS 713



 Score = 40.8 bits (94), Expect = 0.027
 Identities = 56/219 (25%), Positives = 74/219 (33%), Gaps = 23/219 (10%)

Query: 3668 PVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTKTGGGSQPQPASG 3727
            PV P     S AP  LA        P +P A P  S   +  P+        + P  A+ 
Sbjct: 684  PVSPSATPPSQAPPSLAAPPLQ--VPPSPPASPPMSPSATPPPQ--------APPPLAAP 733

Query: 3728 QLQSETATTPAKPSFPSRSPAPERLPARAQAK-SCTKGPREAGEQGPHGSLGPKEKGESS 3786
             LQ   +   + P  PS +P P   P  A         P  +    P     P+     +
Sbjct: 734  PLQVPPSPPASPPMSPSATPPPRVPPLLAAPPLQVPPSPPASLPMSPLAKPPPQAPPALA 793

Query: 3787 TKRKKGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQATPS------RVLPTKPKPNSQN 3840
            T   +     PA       F  + S P  P  TP  QA P       +V P+ P   +  
Sbjct: 794  TPPLQALPSPPASFPGQAPFSPSASLPMSPLATPPPQAPPVLAAPLLQVPPSPPASPTLQ 853

Query: 3841 KPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPPKR 3879
             PR PP+      P  +    RL  A   G P   PP R
Sbjct: 854  APRRPPT----PGPDTSVSGPRLTLALAPGPP--PPPSR 886



 Score = 32.3 bits (72), Expect = 9.5
 Identities = 36/129 (27%), Positives = 43/129 (33%), Gaps = 28/129 (21%)

Query: 3193 SSAVAHLLNSITEPAPKHHRG-------KRSAGKAAGSPGDPWGQEGEAKKDSPGERAKP 3245
            SSA  H   S TEP+P   R        +R A ++  S   P        +  P  R  P
Sbjct: 210  SSASEH---STTEPSPAARRRPSAGGGLQRPASRSLSSSATPLSSPA---RSGPSARGTP 263

Query: 3246 RARSTPS----------NPDGAATPDSASATALADAGS-----PGPPRTTPSPSPDPWAG 3290
            RA + PS           P     P   +A AL    S     P P  T   P P P   
Sbjct: 264  RAPAHPSQPKPKGLQALRPPQVTPPRKDAAPALGPLSSSPLATPSPSGTKARPVPPPDNA 323

Query: 3291 GEPLLQATP 3299
              PL    P
Sbjct: 324  ATPLPATLP 332



 Score = 32.3 bits (72), Expect = 9.5
 Identities = 30/104 (28%), Positives = 35/104 (33%), Gaps = 15/104 (14%)

Query: 3204 TEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPGERAKPRARSTPSN--------PD 3255
            T  AP H    +  G  A  P        +A        + P A  +PS         PD
Sbjct: 262  TPRAPAHPSQPKPKGLQALRPPQVTPPRKDAAPALGPLSSSPLATPSPSGTKARPVPPPD 321

Query: 3256 GAATPDSASATALADAGSPGPPRTTPSPSPDPWAGGEPLLQATP 3299
             AATP  A+         P PP  TP P   P     P LQ  P
Sbjct: 322  NAATPLPATLP-------PSPPLATPLPLAPPSPSAPPSLQTLP 358


>gi|110735435 collagen, type V, alpha 3 preproprotein [Homo sapiens]
          Length = 1745

 Score =  107 bits (267), Expect = 2e-22
 Identities = 356/1416 (25%), Positives = 449/1416 (31%), Gaps = 237/1416 (16%)

Query: 31   SQPPLEDNTP-----ATRTTKGAREAGGQAQAMELPEA----QPRQARDG-ELKPPSLRG 80
            +QPP+  + P     A  T  G ++ G +    ++ E      P+ A    E   P    
Sbjct: 167  AQPPVLGHGPRFISIAGLTVLGTQDLGEKTFEGDIQELLISPDPQAAFQACERYLPDCDN 226

Query: 81   QAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRYILGIASSRTKPTLDETPENP 140
             AP++T   +G P+TP  R   +   R  GR      ++    I +S   P   ++ EN 
Sbjct: 227  LAPAATVAPQGEPETPRPRRKGKGKGRKKGRGRKGKGRKKNKEIWTSSPPP---DSAENQ 283

Query: 141  QLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAEELGFHRCFQE---PPSSFTSTNYT 197
               +  +P+ +TP      AP  P  P      +    G +    E    P S T    T
Sbjct: 284  --TSTDIPKTETP------APNLPPTPTPLVVTSTVTTGLNATILERSLDPDSGTELG-T 334

Query: 198  SPSATPRPPAPGPPQSRG--------TSPLQPGSYPEYQASGADSWPPAAENSFPGANFG 249
              +   R    G   + G         S  Q   +P     GA   P   E    G  F 
Sbjct: 335  LETKAAREDEEGDDSTMGPDFRAAEYPSRTQFQIFPGAGEKGAKGEPAVIEK---GQQFE 391

Query: 250  VPPAEP----------EPIPKGSRPGGSPRGVSFQFPFPALHGASTKP-----FPADVAG 294
             PP  P           P P G      P G +     P + G    P      P   AG
Sbjct: 392  GPPGAPGPQGVVGPSGPPGPPGFPGDPGPPGPAGLPGIPGIDGIRGPPGTVIMMPFQFAG 451

Query: 295  HAFTNGPLVFAFHQPQGAWPEEAVG-TGPAYP--LPTQPAPSPLPCYQGQPG-----GLN 346
             +F   P+ F   Q Q    +  +   GP  P  L  +P P  LP + G  G     G  
Sbjct: 452  GSFKGPPVSFQQAQAQAVLQQTQLSMKGPPGPVGLTGRPGPVGLPGHPGLKGEEGAEGPQ 511

Query: 347  RHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKILP-ERPPSAQDGLGSTRGPPSSLPQRH 405
                L G    PG      RP +D       + LP +  P    G     G P    QR 
Sbjct: 512  GPRGLQGPHGPPGRVGKMGRPGADG-----ARGLPGDTGPKGDRGFDGLPGLPGEKGQRG 566

Query: 406  FPGQAYRASGVDTSPGPP--DTELAAPGPP----PARLP---QLWDPTAAPYPT-PPG-- 453
              G           PGPP  D E  A GPP     A  P    L  P  +P PT  PG  
Sbjct: 567  DFGHV-------GQPGPPGEDGERGAEGPPGPTGQAGEPGPRGLLGPRGSPGPTGRPGVT 619

Query: 454  ---GPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVL--PTARPSPHGMEMLSRLPFPA 508
               G   A  ++   G+P P  +     S  LP PQ L        P G   +  LP   
Sbjct: 620  GIDGAPGAKGNVGPPGEPGPPGQQGNHGSQGLPGPQGLIGTPGEKGPPGNPGIPGLPGSD 679

Query: 509  G--------GPEWQGGSQGALGTAGKT--PGPREKLPAVRSSQGGSPALFTYNGMTDPGA 558
            G        GP  + G+QG  G+AG    PGPR     V+ +  G+  L    G      
Sbjct: 680  GPLGHPGHEGPTGEKGAQGPPGSAGPPGYPGPR----GVKGT-SGNRGLQGEKGEKGEDG 734

Query: 559  QPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPL--------PSPATNTAGSTCSSLSP 610
             P F G    +    G P  P PR  G    E P           P  +        +  
Sbjct: 735  FPGFKGDVGLK-GDQGKPGAPGPR--GEDGPEGPKGQAGQAGEEGPPGSAGEKGKLGVPG 791

Query: 611  MSSSPANPSSEES-QLPGPLGPSAFFHPPTHPQETGSPFPSPE--PPHSLPTHYQPEPAK 667
            +   P  P  + S   PGPLGP           +TG P    E  PP S     QP  A 
Sbjct: 792  LPGYPGRPGPKGSIGFPGPLGP---IGEKGKSGKTGQPGLEGERGPPGSRGERGQP-GAT 847

Query: 668  AFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGFPRAP-PPYPTHHFSLSSASLDQ 726
              P P   +G +GA         P    E G  GLQG P  P P  P  H          
Sbjct: 848  GQPGPKGDVGQDGA---------PGIPGEKGLPGLQGPPGFPGPKGPPGHQGKDGR---- 894

Query: 727  LDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGH---QRSPGPPGLPSPPAAPRVP 783
                       R               G+L  + K G        GPPG P PP    +P
Sbjct: 895  -----PGHPGQRGELGFQGQTGPPGPAGVLGPQGKTGEVGPLGERGPPGPPGPPGEQGLP 949

Query: 784  ADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATP-FPLPASDLDMEDDAKLDS 842
                 GL          G     GK+ P      P     P  P P     ++ D     
Sbjct: 950  -----GLEGREGAKGELGPPGPLGKEGPAGLRGFPGPKGGPGDPGPTG---LKGDKGPPG 1001

Query: 843  LITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAGVTPESKAPPPL- 901
             +    +  E     P            E P GP G       +   G T +   P PL 
Sbjct: 1002 PVGANGSPGERGPLGPAGGIGLPGQSGSEGPVGPAGKKGSRGERGPPGPTGKDGIPGPLG 1061

Query: 902  -----PAATPDPQTPRPGDRGCPAR-------------GRPKTRSLGLAPTEADAPSQGR 943
                  AA P  +    GD G P               G+P  R  G A       + G 
Sbjct: 1062 PLGPPGAAGPSGEEGDKGDVGAPGHKGSKGDKGDAGPPGQPGIR--GPAGHPGPPGADGA 1119

Query: 944  QQRRGKQLKLFRKDLDSG-----GAAEGSGSGGGGRASGLRPRRND--GLGERPPPRPRR 996
            Q RRG    LF +  D G     G     G  G     G +    D   +G    P PR 
Sbjct: 1120 QGRRGPP-GLFGQKGDDGVRGFVGVIGPPGLQGLPGPPGEKGEVGDVGSMGPHGAPGPRG 1178

Query: 997  PRTQAPGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQ 1056
            P  Q P + ++  P +P     P        R      DP    A G          I  
Sbjct: 1179 P--QGP-TGSEGTPGLPGGVGQPGAVGEKGER--GDAGDPGPPGAPG----------IPG 1223

Query: 1057 QKNRLREYDFASESEEDEQPPPRG-PGFRGRRGR-GEKRKEVELTQGPREDEPQKPRKAA 1114
             K  + E   +  S     P  +G PG  G +G  G      +L  GP  D        +
Sbjct: 1224 PKGDIGEKGDSGPSGAAGPPGKKGPPGEDGAKGSVGPTGLPGDL--GPPGDPGVSGIDGS 1281

Query: 1115 RQEAGGDGAPANPEEPGGS-RPGPGRSPQARGPS-------RSLETGAAAREG------- 1159
              E G  G    P  PG S  PG    P  RGPS       R  E GA    G       
Sbjct: 1282 PGEKGDPGDVGGPGPPGASGEPGAPGPPGKRGPSGHMGREGREGEKGAKGEPGPDGPPGR 1341

Query: 1160 -GPKCADRP--SVAPKDPLQVPTNT-ETSEETRPSLDFPQEAKEPETAEESAPDSTEFTE 1215
             GP  A  P   V P+    +P    E      P    P     P        D+    E
Sbjct: 1342 TGPMGARGPPGRVGPEGLRGIPGPVGEPGLLGAPGQMGPPGPLGPSGLPGLKGDTGPKGE 1401

Query: 1216 -------ALRSPPAACAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTP 1268
                    L  PP   AGE G   GL   + PP  + D G P P GSL +  P      P
Sbjct: 1402 KGHIGLIGLIGPPGE-AGEKG-DQGLPGVQGPPGPKGDPGPPGPIGSLGHPGP------P 1453

Query: 1269 GVGSLLGGPGGTQAPVSHNSKDP--PARQPGEFLAP 1302
            GV   LG  G   +P S   +    PA  PG   AP
Sbjct: 1454 GVAGPLGQKGSKGSPGSMGPRGDTGPAGPPGPPGAP 1489



 Score = 75.9 bits (185), Expect = 8e-13
 Identities = 226/908 (24%), Positives = 283/908 (31%), Gaps = 196/908 (21%)

Query: 2    PGER----PRGAPPPT-------MTGDLQPRQVASSPGHPSQPPLEDNTPATRT------ 44
            PG R    PRG+P PT       + G    +     PG P  P  + N  +         
Sbjct: 598  PGPRGLLGPRGSPGPTGRPGVTGIDGAPGAKGNVGPPGEPGPPGQQGNHGSQGLPGPQGL 657

Query: 45   --TKGAREAGGQAQAMELPEAQPRQARDGELKPPSLRGQ-------APSSTPGKRGSPQT 95
              T G +   G      LP +       G   P   +G         P   PG RG   T
Sbjct: 658  IGTPGEKGPPGNPGIPGLPGSDGPLGHPGHEGPTGEKGAQGPPGSAGPPGYPGPRGVKGT 717

Query: 96   PPGRSPLQAPSRLAGRAEGSPPQRYILGIASSRTKPTL-----DETPENPQLEAAQLPEV 150
               R  LQ      G  +G P  +  +G+   + KP       ++ PE P+ +A Q  E 
Sbjct: 718  SGNRG-LQGEKGEKGE-DGFPGFKGDVGLKGDQGKPGAPGPRGEDGPEGPKGQAGQAGEE 775

Query: 151  DTPQGPGTGAPLR-PGLPRTEAQPAAE-ELGFHRCFQEPPSSFTSTNYTSPSATPRPPA- 207
              P   G    L  PGLP    +P  +  +GF       P           S     P  
Sbjct: 776  GPPGSAGEKGKLGVPGLPGYPGRPGPKGSIGF-------PGPLGPIGEKGKSGKTGQPGL 828

Query: 208  ---PGPPQSRGT-----SPLQPGSYPEYQASGADSWPPAAENSFPGAN----FGVPPAEP 255
                GPP SRG      +  QPG   +    GA   P   E   PG      F  P   P
Sbjct: 829  EGERGPPGSRGERGQPGATGQPGPKGDVGQDGAPGIP--GEKGLPGLQGPPGFPGPKGPP 886

Query: 256  EPIPKGSRPG--GSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAW 313
                K  RPG  G    + FQ       G +  P PA V G              PQG  
Sbjct: 887  GHQGKDGRPGHPGQRGELGFQ-------GQTGPPGPAGVLG--------------PQGK- 924

Query: 314  PEEAVGTGPAYPLPTQPAPSPL--PCYQGQPGGLNRHSDLSGALSSPG--------AAHS 363
                  TG   PL  +  P P   P  QG PG L       G L  PG            
Sbjct: 925  ------TGEVGPLGERGPPGPPGPPGEQGLPG-LEGREGAKGELGPPGPLGKEGPAGLRG 977

Query: 364  APRPFSDSLHKSLTKILPERPPSAQDGLGST---RGPPSSLPQRHFPGQAYRASGVDTSP 420
             P P         T +  ++ P    G   +   RGP         PGQ    SG +   
Sbjct: 978  FPGPKGGPGDPGPTGLKGDKGPPGPVGANGSPGERGPLGPAGGIGLPGQ----SGSEGPV 1033

Query: 421  GPPDT-----ELAAPGPP-----PARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPS- 469
            GP        E   PGP      P  L  L  P AA       GP          G P  
Sbjct: 1034 GPAGKKGSRGERGPPGPTGKDGIPGPLGPLGPPGAA-------GPSGEEGDKGDVGAPGH 1086

Query: 470  PGQRLCLPQSAPLPWPQVL-PTARPSPHGMEMLSRLPFPAG--GPEWQGGSQGALGTAGK 526
             G +     + P   P +  P   P P G +       P G  G +   G +G +G  G 
Sbjct: 1087 KGSKGDKGDAGPPGQPGIRGPAGHPGPPGADGAQGRRGPPGLFGQKGDDGVRGFVGVIGP 1146

Query: 527  T--------PGPREKLPAVRS-SQGGSPALFTYNGMTDPGAQP-LFFGVAQPQV------ 570
                     PG + ++  V S    G+P      G T     P L  GV QP        
Sbjct: 1147 PGLQGLPGPPGEKGEVGDVGSMGPHGAPGPRGPQGPTGSEGTPGLPGGVGQPGAVGEKGE 1206

Query: 571  -------SPHGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEES 623
                    P G P +P P+       +S  PS A    G       P     A  S   +
Sbjct: 1207 RGDAGDPGPPGAPGIPGPKGDIGEKGDSG-PSGAAGPPGKK----GPPGEDGAKGSVGPT 1261

Query: 624  QLPGPLGP------SAFFHPPTH---PQETGSPFP--------SPEPPHSL-PTHYQ--- 662
             LPG LGP      S     P     P + G P P        +P PP    P+ +    
Sbjct: 1262 GLPGDLGPPGDPGVSGIDGSPGEKGDPGDVGGPGPPGASGEPGAPGPPGKRGPSGHMGRE 1321

Query: 663  ----PEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPE--------VGRGGLQGFP-RAP 709
                 + AK  P P    G  G        P    GPE        VG  GL G P +  
Sbjct: 1322 GREGEKGAKGEPGPDGPPGRTGPMGA--RGPPGRVGPEGLRGIPGPVGEPGLLGAPGQMG 1379

Query: 710  PPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPG 769
            PP P     L     D      T  + ++ +  L   +      G    +   G Q  PG
Sbjct: 1380 PPGPLGPSGLPGLKGD------TGPKGEKGHIGLIGLIGPPGEAGEKGDQGLPGVQGPPG 1433

Query: 770  PPGLPSPP 777
            P G P PP
Sbjct: 1434 PKGDPGPP 1441



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 241/1074 (22%), Positives = 329/1074 (30%), Gaps = 210/1074 (19%)

Query: 466  GQPS---PGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQG--GSQGA 520
            G+P+    GQ+   P  AP P   V P+  P P G       P PAG P   G  G +G 
Sbjct: 379  GEPAVIEKGQQFEGPPGAPGPQGVVGPSGPPGPPGFPGDPGPPGPAGLPGIPGIDGIRGP 438

Query: 521  LGTAGKTP----GPREKLPAVRSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTP 576
             GT    P    G   K P V   Q  + A+     ++  G         +P   P G P
Sbjct: 439  PGTVIMMPFQFAGGSFKGPPVSFQQAQAQAVLQQTQLSMKGPPGPVGLTGRP--GPVGLP 496

Query: 577  SLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFH 636
                P + G   +E P               +  M    A+ +       GP G   F  
Sbjct: 497  G--HPGLKGEEGAEGPQGPRGLQGPHGPPGRVGKMGRPGADGARGLPGDTGPKGDRGFDG 554

Query: 637  PPTHPQETGSP-----FPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFP 691
             P  P E G          P PP          P    P P    G  G    L     P
Sbjct: 555  LPGLPGEKGQRGDFGHVGQPGPPGEDGERGAEGP----PGPTGQAGEPGPRGLLGPRGSP 610

Query: 692  HEGPEVGRGGLQGFPRA-----PPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAF 746
                  G  G+ G P A     PP  P                                 
Sbjct: 611  GPTGRPGVTGIDGAPGAKGNVGPPGEP--------------------------------- 637

Query: 747  LAHRQFCGLLLARAKDGHQRSPGP------PGLPSPPAAPRVPA-DAHAGLLSHAKTFLL 799
                   G    +   G Q  PGP      PG   PP  P +P      G L H      
Sbjct: 638  -------GPPGQQGNHGSQGLPGPQGLIGTPGEKGPPGNPGIPGLPGSDGPLGHPGHEGP 690

Query: 800  AGDAQAEGKDDPLRTGFLPSLAATP-FPLPASDLDMEDDAKLDSLITEALNGMEYQSDNP 858
             G+  A+G          P  A  P +P P        +  L     +   G + +   P
Sbjct: 691  TGEKGAQGP---------PGSAGPPGYPGPRGVKGTSGNRGL-----QGEKGEKGEDGFP 736

Query: 859  EIDSSFIDVFADE-EPS--GPRGPSSGHPLKSKAGVTPESKAPPPLPAATPDPQTPRPGD 915
                  + +  D+ +P   GPRG       K +AG   E   P    +A    +   PG 
Sbjct: 737  GFKGD-VGLKGDQGKPGAPGPRGEDGPEGPKGQAGQAGEEGPPG---SAGEKGKLGVPGL 792

Query: 916  RGCPARGRPKTRSLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRA 975
             G P R  PK  S+G          +G+  + G+                          
Sbjct: 793  PGYPGRPGPKG-SIGFPGPLGPIGEKGKSGKTGQP------------------------- 826

Query: 976  SGLRPRRNDGLGERPPPRPRRPRTQAPGSRADPAPR----VPRAAALPEETRSSRRRRLP 1031
             GL        GER PP  R  R Q PG+   P P+       A  +P E      +  P
Sbjct: 827  -GLE-------GERGPPGSRGERGQ-PGATGQPGPKGDVGQDGAPGIPGEKGLPGLQGPP 877

Query: 1032 PRKDPRKRKARGGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRGPGFRGRRGR-G 1090
                P+      G  G+           +  E  F  ++      PP   G  G +G+ G
Sbjct: 878  GFPGPKGPPGHQGKDGRP------GHPGQRGELGFQGQTG-----PPGPAGVLGPQGKTG 926

Query: 1091 EKRKEVELTQGPR-----EDEPQKPRKAARQEAGGDGAPANP---EEPGGSR--PGPGRS 1140
            E     E  +GP        E   P    R+ A G+  P  P   E P G R  PGP   
Sbjct: 927  EVGPLGE--RGPPGPPGPPGEQGLPGLEGREGAKGELGPPGPLGKEGPAGLRGFPGPKGG 984

Query: 1141 PQARGPSRSL----ETGAAAREGGPKCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQE 1196
            P   GP+         G     G P   +R  + P   + +P  + +     P+      
Sbjct: 985  PGDPGPTGLKGDKGPPGPVGANGSP--GERGPLGPAGGIGLPGQSGSEGPVGPA------ 1036

Query: 1197 AKEPETAEESAPDSTEFTEALRSPPAACAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSL 1256
             K+    E   P  T   + +  P     G +G  PG   P      + D G P   GS 
Sbjct: 1037 GKKGSRGERGPPGPTG-KDGIPGP----LGPLGP-PGAAGPSGEEGDKGDVGAPGHKGSK 1090

Query: 1257 ANTAPHGSSPTPGVGSLLGGPGGTQAPVSHNSKDPPA--RQPGE-----FLAPVANPSST 1309
             +    G    PG+    G PG   A  +   + PP    Q G+     F+  +  P   
Sbjct: 1091 GDKGDAGPPGQPGIRGPAGHPGPPGADGAQGRRGPPGLFGQKGDDGVRGFVGVIGPPGLQ 1150

Query: 1310 ACPKPSVLSSKISSFGCDPAGFNRDPLGVPVAKKGPQ-PYSSPHSELFLGPKDLAGCFLE 1368
              P P     ++   G      +  P G P   +GPQ P  S  +    G     G   E
Sbjct: 1151 GLPGPPGEKGEVGDVG------SMGPHGAP-GPRGPQGPTGSEGTPGLPGGVGQPGAVGE 1203

Query: 1369 ELHPKPSARDAPPASSSCLCQDGE--DAGSLEPQLPRSPPGTAETEPGRAASPPTLESSS 1426
            +     +    PP +       G+  + G   P     PPG  +  PG   +  ++  + 
Sbjct: 1204 KGERGDAGDPGPPGAPGIPGPKGDIGEKGDSGPSGAAGPPG-KKGPPGEDGAKGSVGPTG 1262

Query: 1427 LFPDL--------------PVDRFDPPLYGSLSANRDSGLPFACADPPQKTVPS 1466
            L  DL              P ++ DP   G       SG P A   PP K  PS
Sbjct: 1263 LPGDLGPPGDPGVSGIDGSPGEKGDPGDVGGPGPPGASGEPGA-PGPPGKRGPS 1315



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 94/359 (26%), Positives = 128/359 (35%), Gaps = 41/359 (11%)

Query: 3543 LDGALERPENEASPGSPGPLLQQALPLGASLPRPGARGQDA-EGKRAPLVFSGKRRAPGA 3601
            L G   RP  + S G PGPL     P+G    + G  GQ   EG+R P    G+R  PGA
Sbjct: 792  LPGYPGRPGPKGSIGFPGPLG----PIGEK-GKSGKTGQPGLEGERGPPGSRGERGQPGA 846

Query: 3602 RGRCAP--DHFQEDHL-LQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSAA 3658
             G+  P  D  Q+    +  EK +         GP G    G    P       +     
Sbjct: 847  TGQPGPKGDVGQDGAPGIPGEKGLPGLQ-----GPPG--FPGPKGPPGHQGKDGRPGHPG 899

Query: 3659 STPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTKTGG 3718
                   +    P    G L P    +G    + P   +  PGP         PG +   
Sbjct: 900  QRGELGFQGQTGPPGPAGVLGP----QGKTGEVGPLGERGPPGPPGPPGEQGLPGLEGRE 955

Query: 3719 GSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPREA-GEQGPHGSL 3777
            G     A G+L          P+     P P+  P          GP    G++GP G +
Sbjct: 956  G-----AKGELGPPGPLGKEGPAGLRGFPGPKGGPG-------DPGPTGLKGDKGPPGPV 1003

Query: 3778 G----PKEKGESSTKRKKGQVPGPARSES-VGSFGRAPSAPDK-PPRTPRKQATPSRVLP 3831
            G    P E+G        G +PG + SE  VG  G+  S  ++ PP    K   P  + P
Sbjct: 1004 GANGSPGERGPLGPAGGIG-LPGQSGSEGPVGPAGKKGSRGERGPPGPTGKDGIPGPLGP 1062

Query: 3832 TKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPPKRGTAVHGAEPAE 3890
              P P +         +     PGH   K   G A P G+P +R P       GA+ A+
Sbjct: 1063 LGP-PGAAGPSGEEGDKGDVGAPGHKGSKGDKGDAGPPGQPGIRGPAGHPGPPGADGAQ 1120



 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 133/534 (24%), Positives = 178/534 (33%), Gaps = 74/534 (13%)

Query: 3413 LRGGRQPFAFRGVR-RPGA---PGQKARALEGTLPSKRRRVAMPG-----SAPGP----- 3458
            L G R P   RG R +PGA   PG K    +   P       +PG       PGP     
Sbjct: 828  LEGERGPPGSRGERGQPGATGQPGPKGDVGQDGAPGIPGEKGLPGLQGPPGFPGPKGPPG 887

Query: 3459 --GED----RPPPRGSSPILSEGSLPALLHLCS------EVAPSTTKGWPETLERPVDPV 3506
              G+D     P  RG      +   P    +        EV P   +G P     P +  
Sbjct: 888  HQGKDGRPGHPGQRGELGFQGQTGPPGPAGVLGPQGKTGEVGPLGERGPPGPPGPPGEQG 947

Query: 3507 THPIRGCELPSNHQECPPPSLSPFPAALADGRGDCALDGALERPENEASPGSPGPLLQQA 3566
               + G E        P P     PA L    G     G       +   G PGP+    
Sbjct: 948  LPGLEGREGAKGELGPPGPLGKEGPAGLRGFPGPKGGPGDPGPTGLKGDKGPPGPVGANG 1007

Query: 3567 LP--LGASLPRPGARGQDAEGKRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSS 3624
             P   G   P  G       G   P+  +GK+ + G RG   P    +D +      +  
Sbjct: 1008 SPGERGPLGPAGGIGLPGQSGSEGPVGPAGKKGSRGERGPPGPTG--KDGIPGPLGPLGP 1065

Query: 3625 SHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSAASTPSK-ALKFPV-HPRKAVGSLA--- 3679
                   G  G   KG    P G + S  D+  A  P +  ++ P  HP       A   
Sbjct: 1066 PGAAGPSGEEGD--KGDVGAP-GHKGSKGDKGDAGPPGQPGIRGPAGHPGPPGADGAQGR 1122

Query: 3680 ---PGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETATT 3736
               PG   +  ++G++       P P  QG   P PG K   G       G +    A  
Sbjct: 1123 RGPPGLFGQKGDDGVRGFVGVIGP-PGLQGLPGP-PGEKGEVGDV-----GSMGPHGAPG 1175

Query: 3737 PAKPSFPSRSPAPERLPARAQAKSCT--KGPR-EAGEQGPHGSLG---PK----EKGESS 3786
            P  P  P+ S     LP           KG R +AG+ GP G+ G   PK    EKG+S 
Sbjct: 1176 PRGPQGPTGSEGTPGLPGGVGQPGAVGEKGERGDAGDPGPPGAPGIPGPKGDIGEKGDSG 1235

Query: 3787 TKRKKGQVPG----PARSESVGSFGRAPSAPDKPPR----------TPRKQATPSRVLPT 3832
                 G  PG    P    + GS G      D  P           +P ++  P  V   
Sbjct: 1236 PSGAAGP-PGKKGPPGEDGAKGSVGPTGLPGDLGPPGDPGVSGIDGSPGEKGDPGDVGGP 1294

Query: 3833 KPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPPKRGTAVHGA 3886
             P P +  +P  P    ++   GH  R+ R G+   +G P    P   T   GA
Sbjct: 1295 GP-PGASGEPGAPGPPGKRGPSGHMGREGREGEKGAKGEPGPDGPPGRTGPMGA 1347



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 125/475 (26%), Positives = 159/475 (33%), Gaps = 87/475 (18%)

Query: 3428 PGAPGQKAR-ALEGTLPSKRRRVAMPGSAPG-------PGED--RPPPRGSSPILSEG-- 3475
            PG PG K     EG  P   R +  P   PG       PG D  R  P  + P    G  
Sbjct: 496  PGHPGLKGEEGAEG--PQGPRGLQGPHGPPGRVGKMGRPGADGARGLPGDTGPKGDRGFD 553

Query: 3476 SLPALLHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNH-----QECPPPSLSPF 3530
             LP L            +G    + +P  P     RG E P        +  P   L P 
Sbjct: 554  GLPGL------PGEKGQRGDFGHVGQPGPPGEDGERGAEGPPGPTGQAGEPGPRGLLGPR 607

Query: 3531 PAALADGR-GDCALDGALERPENEASPGSPGPLLQQALPLGASLPRP-GARGQDAEGKRA 3588
             +    GR G   +DGA     N   PG PGP  QQ       LP P G  G    G++ 
Sbjct: 608  GSPGPTGRPGVTGIDGAPGAKGNVGPPGEPGPPGQQGNHGSQGLPGPQGLIG--TPGEKG 665

Query: 3589 PLVFSGKRRAPGARGRCA-PDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAG 3647
            P    G    PG+ G    P H         +    S+      GPRG   KG++    G
Sbjct: 666  PPGNPGIPGLPGSDGPLGHPGHEGPTGEKGAQGPPGSAGPPGYPGPRGV--KGTSGN-RG 722

Query: 3648 CQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGS 3707
             Q    ++     P                   G++    + G KP      PGP  +  
Sbjct: 723  LQGEKGEKGEDGFPG----------------FKGDVGLKGDQG-KPGA----PGPRGE-D 760

Query: 3708 GSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERL--------PARAQAK 3759
            G   P  + G   +  P     +      P  P +P R P P+          P   + K
Sbjct: 761  GPEGPKGQAGQAGEEGPPGSAGEKGKLGVPGLPGYPGR-PGPKGSIGFPGPLGPIGEKGK 819

Query: 3760 SCTKG-PREAGEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPPR 3818
            S   G P   GE+GP GS     +GE       GQ PGP     VG  G AP  P +   
Sbjct: 820  SGKTGQPGLEGERGPPGS-----RGERGQPGATGQ-PGP--KGDVGQDG-APGIPGE--- 867

Query: 3819 TPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRK-AEPGHTQRKDRLGKAFPQGRP 3872
                     + LP    P     P+ PP  Q K   PGH  ++  LG     G P
Sbjct: 868  ---------KGLPGLQGPPGFPGPKGPPGHQGKDGRPGHPGQRGELGFQGQTGPP 913



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 281/1166 (24%), Positives = 358/1166 (30%), Gaps = 216/1166 (18%)

Query: 1633 PASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQPVQKAGASKTGLCQAEGDSRPPQDV 1692
            P SF    A  +   Q  L    P  P G      PV   G    GL   EG   P    
Sbjct: 458  PVSFQQAQAQAV-LQQTQLSMKGPPGPVGLTGRPGPVGLPG--HPGLKGEEGAEGPQGPR 514

Query: 1693 CLPEPSKQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRLLPCE--QRGGFLP 1750
             L  P   PG     G + +   D     P +          D L  LP E  QRG F  
Sbjct: 515  GLQGPHGPPGR---VGKMGRPGADGARGLPGDT-GPKGDRGFDGLPGLPGEKGQRGDF-- 568

Query: 1751 EPGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPSHAAQGHSAGR 1810
                    H G P P                +G   PP     P G +     +G    R
Sbjct: 569  -------GHVGQPGPPGEDGE----------RGAEGPP----GPTGQAGEPGPRGLLGPR 607

Query: 1811 AGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPACVSNTHPSRRSQDPAL 1870
              G   PT GRPG  G + AP GA     P G        P P      H S+      L
Sbjct: 608  --GSPGPT-GRPGVTGIDGAP-GAKGNVGPPGE-------PGPPGQQGNHGSQ-----GL 651

Query: 1871 SPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNPSGLEGGTVEGGKVACGPAQGS 1930
              P   +  PG        GI GL    P +  P  +   G EG T E G      + G 
Sbjct: 652  PGPQGLIGTPGEKGPPGNPGIPGL----PGSDGP--LGHPGHEGPTGEKGAQGPPGSAGP 705

Query: 1931 PGGVQVTTLPAVAGHQLGLEAD-------------GHWGLLGQAEKTQGQGTANQLQPEN 1977
            PG      +   +G++ GL+ +             G  GL G   K    G   +  PE 
Sbjct: 706  PGYPGPRGVKGTSGNR-GLQGEKGEKGEDGFPGFKGDVGLKGDQGKPGAPGPRGEDGPEG 764

Query: 1978 GVSPGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPTPSPPSPNRES 2037
               P G    A     P +A      G   L    G          +   P P  P  E 
Sbjct: 765  ---PKGQAGQAGEEGPPGSAGEKGKLGVPGLPGYPGRPGPKG----SIGFPGPLGPIGEK 817

Query: 2038 LALALTAAHSRSGSEGRTPERAS--SPGLNKPLLATGDSPAPSVGDLAAC-APSPTSAAH 2094
                 T      G  G    R     PG      ATG  P P  GD+    AP       
Sbjct: 818  GKSGKTGQPGLEGERGPPGSRGERGQPG------ATGQ-PGPK-GDVGQDGAPGIPGEKG 869

Query: 2095 MPCSLGPLPREDPLTSPSRAQGGLGGQLPASPSCRD---------PPGPQQLLACSPAWA 2145
            +P   GP     P   P     G  G+ P  P  R          PPGP  +L       
Sbjct: 870  LPGLQGPPGFPGPKGPPGHQ--GKDGR-PGHPGQRGELGFQGQTGPPGPAGVLG------ 920

Query: 2146 PLEEADGVQATTDTGAEDSPVAPPSLTTSPCDPKEALAGCLLQGEGSPLEDPSSWPPGSV 2205
            P  +   V    + G    P  P        + +E   G L  G   PL       P  +
Sbjct: 921  PQGKTGEVGPLGERGPPGPPGPPGEQGLPGLEGREGAKGEL--GPPGPLGKEG---PAGL 975

Query: 2206 SAVTCTHSGDTPKDSTLRIPEDSRKEKLWESP-GRATSPPLAGAVSPSVAVRATGLSST- 2263
                    G  P D     P   + +K    P G   SP   G + P+  +   G S + 
Sbjct: 976  RGFPGPKGG--PGDPG---PTGLKGDKGPPGPVGANGSPGERGPLGPAGGIGLPGQSGSE 1030

Query: 2264 ----PTGDEAQAG-RGLPGPDPQSRGAPPHTNPDRMPRGHSSYSPS-------NTARLGH 2311
                P G +   G RG PGP  +  G P    P   P    +  PS       +    GH
Sbjct: 1031 GPVGPAGKKGSRGERGPPGPTGKD-GIPGPLGPLGPP---GAAGPSGEEGDKGDVGAPGH 1086

Query: 2312 R--EGQAVTAVPTEPPTLQG-AGPDSPACLEGEMGTSSKEPEDPGT-PETGRSGATKMPR 2367
            +  +G    A P   P ++G AG   P   +G  G        PG   + G  G      
Sbjct: 1087 KGSKGDKGDAGPPGQPGIRGPAGHPGPPGADGAQGRRGP----PGLFGQKGDDGVRGFVG 1142

Query: 2368 VTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRNASHQTPQGDPLGPQDLKQRSRGYKKKP 2427
            V  P    GL           D  S  P  H     + PQG P G +       G  +  
Sbjct: 1143 VIGPPGLQGLPGPPGEKGEVGDVGSMGP--HGAPGPRGPQG-PTGSEGTPGLPGGVGQPG 1199

Query: 2428 ASTENGQWKGQAPHGPVTCEVCAA-------SFRSGP-GLSRHKARKHRP-HPGAPAEPS 2478
            A  E G+       GP                  SGP G +    +K  P   GA     
Sbjct: 1200 AVGEKGERGDAGDPGPPGAPGIPGPKGDIGEKGDSGPSGAAGPPGKKGPPGEDGAKGSVG 1259

Query: 2479 PAALPAQQPLEPLAQKCQPPRKKSHRVSGKERPNHSRGDPSHVTQPPPAQGSKEVLRAPG 2538
            P  LP             PP      VSG +     +GDP  V  P P   S E   APG
Sbjct: 1260 PTGLPGD---------LGPPGDPG--VSGIDGSPGEKGDPGDVGGPGPPGASGEP-GAPG 1307

Query: 2539 SPHSQQLHPPSPTEHEVDVKTPASKPRPDQAREDELHPKQAEKREGRRWRR-EPTVDSPS 2597
             P  +      P+ H                          E REG +  + EP  D P 
Sbjct: 1308 PPGKR-----GPSGH-----------------------MGREGREGEKGAKGEPGPDGP- 1338

Query: 2598 HSEGKSNKKRGKLRGRRLREESILPVSADVISDGRGSRPSPAMASYAASPSHCLSVEG-- 2655
               G++     +    R+  E +  +   V   G    P          PS    ++G  
Sbjct: 1339 --PGRTGPMGARGPPGRVGPEGLRGIPGPVGEPGLLGAPGQMGPPGPLGPSGLPGLKGDT 1396

Query: 2656 GPEADGEQPPRLATLGPGVMEGAAETDQEALCAGETGAQKPPGDR--MLCPGRMDGAALG 2713
            GP+ +      +  +GP   E   + DQ     G  G Q PPG +     PG +   +LG
Sbjct: 1397 GPKGEKGHIGLIGLIGP-PGEAGEKGDQ-----GLPGVQGPPGPKGDPGPPGPI--GSLG 1448

Query: 2714 EQ-------PTGQKGA-SARGFWGPR 2731
                     P GQKG+  + G  GPR
Sbjct: 1449 HPGPPGVAGPLGQKGSKGSPGSMGPR 1474



 Score = 40.8 bits (94), Expect = 0.027
 Identities = 106/459 (23%), Positives = 143/459 (31%), Gaps = 72/459 (15%)

Query: 1683 EGDSRPPQDVCLPEPSKQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRLLPC 1742
            +GD+ PP    +  P+  PGP    G+  +  P               Q+ +D +R    
Sbjct: 1093 KGDAGPPGQPGIRGPAGHPGPPGADGAQGRRGP----------PGLFGQKGDDGVRGFV- 1141

Query: 1743 EQRGGFLPEPGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPSHA 1802
                G +  PG      +G P P            +    GD    + +  P GA     
Sbjct: 1142 ----GVIGPPGL-----QGLPGPPG----------EKGEVGD----VGSMGPHGAPGPRG 1178

Query: 1803 AQGHSAGRAGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPACVSNTHPS 1862
             QG +       L    G+PG  G E    G +    P G      P        ++ PS
Sbjct: 1179 PQGPTGSEGTPGLPGGVGQPGAVG-EKGERGDAGDPGPPGAPGIPGPKGDIGEKGDSGPS 1237

Query: 1863 RRSQDPALSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPP-RVNPSGLEGGTVEGGK 1921
              +  P    P      PG   AK   G  GL    P    PP     SG++G   E G 
Sbjct: 1238 GAAGPPGKKGP------PGEDGAKGSVGPTGL----PGDLGPPGDPGVSGIDGSPGEKGD 1287

Query: 1922 VACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTANQLQPENGVSP 1981
                   G PG       P   G +      GH G  G+  +   +G      P     P
Sbjct: 1288 PGDVGGPGPPGASGEPGAPGPPGKR---GPSGHMGREGREGEKGAKGEPGPDGPPGRTGP 1344

Query: 1982 -GGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPTPSP-----PSPNR 2035
             G       V       + GP     LL    G+   M       P+  P       P  
Sbjct: 1345 MGARGPPGRVGPEGLRGIPGPVGEPGLL----GAPGQMGPPGPLGPSGLPGLKGDTGPKG 1400

Query: 2036 ESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGD-SPAPSVGDLAACAPSPTSAAH 2094
            E   + L       G  G   ++   PG+  P    GD  P   +G L    P P   A 
Sbjct: 1401 EKGHIGLIGLIGPPGEAGEKGDQ-GLPGVQGPPGPKGDPGPPGPIGSLG--HPGPPGVA- 1456

Query: 2095 MPCSLGPLPREDPLTSPSRAQGGLGGQLPASPSCRDPPG 2133
                 GPL ++    SP  + G  G   PA P    PPG
Sbjct: 1457 -----GPLGQKGSKGSPG-SMGPRGDTGPAGPP--GPPG 1487



 Score = 40.0 bits (92), Expect = 0.046
 Identities = 35/118 (29%), Positives = 41/118 (34%), Gaps = 13/118 (11%)

Query: 3187 PGGLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPG-----DPWGQEGEAKKDSPGE 3241
            P G  GS     L   + +P     +G+R      G PG      P G  GE     P  
Sbjct: 1179 PQGPTGSEGTPGLPGGVGQPGAVGEKGERGDAGDPGPPGAPGIPGPKGDIGEKGDSGPSG 1238

Query: 3242 RAKPRARSTPSNPDGAATPDSASATAL-ADAGSPGPPRT-----TPSPSPDPWAGGEP 3293
             A P  +  P   DGA    S   T L  D G PG P       +P    DP   G P
Sbjct: 1239 AAGPPGKKGPPGEDGA--KGSVGPTGLPGDLGPPGDPGVSGIDGSPGEKGDPGDVGGP 1294



 Score = 39.3 bits (90), Expect = 0.078
 Identities = 137/542 (25%), Positives = 175/542 (32%), Gaps = 134/542 (24%)

Query: 3452 PGSAPGPGE--------DRPPPRGSSPILSEGSLPALLHLCSEVAPSTTKGWP--ETLER 3501
            PG   GPG+        D+ PP    P+ + GS          + P+   G P     E 
Sbjct: 979  PGPKGGPGDPGPTGLKGDKGPP---GPVGANGSPGER----GPLGPAGGIGLPGQSGSEG 1031

Query: 3502 PVDPV----THPIRGCELPSNHQECPPP--SLSPFPAALADGR-GDCALDGALERPENEA 3554
            PV P     +   RG   P+     P P   L P  AA   G  GD    GA     ++ 
Sbjct: 1032 PVGPAGKKGSRGERGPPGPTGKDGIPGPLGPLGPPGAAGPSGEEGDKGDVGAPGHKGSKG 1091

Query: 3555 SPGSPGPLLQQAL--PLGASLPRPGARGQDAEGKRAPLVFSGKRRAPGARGRCA---PDH 3609
              G  GP  Q  +  P G   P PGA G  A+G+R P    G++   G RG      P  
Sbjct: 1092 DKGDAGPPGQPGIRGPAGHPGP-PGADG--AQGRRGPPGLFGQKGDDGVRGFVGVIGPPG 1148

Query: 3610 FQEDHLLQKEK----EVSSSHMVSEGGPRG----TFHKGSATKPAGC-------QSSSKD 3654
             Q       EK    +V S       GPRG    T  +G+   P G        +   + 
Sbjct: 1149 LQGLPGPPGEKGEVGDVGSMGPHGAPGPRGPQGPTGSEGTPGLPGGVGQPGAVGEKGERG 1208

Query: 3655 RSAASTPSKALKFPVHPRKAVGSLA----------PGELARGTENGMKPAT-PKAKPG-- 3701
             +    P  A   P  P+  +G             PG+     E+G K +  P   PG  
Sbjct: 1209 DAGDPGPPGAPGIP-GPKGDIGEKGDSGPSGAAGPPGKKGPPGEDGAKGSVGPTGLPGDL 1267

Query: 3702 --PSSQG----SGSPRPGTKTG--GGSQPQPASGQLQSETATTPAKPSFPSR-------- 3745
              P   G     GSP      G  GG  P  ASG+        P  P  P +        
Sbjct: 1268 GPPGDPGVSGIDGSPGEKGDPGDVGGPGPPGASGE--------PGAPGPPGKRGPSGHMG 1319

Query: 3746 ------------SPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPKEKGESSTKRKKGQ 3793
                         P P+  P R         P   G +G  G  GP   GE       GQ
Sbjct: 1320 REGREGEKGAKGEPGPDGPPGRTGPMGARGPPGRVGPEGLRGIPGP--VGEPGLLGAPGQ 1377

Query: 3794 V--PGPARSES-------------------VGSFGRAPSAPDKPPR-TPRKQATPS-RVL 3830
            +  PGP                        +G  G    A +K  +  P  Q  P  +  
Sbjct: 1378 MGPPGPLGPSGLPGLKGDTGPKGEKGHIGLIGLIGPPGEAGEKGDQGLPGVQGPPGPKGD 1437

Query: 3831 PTKPKP-NSQNKPRPP----PSEQR--KAEPGHTQRKDRLGKAFPQGRPLLRPPKRGTAV 3883
            P  P P  S   P PP    P  Q+  K  PG    +   G A P G     PP     +
Sbjct: 1438 PGPPGPIGSLGHPGPPGVAGPLGQKGSKGSPGSMGPRGDTGPAGPPG-----PPGAPAEL 1492

Query: 3884 HG 3885
            HG
Sbjct: 1493 HG 1494



 Score = 33.5 bits (75), Expect = 4.3
 Identities = 64/280 (22%), Positives = 85/280 (30%), Gaps = 33/280 (11%)

Query: 3635 GTFHKGSATKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPA 3694
            G   KG+  +PA  +   +       P         P+  VG   P     G      P 
Sbjct: 371  GAGEKGAKGEPAVIEKGQQFEGPPGAPG--------PQGVVGPSGPPG-PPGFPGDPGPP 421

Query: 3695 TPKAKPG-PSSQGSGSPRPGTK-------TGGGSQPQPASGQLQSETATTPAKPSFPSRS 3746
             P   PG P   G   P PGT         GG  +  P S Q     A            
Sbjct: 422  GPAGLPGIPGIDGIRGP-PGTVIMMPFQFAGGSFKGPPVSFQQAQAQAVLQQTQLSMKGP 480

Query: 3747 PAPERLPARAQAKSCTKGPREAGEQGPHGSLGPKE-KGESSTKRKKGQVPGPARSESVGS 3805
            P P  L  R         P   GE+G  G  GP+  +G      + G++  P    + G 
Sbjct: 481  PGPVGLTGRPGPVGLPGHPGLKGEEGAEGPQGPRGLQGPHGPPGRVGKMGRPGADGARGL 540

Query: 3806 FGRAPSAPDKP----PRTPRKQATPSRV----LPTKPKPNSQNKPRPPPSEQRKA-EPGH 3856
             G      D+     P  P ++           P  P  + +     PP    +A EPG 
Sbjct: 541  PGDTGPKGDRGFDGLPGLPGEKGQRGDFGHVGQPGPPGEDGERGAEGPPGPTGQAGEPGP 600

Query: 3857 TQRKDRLGKAFPQGRPLL-----RPPKRGTAVHGAEPAEP 3891
                   G   P GRP +      P  +G      EP  P
Sbjct: 601  RGLLGPRGSPGPTGRPGVTGIDGAPGAKGNVGPPGEPGPP 640



 Score = 33.5 bits (75), Expect = 4.3
 Identities = 54/185 (29%), Positives = 70/185 (37%), Gaps = 42/185 (22%)

Query: 2653 VEGGPEADGEQPPRLATLGPGVM--EGAAETDQEALCAGETGAQKPPGDRML--CPGRMD 2708
            ++G P A G   P      PG     G+          G  G + PPG+  +   PG  D
Sbjct: 621  IDGAPGAKGNVGPPGEPGPPGQQGNHGSQGLPGPQGLIGTPGEKGPPGNPGIPGLPGS-D 679

Query: 2709 GAALG----EQPTGQKGASAR-------GFWGPRETKALGVCKESGSEPAEDSSRAHSRS 2757
            G  LG    E PTG+KGA          G+ GPR     GV   SG+   +       + 
Sbjct: 680  GP-LGHPGHEGPTGEKGAQGPPGSAGPPGYPGPR-----GVKGTSGNRGLQGE-----KG 728

Query: 2758 EEGVWEENTPPLGPLGFPETSSSPADSTTSSCLQGLPDNPDTQGGVQGPEGPTPDASGSS 2817
            E+G  E+  P     GF        D       QG P  P  +G   GPEGP   A  + 
Sbjct: 729  EKG--EDGFP-----GFKGDVGLKGD-------QGKPGAPGPRGE-DGPEGPKGQAGQAG 773

Query: 2818 AKDPP 2822
             + PP
Sbjct: 774  EEGPP 778



 Score = 32.3 bits (72), Expect = 9.5
 Identities = 51/224 (22%), Positives = 71/224 (31%), Gaps = 41/224 (18%)

Query: 2276 PGPDPQSRGAPPHTNPDRMPRGHSSYSPSNTARLGHREGQAVTAVPTEPPTLQGAGPDSP 2335
            P      +G P    P R  +G            G ++ + +    + PP      PDS 
Sbjct: 229  PAATVAPQGEPETPRPRRKGKGKGRKKGRGRKGKGRKKNKEIWT--SSPP------PDSA 280

Query: 2336 ACLEGEMGTSSKEPEDPGTPETGRSGATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSP 2395
               E +  T   + E P          T  P V   +   GL  T    S   D  ++  
Sbjct: 281  ---ENQTSTDIPKTETPAP----NLPPTPTPLVVTSTVTTGLNATILERSLDPDSGTELG 333

Query: 2396 QSHRNASHQTPQGDP--LGPQ----DLKQRS----------RGYKKKPASTENGQWKGQA 2439
                 A+ +  +GD   +GP     +   R+          +G K +PA  E GQ     
Sbjct: 334  TLETKAAREDEEGDDSTMGPDFRAAEYPSRTQFQIFPGAGEKGAKGEPAVIEKGQQFEGP 393

Query: 2440 PHGPVTCEVCAASFRSGPGLSRHKARKHRPHPGAPAEPSPAALP 2483
            P  P    V   S   GP             PG P  P PA LP
Sbjct: 394  PGAPGPQGVVGPSGPPGPP----------GFPGDPGPPGPAGLP 427


>gi|239757130 PREDICTED: hypothetical protein FLJ22184 [Homo
           sapiens]
          Length = 855

 Score =  107 bits (266), Expect = 3e-22
 Identities = 159/608 (26%), Positives = 213/608 (35%), Gaps = 80/608 (13%)

Query: 144 AAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATP 203
           AA+ P + TP+ PG+  P  P  P      A   LG        P +  +      +   
Sbjct: 18  AARAPGLLTPRPPGSPRPPPPVTPA-----ALRVLGAAGAVGRKPLAERAGGIGGATIPE 72

Query: 204 RPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPAAENSFPGANFGVPPAEPEPIPKGSR 263
             P  GP +S GTS   P S P   ASG     P A+N+ PG     P + P      +R
Sbjct: 73  SAPRAGPTRSAGTSSRNPASRPP--ASGRGERAPPAKNTSPG-----PVSSPGRASGTTR 125

Query: 264 PGG-SPRGVSFQFPFPALHGAST---KPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVG 319
           PG    +G+          G +T   K           T+GP       P  A    A G
Sbjct: 126 PGPLGQKGLRISAEETVARGKATEAPKRSALSAGARRDTSGPTP-GTPSPAMARRSRAAG 184

Query: 320 TGPAYPLPTQPAPSPLPCYQGQPGGLNRHSDLS------GALSSPGAAHSAPRPFSDSLH 373
           T    P P  P+  P P  +G    ++  S+ S       A   P A     RP S SL 
Sbjct: 185 TEVGLPRPA-PSARPRPPTEGPRKSVSSASEHSTTEPSPAARRRPSAGGGLQRPASRSLS 243

Query: 374 KSLTKIL-PERP-PSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPG 431
            S T +  P R  PSA+   G+ R P      +    QA R   V     PP  + A   
Sbjct: 244 SSATPLSSPARSGPSAR---GTPRAPAHPSQPKPKGLQALRPPQVT----PPRKDAA--- 293

Query: 432 PPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPTA 491
                 P L   +++P  TP   P AA +S      P+      L      P    LP A
Sbjct: 294 ------PALGPLSSSPLATP--SPSAALQSQAPPTLPATPHSSSLTCQLATP----LPLA 341

Query: 492 RPSPHGMEMLSRLPFPAGGPEWQG----GSQGALGTAGKTPGPREKLPAVRSSQGGSPAL 547
            PSP     L  LP P   P  Q     GS     T    P P   L  + +    +P  
Sbjct: 342 PPSPSAPPSLQTLPSPPATPPSQATTSLGSPTLQATHSFLPSP--PLSPLATPPPQAPPA 399

Query: 548 FTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVG--------ASPSESPLPSPATN 599
                +  P + P     A P +SP  TPS   P  +         + P   P+ +P + 
Sbjct: 400 LALPPLQAPPSPP-----ASPPLSPLATPSPQAPNALAVHLLQAPFSPPPSPPVQAPFSP 454

Query: 600 TAGSTCS-SLSPMSSSPANPSSEESQLPG------PLGPSAFFHPPTHPQETGSPFPSPE 652
            A    S S +P S +P + ++   Q+P       P+ PSA   P   P     P    +
Sbjct: 455 PASPPVSPSATPPSQAPPSLAAPPLQVPPSPPASPPMSPSATPPPQAPPPLAAPPLQLAK 514

Query: 653 PPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPF------PHEGPEVGRGGLQGFP 706
           PP   P      P +A P P      +  F      P       P + P V    L   P
Sbjct: 515 PPPQAPPALATPPLQALPSPPASFPGQAPFSPSASLPMSPLATPPPQAPPVLAAPLLQVP 574

Query: 707 RAPPPYPT 714
            +PP  PT
Sbjct: 575 PSPPASPT 582



 Score =  102 bits (253), Expect = 1e-20
 Identities = 198/777 (25%), Positives = 256/777 (32%), Gaps = 170/777 (21%)

Query: 10  PPPTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQAME---------L 60
           P     G L PR     PG P  PP    TPA     GA  A G+    E         +
Sbjct: 17  PAARAPGLLTPRP----PGSPRPPP--PVTPAALRVLGAAGAVGRKPLAERAGGIGGATI 70

Query: 61  PEAQPRQA--RDGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQ 118
           PE+ PR    R       +   + P+S  G+R  P       P+ +P R +G     P  
Sbjct: 71  PESAPRAGPTRSAGTSSRNPASRPPASGRGERAPPAKNTSPGPVSSPGRASGTTRPGPLG 130

Query: 119 RYILGIASSRT--KPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAE 176
           +  L I++  T  +    E P+   L A    +   P  PGT +P      R     A  
Sbjct: 131 QKGLRISAEETVARGKATEAPKRSALSAGARRDTSGPT-PGTPSPAMARRSRA----AGT 185

Query: 177 ELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWP 236
           E+G  R               +PSA PRPP  GP +S  ++     + P           
Sbjct: 186 EVGLPR--------------PAPSARPRPPTEGPRKSVSSASEHSTTEPS---------- 221

Query: 237 PAAENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPADVAGHA 296
           PAA    P A  G+       +   + P  SP          A  G S +  P   A  +
Sbjct: 222 PAARRR-PSAGGGLQRPASRSLSSSATPLSSP----------ARSGPSARGTPRAPAHPS 270

Query: 297 FTNGPLVFAFHQPQGAWPEEAVGTGPAY-PLPTQPAPSPLPCYQGQPGGLNRHSDLSGAL 355
                 + A   PQ   P +     PA  PL + P  +P P               S AL
Sbjct: 271 QPKPKGLQALRPPQVTPPRK--DAAPALGPLSSSPLATPSP---------------SAAL 313

Query: 356 SSPGAAHSAPRPFSDSLHKSLTKILPERPPS--AQDGLGSTRGPPSSLPQRHFPGQAYRA 413
            S         P S SL   L   LP  PPS  A   L +   PP++ P      QA  +
Sbjct: 314 QSQAPPTLPATPHSSSLTCQLATPLPLAPPSPSAPPSLQTLPSPPATPPS-----QATTS 368

Query: 414 SGVDTS-------PGPPDTELAAPGP--PPA-RLPQLWDPTAAPYPTPPGGPLAATRSMF 463
            G  T        P PP + LA P P  PPA  LP L  P + P  +PP  PLA      
Sbjct: 369 LGSPTLQATHSFLPSPPLSPLATPPPQAPPALALPPLQAPPSPP-ASPPLSPLATPSPQA 427

Query: 464 FNG----------QPSPGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPF--PAGGP 511
            N            P P   +  P S P   P V P+A P       L+  P   P   P
Sbjct: 428 PNALAVHLLQAPFSPPPSPPVQAPFSPPAS-PPVSPSATPPSQAPPSLAAPPLQVPPSPP 486

Query: 512 EWQGGSQGALGTAGKTPGPREKLPAV-------RSSQGGSPALFT--YNGMTDPGA---- 558
                S  A      TP P+   P         +      PAL T     +  P A    
Sbjct: 487 ASPPMSPSA------TPPPQAPPPLAAPPLQLAKPPPQAPPALATPPLQALPSPPASFPG 540

Query: 559 QPLFFGVAQPQVSPHGTPSLPPPRVVGA----------------SPSESPLPSPATNTAG 602
           Q  F   A   +SP  TP    P V+ A                +P   P P P T+ +G
Sbjct: 541 QAPFSPSASLPMSPLATPPPQAPPVLAAPLLQVPPSPPASPTLQAPRRPPTPGPDTSVSG 600

Query: 603 STCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQE--------TGSPFPSPEPP 654
              +        P    S  S L GP          + P+E         G    SP P 
Sbjct: 601 PRLTLALAPGPPPPPSRSPSSTLSGPDLAGHSSSATSTPEELRGYDSGPEGGAAASPPPD 660

Query: 655 HSL--------------PTHYQPEPAKAFPF-PADGLGAEGAFQCLEETPFPHEGPE 696
             L              P  ++  P    P+ PA G G+      + ET    EGPE
Sbjct: 661 AELAACHPAAWSRGPAPPLAFRGAPGAPLPWPPATGPGSADGLCTIYET----EGPE 713



 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 161/631 (25%), Positives = 210/631 (33%), Gaps = 141/631 (22%)

Query: 8   GAPPPTMTGDLQPRQVASSPGHPSQPPLEDNTPATR-TTKGAREAGGQAQAMELPEAQPR 66
           G P P M    + R   +  G P   P     P T    K    A   +     P A+ R
Sbjct: 170 GTPSPAMAR--RSRAAGTEVGLPRPAPSARPRPPTEGPRKSVSSASEHSTTEPSPAARRR 227

Query: 67  QARDGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPS-----RLAGRAEGSPPQ--- 118
            +  G L+ P+ R  + S+TP    +   P  R   +AP+     +  G     PPQ   
Sbjct: 228 PSAGGGLQRPASRSLSSSATPLSSPARSGPSARGTPRAPAHPSQPKPKGLQALRPPQVTP 287

Query: 119 -----RYILGIAS--------------SRTKPTLDETPENPQLE---AAQLPEVDTPQGP 156
                   LG  S              S+  PTL  TP +  L    A  LP    P  P
Sbjct: 288 PRKDAAPALGPLSSSPLATPSPSAALQSQAPPTLPATPHSSSLTCQLATPLPL--APPSP 345

Query: 157 GTGAPLR--PGLPRTEAQPAAEELG------FHRCFQEPP-SSFTSTNYTSPSATPRPPA 207
                L+  P  P T    A   LG       H     PP S   +    +P A   PP 
Sbjct: 346 SAPPSLQTLPSPPATPPSQATTSLGSPTLQATHSFLPSPPLSPLATPPPQAPPALALPPL 405

Query: 208 PGPPQSRGTSPLQPGSYPEYQASGA---------DSWPPAAENSFPGANFGVPPAEPEPI 258
             PP    + PL P + P  QA  A          S PP+     P +    PPA P   
Sbjct: 406 QAPPSPPASPPLSPLATPSPQAPNALAVHLLQAPFSPPPSPPVQAPFS----PPASPPVS 461

Query: 259 PKGSRPGGSPRGVS---FQFP--FPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAW 313
           P  + P  +P  ++    Q P   PA    S    P   A       PL  A   PQ   
Sbjct: 462 PSATPPSQAPPSLAAPPLQVPPSPPASPPMSPSATPPPQAPPPLAAPPLQLAKPPPQA-- 519

Query: 314 PEEAVGTGPAYPLPTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSLH 373
              A+ T P   LP+ PA  P     GQ       +  S + S P +  + P P +  + 
Sbjct: 520 -PPALATPPLQALPSPPASFP-----GQ-------APFSPSASLPMSPLATPPPQAPPVL 566

Query: 374 KSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGPP 433
            +    +P  PP A   L + R PP+  P     G     +    +PGPP        PP
Sbjct: 567 AAPLLQVPPSPP-ASPTLQAPRRPPTPGPDTSVSGPRLTLA---LAPGPP--------PP 614

Query: 434 PARLPQ--LWDPTAAPYPT------------------------PPGGPLAATRSMFFNGQ 467
           P+R P   L  P  A + +                        PP   LAA     ++  
Sbjct: 615 PSRSPSSTLSGPDLAGHSSSATSTPEELRGYDSGPEGGAAASPPPDAELAACHPAAWSRG 674

Query: 468 PSPGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKT 527
           P+P         APLPWP                     PA GP    GS   L T  +T
Sbjct: 675 PAPPLAFRGAPGAPLPWP---------------------PATGP----GSADGLCTIYET 709

Query: 528 PGPREKLPAVRSSQGGSPALFTYNGMTDPGA 558
            GP    PA  +   G P+  T  G    GA
Sbjct: 710 EGPESATPAPGALDPG-PSPGTSGGKAAAGA 739



 Score = 75.9 bits (185), Expect = 8e-13
 Identities = 191/779 (24%), Positives = 256/779 (32%), Gaps = 214/779 (27%)

Query: 1830 APAGASSLTAPRGREAWLVPVPSPACVSNTHPSRRSQDPALSPPIRQLQLPGPGVAKSKD 1889
            A AGA++ T        L P P  +             P   PP+    L   G A    
Sbjct: 8    AKAGAAARTPAARAPGLLTPRPPGS-------------PRPPPPVTPAALRVLGAA---- 50

Query: 1890 GILGLQELTPAA---------QSPPRVNPSGLEGGTVEGGKVACGPAQG----------- 1929
            G +G + L   A         +S PR  P+    GT      +  PA G           
Sbjct: 51   GAVGRKPLAERAGGIGGATIPESAPRAGPTR-SAGTSSRNPASRPPASGRGERAPPAKNT 109

Query: 1930 ------SPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTANQLQPENGVSPG- 1982
                  SPG    TT P   G +         GL   AE+T  +G A +    + +S G 
Sbjct: 110  SPGPVSSPGRASGTTRPGPLGQK---------GLRISAEETVARGKATEAPKRSALSAGA 160

Query: 1983 ---------GTDNHASVN----ASPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPT-P 2028
                     GT + A       A  +  L  P   A      +G R ++S   E   T P
Sbjct: 161  RRDTSGPTPGTPSPAMARRSRAAGTEVGLPRPAPSARPRPPTEGPRKSVSSASEHSTTEP 220

Query: 2029 SPPS------------PNRESLALALT--AAHSRSGSEGR-TPERASSPGLNKP------ 2067
            SP +            P   SL+ + T  ++ +RSG   R TP   + P   KP      
Sbjct: 221  SPAARRRPSAGGGLQRPASRSLSSSATPLSSPARSGPSARGTPRAPAHPSQPKPKGLQAL 280

Query: 2068 ----LLATGDSPAPSVGDLAA---CAPSPTSA---------------AHMPCSLG-PLP- 2103
                +       AP++G L++     PSP++A               + + C L  PLP 
Sbjct: 281  RPPQVTPPRKDAAPALGPLSSSPLATPSPSAALQSQAPPTLPATPHSSSLTCQLATPLPL 340

Query: 2104 --------------REDPLTSPSRAQGGLGGQL-----------PASPSCRDPPGPQQLL 2138
                             P T PS+A   LG              P SP    PP     L
Sbjct: 341  APPSPSAPPSLQTLPSPPATPPSQATTSLGSPTLQATHSFLPSPPLSPLATPPPQAPPAL 400

Query: 2139 ACSPAWAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCDPKEALAGCLLQGEGSPLEDPS 2198
            A  P  AP                 SP   P  T SP  P  ALA  LLQ   SP   P 
Sbjct: 401  ALPPLQAP------------PSPPASPPLSPLATPSPQAP-NALAVHLLQAPFSPPPSPP 447

Query: 2199 SWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVS------PS 2252
               P S  A        TP     + P       L   P    SPP++ + +      P 
Sbjct: 448  VQAPFSPPASPPVSPSATPPS---QAPPSLAAPPLQVPPSPPASPPMSPSATPPPQAPPP 504

Query: 2253 VAVRATGLSSTPTGDEAQAGRGLPGPDPQSRGAPPHTNPDRMPRGHSSYSPSNTARLGHR 2312
            +A     L+  P     QA   L  P  Q+  +PP + P     G + +SPS +  +   
Sbjct: 505  LAAPPLQLAKPP----PQAPPALATPPLQALPSPPASFP-----GQAPFSPSASLPM--- 552

Query: 2313 EGQAVTAVPTEPPTLQG----AGPDSPACLEGEMGTSSKEPEDPGTPETGRSGATKMPRV 2368
                 T  P  PP L        P  PA        + + P  PG P+T  SG    PR+
Sbjct: 553  -SPLATPPPQAPPVLAAPLLQVPPSPPA---SPTLQAPRRPPTPG-PDTSVSG----PRL 603

Query: 2369 TCPSTGLGLGRTTAPS-STASDFQSDSPQSHRNASHQTPQGDPLGPQDLKQRSRGYKKKP 2427
            T     L  G    PS S +S         H +++  TP           +  RGY    
Sbjct: 604  T---LALAPGPPPPPSRSPSSTLSGPDLAGHSSSATSTP-----------EELRGY---- 645

Query: 2428 ASTENGQWKGQAPHGPVTCEVCA---ASFRSGPGLSRHKARKHRPHPGAPAEPSPAALP 2483
               ++G   G A   P   E+ A   A++  GP          R  PGAP    PA  P
Sbjct: 646  ---DSGPEGGAAASPPPDAELAACHPAAWSRGPA----PPLAFRGAPGAPLPWPPATGP 697



 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 192/818 (23%), Positives = 257/818 (31%), Gaps = 133/818 (16%)

Query: 1639 GHAALLPCAQED--LVSGAPFSPRGANFHFQPVQKAGASKTGLCQAEGDSRPPQ------ 1690
            G AA  P A+    L    P SPR       PV  A     G   A G     +      
Sbjct: 11   GAAARTPAARAPGLLTPRPPGSPRPP----PPVTPAALRVLGAAGAVGRKPLAERAGGIG 66

Query: 1691 DVCLPEPSKQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRLLPCEQRGGFLP 1750
               +PE + + GP   AG+ ++    +  +  + + A  ++ +       P    G    
Sbjct: 67   GATIPESAPRAGPTRSAGTSSRNPASRPPASGRGERAPPAKNTSPGPVSSPGRASG--TT 124

Query: 1751 EPGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAP-PLDATWPFGASPSHAAQGHSAG 1809
             PG   Q      A E         AP  +    GA        P   SP+ A +  +AG
Sbjct: 125  RPGPLGQKGLRISAEETVARGKATEAPKRSALSAGARRDTSGPTPGTPSPAMARRSRAAG 184

Query: 1810 RAGGHLHPTAG---RPGFEGNEFAPAGAS--SLTAP----RGREAWLVPVPSPACVSNTH 1860
               G   P      RP  EG   + + AS  S T P    R R +    +  PA  S + 
Sbjct: 185  TEVGLPRPAPSARPRPPTEGPRKSVSSASEHSTTEPSPAARRRPSAGGGLQRPASRSLSS 244

Query: 1861 PSRRSQDPALSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNPSGLEGGTVEGG 1920
             +     PA S P  +   P      S+    GLQ L P   +PPR + +          
Sbjct: 245  SATPLSSPARSGPSAR-GTPRAPAHPSQPKPKGLQALRPPQVTPPRKDAAP--------- 294

Query: 1921 KVACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKT-----QGQGTANQLQP 1975
              A GP   SP     T  P+ A             L  QA  T            QL  
Sbjct: 295  --ALGPLSSSP---LATPSPSAA-------------LQSQAPPTLPATPHSSSLTCQLAT 336

Query: 1976 ENGVSPGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPTPSPPSPNR 2035
               ++P       S+   P    T P++    L        + +LQ      PSPP    
Sbjct: 337  PLPLAPPSPSAPPSLQTLPSPPATPPSQATTSL-------GSPTLQATHSFLPSPPL--- 386

Query: 2036 ESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAPSVGDLAACAPSPTSAAHM 2095
                           S   TP   + P L  P L    SP  S        PSP +   +
Sbjct: 387  ---------------SPLATPPPQAPPALALPPLQAPPSPPASPPLSPLATPSPQAPNAL 431

Query: 2096 PCSLGPLPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQLLACSPAWAPLEEADGVQA 2155
               L   P   P + P +A        P SPS   P      LA  P   P   +     
Sbjct: 432  AVHLLQAPFSPPPSPPVQAPFSPPASPPVSPSATPPSQAPPSLAAPPLQVP--PSPPASP 489

Query: 2156 TTDTGAEDSPVAPPSLTTSPC-------DPKEALAGCLLQGEGSPLEDPSSWPPGSVSAV 2208
                 A   P APP L   P            ALA   LQ   SP   P+S+P       
Sbjct: 490  PMSPSATPPPQAPPPLAAPPLQLAKPPPQAPPALATPPLQALPSP---PASFP------- 539

Query: 2209 TCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVSP--SVAVRATGLSSTPTG 2266
                 G  P   +  +P         ++P    +P L    SP  S  ++A     TP  
Sbjct: 540  -----GQAPFSPSASLPMSPLATPPPQAPPVLAAPLLQVPPSPPASPTLQAPRRPPTPGP 594

Query: 2267 DEAQAGRGL-----PGPDPQSRGAPPHTNPDRMPRGHSSYSPSNTARL-GHREGQAVTAV 2320
            D + +G  L     PGP P    +P  T       GHSS + S    L G+  G    A 
Sbjct: 595  DTSVSGPRLTLALAPGPPPPPSRSPSSTLSGPDLAGHSSSATSTPEELRGYDSGPEGGAA 654

Query: 2321 PTEPPTLQGA---------GPDSPACLEGEMGTSSKEP--EDPGTPE--------TGRSG 2361
             + PP  + A         GP  P    G  G     P    PG+ +         G   
Sbjct: 655  ASPPPDAELAACHPAAWSRGPAPPLAFRGAPGAPLPWPPATGPGSADGLCTIYETEGPES 714

Query: 2362 ATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHR 2399
            AT  P    P    G     A +   +   S SP+  R
Sbjct: 715  ATPAPGALDPGPSPGTSGGKAAAGAGAGASSRSPKQAR 752



 Score = 70.1 bits (170), Expect = 4e-11
 Identities = 192/802 (23%), Positives = 262/802 (32%), Gaps = 125/802 (15%)

Query: 1109 KPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQAR---GPSRSL-ETGAAAREGGPKCA 1164
            K   AAR  A        P  PG  RP P  +P A    G + ++     A R GG   A
Sbjct: 9    KAGAAARTPAARAPGLLTPRPPGSPRPPPPVTPAALRVLGAAGAVGRKPLAERAGGIGGA 68

Query: 1165 DRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEALRSPPAAC 1224
              P  AP+     PT +  +    P+   P   +      E AP +   +    S P   
Sbjct: 69   TIPESAPRAG---PTRSAGTSSRNPASRPPASGRG-----ERAPPAKNTSPGPVSSPGRA 120

Query: 1225 AGEMGASP----GLLIPEQPPPSRHD-TGTPKPSGSLANTAPHGSSPTPGVGS------- 1272
            +G     P    GL I  +   +R   T  PK S   A      S PTPG  S       
Sbjct: 121  SGTTRPGPLGQKGLRISAEETVARGKATEAPKRSALSAGARRDTSGPTPGTPSPAMARRS 180

Query: 1273 -LLGGPGGTQAPVSHNSKDPPARQPGEFLAPVANPSSTACPKPSVLSSKISSFGCD-PAG 1330
               G   G   P       PP   P + ++  +  S+T  P P+      +  G   PA 
Sbjct: 181  RAAGTEVGLPRPAPSARPRPPTEGPRKSVSSASEHSTTE-PSPAARRRPSAGGGLQRPAS 239

Query: 1331 FNRDPLGVPV---AKKGPQPYSSPHSELFLGPKDLAGCFLEELHPK---PSARDAPPASS 1384
             +      P+   A+ GP    +P +          G  L+ L P    P  +DA PA  
Sbjct: 240  RSLSSSATPLSSPARSGPSARGTPRAPAHPSQPKPKG--LQALRPPQVTPPRKDAAPALG 297

Query: 1385 SCLCQDGEDAGSLEPQLPRSPPGTAETEPGRAASPPTLESSSLFPDLPVDRFDPPLYGSL 1444
                       S  P    SP    +++     +PPTL ++             P   SL
Sbjct: 298  PL---------SSSPLATPSPSAALQSQ-----APPTLPAT-------------PHSSSL 330

Query: 1445 SANRDSGLPFA----CADPPQKTVPSDPPYP--------SFLLLEEVSPMLPSHFPDLSG 1492
            +    + LP A     A P  +T+PS P  P            L+     LPS  P LS 
Sbjct: 331  TCQLATPLPLAPPSPSAPPSLQTLPSPPATPPSQATTSLGSPTLQATHSFLPS--PPLSP 388

Query: 1493 GKVLSKTCPPERTVVP-GAAPSLPGKGSGCSVALMSHLSEDELEIQKLVTELESQLQRSK 1551
                    PP   + P  A PS P       +A  S  + + L +          LQ   
Sbjct: 389  LATPPPQAPPALALPPLQAPPSPPASPPLSPLATPSPQAPNALAVH--------LLQAPF 440

Query: 1552 DTRGAPRELAEAESVGRVELGTGTEPPSQRRTCQATVPHEDTFSAADLTRVGESTAHREG 1611
                +P   A         +     PPSQ     A  P +   S      +  S      
Sbjct: 441  SPPPSPPVQAPFSPPASPPVSPSATPPSQAPPSLAAPPLQVPPSPPASPPMSPSATPPPQ 500

Query: 1612 AESAVATVEAVQGRPGGTWPCPASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQPVQK 1671
            A   +A       +P    P   +  P  A  LP         APFSP  A+    P+  
Sbjct: 501  APPPLAAPPLQLAKPPPQAPPALATPPLQA--LPSPPASFPGQAPFSP-SASLPMSPLAT 557

Query: 1672 AGASKTGLCQA---EGDSRPPQDVCLPEPSKQPGPQLDAG------SLAKC--------- 1713
                   +  A   +    PP    L  P + P P  D        +LA           
Sbjct: 558  PPPQAPPVLAAPLLQVPPSPPASPTLQAPRRPPTPGPDTSVSGPRLTLALAPGPPPPPSR 617

Query: 1714 SPDQELSFPK-NKEAASSQESEDSLRLLPCEQRGGFLPEPGTADQPHRGAPAPEAFGSPA 1772
            SP   LS P     ++S+  + + LR       GG    P    +     PA  + G   
Sbjct: 618  SPSSTLSGPDLAGHSSSATSTPEELRGYDSGPEGGAAASPPPDAELAACHPAAWSRGP-- 675

Query: 1773 VHLAPDLAFQGDGAPPLDATWPFGASPSHA--------AQG-HSAGRAGGHLH--PTAGR 1821
               AP LAF+  GAP     WP    P  A         +G  SA  A G L   P+ G 
Sbjct: 676  ---APPLAFR--GAPGAPLPWPPATGPGSADGLCTIYETEGPESATPAPGALDPGPSPGT 730

Query: 1822 PGFEGNEFAPAGASSLTAPRGR 1843
             G +    A AGASS +  + R
Sbjct: 731  SGGKAAAGAGAGASSRSPKQAR 752



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 204/849 (24%), Positives = 255/849 (30%), Gaps = 184/849 (21%)

Query: 379  ILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGPPPARLP 438
            +L  RPP      GS R PP   P       A R  G   + G       A G   A +P
Sbjct: 24   LLTPRPP------GSPRPPPPVTPA------ALRVLGAAGAVGRKPLAERAGGIGGATIP 71

Query: 439  QLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLP-----TARP 493
            +     +AP   P      ++R+       S       P     P P   P     T RP
Sbjct: 72   E-----SAPRAGPTRSAGTSSRNPASRPPASGRGERAPPAKNTSPGPVSSPGRASGTTRP 126

Query: 494  SPHGMEML--SRLPFPAGGPEWQGGSQGALG------TAGKTPGPREKLPAVRSSQGGSP 545
             P G + L  S     A G   +   + AL       T+G TPG      A RS   G+ 
Sbjct: 127  GPLGQKGLRISAEETVARGKATEAPKRSALSAGARRDTSGPTPGTPSPAMARRSRAAGTE 186

Query: 546  ALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPR--VVGASPSESPLPSPATNTAGS 603
                              G+ +P  S    P    PR  V  AS   +  PSPA     S
Sbjct: 187  V-----------------GLPRPAPSARPRPPTEGPRKSVSSASEHSTTEPSPAARRRPS 229

Query: 604  TCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHP--PTHPQETGSPFPSPEPPHSLPTHY 661
                L   +S   + S+     P   GPSA   P  P HP +     P P+   +L    
Sbjct: 230  AGGGLQRPASRSLSSSATPLSSPARSGPSARGTPRAPAHPSQ-----PKPKGLQAL---- 280

Query: 662  QPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLSS 721
               P +  P   D   A G    L  +P     P      LQ   +APP  P    S S 
Sbjct: 281  --RPPQVTPPRKDAAPALGP---LSSSPLATPSPSAA---LQS--QAPPTLPATPHSSS- 329

Query: 722  ASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAPR 781
                     LTC+                      L  A       P    LPSPPA P 
Sbjct: 330  ---------LTCQLATP------------------LPLAPPSPSAPPSLQTLPSPPATPP 362

Query: 782  VPADAHAG--LLSHAKTFLLAGDAQAEGKDDPLRTGFL--PSLAATPFPL---PASDLDM 834
              A    G   L    +FL +          P     L  P L A P P    P S L  
Sbjct: 363  SQATTSLGSPTLQATHSFLPSPPLSPLATPPPQAPPALALPPLQAPPSPPASPPLSPLAT 422

Query: 835  EDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAG---- 890
                  ++L    L        +P + + F         S P  PS+  P ++       
Sbjct: 423  PSPQAPNALAVHLLQAPFSPPPSPPVQAPF-----SPPASPPVSPSATPPSQAPPSLAAP 477

Query: 891  ---VTPESKAPPPL-PAATPDPQTP-----------RPGDRGCPARGRPKTRSLGLAPTE 935
               V P   A PP+ P+ATP PQ P           +P  +  PA   P  ++L   P  
Sbjct: 478  PLQVPPSPPASPPMSPSATPPPQAPPPLAAPPLQLAKPPPQAPPALATPPLQALPSPP-- 535

Query: 936  ADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPPRPR 995
            A  P Q                     +A    S          P     L + PP  P 
Sbjct: 536  ASFPGQA----------------PFSPSASLPMSPLATPPPQAPPVLAAPLLQVPPSPPA 579

Query: 996  RPRTQAPGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELI---L 1052
             P  QAP  R  P P    + + P  T +      P    P  R       G +L     
Sbjct: 580  SPTLQAP--RRPPTPGPDTSVSGPRLTLA----LAPGPPPPPSRSPSSTLSGPDLAGHSS 633

Query: 1053 KIVQQKNRLREYDFASESEEDEQPPP-------------RGP----GFRGRRGRGEKRKE 1095
                    LR YD   E      PPP             RGP     FRG  G       
Sbjct: 634  SATSTPEELRGYDSGPEGGAAASPPPDAELAACHPAAWSRGPAPPLAFRGAPG------- 686

Query: 1096 VELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGAA 1155
              L   P              E   +G  +    PG   PGP  SP   G   +   GA 
Sbjct: 687  APLPWPPATGPGSADGLCTIYET--EGPESATPAPGALDPGP--SPGTSGGKAAAGAGAG 742

Query: 1156 AREGGPKCA 1164
            A    PK A
Sbjct: 743  ASSRSPKQA 751



 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 104/390 (26%), Positives = 130/390 (33%), Gaps = 69/390 (17%)

Query: 2   PGERPRGAPPPTMTGDLQPRQVASSPGHPSQPPLED-NTPATRTTKGAREAGGQAQAMEL 60
           P   P   PPP     L    + + P  P+ PPL    TP+ +           A A+ L
Sbjct: 384 PPLSPLATPPPQAPPALALPPLQAPPSPPASPPLSPLATPSPQAP--------NALAVHL 435

Query: 61  PEAQPRQARDGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRY 120
            +A           PPS   QAP S P     P +P    P QAP  LA      PP   
Sbjct: 436 LQAP-------FSPPPSPPVQAPFSPPA--SPPVSPSATPPSQAPPSLAAPPLQVPP--- 483

Query: 121 ILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAEELGF 180
                           P +P +  +  P    P  P    PL+   P  +A PA      
Sbjct: 484 --------------SPPASPPMSPSATPPPQAPP-PLAAPPLQLAKPPPQAPPALATPPL 528

Query: 181 HRCFQEPPSSFTSTNYTSPSAT------PRPPAPGPPQSRG---TSPLQPGSYPEYQASG 231
            +    PP+SF      SPSA+        PP   PP         P  P + P  QA  
Sbjct: 529 -QALPSPPASFPGQAPFSPSASLPMSPLATPPPQAPPVLAAPLLQVPPSPPASPTLQAPR 587

Query: 232 ADSWP-PAAENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPA 290
               P P    S P     + P  P P      P  SP   +   P  A H +S    P 
Sbjct: 588 RPPTPGPDTSVSGPRLTLALAPGPPPP------PSRSPSS-TLSGPDLAGHSSSATSTPE 640

Query: 291 DVAGHAFTNGPLVFAFHQPQ-----GAWPEEAVGTGPAYPL-----PTQPAPSPLPCYQG 340
           ++ G  + +GP   A   P       A    A   GPA PL     P  P P P     G
Sbjct: 641 ELRG--YDSGPEGGAAASPPPDAELAACHPAAWSRGPAPPLAFRGAPGAPLPWPPATGPG 698

Query: 341 QPGGLNRHSDLSG---ALSSPGAAHSAPRP 367
              GL    +  G   A  +PGA    P P
Sbjct: 699 SADGLCTIYETEGPESATPAPGALDPGPSP 728



 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 129/507 (25%), Positives = 168/507 (33%), Gaps = 57/507 (11%)

Query: 2109 TSPSRAQGGLGGQLPASPSCRDPPGPQQLLACSPAWA----PL-EEADGVQATTDTGAED 2163
            T  +RA G L  + P SP    P  P  L     A A    PL E A G+   T    E 
Sbjct: 16   TPAARAPGLLTPRPPGSPRPPPPVTPAALRVLGAAGAVGRKPLAERAGGIGGATIP--ES 73

Query: 2164 SPVAPP--SLTTSPCDPKEALAGCLLQGEGSPLEDPSSWPPGSVSAVTCTHSGDTPKDST 2221
            +P A P  S  TS  +P              P ++ S  P  S    + T          
Sbjct: 74   APRAGPTRSAGTSSRNPASRPPASGRGERAPPAKNTSPGPVSSPGRASGTTRPGPLGQKG 133

Query: 2222 LRIP--EDSRKEKLWESPGRA---------TSPPLAGAVSPSVAVRATGLSSTPTGDEAQ 2270
            LRI   E   + K  E+P R+         TS P  G  SP++A R     S   G E  
Sbjct: 134  LRISAEETVARGKATEAPKRSALSAGARRDTSGPTPGTPSPAMARR-----SRAAGTEV- 187

Query: 2271 AGRGLPGPDPQSRGAPPHTNPDRMPRG---HSSYSPSNTARLGHREGQAVTAVPTEPPTL 2327
               GLP P P +R  PP   P +       HS+  PS  AR     G  +    +   + 
Sbjct: 188  ---GLPRPAPSARPRPPTEGPRKSVSSASEHSTTEPSPAARRRPSAGGGLQRPASRSLSS 244

Query: 2328 QGAGPDSPACLEGEMGTSSKEPEDPGTPETGRSGATKMPRVT------CPSTGLGLGRTT 2381
                  SPA        + + P  P  P+     A + P+VT       P+ G       
Sbjct: 245  SATPLSSPARSGPSARGTPRAPAHPSQPKPKGLQALRPPQVTPPRKDAAPALGPLSSSPL 304

Query: 2382 APSSTASDFQSDSPQSHRNASHQTPQGDPLG-PQDLKQRSRGYKKKPASTENGQWKGQAP 2440
            A  S ++  QS +P +     H +     L  P  L   S      P S +        P
Sbjct: 305  ATPSPSAALQSQAPPTLPATPHSSSLTCQLATPLPLAPPS---PSAPPSLQT------LP 355

Query: 2441 HGPVTCEVCAASFRSGPGLSRHKARKHRPHPGAPAEPSPAALPAQQPLEPLAQKCQPPRK 2500
              P T    A +    P L    +    P     A P P A PA   L PL     PP  
Sbjct: 356  SPPATPPSQATTSLGSPTLQATHSFLPSPPLSPLATPPPQAPPA-LALPPLQAPPSPPAS 414

Query: 2501 KSHRVSGKERPNHSRGDPSHVTQ----PPPAQGSKEVLRAPGSPH-SQQLHPPS---PTE 2552
                      P        H+ Q    PPP+   +     P SP  S    PPS   P+ 
Sbjct: 415  PPLSPLATPSPQAPNALAVHLLQAPFSPPPSPPVQAPFSPPASPPVSPSATPPSQAPPSL 474

Query: 2553 HEVDVKTPASKPRPDQAREDELHPKQA 2579
                ++ P S P           P QA
Sbjct: 475  AAPPLQVPPSPPASPPMSPSATPPPQA 501



 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 121/496 (24%), Positives = 162/496 (32%), Gaps = 57/496 (11%)

Query: 3416 GRQPFAFRGVRRPGAPGQKARALEGTLPSKRRRVAMPGSAP---GPGEDRPPPRGSSPIL 3472
            GR+P A R     GA   ++    G   S       P S P   G GE  PP + +SP  
Sbjct: 54   GRKPLAERAGGIGGATIPESAPRAGPTRSAGTSSRNPASRPPASGRGERAPPAKNTSP-- 111

Query: 3473 SEGSLPALLHLCSEVAPSTTKGWPETLERPV---DPVTHPIRGCELPSNHQECPPPSLSP 3529
               S P      +   P   KG   + E  V        P R        ++   P+   
Sbjct: 112  GPVSSPGRASGTTRPGPLGQKGLRISAEETVARGKATEAPKRSALSAGARRDTSGPTPGT 171

Query: 3530 FPAALADGRGDCALDGALERPENEASPGSP--GP--LLQQALPLGASLPRPGARGQDAEG 3585
               A+A        +  L RP   A P  P  GP   +  A     + P P AR + + G
Sbjct: 172  PSPAMARRSRAAGTEVGLPRPAPSARPRPPTEGPRKSVSSASEHSTTEPSPAARRRPSAG 231

Query: 3586 KRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSS---SHMVSEGGPRGTFHKGSA 3642
                    G  + P +R            L      +SS   S   + G PR   H  S 
Sbjct: 232  --------GGLQRPASRS-----------LSSSATPLSSPARSGPSARGTPRAPAHP-SQ 271

Query: 3643 TKPAGCQS--------SSKDRSAASTP--SKALKFPVHPRKAVGSLAPGELARGTENG-- 3690
             KP G Q+          KD + A  P  S  L  P  P  A+ S AP  L     +   
Sbjct: 272  PKPKGLQALRPPQVTPPRKDAAPALGPLSSSPLATP-SPSAALQSQAPPTLPATPHSSSL 330

Query: 3691 ---MKPATPKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQ--LQSETATTPAKPSFPSR 3745
               +    P A P PS+  S    P       SQ   + G   LQ+  +  P+ P  P  
Sbjct: 331  TCQLATPLPLAPPSPSAPPSLQTLPSPPATPPSQATTSLGSPTLQATHSFLPSPPLSPLA 390

Query: 3746 SPAPERLPARA-QAKSCTKGPREAGEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVG 3804
            +P P+  PA A         P  +    P  +  P+     +    +     P       
Sbjct: 391  TPPPQAPPALALPPLQAPPSPPASPPLSPLATPSPQAPNALAVHLLQAPFSPPPSPPVQA 450

Query: 3805 SFGRAPSAPDKPPRTPRKQATPSRVLP---TKPKPNSQNKPRPPPSEQRKAEPGHTQRKD 3861
             F    S P  P  TP  QA PS   P     P P +     P  +   +A P       
Sbjct: 451  PFSPPASPPVSPSATPPSQAPPSLAAPPLQVPPSPPASPPMSPSATPPPQAPPPLAAPPL 510

Query: 3862 RLGKAFPQGRPLLRPP 3877
            +L K  PQ  P L  P
Sbjct: 511  QLAKPPPQAPPALATP 526



 Score = 59.3 bits (142), Expect = 7e-08
 Identities = 94/399 (23%), Positives = 140/399 (35%), Gaps = 58/399 (14%)

Query: 3523 PPPSLSPFPAALADGRGDCALDGALERPENEASPGSPGPLLQQALP-------LGASLPR 3575
            PPP ++P    +    G         +P  E + G  G  + ++ P        G S   
Sbjct: 35   PPPPVTPAALRVLGAAGAVG-----RKPLAERAGGIGGATIPESAPRAGPTRSAGTSSRN 89

Query: 3576 PGARGQ-DAEGKRAPLVFSGKRRAPG---ARGRCAPDHFQEDHLLQKEKEVSSSHMVSEG 3631
            P +R      G+RAP     K  +PG   + GR A    +   L QK   +S+   V+  
Sbjct: 90   PASRPPASGRGERAP---PAKNTSPGPVSSPGR-ASGTTRPGPLGQKGLRISAEETVA-- 143

Query: 3632 GPRGTFHKGSATK-PAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENG 3690
                   +G AT+ P     S+  R   S P+     P   R++         A GTE G
Sbjct: 144  -------RGKATEAPKRSALSAGARRDTSGPTPGTPSPAMARRS--------RAAGTEVG 188

Query: 3691 MKPATPKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETA--TTPAKPSFPSRSPA 3748
            +    P A+P P ++G             ++P PA+ +  S       PA  S  S S  
Sbjct: 189  LPRPAPSARPRPPTEGPRKSVSSASEHSTTEPSPAARRRPSAGGGLQRPASRSL-SSSAT 247

Query: 3749 PERLPARA--QAKSCTKGPREAGEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVG-- 3804
            P   PAR+   A+   + P    +  P G    +    +  ++      GP  S  +   
Sbjct: 248  PLSSPARSGPSARGTPRAPAHPSQPKPKGLQALRPPQVTPPRKDAAPALGPLSSSPLATP 307

Query: 3805 --SFGRAPSAPDKPPRTPRKQ------ATPSRVLPTKPK--PNSQNKPRP---PPSEQRK 3851
              S      AP   P TP         ATP  + P  P   P+ Q  P P   PPS+   
Sbjct: 308  SPSAALQSQAPPTLPATPHSSSLTCQLATPLPLAPPSPSAPPSLQTLPSPPATPPSQATT 367

Query: 3852 AEPGHTQRKDRLGKAFPQGRPLLRPPKRGTAVHGAEPAE 3890
            +    T +        P   PL  PP +        P +
Sbjct: 368  SLGSPTLQATHSFLPSPPLSPLATPPPQAPPALALPPLQ 406



 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 211/908 (23%), Positives = 270/908 (29%), Gaps = 179/908 (19%)

Query: 1172 KDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEAL----RSPPAACAGE 1227
            +D  +      T     P L  P+    P       P +     A     R P A  AG 
Sbjct: 5    RDKAKAGAAARTPAARAPGLLTPRPPGSPRPPPPVTPAALRVLGAAGAVGRKPLAERAGG 64

Query: 1228 MGASPGLLIPEQPP----------PSRHDTGTPKPSGSLANTAPHGSSPTPGVGSLLGGP 1277
            +G   G  IPE  P           SR+    P  SG     AP   + +PG  S  G  
Sbjct: 65   IG---GATIPESAPRAGPTRSAGTSSRNPASRPPASGR-GERAPPAKNTSPGPVSSPGRA 120

Query: 1278 GGTQAPVSHNSKDPPARQPGEFLAP---VANPSSTACPKPSVLSSKISSFGCDPAGFNRD 1334
             GT  P        P  Q G  ++    VA   +T  PK S LS          AG  RD
Sbjct: 121  SGTTRP-------GPLGQKGLRISAEETVARGKATEAPKRSALS----------AGARRD 163

Query: 1335 PLGVPVAKKGPQPYSSPHSELFLGPKDLAGCFLEELHPKPSARDAPPASSSCLCQDGEDA 1394
              G       P P  +  S         AG  +    P PSAR  PP             
Sbjct: 164  TSGPTPGT--PSPAMARRSRA-------AGTEVGLPRPAPSARPRPPTEG---------- 204

Query: 1395 GSLEPQLPRSPPGTAETEPGRAASPPTLESSSLFPDLPVDRFDPPLYGSLSANRDSGLPF 1454
                   PR    +A        SP      S    L       P   SLS++       
Sbjct: 205  -------PRKSVSSASEHSTTEPSPAARRRPSAGGGL-----QRPASRSLSSSATPLSSP 252

Query: 1455 ACADPPQKTVPSDPPYPSFLLLEEVSPMLPSHFPDLSGGKVLSKTCPPERTVVPGAAP-- 1512
            A + P  +  P  P +PS    + +  + P             +  PP +   P   P  
Sbjct: 253  ARSGPSARGTPRAPAHPSQPKPKGLQALRPP------------QVTPPRKDAAPALGPLS 300

Query: 1513 SLPGKGSGCSVALMSHLSEDELEIQKLVTELESQLQRSKDTRGAPRELAEAESVGRVELG 1572
            S P      S AL S  +   L      + L  QL         P  LA         L 
Sbjct: 301  SSPLATPSPSAALQSQ-APPTLPATPHSSSLTCQL-------ATPLPLAPPSPSAPPSLQ 352

Query: 1573 TGTEPPSQRRTCQATVPHEDTFSAADLTRVGESTAHREGAESAVATVEAVQGRPGGTWPC 1632
            T   PP       AT P + T S    T     +       S +AT       P    P 
Sbjct: 353  TLPSPP-------ATPPSQATTSLGSPTLQATHSFLPSPPLSPLAT-------PPPQAPP 398

Query: 1633 PASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQPVQKAGASKTGLCQAEGDSRPPQDV 1692
              +  P  A   P A   L   A  SP+  N          A    L QA     PP   
Sbjct: 399  ALALPPLQAPPSPPASPPLSPLATPSPQAPN----------ALAVHLLQAPFS--PP--- 443

Query: 1693 CLPEPSKQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRLLPCEQRGGFLPEP 1752
                    P P + A      SP      P +  A    ++  SL   P +     +P  
Sbjct: 444  --------PSPPVQAPFSPPASP------PVSPSATPPSQAPPSLAAPPLQ-----VPPS 484

Query: 1753 GTADQPHRGAPAPEAFGSPAVHLAP-DLAFQGDGAPPLDATWPFGASPSHAAQGHSAGRA 1811
              A  P   +  P     P +   P  LA     APP  AT P  A PS  A     G+A
Sbjct: 485  PPASPPMSPSATPPPQAPPPLAAPPLQLAKPPPQAPPALATPPLQALPSPPAS--FPGQA 542

Query: 1812 GGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPACVSNTHPSRRSQDPALS 1871
                 P+A  P       +P       AP    A L+ VP     S          P L 
Sbjct: 543  P--FSPSASLP------MSPLATPPPQAPPVLAAPLLQVPPSPPAS----------PTLQ 584

Query: 1872 PPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNPSGLEGGTVEGGKVACGPAQGSP 1931
             P R    P PG   S  G      L P    PP  +PS              GP     
Sbjct: 585  APRRP---PTPGPDTSVSGPRLTLALAPGPPPPPSRSPSS----------TLSGPDLAGH 631

Query: 1932 GGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTANQLQPENGVSPGGTDNHASVN 1991
                 +T   + G+  G E     G              +      G +P      A   
Sbjct: 632  SSSATSTPEELRGYDSGPEG----GAAASPPPDAELAACHPAAWSRGPAPPLAFRGAPGA 687

Query: 1992 ASPKTALTGP--TEGAVLLEKCKGSRAAMSLQEEAEPTPSPPSPNRESLALALTAAHSRS 2049
              P    TGP   +G   + + +G  +A       +P PSP +   ++ A A   A SRS
Sbjct: 688  PLPWPPATGPGSADGLCTIYETEGPESATPAPGALDPGPSPGTSGGKAAAGAGAGASSRS 747

Query: 2050 GSEGRTPE 2057
              + R  E
Sbjct: 748  PKQARLGE 755



 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 128/549 (23%), Positives = 174/549 (31%), Gaps = 67/549 (12%)

Query: 876  PRGPSSGHPLKSKAGVTPESKAPPPLPAATPDPQT----PRPGDRGC---------PARG 922
            PR P+ G P KS +  +  S   P  PAA   P       RP  R           PAR 
Sbjct: 198  PRPPTEG-PRKSVSSASEHSTTEPS-PAARRRPSAGGGLQRPASRSLSSSATPLSSPARS 255

Query: 923  RPKTRSLGLAPTEADAPS-QGRQQRRGKQLKLFRKDLDSG-GAAEGSGSGGGGRASGLRP 980
             P  R    AP     P  +G Q  R  Q+   RKD     G    S       ++ L+ 
Sbjct: 256  GPSARGTPRAPAHPSQPKPKGLQALRPPQVTPPRKDAAPALGPLSSSPLATPSPSAALQ- 314

Query: 981  RRNDGLGERPPPRPRRPRTQAPGSR-ADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKR 1039
                   + PP  P  P + +   + A P P  P + + P   ++      PP   P + 
Sbjct: 315  ------SQAPPTLPATPHSSSLTCQLATPLPLAPPSPSAPPSLQTLPS---PPATPPSQA 365

Query: 1040 KARGGAWGKELI--------LKIVQQKNRLREYDFASESEEDEQPPPRGPGFRGRRGRGE 1091
                G+   +          L  +           A    +    PP  P          
Sbjct: 366  TTSLGSPTLQATHSFLPSPPLSPLATPPPQAPPALALPPLQAPPSPPASPPLSPLATPSP 425

Query: 1092 KRKE---VELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSR 1148
            +      V L Q P    P  P +A            +   P  + P     P    PS 
Sbjct: 426  QAPNALAVHLLQAPFSPPPSPPVQAPFSPPASPPVSPSATPPSQAPPSLAAPPLQVPPSP 485

Query: 1149 SLETGAAAREGGPKCADRPSVAP-----KDPLQVPTNTET---SEETRPSLDFPQEAKEP 1200
                  +     P  A  P  AP     K P Q P    T        P   FP +A  P
Sbjct: 486  PASPPMSPSATPPPQAPPPLAAPPLQLAKPPPQAPPALATPPLQALPSPPASFPGQA--P 543

Query: 1201 ETAEESAPDSTEFTEALRSPPAACAGEMG------ASPGLLIPEQPPPSRHDTGTPKPSG 1254
             +   S P S   T   ++PP   A  +       ASP L  P +PP    DT    P  
Sbjct: 544  FSPSASLPMSPLATPPPQAPPVLAAPLLQVPPSPPASPTLQAPRRPPTPGPDTSVSGPRL 603

Query: 1255 SLANTAPHGSSPTPGVGSLLGGPGGTQAPVSHNSKDPPARQPGEFLAPVANPSSTACPKP 1314
            +LA        P+    S L GP    A  S ++   P    G    P    +++  P  
Sbjct: 604  TLALAPGPPPPPSRSPSSTLSGP--DLAGHSSSATSTPEELRGYDSGPEGGAAASPPPDA 661

Query: 1315 SVLSSKISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSELFLGPKDLAG-CFLEELHPK 1373
             + +       C PA ++R P   P+A +G      P      GP    G C + E    
Sbjct: 662  ELAA-------CHPAAWSRGP-APPLAFRGAPGAPLPWPPA-TGPGSADGLCTIYETEGP 712

Query: 1374 PSARDAPPA 1382
             SA  AP A
Sbjct: 713  ESATPAPGA 721



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 147/600 (24%), Positives = 180/600 (30%), Gaps = 96/600 (16%)

Query: 3193 SSAVAHLLNSITEPAPKHHRG-------KRSAGKAAGSPGDPWGQEGEAKKDSPGERAKP 3245
            SSA  H   S TEP+P   R        +R A ++  S   P        +  P  R  P
Sbjct: 210  SSASEH---STTEPSPAARRRPSAGGGLQRPASRSLSSSATPLSSPA---RSGPSARGTP 263

Query: 3246 RARSTPSNPDG----AATPDSASATALADAGSPGP----PRTTPSPSPDPWAGGEPLLQA 3297
            RA + PS P      A  P   +      A + GP    P  TPSPS    +   P L A
Sbjct: 264  RAPAHPSQPKPKGLQALRPPQVTPPRKDAAPALGPLSSSPLATPSPSAALQSQAPPTLPA 323

Query: 3298 TPVHEACKDPSRDCHHCGKRFPKPFKLQRHLAVHSPQRVYLCPRCPRVYPEHGELLAHLG 3357
            TP   +          C    P P       A  S Q +   P  P            L 
Sbjct: 324  TPHSSSLT--------CQLATPLPLAPPSPSAPPSLQTLPSPPATPPSQATTSLGSPTLQ 375

Query: 3358 GAHGLLERPELQHT----PLYACELCATVMRIIKKSFACSSCNYTFAKKEQFDRHMNKHL 3413
              H  L  P L       P     L    ++      A    +       Q    +  HL
Sbjct: 376  ATHSFLPSPPLSPLATPPPQAPPALALPPLQAPPSPPASPPLSPLATPSPQAPNALAVHL 435

Query: 3414 RGGRQPFAFRGVRRPGAPGQKARALEGTLPSKRRRVAMPGSAP----GPGEDRPPPRGSS 3469
               + PF+      P +P  +A       P        P  AP     P    PP   +S
Sbjct: 436  L--QAPFS-----PPPSPPVQAPFSPPASPPVSPSATPPSQAPPSLAAPPLQVPPSPPAS 488

Query: 3470 PILSEGSLPALLHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSP 3529
            P +S  + P         AP      P  L +P  P   P      P      PP S   
Sbjct: 489  PPMSPSATPP------PQAPPPLAAPPLQLAKP--PPQAPPALATPPLQALPSPPAS--- 537

Query: 3530 FPAALADGRGDCALDGALERPENEASPGSPGPLLQ-----QALPLGASLPRPGARGQDAE 3584
            FP               L  P  +A P    PLLQ      A P   +  RP   G D  
Sbjct: 538  FPGQAPFSPSASLPMSPLATPPPQAPPVLAAPLLQVPPSPPASPTLQAPRRPPTPGPDTS 597

Query: 3585 --GKRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSA 3642
              G R  L  +     P +R                    S S  +S  GP    H  SA
Sbjct: 598  VSGPRLTLALAPGPPPPPSR--------------------SPSSTLS--GPDLAGHSSSA 635

Query: 3643 TKPA----GCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKA 3698
            T       G  S  +  +AAS P  A     HP       AP    RG      P  P  
Sbjct: 636  TSTPEELRGYDSGPEGGAAASPPPDAELAACHPAAWSRGPAPPLAFRGAPGAPLPWPPAT 695

Query: 3699 KPGPSSQG------SGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERL 3752
             PG S+ G      +  P   T   G   P P+ G      A   A     SRSP   RL
Sbjct: 696  GPG-SADGLCTIYETEGPESATPAPGALDPGPSPG-TSGGKAAAGAGAGASSRSPKQARL 753



 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 184/789 (23%), Positives = 251/789 (31%), Gaps = 138/789 (17%)

Query: 2014 SRAAMSLQEEAEPTPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGD 2073
            +RA   L      +P PP P   +    L AA    G+ GR P    + G+     AT  
Sbjct: 19   ARAPGLLTPRPPGSPRPPPPVTPAALRVLGAA----GAVGRKPLAERAGGIGG---ATIP 71

Query: 2074 SPAPSVGDLAACAPSPTSAAHMPCSLGPLPREDPLTSPSRAQGGLGGQLPASPSCRDPPG 2133
              AP  G   +   S  + A  P + G   R  P  + S       G+  AS + R  P 
Sbjct: 72   ESAPRAGPTRSAGTSSRNPASRPPASGRGERAPPAKNTSPGPVSSPGR--ASGTTRPGPL 129

Query: 2134 PQQLLACSP----AWAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCDPKEALAGCLLQG 2189
             Q+ L  S     A     EA    A +  GA      P   T SP   + + A     G
Sbjct: 130  GQKGLRISAEETVARGKATEAPKRSALS-AGARRDTSGPTPGTPSPAMARRSRAAGTEVG 188

Query: 2190 EGSPLEDPSSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAV 2249
               P       PP            + P+ S     E S  E    SP  A   P AG  
Sbjct: 189  LPRPAPSARPRPPT-----------EGPRKSVSSASEHSTTEP---SPA-ARRRPSAGGG 233

Query: 2250 SPSVAVRATGLSSTPTGDEAQAG---RGLPG-------PDPQSRGA--PPHTNPDRM--- 2294
                A R+   S+TP    A++G   RG P        P P+   A  PP   P R    
Sbjct: 234  LQRPASRSLSSSATPLSSPARSGPSARGTPRAPAHPSQPKPKGLQALRPPQVTPPRKDAA 293

Query: 2295 ----PRGHSSYS-PSNTARLGHREGQAVTAVP---------TEPPTLQGAGPDSPACLEG 2340
                P   S  + PS +A L  +    + A P           P  L    P +P  L+ 
Sbjct: 294  PALGPLSSSPLATPSPSAALQSQAPPTLPATPHSSSLTCQLATPLPLAPPSPSAPPSLQ- 352

Query: 2341 EMGTSSKEPEDPGTPETGRSGATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRN 2400
                    P  P TP +  + +   P +    + L       PS   S   +  PQ+   
Sbjct: 353  ------TLPSPPATPPSQATTSLGSPTLQATHSFL-------PSPPLSPLATPPPQAPPA 399

Query: 2401 ASHQTPQGDPLGPQDLKQRSRGYKKKPASTENGQWKGQAPHGPVTCEVCAASFR--SGPG 2458
             +    Q  P  P              A         QAP  P       A F   + P 
Sbjct: 400  LALPPLQAPPSPPASPPLSPLATPSPQAPNALAVHLLQAPFSPPPSPPVQAPFSPPASPP 459

Query: 2459 LSRHKARKHRPHPGAPAEP-------------SPAALPAQQPLEPLA----QKCQPPRKK 2501
            +S       +  P   A P             SP+A P  Q   PLA    Q  +PP + 
Sbjct: 460  VSPSATPPSQAPPSLAAPPLQVPPSPPASPPMSPSATPPPQAPPPLAAPPLQLAKPPPQA 519

Query: 2502 SHRVS---------------GKERPNHSRGDPSHVTQPPPAQG----SKEVLRAPGSPHS 2542
               ++               G+   + S   P      PP Q     +  +L+ P SP +
Sbjct: 520  PPALATPPLQALPSPPASFPGQAPFSPSASLPMSPLATPPPQAPPVLAAPLLQVPPSPPA 579

Query: 2543 QQL-----HPPSPTEHEVDVKTPASKPRPDQAREDELHPKQAEKREGRRWRREPTVDSPS 2597
                     PP+P        T  S PR   A      P     R        P  D   
Sbjct: 580  SPTLQAPRRPPTP-----GPDTSVSGPRLTLALAP--GPPPPPSRSPSSTLSGP--DLAG 630

Query: 2598 HSEGKSNKKRGKLRGRRLREESILPVSADVISDGRGSRPSPAMASYAASPSHCLSVEGGP 2657
            HS   ++    +LRG     E     S    ++     P    A+++  P+  L+  G P
Sbjct: 631  HSSSATSTPE-ELRGYDSGPEGGAAASPPPDAELAACHP----AAWSRGPAPPLAFRGAP 685

Query: 2658 EADGEQPPRLATLGPGVMEGAAETDQEALCAGETGAQKPPGDRMLCPGRMDGAALGEQPT 2717
             A    PP     GPG  +G     +     G   A   PG   L PG   G + G+   
Sbjct: 686  GAPLPWPP---ATGPGSADGLCTIYE---TEGPESATPAPG--ALDPGPSPGTSGGKAAA 737

Query: 2718 GQ-KGASAR 2725
            G   GAS+R
Sbjct: 738  GAGAGASSR 746



 Score = 42.7 bits (99), Expect = 0.007
 Identities = 122/524 (23%), Positives = 167/524 (31%), Gaps = 96/524 (18%)

Query: 3424 GVRRPGAPGQKARAL--EGTLPSKRRRVAMPGSAPGPGEDR----PPPRGSSPILSEGSL 3477
            G  RPG  GQK   +  E T+   +   A   SA   G  R    P P   SP ++  S 
Sbjct: 122  GTTRPGPLGQKGLRISAEETVARGKATEAPKRSALSAGARRDTSGPTPGTPSPAMARRSR 181

Query: 3478 PALLHLCSEVAPSTTKGWPETLE--RPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALA 3535
             A           T  G P      RP  P   P +     S H      +  P PAA  
Sbjct: 182  AA----------GTEVGLPRPAPSARPRPPTEGPRKSVSSASEHS-----TTEPSPAA-- 224

Query: 3536 DGRGDCALDGALERPENEASPGSPGPLLQQAL--PLGASLPRPGARGQDAEGK-----RA 3588
              R   +  G L+RP + +   S  PL   A   P     PR  A     + K     R 
Sbjct: 225  --RRRPSAGGGLQRPASRSLSSSATPLSSPARSGPSARGTPRAPAHPSQPKPKGLQALRP 282

Query: 3589 PLVFSGKRRAPGARG------------------RCAPDHFQEDHLLQKEKEVSSSHMVSE 3630
            P V   ++ A  A G                  +  P      H      ++++   ++ 
Sbjct: 283  PQVTPPRKDAAPALGPLSSSPLATPSPSAALQSQAPPTLPATPHSSSLTCQLATPLPLAP 342

Query: 3631 GGPRG-----TFHKGSATKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELAR 3685
              P       T     AT P+   +S    +  +T S     P+ P       AP  LA 
Sbjct: 343  PSPSAPPSLQTLPSPPATPPSQATTSLGSPTLQATHSFLPSPPLSPLATPPPQAPPALAL 402

Query: 3686 G------TENGMKPATPKAKPGPSS---------QGSGSPRPGTKTGGGSQPQPASGQLQ 3730
                   +     P +P A P P +         Q   SP P         P PAS  + 
Sbjct: 403  PPLQAPPSPPASPPLSPLATPSPQAPNALAVHLLQAPFSPPPSPPVQAPFSP-PASPPV- 460

Query: 3731 SETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQGPHGSLGP---------KE 3781
            S +AT P++   PS +  P ++P    A            Q P     P         + 
Sbjct: 461  SPSATPPSQAP-PSLAAPPLQVPPSPPASPPMSPSATPPPQAPPPLAAPPLQLAKPPPQA 519

Query: 3782 KGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQATPS------RVLPTKPK 3835
                +T   +     PA       F  + S P  P  TP  QA P       +V P+ P 
Sbjct: 520  PPALATPPLQALPSPPASFPGQAPFSPSASLPMSPLATPPPQAPPVLAAPLLQVPPSPPA 579

Query: 3836 PNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPPKR 3879
              +   PR PP+      P  +    RL  A   G P   PP R
Sbjct: 580  SPTLQAPRRPPT----PGPDTSVSGPRLTLALAPGPP--PPPSR 617


>gi|4502951 collagen type III alpha 1 preproprotein [Homo sapiens]
          Length = 1466

 Score =  105 bits (263), Expect = 7e-22
 Identities = 310/1288 (24%), Positives = 388/1288 (30%), Gaps = 264/1288 (20%)

Query: 3    GERPRG-----APP--PTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQA 55
            G+ P+G      PP  P   GD        SPG P  P + ++ P      G +    Q 
Sbjct: 101  GQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPT-----GPQNYSPQY 155

Query: 56   QAMELPEAQPRQARDGELKPPSLRGQ-APSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEG 114
             + ++          G   P    G   P  T G  GSP +P  + P   P +       
Sbjct: 156  DSYDVKSGVAVGGLAGYPGPAGPPGPPGPPGTSGHPGSPGSPGYQGPPGEPGQAGPSGPP 215

Query: 115  SPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLR-PGLPRTEAQP 173
             PP    +G +    K      P  P        E   P  PG   P   PG P  +   
Sbjct: 216  GPPG--AIGPSGPAGKDGESGRPGRP-------GERGLPGPPGIKGPAGIPGFPGMKGHR 266

Query: 174  AAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAP-GPPQSRGTS--PLQPGSYPEYQAS 230
              +     +     P           +  P P  P G P  RG    P   G+     A 
Sbjct: 267  GFDGRNGEKGETGAPGLKGENGLPGENGAPGPMGPRGAPGERGRPGLPGAAGARGNDGAR 326

Query: 231  GADSWP----PAAENSFPGA--------------NFGVPPAEPEPIPKG-----SRPG-- 265
            G+D  P    P     FPG+              + G P    EP P+G       PG  
Sbjct: 327  GSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGAPGQRGEPGPQGHAGAQGPPGPP 386

Query: 266  ---GSPRGVSFQFP-----FPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEA 317
               GSP G     P      P L GA   P PA   G     G             P   
Sbjct: 387  GINGSPGGKGEMGPAGIPGAPGLMGARGPPGPAGANGAPGLRGGAGEPGKNGAKGEPGPR 446

Query: 318  VGTGPAYPLPTQPAPSPLPCYQGQPG--GLNRHSDLSGALSSPGAAHSAPRPFSDSLHKS 375
               G A  +P  P         G PG  G N     +G   +PG    A           
Sbjct: 447  GERGEA-GIPGVPGAKGEDGKDGSPGEPGANGLPGAAGERGAPGFRGPA----------G 495

Query: 376  LTKILPERPPSAQDGLGSTRGP------------PSSLPQRHFPGQAYRASGVDTSPGPP 423
               I  E+ P+ + G     GP            P     R  PG      G D  PGPP
Sbjct: 496  PNGIPGEKGPAGERGAPGPAGPRGAAGEPGRDGVPGGPGMRGMPGSP-GGPGSDGKPGPP 554

Query: 424  DT--ELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQR-------L 474
             +  E   PGPP    P+   P    +P P G   A  ++    G   PG +        
Sbjct: 555  GSQGESGRPGPPGPSGPR-GQPGVMGFPGPKGNDGAPGKNGERGGPGGPGPQGPPGKNGE 613

Query: 475  CLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQG--GSQGALGTAGKTPGPRE 532
              PQ  P P           P G + L  LP   G P   G  G  G  G AG    P  
Sbjct: 614  TGPQGPPGPTGPGGDKGDTGPPGPQGLQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGG 673

Query: 533  KLPAVRSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSE-- 590
            K  A    + G P L    G+   GA P      +    P G P       +   P E  
Sbjct: 674  KGDAGAPGERGPPGLAGAPGLRG-GAGPPGPEGGKGAAGPPGPPGAAGTPGLQGMPGERG 732

Query: 591  ---SPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSP 647
               SP P       G   +   P    P  P+       GP+GP      P    E G+P
Sbjct: 733  GLGSPGPKGDKGEPGGPGADGVPGKDGPRGPT-------GPIGPPGPAGQPGDKGEGGAP 785

Query: 648  -FPSPEPPHSLPTHY----QPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGL 702
              P    P   P        P PA  FP      G  G      E   P E  E G  G+
Sbjct: 786  GLPGIAGPRGSPGERGETGPPGPA-GFPGAPGQNGEPGG---KGERGAPGEKGEGGPPGV 841

Query: 703  QGFP----RAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLA 758
             G P     A PP P                                    R   G   A
Sbjct: 842  AGPPGGSGPAGPPGP------------------------------QGVKGERGSPGGPGA 871

Query: 759  RAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLP 818
                G +  PGPPG    P  P                    G + + GKD P       
Sbjct: 872  AGFPGARGLPGPPGSNGNPGPP--------------------GPSGSPGKDGP------- 904

Query: 819  SLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRG 878
                   P PA +             +  ++G +  +  P           ++   G +G
Sbjct: 905  -------PGPAGNTGAPG--------SPGVSGPKGDAGQP----------GEKGSPGAQG 939

Query: 879  PSSGHPLKSKAGVTPES--KAPP--PLPAATPDPQ-----TPRPGDRGCPA-RGRPKTRS 928
            P         AG+T       PP  P P  +P PQ     + +PG  G    RG P  + 
Sbjct: 940  PPGAPGPLGIAGITGARGLAGPPGMPGPRGSPGPQGVKGESGKPGANGLSGERGPPGPQG 999

Query: 929  L-GLAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLG 987
            L GLA T   A   GR    G          D     +GS  G G R     P      G
Sbjct: 1000 LPGLAGT---AGEPGRDGNPGS---------DGLPGRDGSPGGKGDRGENGSPGAPGAPG 1047

Query: 988  ERPPPRPRRPRTQAPGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWG 1047
               PP P  P  ++ G R +  P  P  A  P  +R +     P  + PR  K   G  G
Sbjct: 1048 HPGPPGPVGPAGKS-GDRGESGPAGPAGAPGPAGSRGA-----PGPQGPRGDKGETGERG 1101

Query: 1048 KELILKIVQQKNRLREYDFASESEEDEQPPPRG-------PGFRGRRG----RGEKRKEV 1096
               I              F         P P G       PG  G RG     G   K+ 
Sbjct: 1102 AAGI---------KGHRGFPGNPGAPGSPGPAGQQGAIGSPGPAGPRGPVGPSGPPGKDG 1152

Query: 1097 ELTQG-PREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGP-SRSLETGA 1154
              T G P    P  PR   R E G +G+P +P +PG   PGP   P A GP    +   A
Sbjct: 1153 --TSGHPGPIGPPGPR-GNRGERGSEGSPGHPGQPG--PPGP---PGAPGPCCGGVGAAA 1204

Query: 1155 AAREGGPKCADRPSVAPKDPLQVPTNTE 1182
             A  GG K          +P+    NT+
Sbjct: 1205 IAGIGGEKAGGFAPYYGDEPMDFKINTD 1232



 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 326/1305 (24%), Positives = 384/1305 (29%), Gaps = 303/1305 (23%)

Query: 74   KPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRYILGIASSRTKPTL 133
            +PP+  GQ P    G  G P  P        P +        PP     GI  S      
Sbjct: 97   RPPN--GQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPP-----GICES------ 143

Query: 134  DETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAEELGFHRCFQEPPSSFTS 193
               P  PQ  + Q    D   G   G     GL                           
Sbjct: 144  --CPTGPQNYSPQYDSYDVKSGVAVG-----GL--------------------------- 169

Query: 194  TNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPAAENSFPGANFGVPPA 253
              Y  P+  P P  PGPP + G  P  PGS P YQ               PG      P+
Sbjct: 170  AGYPGPAGPPGP--PGPPGTSG-HPGSPGS-PGYQGP-------------PGEPGQAGPS 212

Query: 254  EPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAW 313
             P P P G+     P G   +   P   G    P P  + G A   G      H+     
Sbjct: 213  GP-PGPPGAIGPSGPAGKDGESGRPGRPGERGLPGPPGIKGPAGIPGFPGMKGHRGFDGR 271

Query: 314  PEEAVGTGPAYPLPTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSLH 373
              E   TG     P     + LP   G PG +       G    PG   +A    +D   
Sbjct: 272  NGEKGETG----APGLKGENGLPGENGAPGPMGPRG-APGERGRPGLPGAAGARGNDGAR 326

Query: 374  KSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGPP 433
             S             DG     GPP +     FPG    A G     G P +   APG  
Sbjct: 327  GS-------------DGQPGPPGPPGT---AGFPGSP-GAKGEVGPAGSPGSN-GAPGQR 368

Query: 434  PARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPTAR- 492
                PQ       P P PPG           NG P     +     A +P    L  AR 
Sbjct: 369  GEPGPQGHAGAQGP-PGPPG----------INGSPGGKGEM---GPAGIPGAPGLMGARG 414

Query: 493  -PSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREK-----LPAVRSSQG---- 542
             P P G      L   AG P    G  GA G     PGPR +     +P V  ++G    
Sbjct: 415  PPGPAGANGAPGLRGGAGEP----GKNGAKG----EPGPRGERGEAGIPGVPGAKGEDGK 466

Query: 543  -GSPALFTYNGMTDPGA-----QPLFFGVAQPQVSP--------HGTPSLPPPRVVGASP 588
             GSP     NG+  PGA      P F G A P   P         G P    PR     P
Sbjct: 467  DGSPGEPGANGL--PGAAGERGAPGFRGPAGPNGIPGEKGPAGERGAPGPAGPRGAAGEP 524

Query: 589  SESPLPSPATNTAGSTCSSLSPMSSSPANP--SSEESQLPGPLGPSAFFHPPTHPQETGS 646
                +P       G   S   P S     P  S  ES  PGP GPS    P   P   G 
Sbjct: 525  GRDGVPG-GPGMRGMPGSPGGPGSDGKPGPPGSQGESGRPGPPGPSG---PRGQPGVMG- 579

Query: 647  PFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGFP 706
             FP P+     P           P P    G  G     E  P    GP  G GG +G  
Sbjct: 580  -FPGPKGNDGAPGKNGERGGPGGPGPQGPPGKNG-----ETGPQGPPGP-TGPGGDKGDT 632

Query: 707  RAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQR 766
              P P                                          G      ++G   
Sbjct: 633  GPPGPQGLQGLP-----------------------------------GTGGPPGENGKPG 657

Query: 767  SPGPPGLPSPPAAPRVPADAHA-------------GLLSHAKTFLLAGDAQAEGKDDPLR 813
             PGP G    P AP    DA A             GL   A      G   A G   P  
Sbjct: 658  EPGPKGDAGAPGAPGGKGDAGAPGERGPPGLAGAPGLRGGAGPPGPEGGKGAAGPPGPPG 717

Query: 814  TGFLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEP 873
                P L   P              +   L +    G + +   P  D     V   + P
Sbjct: 718  AAGTPGLQGMP-------------GERGGLGSPGPKGDKGEPGGPGADG----VPGKDGP 760

Query: 874  SGPRGP-----SSGHPLKSKAGVTP--------------ESKAPPPLPAATPDP--QTPR 912
             GP GP      +G P     G  P                +  PP PA  P    Q   
Sbjct: 761  RGPTGPIGPPGPAGQPGDKGEGGAPGLPGIAGPRGSPGERGETGPPGPAGFPGAPGQNGE 820

Query: 913  PGDRGCPARGRPKTRSLGLAPTEADAP-SQGRQQRRGKQ-LKLFRKDLDSGGAAEGSGSG 970
            PG +G   RG P  +  G  P  A  P   G     G Q +K  R      GAA   G+ 
Sbjct: 821  PGGKG--ERGAPGEKGEGGPPGVAGPPGGSGPAGPPGPQGVKGERGSPGGPGAAGFPGAR 878

Query: 971  G-----GGRASGLRPRRNDGLGERPPPRPRRPRTQAPGSRADPAPRVPRAAALPEETRSS 1025
            G     G   +   P  +   G+  PP P    T APGS     P+    A  P E  S 
Sbjct: 879  GLPGPPGSNGNPGPPGPSGSPGKDGPPGP-AGNTGAPGSPGVSGPK--GDAGQPGEKGSP 935

Query: 1026 RRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRG-PGFR 1084
              +  P    P       GA G                      +     P PRG PG +
Sbjct: 936  GAQGPPGAPGPLGIAGITGARGL---------------------AGPPGMPGPRGSPGPQ 974

Query: 1085 GRRGRGEKRKEVELT--QGPREDEPQKPRKAARQEAGGDGAPANPEEPG--GSRPGPGRS 1140
            G +G   K     L+  +GP   +          E G DG P +   PG  GS  G G  
Sbjct: 975  GVKGESGKPGANGLSGERGPPGPQGLPGLAGTAGEPGRDGNPGSDGLPGRDGSPGGKGDR 1034

Query: 1141 PQARGPSRSLETGAAAREGGP-------KCADRPSVAPKDPLQVPTNTETSEETRPSLDF 1193
             +   P      GA    G P       K  DR    P  P   P          P    
Sbjct: 1035 GENGSPG---APGAPGHPGPPGPVGPAGKSGDRGESGPAGPAGAP--GPAGSRGAPGPQG 1089

Query: 1194 PQEAKEPETAEESAPDSTEFTEALRSPPA----ACAGEMGA--SPGLLIPEQP-----PP 1242
            P+  K  ET E  A           +P A      AG+ GA  SPG   P  P     PP
Sbjct: 1090 PRGDK-GETGERGAAGIKGHRGFPGNPGAPGSPGPAGQQGAIGSPGPAGPRGPVGPSGPP 1148

Query: 1243 SRHDT----GTPKPSGSLANTAPHGSSPTPGVGSLLGGPGGTQAP 1283
             +  T    G   P G   N    GS  +PG     G PG   AP
Sbjct: 1149 GKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAP 1193



 Score = 92.8 bits (229), Expect = 6e-18
 Identities = 332/1377 (24%), Positives = 411/1377 (29%), Gaps = 354/1377 (25%)

Query: 140  PQLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAEELGFHRCFQEPPSSFTSTNYTSP 199
            P     + P    PQGP  G P  PG+P     P                         P
Sbjct: 91   PPTAPTRPPNGQGPQGP-KGDPGPPGIPGRNGDPGI-----------------------P 126

Query: 200  SATPRPPAPGPPQSRGTSPLQPGSY-PEYQASGADSWPPAAENS-FPGANFGVPPAEPEP 257
                 P +PGPP    + P  P +Y P+Y +    S       + +PG     PP  P P
Sbjct: 127  GQPGSPGSPGPPGICESCPTGPQNYSPQYDSYDVKSGVAVGGLAGYPGP--AGPPGPPGP 184

Query: 258  IPKGSRPGGSPRGVSFQFP--FPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPE 315
                  PG SP    +Q P   P   G S  P P    G    +GP        +   P 
Sbjct: 185  PGTSGHPG-SPGSPGYQGPPGEPGQAGPSGPPGPPGAIG---PSGPAGKDGESGRPGRPG 240

Query: 316  EAVGTGPAYPLPTQPAPSPLPCYQGQPG--GLNRHSDLSGALSSPGAAHSAPRPFSDSLH 373
            E    GP    P    P+ +P + G  G  G +  +   G   +PG              
Sbjct: 241  ERGLPGP----PGIKGPAGIPGFPGMKGHRGFDGRNGEKGETGAPGL------------- 283

Query: 374  KSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYR-----ASGVDTSPGPPDTELA 428
                          ++GL    G P  +  R  PG+  R     A+G   + G   ++  
Sbjct: 284  ------------KGENGLPGENGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSD-G 330

Query: 429  APGPPPARLPQLWDPTAAPYPTPPG--GPLAATRSMFFNGQPSPGQR-LCLPQS-APLPW 484
             PGPP         P  A +P  PG  G +    S   NG  +PGQR    PQ  A    
Sbjct: 331  QPGPPGP-------PGTAGFPGSPGAKGEVGPAGSPGSNG--APGQRGEPGPQGHAGAQG 381

Query: 485  PQVLPTARPSPHGMEMLSRLPFP-------AGGPEWQGGSQGALGTAGKT---------- 527
            P   P    SP G   +     P       A GP    G+ GA G  G            
Sbjct: 382  PPGPPGINGSPGGKGEMGPAGIPGAPGLMGARGPPGPAGANGAPGLRGGAGEPGKNGAKG 441

Query: 528  -PGPREK-----LPAVRSSQG-----GSPALFTYNGMTDPGAQ-----PLFFGVAQPQVS 571
             PGPR +     +P V  ++G     GSP     NG+  PGA      P F G A P   
Sbjct: 442  EPGPRGERGEAGIPGVPGAKGEDGKDGSPGEPGANGL--PGAAGERGAPGFRGPAGPNGI 499

Query: 572  P--------HGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEES 623
            P         G P    PR     P    +P             +  M  SP  P S+  
Sbjct: 500  PGEKGPAGERGAPGPAGPRGAAGEPGRDGVPGGP---------GMRGMPGSPGGPGSDGK 550

Query: 624  QLPGPLGPSAFFHPPTHPQETGSPFP-SPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAF 682
              PGP G            E+G P P  P  P   P          FP P    GA G  
Sbjct: 551  --PGPPGSQG---------ESGRPGPPGPSGPRGQPG------VMGFPGPKGNDGAPGKN 593

Query: 683  QCLEETPFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSS 742
                    P      G+ G  G P+ PP  PT          D+ D              
Sbjct: 594  GERGGPGGPGPQGPPGKNGETG-PQGPPG-PT------GPGGDKGDT------------- 632

Query: 743  LAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGD 802
                       G    +   G   + GPPG    P  P    DA A      K     GD
Sbjct: 633  -----------GPPGPQGLQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGGK-----GD 676

Query: 803  AQAEGKDDPLRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDS 862
            A A G+  P      P LA  P                       L G            
Sbjct: 677  AGAPGERGP------PGLAGAP----------------------GLRG------------ 696

Query: 863  SFIDVFADEEPSGPRGPSSGHPLKSKAGVTPESKAPPPLPAATPDPQTPRPGDRGCPARG 922
                       +GP GP  G       G        PP  A TP  Q   PG+RG     
Sbjct: 697  ----------GAGPPGPEGGKGAAGPPG--------PPGAAGTPGLQG-MPGERGGLGSP 737

Query: 923  RPKTRSLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLR--- 979
             PK          AD    G+   RG         +   G A   G  G G A GL    
Sbjct: 738  GPKGDKGEPGGPGADGVP-GKDGPRGPT-----GPIGPPGPAGQPGDKGEGGAPGLPGIA 791

Query: 980  -PRRNDG-LGERPPPRPRRPRTQAPGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPR 1037
             PR + G  GE  PP P      APG   +P  +  R A  P E         P    P 
Sbjct: 792  GPRGSPGERGETGPPGPAG-FPGAPGQNGEPGGKGERGA--PGEKGEGGP---PGVAGPP 845

Query: 1038 KRKARGGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRGPG---FRGRRGRGEKRK 1094
                  G  G + +                    + E+  P GPG   F G RG      
Sbjct: 846  GGSGPAGPPGPQGV--------------------KGERGSPGGPGAAGFPGARGLPGPPG 885

Query: 1095 EVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPG----GSRPGPGRSPQARGPSRSL 1150
                  GP        +      AG  GAP +P   G      +PG   SP A+GP  + 
Sbjct: 886  S-NGNPGPPGPSGSPGKDGPPGPAGNTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAP 944

Query: 1151 E-------TGAAAREG-----GPKCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAK 1198
                    TGA    G     GP+ +  P     +  +   N  + E   P    PQ   
Sbjct: 945  GPLGIAGITGARGLAGPPGMPGPRGSPGPQGVKGESGKPGANGLSGERGPPG---PQGLP 1001

Query: 1199 E-PETAEESAPDSTEFTEAL--RSPPAACAGEMGAS-----------PGLLIPEQPPPSR 1244
                TA E   D    ++ L  R       G+ G +           PG   P  P    
Sbjct: 1002 GLAGTAGEPGRDGNPGSDGLPGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPAGKS 1061

Query: 1245 HDTGTPKPSGSLANTAPHGSSPTPGVGSLLGGPGGTQAPVSHNSKDPPARQPGEFLAPVA 1304
             D G   P+G      P GS   P       GP G +       +   A   G    P  
Sbjct: 1062 GDRGESGPAGPAGAPGPAGSRGAP-------GPQGPRGDKGETGERGAAGIKGHRGFP-G 1113

Query: 1305 NPSSTACPKPSVLSSKISSFGCDPAGFNRDPLGV--PVAKKG----PQPYSSPHSELFLG 1358
            NP +   P P+     I S G  PAG  R P+G   P  K G    P P   P      G
Sbjct: 1114 NPGAPGSPGPAGQQGAIGSPG--PAG-PRGPVGPSGPPGKDGTSGHPGPIGPPGPRGNRG 1170

Query: 1359 PKDLAGCFLEELHPKPSARDAPPASSSCLCQ----------DGEDAGSLEPQLPRSP 1405
             +   G      HP       PP +    C            GE AG   P     P
Sbjct: 1171 ERGSEG---SPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEP 1224



 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 208/834 (24%), Positives = 252/834 (30%), Gaps = 189/834 (22%)

Query: 1    MPGER-------PRGAPP----PTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAR 49
            +PGE        PRGAP     P + G    R    + G   QP      P T    G+ 
Sbjct: 289  LPGENGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPG-PPGPPGTAGFPGSP 347

Query: 50   EAGGQAQAMELPEAQPRQARDGELKPPSLRG-QAPSSTPGKRGSP--------------- 93
             A G+      P +     + GE  P    G Q P   PG  GSP               
Sbjct: 348  GAKGEVGPAGSPGSNGAPGQRGEPGPQGHAGAQGPPGPPGINGSPGGKGEMGPAGIPGAP 407

Query: 94   -----QTPPGRSPLQAPSRLAGRA--------EGSPPQRY------ILGIASSRTKPTLD 134
                 + PPG +       L G A        +G P  R       I G+  ++ +   D
Sbjct: 408  GLMGARGPPGPAGANGAPGLRGGAGEPGKNGAKGEPGPRGERGEAGIPGVPGAKGEDGKD 467

Query: 135  ETPENPQLEAAQLPEVDTPQG-PGTGAPLRPGLPRTEAQPAAEE-----LGFHRCFQEPP 188
             +P  P   A  LP     +G PG   P  P     E  PA E       G      EP 
Sbjct: 468  GSPGEPG--ANGLPGAAGERGAPGFRGPAGPNGIPGEKGPAGERGAPGPAGPRGAAGEPG 525

Query: 189  SSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPAAENSFPGANF 248
                      P     P +PG P S G  P  PGS  E    G    PP      P    
Sbjct: 526  RDGVPGG---PGMRGMPGSPGGPGSDG-KPGPPGSQGESGRPG----PPG-----PSGPR 572

Query: 249  GVPPAEPEPIPKGS--RPG-----GSPRGVSFQFPFPALHGASTK---PFPADVAGHAFT 298
            G P     P PKG+   PG     G P G   Q P P  +G +     P P    G    
Sbjct: 573  GQPGVMGFPGPKGNDGAPGKNGERGGPGGPGPQGP-PGKNGETGPQGPPGPTGPGGDKGD 631

Query: 299  NGPLVFAFHQPQGAWPEEAVGTGPAYP-LPTQPAPSPLPCYQGQPGGLNRHSDLSGALSS 357
             GP       PQG       G  P     P +P P       G PGG    +   G    
Sbjct: 632  TGP-----PGPQGLQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGGKG-DAGAPGERGP 685

Query: 358  PGAAHSAPRPFSDSLHKSLTKILPERPPSAQDGLGSTR--GPPSSLPQRHFPGQAYRASG 415
            PG A  AP     +            PP  + G G+    GPP +       G      G
Sbjct: 686  PGLA-GAPGLRGGA-----------GPPGPEGGKGAAGPPGPPGAAGTPGLQGMPGERGG 733

Query: 416  VDTSPGPPDTELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLC 475
            +  SPGP   +    GP    +P    P     P  P GP          G P       
Sbjct: 734  LG-SPGPKGDKGEPGGPGADGVPGKDGPRGPTGPIGPPGPAGQPGDKGEGGAPG------ 786

Query: 476  LPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKLP 535
            LP  A        P   P   G            GP    G  GA G  G+  G  E+  
Sbjct: 787  LPGIAG-------PRGSPGERGET----------GPPGPAGFPGAPGQNGEPGGKGERGA 829

Query: 536  AVRSSQGGSPALFTYNGMTDPGAQPLFFGV-----------------AQPQVSPHGTPSL 578
                 +GG P +    G + P   P   GV                 A+    P G+   
Sbjct: 830  PGEKGEGGPPGVAGPPGGSGPAGPPGPQGVKGERGSPGGPGAAGFPGARGLPGPPGSNGN 889

Query: 579  PPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQ-------LPGPL-- 629
            P P     SP +   P PA NT       +S        P  + S         PGPL  
Sbjct: 890  PGPPGPSGSPGKDGPPGPAGNTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGPLGI 949

Query: 630  ----GPSAFFHPPTHPQETGSPFP-------------------SPEPPHSLP--THYQPE 664
                G      PP  P   GSP P                    P  P  LP       E
Sbjct: 950  AGITGARGLAGPPGMPGPRGSPGPQGVKGESGKPGANGLSGERGPPGPQGLPGLAGTAGE 1009

Query: 665  PAKAFPFPADGL-GAEGAFQCLEETPFPHEGPEVGRGGLQGFPRAP----PPYP 713
            P +     +DGL G +G+         P    + G  G  G P AP    PP P
Sbjct: 1010 PGRDGNPGSDGLPGRDGS---------PGGKGDRGENGSPGAPGAPGHPGPPGP 1054



 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 217/902 (24%), Positives = 274/902 (30%), Gaps = 155/902 (17%)

Query: 649  PSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGFPRA 708
            P+PE P        P+P  A   P +G G +G          P    + G  G  G P +
Sbjct: 75   PNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGS 134

Query: 709  PPP------YPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKD 762
            P P       PT   + S    D  DV     +       LA +       G        
Sbjct: 135  PGPPGICESCPTGPQNYSP-QYDSYDV-----KSGVAVGGLAGYPGPAGPPGPPGPPGTS 188

Query: 763  GHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAA 822
            GH  SPG PG   PP  P       AG           G +   GKD        P    
Sbjct: 189  GHPGSPGSPGYQGPPGEP-----GQAGPSGPPGPPGAIGPSGPAGKDGESGRPGRPGERG 243

Query: 823  TPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSG 882
             P P                     + G      +   D            +G +G +  
Sbjct: 244  LPGPPGIKG-------------PAGIPGFPGMKGHRGFDGR----------NGEKGETGA 280

Query: 883  HPLKSKAGVTPESKAPPPLPAATPDPQTPRPGDRGCP-ARGRPKTRSLGLAPTEADAPSQ 941
              LK + G+  E+ AP P+       +  RPG  G   ARG    R     P     P  
Sbjct: 281  PGLKGENGLPGENGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGT 340

Query: 942  GRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLR--PRRNDGLGERPPPRPRRPRT 999
                        F     + G    +GS G   A G R  P      G + PP P     
Sbjct: 341  AG----------FPGSPGAKGEVGPAGSPGSNGAPGQRGEPGPQGHAGAQGPPGPPGING 390

Query: 1000 QAPGSRADPAPR-VPRAAAL--------PEETRSSRRRRLPPRKDPRKRKARG-----GA 1045
             +PG + +  P  +P A  L        P     +   R     +P K  A+G     G 
Sbjct: 391  -SPGGKGEMGPAGIPGAPGLMGARGPPGPAGANGAPGLR-GGAGEPGKNGAKGEPGPRGE 448

Query: 1046 WGKELILKIVQQKNRLREYDFASESEEDEQPPPRG----PGFRGRRGRGEKRKEVELTQG 1101
             G+  I  +   K    +     E   +  P   G    PGFRG  G      E    +G
Sbjct: 449  RGEAGIPGVPGAKGEDGKDGSPGEPGANGLPGAAGERGAPGFRGPAGPNGIPGE----KG 504

Query: 1102 PREDE----PQKPRKAARQEAGGDGAPANPEEPG--GSRPGPGRSPQARGPSRSLETGAA 1155
            P  +     P  PR AA  E G DG P  P   G  GS  GPG   +   P    E+G  
Sbjct: 505  PAGERGAPGPAGPRGAAG-EPGRDGVPGGPGMRGMPGSPGGPGSDGKPGPPGSQGESGRP 563

Query: 1156 AREGGPKCADRPSV----APKDPLQVPTNTETSEETRPSLDFPQ--EAKEPETAEESAPD 1209
               G      +P V     PK     P   +  E   P    PQ    K  ET  +  P 
Sbjct: 564  GPPGPSGPRGQPGVMGFPGPKGNDGAPG--KNGERGGPGGPGPQGPPGKNGETGPQGPPG 621

Query: 1210 STEFTEALRSPPAACAGEMGAS-----PGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGS 1264
             T         P    G+ G        GL     PP      G P P G        G 
Sbjct: 622  PTG--------PGGDKGDTGPPGPQGLQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGG 673

Query: 1265 SPTPGVGSLLGGPGGTQAPVSHNSKDPPARQPGEFLA-PVANPSSTACPKPSVLSSKISS 1323
                G     G PG   AP       PP  + G+  A P   P +   P    +  +   
Sbjct: 674  KGDAGAPGERGPPGLAGAPGLRGGAGPPGPEGGKGAAGPPGPPGAAGTPGLQGMPGERGG 733

Query: 1324 FGC--------DPAGFNRDPLGVPVAKKGPQPYSSPHSELFLGPKDLAGCFLEELHPKPS 1375
             G         +P G   D  GVP  K GP+  + P     +GP   AG       P   
Sbjct: 734  LGSPGPKGDKGEPGGPGAD--GVP-GKDGPRGPTGP-----IGPPGPAG------QPGDK 779

Query: 1376 ARDAPPASSSCLCQDGEDAGSLEPQLPRSPPGT-AETEPGRAASPPTLESSSLFPDLPVD 1434
                 P            AG      PR  PG   ET P   A          FP  P  
Sbjct: 780  GEGGAPGLPGI-------AG------PRGSPGERGETGPPGPAG---------FPGAPGQ 817

Query: 1435 RFDPPLYGSLSA--NRDSGLPFACADPPQKTVPSDPPYPSFLLLEEVSPMLP--SHFPDL 1490
              +P   G   A   +  G P   A PP  + P+ PP P  +  E  SP  P  + FP  
Sbjct: 818  NGEPGGKGERGAPGEKGEGGPPGVAGPPGGSGPAGPPGPQGVKGERGSPGGPGAAGFPGA 877

Query: 1491 SG 1492
             G
Sbjct: 878  RG 879



 Score = 73.2 bits (178), Expect = 5e-12
 Identities = 232/966 (24%), Positives = 302/966 (31%), Gaps = 201/966 (20%)

Query: 1622 VQGRPGGTWPCPASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQPVQKAGASKTGLCQ 1681
            + G PGG      +  PG   L+           P  P GAN    P  + GA + G   
Sbjct: 388  INGSPGGKGEMGPAGIPGAPGLMGAR-------GPPGPAGANG--APGLRGGAGEPGKNG 438

Query: 1682 AEGDSRPPQDVCLPEPSKQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRLLP 1741
            A+G+               PGP+ + G         E   P         + ED     P
Sbjct: 439  AKGE---------------PGPRGERG---------EAGIP----GVPGAKGEDGKDGSP 470

Query: 1742 CEQRGGFLPEPGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPSH 1801
             E     LP  G A +  RGAP    F  PA    P+    G+  P  +   P  A P  
Sbjct: 471  GEPGANGLP--GAAGE--RGAPG---FRGPA---GPN-GIPGEKGPAGERGAPGPAGPRG 519

Query: 1802 AA--QGHSAGRAGGHLHPTAGRPGFEGNEFAPA-----GASSLTAPRGREAWLVPVPSPA 1854
            AA   G      G  +    G PG  G++  P      G S    P G      P   P 
Sbjct: 520  AAGEPGRDGVPGGPGMRGMPGSPGGPGSDGKPGPPGSQGESGRPGPPGPSG---PRGQPG 576

Query: 1855 CVSNTHPSRRSQDPALSPPIRQLQLPGPGVAKSKDGILGLQ----ELTPAAQS----PPR 1906
             +    P      P  +        PGP     K+G  G Q       P        PP 
Sbjct: 577  VMGFPGPKGNDGAPGKNGERGGPGGPGPQGPPGKNGETGPQGPPGPTGPGGDKGDTGPP- 635

Query: 1907 VNPSGLEGGTVEGGKVACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQG 1966
              P GL+G    GG        G PG       P   G +    A G  G  G A     
Sbjct: 636  -GPQGLQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGPPGLAGAPGL 694

Query: 1967 QGTANQLQPENGVSPGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEP 2026
            +G A    PE G    G         +P         G +     KG +        A+ 
Sbjct: 695  RGGAGPPGPEGGKGAAGPPGPPGAAGTPGLQGMPGERGGLGSPGPKGDKGEPG-GPGADG 753

Query: 2027 TPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAPSVGDLAACA 2086
             P    P   +  +       + G +G       +PGL  P +A    P  S G+     
Sbjct: 754  VPGKDGPRGPTGPIGPPGPAGQPGDKG----EGGAPGL--PGIA---GPRGSPGERGETG 804

Query: 2087 -PSPTSAAHMPCSLGP--------LPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQL 2137
             P P      P   G          P E     P    G  GG  PA      PPGPQ +
Sbjct: 805  PPGPAGFPGAPGQNGEPGGKGERGAPGEKGEGGPPGVAGPPGGSGPAG-----PPGPQGV 859

Query: 2138 LACSPAWAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCDPKEALAGCLLQGEGSPLEDP 2197
                          G  A    GA   P  PP    +P  P  +         GSP +D 
Sbjct: 860  K------GERGSPGGPGAAGFPGARGLP-GPPGSNGNPGPPGPS---------GSPGKDG 903

Query: 2198 SSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRA 2257
               P G+  A         P    +  P+    +     PG   SP   GA  P  A   
Sbjct: 904  PPGPAGNTGA---------PGSPGVSGPKGDAGQ-----PGEKGSP---GAQGPPGAPGP 946

Query: 2258 TGLSSTPTGDEAQAG-RGLPGPDPQSRGAPPHTNPDRMPRG--HSSYSPSNTARLGHREG 2314
             G++   TG    AG  G+PGP    RG+P        P+G    S  P      G R  
Sbjct: 947  LGIAGI-TGARGLAGPPGMPGP----RGSPG-------PQGVKGESGKPGANGLSGER-- 992

Query: 2315 QAVTAVPTEPPTLQGAGPDSPACLEGEMGTSSKEPEDPGTPETGRSGATKMPRVTCPSTG 2374
                            GP  P  L G  GT+ +   D      G  G+  +P        
Sbjct: 993  ----------------GPPGPQGLPGLAGTAGEPGRD------GNPGSDGLP-------- 1022

Query: 2375 LGLGRTTAPSSTASDFQSDSPQSHRNASHQTPQGDPLGPQDLKQRSRGYKKKPASTEN-- 2432
               GR  +P       ++ SP +     H  P G P+GP   K   RG +  PA      
Sbjct: 1023 ---GRDGSPGGKGDRGENGSPGAPGAPGHPGPPG-PVGPAG-KSGDRG-ESGPAGPAGAP 1076

Query: 2433 ---GQWKGQAPHGPVTCEVCAASFRSGPGLSRHKARKHRPHPGAPAEPSPA----ALPAQ 2485
               G      P GP   +      R   G+  H  R    +PGAP  P PA    A+ + 
Sbjct: 1077 GPAGSRGAPGPQGP-RGDKGETGERGAAGIKGH--RGFPGNPGAPGSPGPAGQQGAIGSP 1133

Query: 2486 QPLEPLAQKCQPPRKKSHRVSGKERPNHSRGDPSHVTQPPPAQGSKEVLRAPGSP-HSQQ 2544
             P  P         +     SG    + + G P  +  PP  +G++    + GSP H  Q
Sbjct: 1134 GPAGP---------RGPVGPSGPPGKDGTSGHPGPI-GPPGPRGNRGERGSEGSPGHPGQ 1183

Query: 2545 LHPPSP 2550
              PP P
Sbjct: 1184 PGPPGP 1189



 Score = 68.9 bits (167), Expect = 9e-11
 Identities = 259/1075 (24%), Positives = 333/1075 (30%), Gaps = 206/1075 (19%)

Query: 480  APLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQG-----GSQGALGTAGKTPGPREKL 534
            A  P P   PT  P+  G +     P P G P   G     G  G+ G+ G  PG  E  
Sbjct: 86   AVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGP-PGICESC 144

Query: 535  PAVRSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLP 594
            P     Q  SP   +Y+  +         GVA   ++ +  P+ PP       P   P  
Sbjct: 145  PT--GPQNYSPQYDSYDVKS---------GVAVGGLAGYPGPAGPP------GPPGPPGT 187

Query: 595  SPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHP------PTHPQETGSPF 648
            S    + GS      P     A PS      PG +GPS           P  P E G P 
Sbjct: 188  SGHPGSPGSPGYQGPPGEPGQAGPSGPPGP-PGAIGPSGPAGKDGESGRPGRPGERGLPG 246

Query: 649  PSP-EPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHE-------GP----- 695
            P   + P  +P     +  + F       G  GA     E   P E       GP     
Sbjct: 247  PPGIKGPAGIPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGENGAPGPMGPRGAPG 306

Query: 696  EVGRGGLQGF---------------PRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNY 740
            E GR GL G                P  P P  T  F  S  +  ++             
Sbjct: 307  ERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGP----------- 355

Query: 741  SSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLA 800
               A         G        GH  + GPPG P    +P        G +  A      
Sbjct: 356  ---AGSPGSNGAPGQRGEPGPQGHAGAQGPPGPPGINGSP-----GGKGEMGPAGIPGAP 407

Query: 801  GDAQAEGKDDPLRTGFLPSL----------AATPFPLPASDLDMEDDAKLDSLITEALNG 850
            G   A G   P      P L           A   P P  +     +A +  +      G
Sbjct: 408  GLMGARGPPGPAGANGAPGLRGGAGEPGKNGAKGEPGPRGE---RGEAGIPGV--PGAKG 462

Query: 851  MEYQSDNP-EIDSSFIDVFADEEPS-GPRGPSSGHPLKSKAGVTPESKAPPPLPAATPDP 908
             + +  +P E  ++ +   A E  + G RGP+  + +  + G   E  AP P   A P  
Sbjct: 463  EDGKDGSPGEPGANGLPGAAGERGAPGFRGPAGPNGIPGEKGPAGERGAPGP---AGPRG 519

Query: 909  QTPRPGDRGCPARGRPKTRSLGLAPTEADAPSQGRQQRRGKQLKLFR------------- 955
                PG  G P  G P  R  G+  +     S G+    G Q +  R             
Sbjct: 520  AAGEPGRDGVP--GGPGMR--GMPGSPGGPGSDGKPGPPGSQGESGRPGPPGPSGPRGQP 575

Query: 956  --------KDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPPRPRRPRTQAPGSRAD 1007
                    K  D      G   G GG      P +N   G + PP P  P     G + D
Sbjct: 576  GVMGFPGPKGNDGAPGKNGERGGPGGPGPQGPPGKNGETGPQGPPGPTGPG----GDKGD 631

Query: 1008 PAPRVPRAA-ALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKN------- 1059
              P  P+    LP           P    P+      GA G +       ++        
Sbjct: 632  TGPPGPQGLQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGPPGLAGA 691

Query: 1060 ---RLREYDFASESEEDEQPPPRGPGFRGRRG-RGEKRKEVEL-TQGPREDEPQKPRKAA 1114
               R        E  +    PP  PG  G  G +G   +   L + GP+ D+ +     A
Sbjct: 692  PGLRGGAGPPGPEGGKGAAGPPGPPGAAGTPGLQGMPGERGGLGSPGPKGDKGEPGGPGA 751

Query: 1115 RQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLET-GAAAREGGPKCADRPSVAPKD 1173
                G DG P  P  P G  PGP   P  +G   +    G A   G P   +R    P  
Sbjct: 752  DGVPGKDG-PRGPTGPIGP-PGPAGQPGDKGEGGAPGLPGIAGPRGSP--GERGETGPPG 807

Query: 1174 PLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEALRSP-----PAACAGEM 1228
            P   P     + E         E   P    E  P           P     P    GE 
Sbjct: 808  PAGFPGAPGQNGEPGGK----GERGAPGEKGEGGPPGVAGPPGGSGPAGPPGPQGVKGER 863

Query: 1229 GASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSLLGGPGGTQAPVSHNS 1288
            G SPG       P +R   G P P GS  N  P G S +PG     G  G T AP S   
Sbjct: 864  G-SPGGPGAAGFPGAR---GLPGPPGSNGNPGPPGPSGSPGKDGPPGPAGNTGAPGSPGV 919

Query: 1289 KDP--PARQPGEFLAPVANPSSTACPKPSVLSSKISSFGCDPAGFNRDPLGVPVAKKGPQ 1346
              P   A QPGE  +P A       P P  ++    + G   AG    P G+P  +  P 
Sbjct: 920  SGPKGDAGQPGEKGSPGAQ-GPPGAPGPLGIAGITGARGL--AG----PPGMPGPRGSPG 972

Query: 1347 PYSSPHSELFLGPKDLAGCFLEELHPKPSARDAPPASSSCLCQDGEDAGSLEPQLPRSPP 1406
            P          G K  +G        KP A                 +G   P  P+  P
Sbjct: 973  PQ---------GVKGESG--------KPGANGL--------------SGERGPPGPQGLP 1001

Query: 1407 GTAET--EPGRAASPPTLESSSLFPDLPVDRFDPPLYGSLSANRDSGLPFACADP 1459
            G A T  EPGR  +P +         LP     P   G    N   G P A   P
Sbjct: 1002 GLAGTAGEPGRDGNPGS-------DGLPGRDGSPGGKGDRGENGSPGAPGAPGHP 1049



 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 264/1160 (22%), Positives = 352/1160 (30%), Gaps = 233/1160 (20%)

Query: 1119 GGDGAPANPEEPGGSRP-GPGRSPQARGPS----RSLETGAAAREGGPKCADRPSVAPKD 1173
            G  G    P EPG + P GP   P A GPS    +  E+G   R G       P +  K 
Sbjct: 195  GSPGYQGPPGEPGQAGPSGPPGPPGAIGPSGPAGKDGESGRPGRPGERGLPGPPGI--KG 252

Query: 1174 PLQVPTNTETSEETRPSLDFPQ-------EAKEPETAEESAPDSTEFTEALRSPPAACAG 1226
            P  +P              FP        + +  E  E  AP                 G
Sbjct: 253  PAGIP-------------GFPGMKGHRGFDGRNGEKGETGAPGL--------KGENGLPG 291

Query: 1227 EMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSLLGGPGGTQAPVSH 1286
            E GA PG + P   P  R   G P  +G+  N    GS   PG     G PG    P S 
Sbjct: 292  ENGA-PGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPP---GPPGTAGFPGSP 347

Query: 1287 NSKDPPARQPGEFLAPVANPSSTACP----KPSVLSSKISSFGCDPAGFNRDPLGVPVAK 1342
             +K       GE + P  +P S   P    +P       +     P G N    G P  K
Sbjct: 348  GAK-------GE-VGPAGSPGSNGAPGQRGEPGPQGHAGAQGPPGPPGIN----GSPGGK 395

Query: 1343 KGPQPYSSPHSELFLGPKDLAGCFLEELHPKPSARDAPPASSSCLCQDGEDAGSLEPQLP 1402
                P   P +   +G +           P P+  +  P       + G++    EP  P
Sbjct: 396  GEMGPAGIPGAPGLMGARG---------PPGPAGANGAPGLRGGAGEPGKNGAKGEPG-P 445

Query: 1403 RSPPGTA--------ETEPGRAASPPTLESSSLFPDLPVDRFDPPLYGSLSANRDSGLPF 1454
            R   G A        + E G+  SP    ++ L P    +R  P   G    N   G+P 
Sbjct: 446  RGERGEAGIPGVPGAKGEDGKDGSPGEPGANGL-PGAAGERGAPGFRGPAGPN---GIPG 501

Query: 1455 ACADPPQKTVPSDPPYPSFLLLEEVSPMLPSH-----FPDLSGGKVLSKTCPPERTVVPG 1509
                  ++  P  P  P     E     +P        P   GG        P  +    
Sbjct: 502  EKGPAGERGAPG-PAGPRGAAGEPGRDGVPGGPGMRGMPGSPGGPGSDGKPGPPGSQGES 560

Query: 1510 AAPSLPG-KGSGCSVALMSHLSEDELEIQKLVTELESQLQRSKDTRGAPRELAEAESVGR 1568
              P  PG  G      +M                        K   GAP +  E    G 
Sbjct: 561  GRPGPPGPSGPRGQPGVMG-------------------FPGPKGNDGAPGKNGERGGPG- 600

Query: 1569 VELGTGTE-PPSQRRTCQATVPHEDTFSAADLTRVGESTAHREGAESAVATVEAVQGRPG 1627
               G G + PP +        P   T    D    G                + +QG PG
Sbjct: 601  ---GPGPQGPPGKNGETGPQGPPGPTGPGGDKGDTGPPGP------------QGLQGLPG 645

Query: 1628 GTWPCPASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQPVQKAGASKTGLCQAEGDSR 1687
               P   +  PG     P  + D  +GAP +P G      P ++      G     G + 
Sbjct: 646  TGGPPGENGKPGE----PGPKGD--AGAPGAPGGKGDAGAPGERGPPGLAGAPGLRGGAG 699

Query: 1688 PPQDVCLPEPSKQPGPQLDAGSLAKCSPDQELSF-----PKNKEAASSQESEDSLRLLPC 1742
            PP        +  PGP   AG+        E        PK  +        D +   P 
Sbjct: 700  PPGPEGGKGAAGPPGPPGAAGTPGLQGMPGERGGLGSPGPKGDKGEPGGPGADGV---PG 756

Query: 1743 EQ--RG--GFLPEPGTADQP----HRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWP 1794
            +   RG  G +  PG A QP      GAP       P          +G+  PP  A +P
Sbjct: 757  KDGPRGPTGPIGPPGPAGQPGDKGEGGAPGLPGIAGPRGSPGE----RGETGPPGPAGFP 812

Query: 1795 FGASPSHAAQGHSAGRAGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPA 1854
             GA   +   G    R         G PG  G    P G S    P          P P 
Sbjct: 813  -GAPGQNGEPGGKGERGAPGEKGEGGPPGVAG----PPGGSGPAGP----------PGPQ 857

Query: 1855 CVSNTHPSRRSQDPALSPPIRQLQ----------LPGPGVAKSKDGILGLQELTPAAQSP 1904
             V     S      A  P  R L            PGP  +  KDG  G    T A  SP
Sbjct: 858  GVKGERGSPGGPGAAGFPGARGLPGPPGSNGNPGPPGPSGSPGKDGPPGPAGNTGAPGSP 917

Query: 1905 PRVNPSGLEGGTVEGGKVACGPAQGSPGGVQVTTLPAVAG--HQLGLE----ADGHWGLL 1958
                P G  G   E G        G+PG + +  +    G     G+     + G  G+ 
Sbjct: 918  GVSGPKGDAGQPGEKGSPGAQGPPGAPGPLGIAGITGARGLAGPPGMPGPRGSPGPQGVK 977

Query: 1959 GQAEKTQGQGTANQLQPENGVS-PG--GTDNHASVNASPKTALTGPTEGAVLLEKCKGSR 2015
            G++ K    G + +  P      PG  GT      + +P +      +G+   +  +G  
Sbjct: 978  GESGKPGANGLSGERGPPGPQGLPGLAGTAGEPGRDGNPGSDGLPGRDGSPGGKGDRGEN 1037

Query: 2016 AAMSLQEEAEPTPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSP 2075
             +      A   P PP P                G  G++ +R  S             P
Sbjct: 1038 GSPG-APGAPGHPGPPGP---------------VGPAGKSGDRGES------------GP 1069

Query: 2076 APSVGDLAACAPSPTSAAHMPCSLGPLPREDPLTSPSRAQGGLGGQ--LPASPSCRDPPG 2133
            A   G     AP P  +   P   G  PR D   +  R   G+ G    P +P     PG
Sbjct: 1070 AGPAG-----APGPAGSRGAPGPQG--PRGDKGETGERGAAGIKGHRGFPGNPGAPGSPG 1122

Query: 2134 P--QQLLACSPAWA----PLEEADGVQATTDTGAEDSPVAPPSLTTSPCDPKEALAGCLL 2187
            P  QQ    SP  A    P+  + G      T     P+ PP    +  +          
Sbjct: 1123 PAGQQGAIGSPGPAGPRGPVGPS-GPPGKDGTSGHPGPIGPPGPRGNRGE---------R 1172

Query: 2188 QGEGSPLEDPSSWPPGSVSA 2207
              EGSP       PPG   A
Sbjct: 1173 GSEGSPGHPGQPGPPGPPGA 1192



 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 290/1235 (23%), Positives = 372/1235 (30%), Gaps = 247/1235 (20%)

Query: 1683 EGDSRPPQDVCLPEPSKQPGPQLDAGSLAKCSPDQEL-SFPKNKEAASSQESEDSLRLLP 1741
            +GD  PP    +P  +  PG     GS     P     S P   +  S Q   DS  +  
Sbjct: 108  KGDPGPPG---IPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYSPQY--DSYDVKS 162

Query: 1742 CEQRGGFLPEPGTADQPHRGAPA-----PEAFGSPAVHLAPDLAFQGDGAPPLDATWPFG 1796
                GG    PG A  P    P      P + GSP     P    Q   + P       G
Sbjct: 163  GVAVGGLAGYPGPAGPPGPPGPPGTSGHPGSPGSPGYQGPPGEPGQAGPSGPPGPPGAIG 222

Query: 1797 ASPSHAAQGHSA--GRAGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGR----------- 1843
             S      G S   GR G    P  G PG +G    PAG       +G            
Sbjct: 223  PSGPAGKDGESGRPGRPGERGLP--GPPGIKG----PAGIPGFPGMKGHRGFDGRNGEKG 276

Query: 1844 EAWLVPVPSPACVSNTHPSRRSQDPALSPPIR-QLQLPGPGVAKSKDGILGLQELTPAAQ 1902
            E     +     +   + +     P  +P  R +  LPG   A+  DG  G  +  P   
Sbjct: 277  ETGAPGLKGENGLPGENGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARG-SDGQPGPP 335

Query: 1903 SPPRVNPSGLEGGTVEGGKVACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAE 1962
             PP    +G  G     G+V    + GS G       P   GH       G  G+ G   
Sbjct: 336  GPP--GTAGFPGSPGAKGEVGPAGSPGSNGAPGQRGEPGPQGHAGAQGPPGPPGINGSPG 393

Query: 1963 KTQGQGTANQLQPENGVSPGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMSLQE 2022
                 G A        +   G    A  N +P   L G               A    + 
Sbjct: 394  GKGEMGPAGIPGAPGLMGARGPPGPAGANGAP--GLRG--------------GAGEPGKN 437

Query: 2023 EAEPTPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAPSVGDL 2082
             A+  P P     E+    +  A    G +G   E    PG N    A G+  AP     
Sbjct: 438  GAKGEPGPRGERGEAGIPGVPGAKGEDGKDGSPGE----PGANGLPGAAGERGAPGF--- 490

Query: 2083 AACAPSPTSAAHMPCSLGPL-PREDPLTSPSRAQGGLGGQ--LPASPSCRDPPGPQQLLA 2139
                  P     +P   GP   R  P  +  R   G  G+  +P  P  R  PG      
Sbjct: 491  ----RGPAGPNGIPGEKGPAGERGAPGPAGPRGAAGEPGRDGVPGGPGMRGMPG------ 540

Query: 2140 CSPAWAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCDPKEALAGCLLQGEGSPLEDPSS 2199
             SP       +DG      +  E     PP     P  P+           G P      
Sbjct: 541  -SPGG---PGSDGKPGPPGSQGESGRPGPP----GPSGPR-----------GQPGVMGFP 581

Query: 2200 WPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRATG 2259
             P G+  A                 P  + +      PG    P   G   P      TG
Sbjct: 582  GPKGNDGA-----------------PGKNGERGGPGGPGPQGPPGKNGETGPQGPPGPTG 624

Query: 2260 LSSTPTGDEAQAG-------RGLPGPDPQSRGAPPHTN---PDRMPRGHSSY--SPSNTA 2307
                P GD+   G       +GLPG      G PP  N    +  P+G +    +P    
Sbjct: 625  ----PGGDKGDTGPPGPQGLQGLPG-----TGGPPGENGKPGEPGPKGDAGAPGAPGGKG 675

Query: 2308 RLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSSKEPEDPGTPETGRSGATKMPR 2367
              G    +    +   P    GAGP  P   EG  G +      PG P  G +G   +  
Sbjct: 676  DAGAPGERGPPGLAGAPGLRGGAGPPGP---EGGKGAAG----PPGPP--GAAGTPGLQG 726

Query: 2368 VTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRNASHQTPQG--DPLGPQDLKQRSRGYKK 2425
            +     GLG     +P       +   P +        P+G   P+GP            
Sbjct: 727  MPGERGGLG-----SPGPKGDKGEPGGPGADGVPGKDGPRGPTGPIGPPG---------- 771

Query: 2426 KPASTENGQWKGQAPHGPVTCEVCAASFRSGPGLSRHKARKHRPHPGAPAEPSPAALPAQ 2485
             PA     + +G AP  P       A  R  PG             G    P PA  P  
Sbjct: 772  -PAGQPGDKGEGGAPGLP-----GIAGPRGSPG-----------ERGETGPPGPAGFPGA 814

Query: 2486 QPLEPLAQKCQPPRKKSHRVSGKE---RPNHSRGDP--SHVTQPPPAQGSKEVLRAPGS- 2539
                   Q  +P  K      G++    P    G P  S    PP  QG K    +PG  
Sbjct: 815  P-----GQNGEPGGKGERGAPGEKGEGGPPGVAGPPGGSGPAGPPGPQGVKGERGSPGGP 869

Query: 2540 -----PHSQQLHPPSPTEHEVDVKTPASKPRPDQAREDELHPKQAEKREGRRWRREPTVD 2594
                 P ++ L  P  +        P+  P  D        P       G      P V 
Sbjct: 870  GAAGFPGARGLPGPPGSNGNPGPPGPSGSPGKD-------GPPGPAGNTGA--PGSPGVS 920

Query: 2595 SPSHSEGKSNKKRGKLRGRRLREESILPVSADVISDGRGSRPSPAMASYAAS--PSHCLS 2652
             P    G+  +K     G +    +  P+    I+  RG    P M     S  P     
Sbjct: 921  GPKGDAGQPGEKGSP--GAQGPPGAPGPLGIAGITGARGLAGPPGMPGPRGSPGPQGVKG 978

Query: 2653 VEGGPEADGEQPPRLATLGPGVMEGAAETDQEALCAGETGAQKPPGDRMLCPGRMDGAAL 2712
              G P A+G    R    GP  + G A T      AGE G    PG   L PGR DG+  
Sbjct: 979  ESGKPGANGLSGER-GPPGPQGLPGLAGT------AGEPGRDGNPGSDGL-PGR-DGSPG 1029

Query: 2713 GEQPTGQKGA-SARGFWG-PRETKALGVCKESGSE-------PAEDSSRAHSRSEEGVWE 2763
            G+   G+ G+  A G  G P     +G   +SG         PA     A SR   G   
Sbjct: 1030 GKGDRGENGSPGAPGAPGHPGPPGPVGPAGKSGDRGESGPAGPAGAPGPAGSRGAPG--- 1086

Query: 2764 ENTPPLGPLGFP-ETSSSPADSTTSSCLQGLPDNPDTQG--------------GVQGPEG 2808
                P GP G   ET    A        +G P NP   G              G  GP G
Sbjct: 1087 ----PQGPRGDKGETGERGAAGIKGH--RGFPGNPGAPGSPGPAGQQGAIGSPGPAGPRG 1140

Query: 2809 PTPDASGSSAKDPPSLFDDEVSFSQLFPPGGRLTR 2843
            P    SG   KD  S     +      PPG R  R
Sbjct: 1141 PV-GPSGPPGKDGTSGHPGPIG-----PPGPRGNR 1169



 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 107/414 (25%), Positives = 146/414 (35%), Gaps = 66/414 (15%)

Query: 3428 PGAPGQKARAL---EGTLPSKRRRVAMPGSAPGPGEDRPP-PRGSSPILSEGSLPALLHL 3483
            PGAPGQ        E   P ++     PG A  PG   P  P G   +  E   P     
Sbjct: 812  PGAPGQNGEPGGKGERGAPGEKGEGGPPGVAGPPGGSGPAGPPGPQGVKGERGSPG---- 867

Query: 3484 CSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNH--QECPPPSL----SPFPAALADG 3537
                 P    G+P     P  P ++   G   PS    ++ PP       +P    ++  
Sbjct: 868  ----GPGAA-GFPGARGLPGPPGSNGNPGPPGPSGSPGKDGPPGPAGNTGAPGSPGVSGP 922

Query: 3538 RGDCALDGALERPENEASPGSPGPLLQQAL--------PLGASLPR--PGARGQDAE-GK 3586
            +GD    G    P  +  PG+PGPL    +        P G   PR  PG +G   E GK
Sbjct: 923  KGDAGQPGEKGSPGAQGPPGAPGPLGIAGITGARGLAGPPGMPGPRGSPGPQGVKGESGK 982

Query: 3587 RAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPA 3646
                  SG+R  PG +G                   ++     +G P      G    P 
Sbjct: 983  PGANGLSGERGPPGPQGLPG-------------LAGTAGEPGRDGNPGSDGLPGRDGSPG 1029

Query: 3647 GCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAP-GELARGTENGMKPATPKAKPGPS-S 3704
            G      DR    +P  A   P HP    G + P G+     E+G  PA P   PGP+ S
Sbjct: 1030 G----KGDRGENGSPG-APGAPGHPGPP-GPVGPAGKSGDRGESG--PAGPAGAPGPAGS 1081

Query: 3705 QGSGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKG 3764
            +G+  P+      G +  + A+G              FP    AP   P  A  +     
Sbjct: 1082 RGAPGPQGPRGDKGETGERGAAG--------IKGHRGFPGNPGAPGS-PGPAGQQGAIGS 1132

Query: 3765 PREAGEQGPHGSLGPKEKGESSTKRKKGQV--PGPARSESVGSFGRAPSAPDKP 3816
            P  AG +GP G  GP   G+  T    G +  PGP  +        +P  P +P
Sbjct: 1133 PGPAGPRGPVGPSGP--PGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQP 1184



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 126/515 (24%), Positives = 154/515 (29%), Gaps = 75/515 (14%)

Query: 3415 GGRQPFAFRGVRRPGAPG-QKARALEGTL-----PSKRRRVAMPGSAPGPGEDRPPPRGS 3468
            GG+      G+  PGAPG   AR   G       P  R     PG     GE  P PRG 
Sbjct: 393  GGKGEMGPAGI--PGAPGLMGARGPPGPAGANGAPGLRGGAGEPGKNGAKGE--PGPRGE 448

Query: 3469 SPILSEGSLPALLHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLS 3528
                 E  +P +     E     + G P     P         G   P+     P     
Sbjct: 449  R---GEAGIPGVPGAKGEDGKDGSPGEPGANGLPGAAGERGAPGFRGPAGPNGIPGEK-- 503

Query: 3529 PFPAALADGRGDCALDGALERPENEASPGSPGPLLQQALPLG-ASLPRPGARGQDAE-GK 3586
              PA      G     GA   P  +  PG PG       P G  S  +PG  G   E G+
Sbjct: 504  -GPAGERGAPGPAGPRGAAGEPGRDGVPGGPGMRGMPGSPGGPGSDGKPGPPGSQGESGR 562

Query: 3587 RAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPA 3646
              P   SG R  PG  G   P          K  + +       GGP G   +G   K  
Sbjct: 563  PGPPGPSGPRGQPGVMGFPGP----------KGNDGAPGKNGERGGPGGPGPQGPPGKNG 612

Query: 3647 GCQSSSKDRSAASTPSKALKFPVHPRKAVGSLA----PGELARGTENGMK-----PATPK 3697
                            K    P  P+   G       PGE  +  E G K     P  P 
Sbjct: 613  ETGPQGPPGPTGPGGDKGDTGPPGPQGLQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPG 672

Query: 3698 AKPGPSSQGSGSP-----RPGTKTGGGSQPQPASGQLQSE------TATTPAKPSFPSR- 3745
             K    + G   P      PG + GG   P P  G+  +        A TP     P   
Sbjct: 673  GKGDAGAPGERGPPGLAGAPGLR-GGAGPPGPEGGKGAAGPPGPPGAAGTPGLQGMPGER 731

Query: 3746 ----SPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPKEKGESSTKRKKGQVPG-PARS 3800
                SP P+              P + G +GP G +GP         + +G  PG P  +
Sbjct: 732  GGLGSPGPKGDKGEPGGPGADGVPGKDGPRGPTGPIGPPGPAGQPGDKGEGGAPGLPGIA 791

Query: 3801 ESVGSFGR----APSAPDKPPRTPRKQATP----SRVLPTKP----------KPNSQNKP 3842
               GS G      P  P   P  P +   P     R  P +            P      
Sbjct: 792  GPRGSPGERGETGPPGPAGFPGAPGQNGEPGGKGERGAPGEKGEGGPPGVAGPPGGSGPA 851

Query: 3843 RPPPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPP 3877
             PP  +  K E G        G  FP  R L  PP
Sbjct: 852  GPPGPQGVKGERGSPGGPGAAG--FPGARGLPGPP 884



 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 121/501 (24%), Positives = 164/501 (32%), Gaps = 92/501 (18%)

Query: 3428 PGAPGQKARALEGTLPSKRRRVAMPG------SAPGPGEDRPPPRGSSPILSEGSLPALL 3481
            PG PG   R  +  +P +      PG      S P   ++  P   S  + S  ++  L 
Sbjct: 111  PGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYSPQYDSYDVKSGVAVGGLA 170

Query: 3482 HLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGDC 3541
                   P    G P T   P  P +   +G   P        PS  P P       G  
Sbjct: 171  GYPGPAGPPGPPGPPGTSGHPGSPGSPGYQG---PPGEPGQAGPSGPPGPPGAIGPSGPA 227

Query: 3542 ALDGALERPENEASPGSPGPLLQQALPLGASLPR-PGARG-QDAEGKRAPLVFSGKRRAP 3599
              DG   RP      G PGP     +   A +P  PG +G +  +G+       G+  AP
Sbjct: 228  GKDGESGRPGRPGERGLPGP---PGIKGPAGIPGFPGMKGHRGFDGRNGE---KGETGAP 281

Query: 3600 GARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGT-FHKGSATKPAGCQSSSKDRSAA 3658
            G +G         ++ L  E            GPRG    +G    P    +   D +  
Sbjct: 282  GLKG---------ENGLPGENGAPGPM-----GPRGAPGERGRPGLPGAAGARGNDGARG 327

Query: 3659 ST-------PSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPR 3711
            S        P     FP  P  A G + P     G+         + +PGP         
Sbjct: 328  SDGQPGPPGPPGTAGFPGSP-GAKGEVGPA----GSPGSNGAPGQRGEPGPQGHAGAQGP 382

Query: 3712 PGT-----KTGGGSQPQPAS--GQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKG 3764
            PG        GG  +  PA   G      A  P  P+  + +P   R  A    K+  KG
Sbjct: 383  PGPPGINGSPGGKGEMGPAGIPGAPGLMGARGPPGPAGANGAPG-LRGGAGEPGKNGAKG 441

Query: 3765 -PREAGEQGPHGSLG-PKEKGESSTKRKKGQ-----VPGPARSESVGSFGRAPSAP---- 3813
             P   GE+G  G  G P  KGE       G+     +PG A       F R P+ P    
Sbjct: 442  EPGPRGERGEAGIPGVPGAKGEDGKDGSPGEPGANGLPGAAGERGAPGF-RGPAGPNGIP 500

Query: 3814 -DKPPRTPRKQATPS--------------------RVLPTKP-KPNSQNKPRPPPSEQRK 3851
             +K P   R    P+                    R +P  P  P S  KP PP S+   
Sbjct: 501  GEKGPAGERGAPGPAGPRGAAGEPGRDGVPGGPGMRGMPGSPGGPGSDGKPGPPGSQGES 560

Query: 3852 AEPGHTQRKDRLGKAFPQGRP 3872
              PG        G + P+G+P
Sbjct: 561  GRPGPP------GPSGPRGQP 575



 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 131/525 (24%), Positives = 165/525 (31%), Gaps = 91/525 (17%)

Query: 3415 GGRQPFAFRGVRRPGAP-GQKARALEGTLPSKRRRVAMPGSAPGPGED-RPPPRGSSPIL 3472
            G + P   RG   P  P G         +P       MPGS  GPG D +P P GS    
Sbjct: 501  GEKGPAGERGAPGPAGPRGAAGEPGRDGVPGGPGMRGMPGSPGGPGSDGKPGPPGSQ--- 557

Query: 3473 SEGSLPALLHLCSEVAPSTTKGWPETLERPVD------PVTHPIRGCELPSNHQECPP-- 3524
             E   P          PS  +G P  +  P        P  +  RG       Q  P   
Sbjct: 558  GESGRPG------PPGPSGPRGQPGVMGFPGPKGNDGAPGKNGERGGPGGPGPQGPPGKN 611

Query: 3525 ----PSLSPFPAALADGRGDCA---------LDGALERPENEASPGSPGPLLQQALPLGA 3571
                P   P P      +GD           L G    P     PG PGP      P GA
Sbjct: 612  GETGPQGPPGPTGPGGDKGDTGPPGPQGLQGLPGTGGPPGENGKPGEPGPKGDAGAP-GA 670

Query: 3572 SLPRPGARGQ-DAEGKRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEK----EVSSSH 3626
                PG +G   A G+R P   +G   APG RG   P   +                +  
Sbjct: 671  ----PGGKGDAGAPGERGPPGLAG---APGLRGGAGPPGPEGGKGAAGPPGPPGAAGTPG 723

Query: 3627 MVSEGGPRGTFH----KGSATKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGE 3682
            +    G RG       KG   +P G      D        +    P+ P    G   PG+
Sbjct: 724  LQGMPGERGGLGSPGPKGDKGEPGG---PGADGVPGKDGPRGPTGPIGPPGPAGQ--PGD 778

Query: 3683 LARGTENGMKP-ATPKAKPGPSSQGSGSPRP----------GTKTGGGSQPQPAS-GQLQ 3730
               G   G+   A P+  PG   + +G P P          G   G G +  P   G+  
Sbjct: 779  KGEGGAPGLPGIAGPRGSPGERGE-TGPPGPAGFPGAPGQNGEPGGKGERGAPGEKGEGG 837

Query: 3731 SETATTPAKPSFPSRSPAPERLPARAQAKS---CTKGPREAGEQGPHGSLG-PKEKGESS 3786
                  P   S P+  P P+ +     +         P   G  GP GS G P   G S 
Sbjct: 838  PPGVAGPPGGSGPAGPPGPQGVKGERGSPGGPGAAGFPGARGLPGPPGSNGNPGPPGPSG 897

Query: 3787 TKRKKGQVPGPARSESV-------GSFGRAPSAPDK-------PPRTPRKQA----TPSR 3828
            +  K G  PGPA +          G  G A    +K       PP  P        T +R
Sbjct: 898  SPGKDGP-PGPAGNTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGPLGIAGITGAR 956

Query: 3829 VLPTKP-KPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRP 3872
             L   P  P  +  P P   +    +PG        G   PQG P
Sbjct: 957  GLAGPPGMPGPRGSPGPQGVKGESGKPGANGLSGERGPPGPQGLP 1001



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 193/831 (23%), Positives = 244/831 (29%), Gaps = 165/831 (19%)

Query: 2321 PTEPPTLQGAGPDSPACLEGEMGTSSKEPEDPGTPETGRSGATKMPRVTCPSTGLGLGRT 2380
            PT PP   G GP  P    G  G   +   DPG P    S  +  P   C S   G  + 
Sbjct: 95   PTRPPN--GQGPQGPKGDPGPPGIPGRNG-DPGIPGQPGSPGSPGPPGICESCPTG-PQN 150

Query: 2381 TAPSSTASDFQSDSPQSHRNASHQTPQGDP--LGPQDLKQR-----SRGYKKKPASTENG 2433
             +P   + D +S        A +  P G P   GP           S GY+  P   E G
Sbjct: 151  YSPQYDSYDVKSGVAVGGL-AGYPGPAGPPGPPGPPGTSGHPGSPGSPGYQGPPG--EPG 207

Query: 2434 QWKGQAPHGPVTCEVCAASFRSGP-GLSRHKARKHRPH----PGAPAEPSPAALPAQQPL 2488
            Q     P GP       A   SGP G      R  RP     PG P    PA +P     
Sbjct: 208  QAGPSGPPGPP-----GAIGPSGPAGKDGESGRPGRPGERGLPGPPGIKGPAGIPGF--- 259

Query: 2489 EPLAQKCQPPRKKSHRVSGKERPNHSRGDPSHVTQPPPAQGSKEVLRAPGSPHSQQLHPP 2548
                     P  K HR  G +  N  +G+    T  P  +G   +    G+P      P 
Sbjct: 260  ---------PGMKGHR--GFDGRNGEKGE----TGAPGLKGENGLPGENGAPG-----PM 299

Query: 2549 SPTEHEVDVKTPASKPRPDQAREDELHPKQAEKREGRRWRREPTVDSPSHSEGKSNKKRG 2608
             P         P  + RP         P  A  R     R       P    G +     
Sbjct: 300  GPRG------APGERGRPGL-------PGAAGARGNDGARGSDGQPGPPGPPGTAG---- 342

Query: 2609 KLRGRRLREESILPVSADVISDGRGSRPSPAMASYAAS--PSHCLSVEGGPEADGEQPPR 2666
               G    +  + P  +   +   G R  P    +A +  P     + G P   GE  P 
Sbjct: 343  -FPGSPGAKGEVGPAGSPGSNGAPGQRGEPGPQGHAGAQGPPGPPGINGSPGGKGEMGPA 401

Query: 2667 LATLGPGVM-----------EGAAETDQEALCAGETGAQKPPGDR-----MLCPG----- 2705
                 PG+M            GA      A   G+ GA+  PG R        PG     
Sbjct: 402  GIPGAPGLMGARGPPGPAGANGAPGLRGGAGEPGKNGAKGEPGPRGERGEAGIPGVPGAK 461

Query: 2706 ---RMDGAALGEQPTGQKGAS----ARGFWGPRETKAL----GVCKESGSE-PAEDSSRA 2753
                 DG+       G  GA+    A GF GP     +    G   E G+  PA     A
Sbjct: 462  GEDGKDGSPGEPGANGLPGAAGERGAPGFRGPAGPNGIPGEKGPAGERGAPGPAGPRGAA 521

Query: 2754 HSRSEEGVWEENTPPLGP--LGFPETSSSPADSTTSSCLQGLPDNPDTQG-----GVQGP 2806
                 +GV      P GP   G P +   P          G P  P +QG     G  GP
Sbjct: 522  GEPGRDGV------PGGPGMRGMPGSPGGPGS-------DGKPGPPGSQGESGRPGPPGP 568

Query: 2807 EGPTPDASGSSAKDPPSLFDDEVSFSQLFPPGGRLTRKRNPHVYGKRCEKPVLPLPTQPS 2866
             GP           P           +   PGG     + P            P PT P 
Sbjct: 569  SGPRGQPGVMGFPGPKGNDGAPGKNGERGGPGG--PGPQGPPGKNGETGPQGPPGPTGPG 626

Query: 2867 FEEGGDPTLGPARLP----TDLSDSSSLCLCHEDPWEDEDPAGLPESFLLDGFLNSRVPG 2922
             ++G     GP  L     T      +       P  D    G P      G    R P 
Sbjct: 627  GDKGDTGPPGPQGLQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGPP 686

Query: 2923 IDPWAPGLSLWALEPSREAGAEKLPSHCPEDDRPEAIPELHMVPAAWRGLEMPAPADDSS 2982
                APGL   A  P  E G  K  +  P        P L  +P    GL  P P  D  
Sbjct: 687  GLAGAPGLRGGAGPPGPEGG--KGAAGPPGPPGAAGTPGLQGMPGERGGLGSPGPKGDKG 744

Query: 2983 SSLGDVS------------------PEPPSLERERCDGGLPGNTHLLPLRATDFEVLSTK 3024
               G  +                  P P     ++ +GG PG   +   R +  E     
Sbjct: 745  EPGGPGADGVPGKDGPRGPTGPIGPPGPAGQPGDKGEGGAPGLPGIAGPRGSPGE----- 799

Query: 3025 FEMQDLCFLGPFEDPVGLPGPSFLDFEGTASSQGPQSRRTEEAAGAGRAQG 3075
                            G PGP+   F G     G    + E  A   + +G
Sbjct: 800  ------------RGETGPPGPA--GFPGAPGQNGEPGGKGERGAPGEKGEG 836



 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 95/395 (24%), Positives = 131/395 (33%), Gaps = 74/395 (18%)

Query: 3505 PVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGDCALDGALERPENEASPGSPGPLLQ 3564
            P T P R    P N Q    P   P P  +    GD  + G   +P +  SPG PG  + 
Sbjct: 91   PPTAPTR----PPNGQGPQGPKGDPGPPGIPGRNGDPGIPG---QPGSPGSPGPPG--IC 141

Query: 3565 QALPLGASLPRPGARGQDAEGKRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSS 3624
            ++ P G   P+  +   D+   ++ +   G    PG  G   P                 
Sbjct: 142  ESCPTG---PQNYSPQYDSYDVKSGVAVGGLAGYPGPAGPPGPP---------------- 182

Query: 3625 SHMVSEGGPRGTF-HKGSATKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAP-GE 3682
                   GP GT  H GS   P G Q    +   A         P  P    G++ P G 
Sbjct: 183  -------GPPGTSGHPGSPGSP-GYQGPPGEPGQAG--------PSGPPGPPGAIGPSGP 226

Query: 3683 LARGTENGMKPATP--KAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETATTPAK- 3739
              +  E+G +P  P  +  PGP      +  PG     G +        + ET     K 
Sbjct: 227  AGKDGESG-RPGRPGERGLPGPPGIKGPAGIPGFPGMKGHRGFDGRNGEKGETGAPGLKG 285

Query: 3740 -PSFPSRSPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPKEKGESSTKRKKGQVPGPA 3798
                P  + AP  +  R         P E G  G  G+ G   +G    +   GQ PGP 
Sbjct: 286  ENGLPGENGAPGPMGPRG-------APGERGRPGLPGAAG--ARGNDGARGSDGQ-PGPP 335

Query: 3799 RSESVGSFGRAPSAPDK--PPRTPRKQATPSRVLPTKPK--PNSQNKPRPPPSEQRKAEP 3854
                   F  +P A  +  P  +P     P +     P+    +Q  P PP         
Sbjct: 336  GPPGTAGFPGSPGAKGEVGPAGSPGSNGAPGQRGEPGPQGHAGAQGPPGPPGIN------ 389

Query: 3855 GHTQRKDRLGKAFPQGRPLL---RPPKRGTAVHGA 3886
            G    K  +G A   G P L   R P      +GA
Sbjct: 390  GSPGGKGEMGPAGIPGAPGLMGARGPPGPAGANGA 424



 Score = 38.1 bits (87), Expect = 0.17
 Identities = 32/114 (28%), Positives = 40/114 (35%), Gaps = 12/114 (10%)

Query: 3189 GLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPGERAKPRAR 3248
            GL G +       +  EP P+  RG+      AG PG P  +  + K  SPGE   P A 
Sbjct: 426  GLRGGAGEPGKNGAKGEPGPRGERGE------AGIPGVPGAKGEDGKDGSPGE---PGAN 476

Query: 3249 STPSNPDGAATP---DSASATALADAGSPGPPRTTPSPSPDPWAGGEPLLQATP 3299
              P        P     A    +     P   R  P P+    A GEP     P
Sbjct: 477  GLPGAAGERGAPGFRGPAGPNGIPGEKGPAGERGAPGPAGPRGAAGEPGRDGVP 530



 Score = 38.1 bits (87), Expect = 0.17
 Identities = 26/89 (29%), Positives = 31/89 (34%), Gaps = 9/89 (10%)

Query: 3205 EPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPGERAKPRARSTPSNPDGAATPDSAS 3264
            EP  K  RG        G PG      G      PG +     R +P  P  A  P +  
Sbjct: 820  EPGGKGERGAPGEKGEGGPPGVAGPPGGSGPAGPPGPQGVKGERGSPGGPGAAGFPGA-- 877

Query: 3265 ATALADAGSPGPPRTTPSPSPDPWAGGEP 3293
                   G PGPP +  +P P P   G P
Sbjct: 878  ------RGLPGPPGSNGNPGP-PGPSGSP 899



 Score = 37.7 bits (86), Expect = 0.23
 Identities = 28/79 (35%), Positives = 33/79 (41%), Gaps = 14/79 (17%)

Query: 3205 EPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPGERAKPRARSTPSNPDGAATPDSAS 3264
            EP PK           AG+PG P G +G+A   +PGER  P     P    GA  P    
Sbjct: 658  EPGPKGD---------AGAPGAP-GGKGDA--GAPGERGPPGLAGAPGLRGGAGPPGPEG 705

Query: 3265 ATALADAGSPGPPRTTPSP 3283
                  AG PGPP    +P
Sbjct: 706  GKGA--AGPPGPPGAAGTP 722



 Score = 37.4 bits (85), Expect = 0.30
 Identities = 31/95 (32%), Positives = 38/95 (40%), Gaps = 11/95 (11%)

Query: 3206 PAPKHHRGKRSAGKAAGSPGDPW-----GQEGEAKKDSPGERAKPRARSTPSNPDGAATP 3260
            P P    GK      AG+ G P      G +G+A +  PGE+  P A+  P  P      
Sbjct: 893  PGPSGSPGKDGPPGPAGNTGAPGSPGVSGPKGDAGQ--PGEKGSPGAQGPPGAPGPLGIA 950

Query: 3261 DSASATALADAGSPGPPRTTPSPSPDPWAG--GEP 3293
                A  L  AG PG P    SP P    G  G+P
Sbjct: 951  GITGARGL--AGPPGMPGPRGSPGPQGVKGESGKP 983



 Score = 35.8 bits (81), Expect = 0.86
 Identities = 58/214 (27%), Positives = 66/214 (30%), Gaps = 32/214 (14%)

Query: 3414 RGGRQPFAFRGVR-RPGAPGQKA-RALEGT--LPSKRRRVAMPGSAPGPGEDRPPPRGSS 3469
            RG   P   +G   +PGA G    R   G   LP        PG    PG D  P R  S
Sbjct: 968  RGSPGPQGVKGESGKPGANGLSGERGPPGPQGLPGLAGTAGEPGRDGNPGSDGLPGRDGS 1027

Query: 3470 P----ILSEGSLPALLHLCSEVAPS-----TTKGWPETLERPVDPVTHPIRGCELPSNHQ 3520
            P       E   P          P        K        P  P      G   P+  +
Sbjct: 1028 PGGKGDRGENGSPGAPGAPGHPGPPGPVGPAGKSGDRGESGPAGPA-----GAPGPAGSR 1082

Query: 3521 ECPPPSLSPFPAALADGRGDCALDGALERPENEASPGSPGPLLQQAL-----------PL 3569
              P P            RG   + G    P N  +PGSPGP  QQ             P+
Sbjct: 1083 GAPGPQGPRGDKGETGERGAAGIKGHRGFPGNPGAPGSPGPAGQQGAIGSPGPAGPRGPV 1142

Query: 3570 GASLPRPGARGQDAEGKRAPLVFSGKRRAPGARG 3603
            G S P PG  G    G   P+   G R   G RG
Sbjct: 1143 GPSGP-PGKDG--TSGHPGPIGPPGPRGNRGERG 1173



 Score = 35.8 bits (81), Expect = 0.86
 Identities = 30/97 (30%), Positives = 35/97 (36%), Gaps = 17/97 (17%)

Query: 3209 KHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPGERAKPRARSTPSNPDGAA---------- 3258
            K HRG      A GSPG P GQ+G      P     P   S P   DG +          
Sbjct: 1106 KGHRGFPGNPGAPGSPG-PAGQQGAIGSPGPAGPRGPVGPSGPPGKDGTSGHPGPIGPPG 1164

Query: 3259 ----TPDSASATALADAGSPGPPRTTPSPSPDPWAGG 3291
                  +  S  +    G PGPP   P  +P P  GG
Sbjct: 1165 PRGNRGERGSEGSPGHPGQPGPPG--PPGAPGPCCGG 1199



 Score = 34.3 bits (77), Expect = 2.5
 Identities = 29/84 (34%), Positives = 30/84 (35%), Gaps = 7/84 (8%)

Query: 3213 GKRSAGKAAGSPGDPWGQEGEAKKDSPGERAKPRA---RSTPSNPDGAATPDSASATALA 3269
            G   A   AGS G P  Q     K   GER        R  P NP    +P  A      
Sbjct: 1071 GPAGAPGPAGSRGAPGPQGPRGDKGETGERGAAGIKGHRGFPGNPGAPGSPGPAGQQGA- 1129

Query: 3270 DAGSPGP--PRTTPSPSPDPWAGG 3291
              GSPGP  PR    PS  P   G
Sbjct: 1130 -IGSPGPAGPRGPVGPSGPPGKDG 1152



 Score = 33.9 bits (76), Expect = 3.3
 Identities = 29/105 (27%), Positives = 40/105 (38%), Gaps = 13/105 (12%)

Query: 3189 GLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPGERAKPRAR 3248
            G +G+     L      P  K  RG+  +  A G+PG P    G      P  ++  R  
Sbjct: 1011 GRDGNPGSDGLPGRDGSPGGKGDRGENGSPGAPGAPGHP----GPPGPVGPAGKSGDRGE 1066

Query: 3249 STPSNPDGAATPDSASATALADAGSPGP--PRTTPSPSPDPWAGG 3291
            S P+ P GA  P           G+PGP  PR     + +  A G
Sbjct: 1067 SGPAGPAGAPGP-------AGSRGAPGPQGPRGDKGETGERGAAG 1104



 Score = 33.1 bits (74), Expect = 5.6
 Identities = 32/103 (31%), Positives = 40/103 (38%), Gaps = 10/103 (9%)

Query: 3205 EPAPKHHRGKRSAGKAAGSPGDPWGQEGE-AKKDSPGERAKPRARSTPSNP--DGAATPD 3261
            E  P    G       AG PG P G +GE      PG    P AR  P  P  +G   P 
Sbjct: 835  EGGPPGVAGPPGGSGPAGPPG-PQGVKGERGSPGGPGAAGFPGARGLPGPPGSNGNPGPP 893

Query: 3262 SASATALADAGSPGPPRTTPSPSPDPWAG-----GEPLLQATP 3299
              S +   D G PGP   T +P     +G     G+P  + +P
Sbjct: 894  GPSGSPGKD-GPPGPAGNTGAPGSPGVSGPKGDAGQPGEKGSP 935


>gi|110349772 alpha 1 type I collagen preproprotein [Homo sapiens]
          Length = 1464

 Score =  103 bits (256), Expect = 4e-21
 Identities = 306/1259 (24%), Positives = 383/1259 (30%), Gaps = 230/1259 (18%)

Query: 81   QAPSSTPGKRG--SPQTPPGRSPLQAPSRLAGR-AEGSPPQRYILGIASSRTKPTLDETP 137
            + P    G RG   P  PPGR  +     L G      PP    LG       P L    
Sbjct: 111  EGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLG---GNFAPQLSYGY 167

Query: 138  ENPQLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAEELGFHRCFQEPPSSFTSTNYT 197
            +        +P    P GP  G P  PG P  +             FQ PP         
Sbjct: 168  DEKSTGGISVPGPMGPSGP-RGLPGPPGAPGPQG------------FQGPPG-------- 206

Query: 198  SPSATP-RPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPAAENSFPGANFGVPPAEPE 256
                 P  P A GP   RG  P  PG   +   +G    P       P    G+P     
Sbjct: 207  ----EPGEPGASGPMGPRG-PPGPPGKNGDDGEAGKPGRPGERGPPGPQGARGLPGTAGL 261

Query: 257  PIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEE 316
            P  KG R             F  L GA     PA   G   + G          GA    
Sbjct: 262  PGMKGHR------------GFSGLDGAKGDAGPAGPKGEPGSPG--------ENGA---- 297

Query: 317  AVGTGPAYPLPTQPAPSPLPCYQGQPG-----GLNRHSDLSGALSSPGAAHSAPRPFSDS 371
                      P Q  P  LP  +G+PG     G   +   +GA   PG    A  P    
Sbjct: 298  ----------PGQMGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPG 347

Query: 372  LHKSLTKILPERPPSAQ--DGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAA 429
               +  +  P+ P  ++   G+    GPP        P  A   +G   + G P  + A 
Sbjct: 348  AVGAKGEAGPQGPRGSEGPQGVRGEPGPPG-------PAGAAGPAGNPGADGQPGAKGAN 400

Query: 430  PGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLP 489
              P  A  P          P  PGGP     +   +G+P           AP        
Sbjct: 401  GAPGIAGAPGFPGARGPSGPQGPGGPPGPKGN---SGEP----------GAPGSKGDTGA 447

Query: 490  TARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKLPAVRSSQGGSPALFT 549
               P P G++          GP    G +G  G  G+ PGP   LP     +GG      
Sbjct: 448  KGEPGPVGVQ----------GPPGPAGEEGKRGARGE-PGP-TGLPGPPGERGGP----- 490

Query: 550  YNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPA--TNTAGSTCSS 607
                  PGA     GVA P+  P G    P P     SP E+  P  A      G T S 
Sbjct: 491  -GSRGFPGAD----GVAGPK-GPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSP 544

Query: 608  LSP---MSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSPFPSP-----EPPHSLPT 659
             SP     + P  P+ ++ + PGP GP     P    Q     FP P     EP  +   
Sbjct: 545  GSPGPDGKTGPPGPAGQDGR-PGPPGP-----PGARGQAGVMGFPGPKGAAGEPGKAGER 598

Query: 660  HYQPEPAKAFPFPADG-LGAEGAFQCLEETPFPHEGPEVGRGGLQGFP-RAPPPYPTHHF 717
                 P    P   DG  GA+G            E    G  G QG P  A PP      
Sbjct: 599  GVPGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKP 658

Query: 718  SLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPP 777
                   D                     L      G    R   G +   GPPG   P 
Sbjct: 659  GEQGVPGD---------------------LGAPGPSGARGERGFPGERGVQGPPGPAGPR 697

Query: 778  AAPRVPADAHAGLLSHAKTFLLAGDAQAEG----KDDPLRTGFLPSLAATPFPLPASDL- 832
             A   P +  A            GDA A G    +  P   G      A   P P  D  
Sbjct: 698  GANGAPGNDGA-----------KGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRG 746

Query: 833  DMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAGVT 892
            D        S   + + G+      P    +  D   +  PSGP GP+         G  
Sbjct: 747  DAGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGDK-GESGPSGPAGPTGARGAPGDRG-- 803

Query: 893  PESKAPPPLPAATPDPQTPRPGDRGCP-ARGRPKTRSLGLAPTEADAPSQGRQQRRGKQL 951
               +  PP PA    P    PG  G P A+G P     G A  + DA   G     G   
Sbjct: 804  ---EPGPPGPAGFAGP----PGADGQPGAKGEP-----GDAGAKGDAGPPGPAGPAGPPG 851

Query: 952  KLFRKDLDSGGAAEGSGSGGGGRASGL--------RPRRNDGLGERPPPRPR-RPRTQAP 1002
             +   ++ + GA    GS G   A+G          P  +   G   PP P  +   + P
Sbjct: 852  PI--GNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPAGKEGGKGP 909

Query: 1003 GSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRLR 1062
                 PA R P     P     +  +  P    P       G  G      +V    +  
Sbjct: 910  RGETGPAGR-PGEVGPPGPPGPAGEKGSPGADGPAGAPGTPGPQGIAGQRGVVGLPGQRG 968

Query: 1063 EYDFASESEEDEQPPPRGP-GFRGRRGRGEKRKEVELTQGPREDEPQKPRKAARQEAGGD 1121
            E  F        +P  +GP G  G RG         L  GP  +  ++    A    G D
Sbjct: 969  ERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLA-GPPGESGREGAPGAEGSPGRD 1027

Query: 1122 GAPANPEEPGGSRP-GPGRSPQARGPSRSLETGAAAREGGPKCADRPSVAPKDPLQVPTN 1180
            G+P    + G + P GP  +P A  P      G A + G     DR    P  P   P  
Sbjct: 1028 GSPGAKGDRGETGPAGPPGAPGA--PGAPGPVGPAGKSG-----DRGETGPAGPAG-PVG 1079

Query: 1181 TETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEALRSPPAACAGEMGASPGLLIPEQP 1240
                         P  A+ P   +    D  E  E          G  G S GL  P  P
Sbjct: 1080 -------------PVGARGPAGPQGPRGDKGETGE---QGDRGIKGHRGFS-GLQGPPGP 1122

Query: 1241 PPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSLLG--GPGGTQAPVSHNSKDPPARQPG 1297
            P S  + G    SG      P GS+  PG   L G  GP G   P        P   PG
Sbjct: 1123 PGSPGEQGPSGASGPAGPRGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPG 1181



 Score = 96.3 bits (238), Expect = 5e-19
 Identities = 229/866 (26%), Positives = 272/866 (31%), Gaps = 170/866 (19%)

Query: 6    PRGAPPPT-MTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQAMELPEAQ 64
            PRG+  P  + G+  P   A + G P+  P  D  P     KGA  A G A A   P A+
Sbjct: 360  PRGSEGPQGVRGEPGPPGPAGAAG-PAGNPGADGQPGA---KGANGAPGIAGAPGFPGAR 415

Query: 65   PRQARDGELKPPSLRGQAPS-STPGKRGSP--QTPPGRSPLQAPSRLAGR-----AEGSP 116
                  G   PP  +G +     PG +G    +  PG   +Q P   AG      A G P
Sbjct: 416  GPSGPQGPGGPPGPKGNSGEPGAPGSKGDTGAKGEPGPVGVQGPPGPAGEEGKRGARGEP 475

Query: 117  PQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDT----PQGPGTGAPLRPGLPRTEAQ 172
                + G    R  P     P    +   + P  +     P GP  G+P   G P     
Sbjct: 476  GPTGLPGPPGERGGPGSRGFPGADGVAGPKGPAGERGSPGPAGP-KGSPGEAGRPGEAGL 534

Query: 173  PAAEELGFHRCFQEPPSSFTSTNYTSPSATP----RPPAPGPPQSRGTSPLQPGSYPEYQ 228
            P A+ L         P S      T P        RP  PGPP +RG + +     P+  
Sbjct: 535  PGAKGL------TGSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPK-- 586

Query: 229  ASGADSWP-PAAENSFPGANFGVPPA----------EPEPI-PKGSR----PGGSPRGVS 272
              GA   P  A E   PG    V PA           P P  P G R    P GSP    
Sbjct: 587  --GAAGEPGKAGERGVPGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSP---G 641

Query: 273  FQ-FPFPA-LHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPL---- 326
            FQ  P PA   G + KP    V G     GP   +  + +  +P E    GP  P     
Sbjct: 642  FQGLPGPAGPPGEAGKPGEQGVPGDLGAPGP---SGARGERGFPGERGVQGPPGPAGPRG 698

Query: 327  ----------------PTQPAPSPLPCYQGQPG-----GLNRHSDLSGALSSPGAAHSAP 365
                            P  P     P  QG PG     GL       G     GA  S  
Sbjct: 699  ANGAPGNDGAKGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGS-- 756

Query: 366  RPFSDSLHKSLTKILPERP-----------PSAQDGLGSTRGPPSSLPQRHFPGQAYRAS 414
             P  D +      I P  P           PS   G    RG P    +   PG A  A 
Sbjct: 757  -PGKDGVRGLTGPIGPPGPAGAPGDKGESGPSGPAGPTGARGAPGDRGEPGPPGPAGFAG 815

Query: 415  --GVDTSPG----PPDTELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQP 468
              G D  PG    P D        PP        P     P  P G + A  +    G  
Sbjct: 816  PPGADGQPGAKGEPGDAGAKGDAGPPG-------PAGPAGPPGPIGNVGAPGAKGARGSA 868

Query: 469  SPGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTP 528
             P      P +A    P       P P G       P PAG  E   G +G  G AG+  
Sbjct: 869  GPPGATGFPGAAGRVGP-------PGPSGNAGPPGPPGPAG-KEGGKGPRGETGPAGRPG 920

Query: 529  GPREKLPAVRSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQ--VSPHGTPSLPPPRVVGA 586
                  P   + + GSP      G   P   P   G   PQ      G   LP  R    
Sbjct: 921  EVGPPGPPGPAGEKGSP------GADGPAGAP---GTPGPQGIAGQRGVVGLPGQRGERG 971

Query: 587  SPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETGS 646
             P    LP P          S  P    P+  S E    PGP+GP     PP      G+
Sbjct: 972  FPG---LPGP----------SGEPGKQGPSGASGERGP-PGPMGPPGLAGPPGESGREGA 1017

Query: 647  PFPSPEPPHSLPTHYQPEPAKAFPF-PADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGF 705
            P     P        + +  +  P  P    GA GA       P    G    RG     
Sbjct: 1018 PGAEGSPGRDGSPGAKGDRGETGPAGPPGAPGAPGA-----PGPVGPAGKSGDRGETGPA 1072

Query: 706  PRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQ 765
              A P  P      +     + D   T  Q DR          HR F GL         Q
Sbjct: 1073 GPAGPVGPVGARGPAGPQGPRGDKGETGEQGDRGIK------GHRGFSGL---------Q 1117

Query: 766  RSPGPPGLP--------SPPAAPRVP 783
              PGPPG P        S PA PR P
Sbjct: 1118 GPPGPPGSPGEQGPSGASGPAGPRGP 1143



 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 322/1378 (23%), Positives = 400/1378 (29%), Gaps = 312/1378 (22%)

Query: 131  PTLDETPENPQLEAAQLPEVDT----PQGPGTGAPLRPGLPRTEAQPAAEELGFHRCFQE 186
            P   E+P + +    + P+ DT    P+GP  G P R G+P     P             
Sbjct: 96   PDGSESPTDQETTGVEGPKGDTGPRGPRGPA-GPPGRDGIPGQPGLPG------------ 142

Query: 187  PPSSFTSTNYTSPSATPRPPAPGPPQSRGT-SPLQPGSYPEYQASGADSWPPAAENSFPG 245
                        P   P PP  GPP   G  +P     Y E    G          S PG
Sbjct: 143  ------------PPGPPGPP--GPPGLGGNFAPQLSYGYDEKSTGGI---------SVPG 179

Query: 246  ANFGVPPAEPEPIPKGSRPGGSPRGVSFQFP--FPALHGASTKPFPADVAGHAFTNGPLV 303
                + P+ P  +P    P G+P    FQ P   P   GAS    P    G    NG   
Sbjct: 180  P---MGPSGPRGLPG---PPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGD-- 231

Query: 304  FAFHQPQGAWPEEAVGTGPAYPLPTQ--PAPSPLPCYQGQPGGLNRHSDLSGALSSPGAA 361
                  +   P      GP  P   +  P  + LP  +G  G     S L GA    G A
Sbjct: 232  ----DGEAGKPGRPGERGPPGPQGARGLPGTAGLPGMKGHRG----FSGLDGAKGDAGPA 283

Query: 362  HSAPRPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPG 421
                                   P  + G     G P  +  R  PG+  R      +PG
Sbjct: 284  G----------------------PKGEPGSPGENGAPGQMGPRGLPGERGRPG----APG 317

Query: 422  PP-----DTELAAPGPP----PARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQ 472
            P      D    A GPP    PA  P       A     P GP  +       G+P P  
Sbjct: 318  PAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGPRGSEGPQGVRGEPGP-- 375

Query: 473  RLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQG--GSQGALGTAGKTPGP 530
                P  A    P   P A   P G +  +  P  AG P + G  G  G  G  G  PGP
Sbjct: 376  ----PGPAGAAGPAGNPGADGQP-GAKGANGAPGIAGAPGFPGARGPSGPQGPGGP-PGP 429

Query: 531  REKLPAVRSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSE 590
            +           G P      G T    +P   GV      P G       R     P  
Sbjct: 430  K--------GNSGEPGAPGSKGDTGAKGEPGPVGVQ----GPPGPAGEEGKRGARGEPGP 477

Query: 591  SPLPSPATNTAGSTCSSLSPMS--SSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSPF 648
            + LP P     G            + P  P+ E    PGP GP         P E G P 
Sbjct: 478  TGLPGPPGERGGPGSRGFPGADGVAGPKGPAGERGS-PGPAGPKGSPGEAGRPGEAGLP- 535

Query: 649  PSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGFPRA 708
                             AK         G +G      +T  P    + GR G  G P A
Sbjct: 536  ----------------GAKGLTGSPGSPGPDG------KTGPPGPAGQDGRPGPPGPPGA 573

Query: 709  PPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSP 768
                                         R  + +  F   +   G      K G +  P
Sbjct: 574  -----------------------------RGQAGVMGFPGPKGAAG---EPGKAGERGVP 601

Query: 769  GPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLP 828
            GPPG   P        D  AG          AG A   G+  P  +     L     P  
Sbjct: 602  GPPGAVGPAGK-----DGEAGAQGPPGP---AGPAGERGEQGPAGSPGFQGLPGPAGPPG 653

Query: 829  ASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSK 888
             +    E     D L     +G   +   P            + P GP GP   +     
Sbjct: 654  EAGKPGEQGVPGD-LGAPGPSGARGERGFPGERGV-------QGPPGPAGPRGANGAPGN 705

Query: 889  AGVTPESKAP-PPLPAATPDPQTPRPGDRGCPARGRPKTRSLGLAPTEADAPSQGRQQRR 947
             G   ++ AP  P     P  Q   PG+RG      PK       P  AD  S G+   R
Sbjct: 706  DGAKGDAGAPGAPGSQGAPGLQG-MPGERGAAGLPGPKGDRGDAGPKGADG-SPGKDGVR 763

Query: 948  GKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPPRPRRPRTQAPGSRAD 1007
            G         +   G A   G  G    SG             P  P   R  APG R +
Sbjct: 764  G-----LTGPIGPPGPAGAPGDKGESGPSG-------------PAGPTGARG-APGDRGE 804

Query: 1008 PAPRVPRAAALPEETRSSRRRRLPPRK-DPRKRKARGGAWGKELILKIVQQKNRLREYDF 1066
            P P  P   A P           P  K +P    A+G A                     
Sbjct: 805  PGPPGPAGFAGPPGADGQ-----PGAKGEPGDAGAKGDAGPP------------------ 841

Query: 1067 ASESEEDEQPPPRG----PGFRGRRGRGEKRKEVELTQGPREDEPQKPRKAARQEAGGDG 1122
               +     P P G    PG +G RG                  P  P       AG  G
Sbjct: 842  -GPAGPAGPPGPIGNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGPSG----NAGPPG 896

Query: 1123 APANPEEPGGSRP----GPGRSPQARGPSRSLETGAAAREGGPKCADRPSVAPKDPLQVP 1178
             P    + GG  P    GP   P   GP      G A  +G P  AD P+ AP  P    
Sbjct: 897  PPGPAGKEGGKGPRGETGPAGRPGEVGPPGP--PGPAGEKGSPG-ADGPAGAPGTP---- 949

Query: 1179 TNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEALRSPPAACAGEMGASPGLLIPE 1238
               +     R  +  P +  E        P      E  +  P+  +GE G  PG + P 
Sbjct: 950  -GPQGIAGQRGVVGLPGQRGERGFPGLPGPSG----EPGKQGPSGASGERGP-PGPMGPP 1003

Query: 1239 Q---PPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSLLGGPGGTQAPVSHNSKDPPARQ 1295
                PP      G P   GS       G+    G     G PG   AP +          
Sbjct: 1004 GLAGPPGESGREGAPGAEGSPGRDGSPGAKGDRGETGPAGPPGAPGAPGA---------- 1053

Query: 1296 PGEFLAPVANPSSTACPKPSVLSSKISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSEL 1355
            PG  + P           P+            PAG    P+G PV  +GP     P  + 
Sbjct: 1054 PGP-VGPAGKSGDRGETGPA-----------GPAG----PVG-PVGARGPAGPQGPRGD- 1095

Query: 1356 FLGPKDLAGCFLEELHPKPSARDAPPASSSCLCQDGEDAGSLEPQLPRSPPGTAETEPGR 1415
              G     G    + H   S    PP       + G  +G+  P  PR PPG+A   PG+
Sbjct: 1096 -KGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQG-PSGASGPAGPRGPPGSAGA-PGK 1152

Query: 1416 AASPPTLESSSLFPDLPVDRFDPPLYGSLSANRDSGLPFACADPPQKTVPSDPPYPSF 1473
                           LP     PP  G      D+G P     PP    P  PP   F
Sbjct: 1153 DG----------LNGLP-GPIGPP--GPRGRTGDAG-PVGPPGPPGPPGPPGPPSAGF 1196



 Score = 83.2 bits (204), Expect = 5e-15
 Identities = 212/802 (26%), Positives = 259/802 (32%), Gaps = 166/802 (20%)

Query: 27  PGHPSQPPLEDN-TPATRTTKGAREAGGQAQAMELPEAQPRQARDGELKPPSLRG----Q 81
           PG P  P L  N  P        +  GG +    +  + PR    G   PP   G    Q
Sbjct: 147 PGPPGPPGLGGNFAPQLSYGYDEKSTGGISVPGPMGPSGPR----GLPGPPGAPGPQGFQ 202

Query: 82  APSSTPGKRGS--------PQTPPGRSPLQAPSRLAGR-----------AEGSPPQRYIL 122
            P   PG+ G+        P  PPG++     +   GR           A G P    + 
Sbjct: 203 GPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRPGERGPPGPQGARGLPGTAGLP 262

Query: 123 GIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPG-TGAP--LRP-GLPRTEAQPAAEEL 178
           G+   R    LD      + +A        P  PG  GAP  + P GLP    +P A   
Sbjct: 263 GMKGHRGFSGLD----GAKGDAGPAGPKGEPGSPGENGAPGQMGPRGLPGERGRPGAPGP 318

Query: 179 GFHRCFQEPPSSFTSTNYTSPSATPRPPA-------------------------PGPPQS 213
              R       +      T P+  P  P                          PGPP  
Sbjct: 319 AGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGPRGSEGPQGVRGEPGPPGP 378

Query: 214 RGTS--PLQPGSYPEYQASGADSWPP-AAENSFPGANFGVPPAEP--EPIPKGS--RPG- 265
            G +     PG+  +  A GA+  P  A    FPGA     P  P   P PKG+   PG 
Sbjct: 379 AGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGPGGPPGPKGNSGEPGA 438

Query: 266 ----------GSPRGVSFQF-PFPA----LHGASTKPFPADVAG-HAFTNGPLVFAFHQP 309
                     G P  V  Q  P PA      GA  +P P  + G      GP    F   
Sbjct: 439 PGSKGDTGAKGEPGPVGVQGPPGPAGEEGKRGARGEPGPTGLPGPPGERGGPGSRGFPGA 498

Query: 310 QGAWPEEAVGTGPAYPLPTQPAPSPL-----PCYQGQPG--GLNRHSDLSGALSSPGAAH 362
            G         GP  P   + +P P      P   G+PG  GL     L+G+  SPG   
Sbjct: 499 DGV-------AGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPDG 551

Query: 363 SAPRPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSSLPQ---RHFPGQAYRASGVDTS 419
               P                 P+ QDG     GPP +  Q     FPG      G    
Sbjct: 552 KTGPP----------------GPAGQDGRPGPPGPPGARGQAGVMGFPG----PKGAAGE 591

Query: 420 PGPPDTELAAPGPPPARLPQLWDPTA-APYPTPPGGPL------AATRSMFFNGQPSPGQ 472
           PG    E   PGPP A  P   D  A A  P  P GP           S  F G P P  
Sbjct: 592 PGKAG-ERGVPGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAG 650

Query: 473 RLCLPQSAPLPWPQVLP--TARPSPHGMEMLSRLPFPAG--GPEWQGGSQGALGTAGKTP 528
               P  A  P  Q +P     P P G       P   G  GP    G +GA G  G   
Sbjct: 651 P---PGEAGKPGEQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDG 707

Query: 529 GPREK-LPAVRSSQG-----GSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPR 582
              +   P    SQG     G P      G+  P       G A P+    G+P     R
Sbjct: 708 AKGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDR---GDAGPK-GADGSPGKDGVR 763

Query: 583 VVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPP---T 639
            +   P   P P+ A    G +  S  P   + A  +  +   PGP GP+ F  PP    
Sbjct: 764 GL-TGPIGPPGPAGAPGDKGESGPS-GPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADG 821

Query: 640 HPQETGSPFPSPEPPHSLPTHYQPEPA--KAFPFPADGLGAEGAFQCLEE------TPFP 691
            P   G P  +     + P    P PA     P P   +GA GA            T FP
Sbjct: 822 QPGAKGEPGDAGAKGDAGP----PGPAGPAGPPGPIGNVGAPGAKGARGSAGPPGATGFP 877

Query: 692 HEGPEVGRGGLQGFPRAPPPYP 713
                VG  G  G   A PP P
Sbjct: 878 GAAGRVGPPGPSG--NAGPPGP 897



 Score = 79.7 bits (195), Expect = 5e-14
 Identities = 196/772 (25%), Positives = 235/772 (30%), Gaps = 156/772 (20%)

Query: 6    PRGAP-PPTMTGDLQPRQVASSPG--HPSQPPLEDNTPATRTTKGAREAGGQAQAMELPE 62
            P G P PP   G    R    + G   P  P  E  +P     KG+    G+     LP 
Sbjct: 477  PTGLPGPPGERGGPGSRGFPGADGVAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPG 536

Query: 63   AQPRQAR------DGELKPPSLRGQ----APSSTPGKRGSPQT---PPGRSPLQAPSRLA 109
            A+           DG+  PP   GQ     P   PG RG       P  +     P +  
Sbjct: 537  AKGLTGSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAG 596

Query: 110  GRAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPG-TGAPLRPGLPR 168
             R    PP    +G A    +    + P  P   A +  E      PG  G P   G P 
Sbjct: 597  ERGVPGPPGA--VGPAGKDGEAGA-QGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPG 653

Query: 169  TEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQ 228
               +P  + +        P  +     +        PP P  P+    +P   G+  +  
Sbjct: 654  EAGKPGEQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAG 713

Query: 229  ASGADSWPPAAENSFPGANFGVPP---AEPEPIPKGSRPGGSPRGVSF---QFPFPALHG 282
            A GA    P ++ + PG   G+P    A   P PKG R    P+G      +     L G
Sbjct: 714  APGA----PGSQGA-PGLQ-GMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTG 767

Query: 283  ASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPL---PCYQ 339
                P PA   G    +GP       P G  P  A G       P  P P+     P   
Sbjct: 768  PIGPPGPAGAPGDKGESGP-----SGPAG--PTGARGAPGDRGEPGPPGPAGFAGPPGAD 820

Query: 340  GQPGGLNRHSDLS--GALSSPGAAHSAPRPFSDSLHKSLTKILPERPPSAQDGLGSTRGP 397
            GQPG      D    G    PG A  A  P           I     P A+   GS  GP
Sbjct: 821  GQPGAKGEPGDAGAKGDAGPPGPAGPAGPP---------GPIGNVGAPGAKGARGSA-GP 870

Query: 398  PSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGPP-PARLPQLWDPTAAPYPT------ 450
            P +     FPG A R       P  P      PGPP PA       P     P       
Sbjct: 871  PGATG---FPGAAGRVG-----PPGPSGNAGPPGPPGPAGKEGGKGPRGETGPAGRPGEV 922

Query: 451  -PPGGPLAATRSMFFNGQPSPGQRLCLPQSAP-LPWPQVLPTAR-----PSPHGMEMLSR 503
             PPG P  A       G P        P  AP  P PQ +   R     P   G      
Sbjct: 923  GPPGPPGPAGEK----GSPGADG----PAGAPGTPGPQGIAGQRGVVGLPGQRGERGFPG 974

Query: 504  LPFPAGGPEWQGGSQGALGTAGKTPGP--------------REKLPAVRSSQG--GSPAL 547
            LP P+G P  QG S GA G  G  PGP              RE  P    S G  GSP  
Sbjct: 975  LPGPSGEPGKQGPS-GASGERGP-PGPMGPPGLAGPPGESGREGAPGAEGSPGRDGSPGA 1032

Query: 548  FTYNGMTDPGAQPLFFGV--AQPQVSPHG-------TPSLPPPRVVGASPSESPL-PSPA 597
                G T P   P   G   A   V P G       T    P   VG   +  P  P   
Sbjct: 1033 KGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPAGPAGPVGPVGARGPAGPQGP 1092

Query: 598  TNTAGSTCSS----------LSPMSSSPANPSSEESQ----------------------- 624
                G T              S +   P  P S   Q                       
Sbjct: 1093 RGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSAGAPGK 1152

Query: 625  -----LPGPLGP------SAFFHPPTHPQETGSPFPSPEPPHSLPTHYQPEP 665
                 LPGP+GP      +    P   P   G P P   P       + P+P
Sbjct: 1153 DGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSFLPQP 1204



 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 270/1079 (25%), Positives = 337/1079 (31%), Gaps = 211/1079 (19%)

Query: 1881 GPGVAKSKDGILGLQELTPAAQSPPRVNPSGLEGGTVEGGKVACGPAQGSPGGVQVTTLP 1940
            GP     +DGI G   L      P    P GL G      +++ G  + S GG+ V    
Sbjct: 124  GPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAP--QLSYGYDEKSTGGISVPGPM 181

Query: 1941 AVAGHQLGLE----ADGHWGLLGQAEKTQGQGTANQLQPENGVSP---GGTDNHASVNAS 1993
              +G + GL     A G  G  G   +    G +  + P     P    G D  A     
Sbjct: 182  GPSGPR-GLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGR 240

Query: 1994 P-KTALTGPT-----EGAVLLEKCKGSRAAMSLQEEAEPTPSPPSPNRESLALALTAAHS 2047
            P +    GP       G   L   KG R    L + A+    P  P  E  +     A  
Sbjct: 241  PGERGPPGPQGARGLPGTAGLPGMKGHRGFSGL-DGAKGDAGPAGPKGEPGSPGENGAPG 299

Query: 2048 RSGSEGRTPERASSPGLNKPLLATGDSPAPSVGDLAACAPSPTSAAHMPCSLGPLPREDP 2107
            + G  G   ER   PG   P  A G+  A      AA  P PT  A  P   G +  +  
Sbjct: 300  QMGPRGLPGERGR-PGAPGPAGARGNDGATG----AAGPPGPTGPAGPPGFPGAVGAKGE 354

Query: 2108 LTSPSRAQGGLGGQ-LPASPSCRDPPGPQQLLACSPAWAPLEEADGVQATTDTGAEDSPV 2166
               P   +G  G Q +   P    PPGP    A  PA  P   ADG       GA+ +  
Sbjct: 355  -AGPQGPRGSEGPQGVRGEPG---PPGPAG--AAGPAGNP--GADG-----QPGAKGANG 401

Query: 2167 APPSLTTSPCDPKEALAGCLLQGEGSPLEDPSSWPPGSVSAVTCTHSGDTPKDSTLRIPE 2226
            AP  +  +P  P         +G   P + P   PPG             PK ++     
Sbjct: 402  AP-GIAGAPGFPGA-------RGPSGP-QGPGG-PPG-------------PKGNS----- 433

Query: 2227 DSRKEKLWESPGRATSPPLAGAVSPSVAVRATGLSSTPTGDEAQAGR-------GLPGPD 2279
                      PG   S    GA      V   G    P G+E + G        GLPGP 
Sbjct: 434  --------GEPGAPGSKGDTGAKGEPGPVGVQGPPG-PAGEEGKRGARGEPGPTGLPGP- 483

Query: 2280 PQSRGAPPHTNPDRMPRGHSSYSPSNTARLGHREGQAVTAVPTEPPTLQGA-GPDSPACL 2338
            P  RG P         RG                G    A P  P   +G+ GP  P   
Sbjct: 484  PGERGGPGS-------RGFP--------------GADGVAGPKGPAGERGSPGPAGPKGS 522

Query: 2339 EGEMGTSSKEPEDPGTPETGRSGATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSH 2398
             GE G     P + G P  G  G T  P    P      G+T  P     D +   P   
Sbjct: 523  PGEAG----RPGEAGLP--GAKGLTGSPGSPGPD-----GKTGPPGPAGQDGRPGPPGPP 571

Query: 2399 RNASHQTPQGDPLGPQDL-----KQRSRGYKKKPAST----ENGQWKGQAPHGPVTCEVC 2449
                     G P GP+       K   RG    P +     ++G+   Q P GP      
Sbjct: 572  GARGQAGVMGFP-GPKGAAGEPGKAGERGVPGPPGAVGPAGKDGEAGAQGPPGPAG---- 626

Query: 2450 AASFRSGPGLSRHKARKHRPHPGAPAEPSPAALPAQQPLEPLAQKCQPPRKKSHR----- 2504
             A  R   G +     +  P P  P  P  A  P +Q +        P   +  R     
Sbjct: 627  PAGERGEQGPAGSPGFQGLPGPAGP--PGEAGKPGEQGVPGDLGAPGPSGARGERGFPGE 684

Query: 2505 --VSGKERPNHSRGDPSHVTQPPPAQGSKEVLRAPGSPHSQQLHPPSPTEHEVDVKTPAS 2562
              V G   P   RG        P   G+K    APG+P SQ          E   +  A 
Sbjct: 685  RGVQGPPGPAGPRG----ANGAPGNDGAKGDAGAPGAPGSQGAPGLQGMPGE---RGAAG 737

Query: 2563 KPRPDQAREDELHPKQAEKREGRRWRREPTVDSPSHSEGKSNKKRGKLRGRRLREESILP 2622
             P P   R D   PK A+   G+   R  T   P    G +     K  G         P
Sbjct: 738  LPGPKGDRGDA-GPKGADGSPGKDGVRGLT--GPIGPPGPAGAPGDK--GESGPSGPAGP 792

Query: 2623 VSADVISDGRGSRPSPAMASYAASPSHCLSVEGGPEADGEQ----------PPRLATLGP 2672
              A      RG    P  A +A  P      +G P A GE           PP  A  GP
Sbjct: 793  TGARGAPGDRGEPGPPGPAGFAGPPG----ADGQPGAKGEPGDAGAKGDAGPPGPA--GP 846

Query: 2673 GVMEGAAETDQEALCAGETGAQKPPGDRMLCPGRMDGAALGEQPTGQKG-ASARGFWGPR 2731
                G           G  G+  PPG          GAA    P G  G A   G  GP 
Sbjct: 847  AGPPGPIGNVGAPGAKGARGSAGPPGAT-----GFPGAAGRVGPPGPSGNAGPPGPPGPA 901

Query: 2732 ETKALGVCKESGSEPAEDSSRAHSRSEEG-------VWEENTPPL-GPLGFPETSSSPAD 2783
                    KE G  P  ++  A    E G         E+ +P   GP G P T   P  
Sbjct: 902  G-------KEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPG-PQG 953

Query: 2784 STTSSCLQGLPDN-----------PDTQGGVQGPEGPTPDASGSSAKDPPSLFDDEVSFS 2832
                  + GLP             P  + G QGP G + +        PP L        
Sbjct: 954  IAGQRGVVGLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESG 1013

Query: 2833 QLFPPG--GRLTRKRNPHVYGKRCE-----------KPVLPLPTQPSFEEGGDPTLGPA 2878
            +   PG  G   R  +P   G R E            P  P P  P+ + G     GPA
Sbjct: 1014 REGAPGAEGSPGRDGSPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPA 1072



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 129/491 (26%), Positives = 161/491 (32%), Gaps = 75/491 (15%)

Query: 3415 GGRQPFAFRGVRRP----GAPGQKARALEGTLPSKRRRVAMPGSA--------PGP-GED 3461
            G + P   RG   P    G+PG+  R  E  LP  +     PGS         PGP G+D
Sbjct: 503  GPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPDGKTGPPGPAGQD 562

Query: 3462 -RPPPRGSSPILSEGSLPALLHLCSEVAPSTTKGWP-ETLER--PVDPVTHPIRGCELPS 3517
             RP P G      +  +           P    G P +  ER  P  P      G +  +
Sbjct: 563  GRPGPPGPPGARGQAGVMGF------PGPKGAAGEPGKAGERGVPGPPGAVGPAGKDGEA 616

Query: 3518 NHQECPPPSLSPFPAALADGRGDCALDGALERPENEASPGSPGPLLQQALPLGASLPRP- 3576
              Q  P P+    PA     +G     G    P     PG  G   +Q +P     P P 
Sbjct: 617  GAQGPPGPA---GPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPGDLGAPGPS 673

Query: 3577 GARGQDAEGKRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGT 3636
            GARG+          F G+R   G  G   P                     + G P   
Sbjct: 674  GARGERG--------FPGERGVQGPPGPAGPRG-------------------ANGAPGND 706

Query: 3637 FHKGSATKPA--------GCQSSSKDRSAASTPS-KALKFPVHPRKAVGSLAPG-ELARG 3686
              KG A  P         G Q    +R AA  P  K  +    P+ A GS  PG +  RG
Sbjct: 707  GAKGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGS--PGKDGVRG 764

Query: 3687 TENGMKPATPKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRS 3746
                + P  P   PG   + SG   P   TG    P    G+         A P      
Sbjct: 765  LTGPIGPPGPAGAPGDKGE-SGPSGPAGPTGARGAPGDR-GEPGPPGPAGFAGPPGADGQ 822

Query: 3747 PAPERLPARAQAKSCTKGPREAGEQGPHGSLG----PKEKGESSTKRKKGQVPGPARSES 3802
            P  +  P  A AK     P  AG  GP G +G    P  KG   +    G    P  +  
Sbjct: 823  PGAKGEPGDAGAKGDAGPPGPAGPAGPPGPIGNVGAPGAKGARGSAGPPGATGFPGAAGR 882

Query: 3803 VGSFGRAPSA-PDKPPRTPRKQATPSRVLPTKP--KPNSQNKPRPPPSEQRKAEPGHTQR 3859
            VG  G + +A P  PP    K+        T P  +P     P PP     K  PG    
Sbjct: 883  VGPPGPSGNAGPPGPPGPAGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGP 942

Query: 3860 KDRLGKAFPQG 3870
                G   PQG
Sbjct: 943  AGAPGTPGPQG 953



 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 236/1034 (22%), Positives = 309/1034 (29%), Gaps = 161/1034 (15%)

Query: 1879 LPGPGVAKSKDGILGL--QELTPAAQSP--PR--VNPSGLEGGTVEGGKVACGPAQGSPG 1932
            LPGP  A    G  G   +   P A  P  PR    P G  G   E GK      +G PG
Sbjct: 189  LPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRPGERGPPG 248

Query: 1933 -----GVQVTT-LPAVAGHQLGLEADGHWGLLGQAEKTQGQGTANQLQPENGVSP----- 1981
                 G+  T  LP + GH+     DG  G  G A      G+  +      + P     
Sbjct: 249  PQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRGLPG 308

Query: 1982 -----------GGTDNHASVNASPKTALTGP-----------TEGAVLLEKCKGSRAAMS 2019
                       G   N  +  A+     TGP            +G    +  +GS     
Sbjct: 309  ERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGPRGSEGPQG 368

Query: 2020 LQEEAEPTPSPPSPNRESLALALTAAHSRSGSEGR--TPERASSPGL-----NKPLLATG 2072
            ++ E    P PP P   +       A  + G++G    P  A +PG             G
Sbjct: 369  VRGE----PGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGPG 424

Query: 2073 DSPAPSVGDLAACAPSPTSAAHMPCSLGPLPREDPLTSPSRAQGGLGGQ-LPASPSCRDP 2131
              P P        AP            GP+  + P   P+  +G  G +  P       P
Sbjct: 425  GPPGPKGNSGEPGAPGSKGDTGAKGEPGPVGVQGP-PGPAGEEGKRGARGEPGPTGLPGP 483

Query: 2132 PGPQQLLACSPAWAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCD---PKEA-LAGC-- 2185
            PG +      P       ADGV        E     P     SP +   P EA L G   
Sbjct: 484  PGERG----GPGSRGFPGADGVAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKG 539

Query: 2186 LLQGEGSPLEDPSSWPPGSVSAVTCTHSGDTP----KDSTLRIPEDSRKEKLWESPGRAT 2241
            L    GSP  D  + PPG             P    +   +  P            G   
Sbjct: 540  LTGSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERG 599

Query: 2242 SPPLAGAVSPSVAVRATGLSST--PTGDEAQAGRGLPGPDPQSRGAP-PHTNPDRMPRGH 2298
             P   GAV P+      G      P G   + G   P   P  +G P P   P    +  
Sbjct: 600  VPGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPG 659

Query: 2299 SSYSPSNTARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSSKEPE--DPGTPE 2356
                P +    G    +     P E       GP  P    G  G    + +   PG P 
Sbjct: 660  EQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAP- 718

Query: 2357 TGRSGATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRNASHQT----PQGDPLG 2412
             G  GA  +  +       GL         A    +D           T    P G    
Sbjct: 719  -GSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPAGA 777

Query: 2413 PQDLKQRSRGYKKKPASTEN--GQWKGQAPHGPVTCEVCAASFRSGPGLSRHKARKHRP- 2469
            P D  +        P       G      P GP       A F   PG       K  P 
Sbjct: 778  PGDKGESGPSGPAGPTGARGAPGDRGEPGPPGP-------AGFAGPPGADGQPGAKGEPG 830

Query: 2470 ---HPGAPAEPSPAALPAQQPLEPLAQKCQPPRKKSHRVSGKERPNHSRGDPSHVTQPPP 2526
                 G    P PA  PA  P  P+     P  K +   +G        G    V  P P
Sbjct: 831  DAGAKGDAGPPGPAG-PAGPP-GPIGNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGP 888

Query: 2527 AQGSKEVLRAPGSPHSQQLHPPSPTEHEVDVKTPASKPRPDQAREDELHPKQAEKREGRR 2586
            +  +       G P      PP P   E   K P  +  P   R  E+ P       G  
Sbjct: 889  SGNA-------GPP-----GPPGPAGKE-GGKGPRGETGP-AGRPGEVGPPGPPGPAGE- 933

Query: 2587 WRREPTVDSPSHSEGKSNKKRGKLRGRRLREESILPVSADVISDGRGSRPSPAMASYAAS 2646
             +  P  D P+ + G    +   + G+R             +   RG R  P +   +  
Sbjct: 934  -KGSPGADGPAGAPGTPGPQ--GIAGQR---------GVVGLPGQRGERGFPGLPGPSGE 981

Query: 2647 PSHCLSVEGGPEADGEQPPRLATLGPGVMEGAAETDQEALCAGETGAQKPPGDRMLCPGR 2706
            P      +G   A GE+ P      PG+     E+ +E    G  GA+  PG       +
Sbjct: 982  PGK----QGPSGASGERGPPGPMGPPGLAGPPGESGRE----GAPGAEGSPGRDGSPGAK 1033

Query: 2707 MDGAALGEQPTGQKGA-SARGFWGPRETKALGVCKESGSE-------PAEDSSRAHSRSE 2758
             D    G  P G  GA  A G  GP     +G   +SG         PA       +R  
Sbjct: 1034 GDRGETG--PAGPPGAPGAPGAPGP-----VGPAGKSGDRGETGPAGPAGPVGPVGARGP 1086

Query: 2759 EGVWEENTPPLGPLGFPETSSSPADSTTS-----SCLQGLPDNPDTQG-----GVQGPEG 2808
             G       P GP G    +    D         S LQG P  P + G     G  GP G
Sbjct: 1087 AG-------PQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAG 1139

Query: 2809 P--TPDASGSSAKD 2820
            P   P ++G+  KD
Sbjct: 1140 PRGPPGSAGAPGKD 1153



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 108/429 (25%), Positives = 138/429 (32%), Gaps = 52/429 (12%)

Query: 3428 PGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPP----PRGSSPILSEGSLPALLHL 3483
            PG PG    A       +      PG A   G+  PP    P G    +     P     
Sbjct: 805  PGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGPPGPAGPAGPPGPIGNVGAPGAKGA 864

Query: 3484 CSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGDCAL 3543
                 P    G+P    R   P          PS +   P P   P PA    G+G    
Sbjct: 865  RGSAGPPGATGFPGAAGRVGPPG---------PSGNAGPPGP---PGPAGKEGGKGPRGE 912

Query: 3544 DGALERPENEASPGSPGPLLQQALPLGASLP--RPGARG-QDAEGKRAPLVFSGKRRAPG 3600
             G   RP     PG PGP  ++  P GA  P   PG  G Q   G+R  +   G+R   G
Sbjct: 913  TGPAGRPGEVGPPGPPGPAGEKGSP-GADGPAGAPGTPGPQGIAGQRGVVGLPGQRGERG 971

Query: 3601 ARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSAAST 3660
              G   P          +  +   S    E GP G         P G         A  +
Sbjct: 972  FPGLPGPS--------GEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGAPGAEGS 1023

Query: 3661 PSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPG-PSSQGSGSPRPGTKTGGG 3719
            P +               +PG  A+G      PA P   PG P + G   P   +   G 
Sbjct: 1024 PGR-------------DGSPG--AKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGE 1068

Query: 3720 SQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPRE-AGEQGPHGSLG 3778
            + P   +G +    A  PA P    + P  ++     Q     KG R  +G QGP G  G
Sbjct: 1069 TGPAGPAGPVGPVGARGPAGP----QGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPG 1124

Query: 3779 -PKEKGESSTKRKKGQVPGPARSESVGSFG-RAPSAPDKPPRTPRKQATPSRVLPTKPKP 3836
             P E+G S      G    P  + + G  G      P  PP    +      V P  P P
Sbjct: 1125 SPGEQGPSGASGPAGPRGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGP-P 1183

Query: 3837 NSQNKPRPP 3845
                 P PP
Sbjct: 1184 GPPGPPGPP 1192



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 169/642 (26%), Positives = 207/642 (32%), Gaps = 104/642 (16%)

Query: 3    GER----PRGAPP-PTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQA 57
            GER    P G+P    + G   P   A  PG    P  +   P     +G R   G+   
Sbjct: 629  GERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPG-DLGAPGPSGARGERGFPGERGV 687

Query: 58   MELPEAQPRQARDGELKPPSLRGQAPS-STPGKRGSP--QTPPG-RSPLQAPSRLAGR-- 111
               P     +  +G       +G A +   PG +G+P  Q  PG R     P     R  
Sbjct: 688  QGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGD 747

Query: 112  -----AEGSPPQRYILGIASSRTKPTL-----DETPENPQLEAAQLPEVDTPQGPGTGAP 161
                 A+GSP +  + G+      P       D+    P   A        P   G   P
Sbjct: 748  AGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGDKGESGPSGPAGPTGARGAPGDRGEPGP 807

Query: 162  LRP----GLPRTEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTS 217
              P    G P  + QP A+         EP  +    +   P   P  PA GPP      
Sbjct: 808  PGPAGFAGPPGADGQPGAKG--------EPGDAGAKGDAGPPG--PAGPA-GPP-----G 851

Query: 218  PLQPGSYPEYQASGADSWPPAAENSFPGANFGVPPAEPE--------PIPKGSRPGGSPR 269
            P+     P  + +   + PP A   FPGA   V P  P         P P G   G  PR
Sbjct: 852  PIGNVGAPGAKGARGSAGPPGA-TGFPGAAGRVGPPGPSGNAGPPGPPGPAGKEGGKGPR 910

Query: 270  GVSFQFPFPALHGASTKPFPADVAGHAFTNGPL-VFAFHQPQGAWPEEAV----GTGPAY 324
            G +     P   G    P PA   G    +GP        PQG   +  V    G     
Sbjct: 911  GETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPGPQGIAGQRGVVGLPGQRGER 970

Query: 325  PLPTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERP 384
              P  P PS  P  QG P G +      G +  PG A     P  +S          E  
Sbjct: 971  GFPGLPGPSGEPGKQG-PSGASGERGPPGPMGPPGLA----GPPGESGR--------EGA 1017

Query: 385  PSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGP-PPARLPQLWDP 443
            P A+   G   G P +   R   G A    G   +PG P     APGP  PA        
Sbjct: 1018 PGAEGSPGRD-GSPGAKGDRGETGPA----GPPGAPGAP----GAPGPVGPAGKSGDRGE 1068

Query: 444  TAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSR 503
            T    P  P GP+ A       G   P      P+       +          G   L  
Sbjct: 1069 TGPAGPAGPVGPVGA------RGPAGPQG----PRGDKGETGEQGDRGIKGHRGFSGLQG 1118

Query: 504  LPFPAGGPEWQGGSQGALGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTDPGAQP--- 560
             P P G P  QG S GA G AG    P            G+P     NG+  P   P   
Sbjct: 1119 PPGPPGSPGEQGPS-GASGPAGPRGPP---------GSAGAPGKDGLNGLPGPIGPPGPR 1168

Query: 561  LFFGVAQPQVSPHGTPSLP-PPRVVGASPSESPLPSPATNTA 601
               G A P V P G P  P PP    A    S LP P    A
Sbjct: 1169 GRTGDAGP-VGPPGPPGPPGPPGPPSAGFDFSFLPQPPQEKA 1209



 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 235/978 (24%), Positives = 311/978 (31%), Gaps = 195/978 (19%)

Query: 1656 PFSPRGANFHFQPVQKAGASK--TGLCQAEGDSRPPQDVCLPEPSKQPGPQLDAGSLAK- 1712
            P  P G   +F P    G  +  TG     G   P     LP P   PGPQ   G   + 
Sbjct: 149  PPGPPGLGGNFAPQLSYGYDEKSTGGISVPGPMGPSGPRGLPGPPGAPGPQGFQGPPGEP 208

Query: 1713 ----CSPDQELSFPKNKEAASSQESEDSLRLLPCEQRGGFLPE-----PGTADQP----H 1759
                 S       P      +  + E      P E RG   P+     PGTA  P    H
Sbjct: 209  GEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRPGE-RGPPGPQGARGLPGTAGLPGMKGH 267

Query: 1760 RG--------------APAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPSHAAQG 1805
            RG               P  E  GSP  + AP     G    P +   P    P+ A   
Sbjct: 268  RGFSGLDGAKGDAGPAGPKGEP-GSPGENGAP--GQMGPRGLPGERGRPGAPGPAGARGN 324

Query: 1806 HSAGRAGGHLHPT--AGRPGFEG-----NEFAPAGASSLTAPRGREAWLVPVPSPACVSN 1858
              A  A G   PT  AG PGF G      E  P G      P+G      P P PA  + 
Sbjct: 325  DGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGPRGSEGPQGVRGEPGP-PGPAGAAG 383

Query: 1859 THPSRRSQDPALSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRV----NPSGLEG 1914
                     PA +P       PG   A    GI G     P A+ P        P G +G
Sbjct: 384  ---------PAGNPGAD--GQPGAKGANGAPGIAGAPGF-PGARGPSGPQGPGGPPGPKG 431

Query: 1915 GTVE----GGKVACGPAQGSPGGVQVTTLPAVAGHQ--LGLEAD-GHWGLLGQAEKTQGQ 1967
             + E    G K   G A+G PG V V   P  AG +   G   + G  GL G   +  G 
Sbjct: 432  NSGEPGAPGSKGDTG-AKGEPGPVGVQGPPGPAGEEGKRGARGEPGPTGLPGPPGERGGP 490

Query: 1968 GTANQLQPENGVSPGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPT 2027
            G+      +    P G    A    SP  A    + G    E  +   A +   +    +
Sbjct: 491  GSRGFPGADGVAGPKGP---AGERGSPGPAGPKGSPG----EAGRPGEAGLPGAKGLTGS 543

Query: 2028 PSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAPSVGDLAACAP 2087
            P  P P+ +      T     +G +GR       PG   P  A G +            P
Sbjct: 544  PGSPGPDGK------TGPPGPAGQDGR-------PGPPGPPGARGQAGVMGF-------P 583

Query: 2088 SPTSAAHMPCSLGP--LPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQLLACSPAWA 2145
             P  AA  P   G   +P       P+   G  G Q P  P+       +Q  A SP + 
Sbjct: 584  GPKGAAGEPGKAGERGVPGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQ 643

Query: 2146 PLEEADGVQATTDTGAEDSPVAPPSLTTSPCDPKEALAGCL-------LQGE-GSPLEDP 2197
             L                 P  PP     P   ++ + G L        +GE G P E  
Sbjct: 644  GL---------------PGPAGPPGEAGKP--GEQGVPGDLGAPGPSGARGERGFPGERG 686

Query: 2198 SSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRA 2257
               PPG             P+ +               +PG   +   AGA     +  A
Sbjct: 687  VQGPPGPAG----------PRGAN-------------GAPGNDGAKGDAGAPGAPGSQGA 723

Query: 2258 TGLSSTPTGDEAQAGRGLPGP-----DPQSRGAPPHTNPDRMPRGHSSYSPSNTARLGHR 2312
             GL   P G+   A  GLPGP     D   +GA      D +        P   A     
Sbjct: 724  PGLQGMP-GERGAA--GLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGD 780

Query: 2313 EGQAVTAVPTEPPTLQGA-------GPDSPACLEGEMGTSSKEPEDPGTP-ETGRSGATK 2364
            +G++  + P  P   +GA       GP  PA   G  G    +P   G P + G  G   
Sbjct: 781  KGESGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADG-QPGAKGEPGDAGAKGDAG 839

Query: 2365 MPRVTCPSTGLG-LGRTTAP------SSTASDFQSDSPQSHRNASHQTPQGD--PLGPQD 2415
             P    P+   G +G   AP       S      +  P +        P G+  P GP  
Sbjct: 840  PPGPAGPAGPPGPIGNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPG 899

Query: 2416 LKQRSRGYKKKPASTENGQWKGQAPHGPVTCEVCAASFRSGPGLSRHKARKHRPHP-GAP 2474
               +  G   +  +   G+     P GP             PG +  K       P GAP
Sbjct: 900  PAGKEGGKGPRGETGPAGRPGEVGPPGP-------------PGPAGEKGSPGADGPAGAP 946

Query: 2475 AEPSPAALPAQQPLEPL----AQKCQPPRKKSHRVSGKERPNHSRGD--------PSHVT 2522
              P P  +  Q+ +  L     ++  P         GK+ P+ + G+        P  + 
Sbjct: 947  GTPGPQGIAGQRGVVGLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLA 1006

Query: 2523 QPPPAQGSKEVLRAPGSP 2540
             PP   G +    A GSP
Sbjct: 1007 GPPGESGREGAPGAEGSP 1024



 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 121/477 (25%), Positives = 158/477 (33%), Gaps = 109/477 (22%)

Query: 3429 GAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEVA 3488
            GAPGQ        LP +R R   PG A   G D        P                  
Sbjct: 296  GAPGQMGPR---GLPGERGRPGAPGPAGARGNDGATGAAGPP--------------GPTG 338

Query: 3489 PSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGDCALDGALE 3548
            P+   G+P  +    +      RG E P   +  P P   P PA  A   G+   DG   
Sbjct: 339  PAGPPGFPGAVGAKGEAGPQGPRGSEGPQGVRGEPGP---PGPAGAAGPAGNPGADG--- 392

Query: 3549 RPENEASPGSPGPLLQQALPLGASLPRPGARG----QDAEGKRAPLVFSGKRRAPGARGR 3604
            +P  + + G+PG        +  +   PGARG    Q   G   P   SG+  APG++G 
Sbjct: 393  QPGAKGANGAPG--------IAGAPGFPGARGPSGPQGPGGPPGPKGNSGEPGAPGSKG- 443

Query: 3605 CAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSAASTPS-K 3663
                                +    E GP G         P G       R A   P   
Sbjct: 444  -------------------DTGAKGEPGPVG------VQGPPGPAGEEGKRGARGEPGPT 478

Query: 3664 ALKFPVHPRKAVGS--------LAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTK 3715
             L  P   R   GS        +A  +   G      PA PK  PG + +   +  PG K
Sbjct: 479  GLPGPPGERGGPGSRGFPGADGVAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAK 538

Query: 3716 --TGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLP-ARAQA--------KSCTKG 3764
              TG    P P       +  T P  P+     P P   P AR QA        K     
Sbjct: 539  GLTGSPGSPGP-------DGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGE 591

Query: 3765 PREAGEQ---GPHGSLGPKEK-GESSTKRKKGQV-PGPARSES--VGSFG----RAPSAP 3813
            P +AGE+   GP G++GP  K GE+  +   G   P   R E    GS G      P+ P
Sbjct: 592  PGKAGERGVPGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGP 651

Query: 3814 DKPPRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQG 3870
                  P +Q  P  +            P P  +   +  PG    +   G A P+G
Sbjct: 652  PGEAGKPGEQGVPGDL----------GAPGPSGARGERGFPGERGVQGPPGPAGPRG 698



 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 106/437 (24%), Positives = 143/437 (32%), Gaps = 71/437 (16%)

Query: 3483 LCSEVAPSTTKGWP--ETLERPVDPVTHPIRGCELPSNHQEC--PPPSLSPFPAALADGR 3538
            LC +V    TK  P  E  E    PV     G E P++ +      P     P       
Sbjct: 69   LCDDVICDETKNCPGAEVPEGECCPVCPD--GSESPTDQETTGVEGPKGDTGPRGPRGPA 126

Query: 3539 GDCALDGALERPENEASPGSPGPLLQQALPLGASLPRPGARGQDAEGKRA-----PLVFS 3593
            G    DG   +P     PG PGP     L  G +     + G D +         P+  S
Sbjct: 127  GPPGRDGIPGQPGLPGPPGPPGPPGPPGL--GGNFAPQLSYGYDEKSTGGISVPGPMGPS 184

Query: 3594 GKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSK 3653
            G R  PG  G   P  FQ       E   S        GPRG         P G    + 
Sbjct: 185  GPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPM-----GPRG---------PPGPPGKNG 230

Query: 3654 DRSAASTPSK-ALKFPVHPRKAVG----SLAPGELAR-------GTENGMKPATPKAKPG 3701
            D   A  P +   + P  P+ A G    +  PG           G +    PA PK +PG
Sbjct: 231  DDGEAGKPGRPGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPG 290

Query: 3702 PSSQGSGSPRPGTKTGGGSQPQPAS----GQLQSETATTPAKPSFPSRSPAPERLPARAQ 3757
               +     + G +   G + +P +    G   ++ AT  A P  P+    P   P    
Sbjct: 291  SPGENGAPGQMGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVG 350

Query: 3758 AKSCTKGPREAGEQGPHGSLGPK----EKGESSTKRKKGQVPGPARSESVGSFG------ 3807
            AK       EAG QGP GS GP+    E G        G    P      G+ G      
Sbjct: 351  AKG------EAGPQGPRGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPG 404

Query: 3808 ----------RAPSAPDKP--PRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPG 3855
                      R PS P  P  P  P+  +       +K    ++ +P P   +      G
Sbjct: 405  IAGAPGFPGARGPSGPQGPGGPPGPKGNSGEPGAPGSKGDTGAKGEPGPVGVQGPPGPAG 464

Query: 3856 HTQRKDRLGKAFPQGRP 3872
               ++   G+  P G P
Sbjct: 465  EEGKRGARGEPGPTGLP 481



 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 286/1248 (22%), Positives = 366/1248 (29%), Gaps = 255/1248 (20%)

Query: 1232 PGLLIPE-----------QPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSLLGGPGGT 1280
            PG  +PE           + P  +  TG   P G      P G +  PG   + G PG  
Sbjct: 82   PGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLP 141

Query: 1281 QAPVSHNSKDPPARQPGEFLAPVANPSSTACPKPSVLSSKISSFGCDPAGFNRDPLGVPV 1340
              P       PP    G F            P+ S    + S+ G    G    P+G   
Sbjct: 142  GPPGPPGPPGPPG-LGGNF-----------APQLSYGYDEKSTGGISVPG----PMGPSG 185

Query: 1341 AKKGPQPYSSPHSELFLGPKDLAGCFLEELHPKPSARDAPPASSSCLCQDGE-------- 1392
             +  P P  +P  + F GP    G   E     P     PP        DGE        
Sbjct: 186  PRGLPGPPGAPGPQGFQGPPGEPG---EPGASGPMGPRGPPGPPGKNGDDGEAGKPGRPG 242

Query: 1393 DAGSLEPQLPRSPPGTA-------------------ETEPGRAASPPTLESSSLFP---- 1429
            + G   PQ  R  PGTA                   +  P      P     +  P    
Sbjct: 243  ERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMG 302

Query: 1430 --DLPVDRFDPPLYGSLSANRDSGLPFACADPPQKTVPSDPP-YPSFLLLE-EVSPMLPS 1485
               LP +R  P   G   A  + G   A A PP  T P+ PP +P  +  + E  P  P 
Sbjct: 303  PRGLPGERGRPGAPGPAGARGNDGATGA-AGPPGPTGPAGPPGFPGAVGAKGEAGPQGPR 361

Query: 1486 HFPDLSGGKVLSKTCPPERTVV------PGA-----------------APSLPG------ 1516
                  G  V  +  PP           PGA                 AP  PG      
Sbjct: 362  GSEGPQG--VRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSG 419

Query: 1517 -KGSGCSVALMSHLSEDELEIQKLVTELESQLQRSKDTRGAPRELAEAESVG-RVELG-T 1573
             +G G       +  E      K  T  + +       +G P    E    G R E G T
Sbjct: 420  PQGPGGPPGPKGNSGEPGAPGSKGDTGAKGE-PGPVGVQGPPGPAGEEGKRGARGEPGPT 478

Query: 1574 GTE-PPSQRRTCQATVPHEDTFSAADLTRVGESTAHREGAESAVATVEAVQGRPGGTWPC 1632
            G   PP +R       P    F  AD     +  A   G+          +G PG     
Sbjct: 479  GLPGPPGERGG-----PGSRGFPGADGVAGPKGPAGERGSPGPAGP----KGSPG----- 524

Query: 1633 PASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQPVQKAGASKTGLCQAEGDSRPPQDV 1692
              +  PG A  LP A+   ++G+P SP G +    P   AG           D RP    
Sbjct: 525  -EAGRPGEAG-LPGAKG--LTGSPGSP-GPDGKTGPPGPAGQ----------DGRP---- 565

Query: 1693 CLPEPSKQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRLLPCEQRGGFLPEP 1752
                P   PG +  AG +    P      P             ++     +   G    P
Sbjct: 566  ---GPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGVPGPPGAVGPAGKDGEAGAQGPP 622

Query: 1753 GTADQP-HRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWP--------FGASPSHAA 1803
            G A     RG   P   GSP     P     G   PP +A  P         GA     A
Sbjct: 623  GPAGPAGERGEQGPA--GSPGFQGLP-----GPAGPPGEAGKPGEQGVPGDLGAPGPSGA 675

Query: 1804 QGHSA--GRAGGHLHPTAGRP----GFEGNEFAPAGASSLTAPRGREA-WLVPVPSPACV 1856
            +G     G  G    P    P    G  GN+ A   A +  AP  + A  L  +P     
Sbjct: 676  RGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGSQGAPGLQGMPGERGA 735

Query: 1857 SNTHPSRRSQDPALSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNPSGLEGGT 1916
            +     +  +  A           GP  A    G  G++ LT     P      G +G +
Sbjct: 736  AGLPGPKGDRGDA-----------GPKGADGSPGKDGVRGLTGPIGPPGPAGAPGDKGES 784

Query: 1917 VEGGKVACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTANQLQPE 1976
               G      A+G+PG       P  AG      ADG  G  G+      +G A    P 
Sbjct: 785  GPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGPPGPA 844

Query: 1977 NGVS-PGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPTPSPPSPNR 2035
                 PG   N  +  A       GP  GA       G          A P P PP P  
Sbjct: 845  GPAGPPGPIGNVGAPGAKGARGSAGP-PGATGFPGAAGRVGPPGPSGNAGP-PGPPGP-- 900

Query: 2036 ESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAPSVGDLAACAPSPTSAAHM 2095
                         +G EG    R  +    +P       P    G+    +P     A  
Sbjct: 901  -------------AGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKG--SPGADGPAGA 945

Query: 2096 PCSLGPLPREDPLTSPSRAQGGLGGQ-----LPASPSCRDPPGPQQLLACSPAWAPLEEA 2150
            P + GP        +  R   GL GQ      P  P     PG Q               
Sbjct: 946  PGTPGPQG-----IAGQRGVVGLPGQRGERGFPGLPGPSGEPGKQ--------------- 985

Query: 2151 DGVQATTDTGAEDSPVAPPSLTTSPCDP-KEALAGCLLQGEGSPLEDPSSWPPGSVSAVT 2209
             G    +       P+ PP L   P +  +E   G     EGSP  D S    G      
Sbjct: 986  -GPSGASGERGPPGPMGPPGLAGPPGESGREGAPG----AEGSPGRDGSPGAKGDRGETG 1040

Query: 2210 CTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPL--AGAVSPSVAVRATGLSSTPTGD 2267
                   P       P         +S  R  + P   AG V P V  R       P GD
Sbjct: 1041 PAGPPGAPGAPGAPGPVG----PAGKSGDRGETGPAGPAGPVGP-VGARGPAGPQGPRGD 1095

Query: 2268 EAQAGR-------------GLPGPDPQSRGAPPHTNPDRMPRGHSSYSPSNTARLGHREG 2314
            + + G              GL GP P   G+P    P           P  +A    ++G
Sbjct: 1096 KGETGEQGDRGIKGHRGFSGLQGP-PGPPGSPGEQGPSGASGPAGPRGPPGSAGAPGKDG 1154

Query: 2315 QAVTAVPTEPPTLQG----AGPDSPACLEGEMGTSSKEPEDPGTPETG 2358
                  P  PP  +G    AGP  P    G        P  PG P  G
Sbjct: 1155 LNGLPGPIGPPGPRGRTGDAGPVGPPGPPG-------PPGPPGPPSAG 1195



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 138/542 (25%), Positives = 171/542 (31%), Gaps = 115/542 (21%)

Query: 3422 FRGVRRP-------GAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSE 3474
            F G R P       G PG K  + E   P  +      G  PGP   + PP    P   E
Sbjct: 411  FPGARGPSGPQGPGGPPGPKGNSGEPGAPGSKGDTGAKGE-PGPVGVQGPP---GPAGEE 466

Query: 3475 GSLPALLHLCSEVAPSTTKGWPETLERPVD---PVTHPIRGCELPSNHQECPPPSLSPFP 3531
            G   A      E  P+   G P     P     P    + G + P+  +  P P+     
Sbjct: 467  GKRGAR----GEPGPTGLPGPPGERGGPGSRGFPGADGVAGPKGPAGERGSPGPAGPKGS 522

Query: 3532 AALADGRGDCALDGALERPENEASPGS------PGPLLQQALPLGASLPRPGARGQDA-- 3583
               A   G+  L GA     +  SPG       PGP  Q   P G   P PGARGQ    
Sbjct: 523  PGEAGRPGEAGLPGAKGLTGSPGSPGPDGKTGPPGPAGQDGRP-GPPGP-PGARGQAGVM 580

Query: 3584 -----EGKRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFH 3638
                 +G       +G+R  PG  G   P          K+ E  +       GP G   
Sbjct: 581  GFPGPKGAAGEPGKAGERGVPGPPGAVGP--------AGKDGEAGAQGPPGPAGPAG--- 629

Query: 3639 KGSATKPAGCQSSSKDRSAASTPSKALKFPVH----------PRKAVGSLA-PGELARGT 3687
            +     PAG          A  P +A K              P  A G    PGE  RG 
Sbjct: 630  ERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPGDLGAPGPSGARGERGFPGE--RGV 687

Query: 3688 ENGMKPATPKAKPG-PSSQGS----GSP-RPGTKTGGGSQPQP----ASGQLQSETATTP 3737
            +    PA P+   G P + G+    G+P  PG++   G Q  P    A+G    +     
Sbjct: 688  QGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGD 747

Query: 3738 AKPSFPSRSPAPER---LPARAQAKSCTKGPREAGEQGPHGSLGPK-------------- 3780
            A P     SP  +    L            P + GE GP G  GP               
Sbjct: 748  AGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGDKGESGPSGPAGPTGARGAPGDRGEPGP 807

Query: 3781 -----------------EKGESSTKRKKGQV--PGPARSES----VGSFGRAPSAPDK-- 3815
                              KGE      KG    PGPA        +G+ G AP A     
Sbjct: 808  PGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGPPGPAGPAGPPGPIGNVG-APGAKGARG 866

Query: 3816 ---PPRTPRKQATPSRVLPTKPKPNS--QNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQG 3870
               PP          RV P  P  N+     P P   E  K   G T    R G+  P G
Sbjct: 867  SAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPAGKEGGKGPRGETGPAGRPGEVGPPG 926

Query: 3871 RP 3872
             P
Sbjct: 927  PP 928



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 176/707 (24%), Positives = 212/707 (29%), Gaps = 157/707 (22%)

Query: 2632 RGSRPSPAMASYAASPSHCLSVEGGPEADGEQPPRLATLGPGVMEGAAETDQEALCAGET 2691
            +G+R  P  A       H     G    DG +       GP   +G   +  E    G+ 
Sbjct: 250  QGARGLPGTAGLPGMKGH----RGFSGLDGAK----GDAGPAGPKGEPGSPGENGAPGQM 301

Query: 2692 GAQKPPGDRML--CPGRM-----DGAALGEQPTGQKG-ASARGFWGPRETKALGVCKESG 2743
            G +  PG+R     PG       DGA     P G  G A   GF G     A+G   E+G
Sbjct: 302  GPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPG-----AVGAKGEAG 356

Query: 2744 SEPAEDSSRAHSRSEEGVWEENTPP-----LGPLGFPETSSSPADSTTSSC--LQGLPDN 2796
             +    S        +GV  E  PP      GP G P     P     +    + G P  
Sbjct: 357  PQGPRGSE-----GPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGF 411

Query: 2797 PDTQG--GVQGPEGPTPDASGSSAKDPPSLFDDEVSFSQLFPPG--GRLTRKRNPHVYGK 2852
            P  +G  G QGP GP      S     P    D  +  +  P G  G           G 
Sbjct: 412  PGARGPSGPQGPGGPPGPKGNSGEPGAPGSKGDTGAKGEPGPVGVQGPPGPAGEEGKRGA 471

Query: 2853 RCEKPVLPLPTQPSFEEGG---------DPTLGPARLPTDLSDSSSLCLCHEDPWEDEDP 2903
            R E     LP  P  E GG         D   GP + P     S         P E   P
Sbjct: 472  RGEPGPTGLPGPPG-ERGGPGSRGFPGADGVAGP-KGPAGERGSPGPAGPKGSPGEAGRP 529

Query: 2904 --AGLPESFLLDGFLNSRVPGIDPWAPGLSLWALEPSR--------EAGAEKLPSHCPED 2953
              AGLP +  L G   S  P      PG +     P          +AG    P      
Sbjct: 530  GEAGLPGAKGLTGSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAA 589

Query: 2954 DRPEAIPELHMVPAAWRGLEMPAPADDSSSSLGDVSPEPPSLER-ERCDGGLPGNTHLLP 3012
              P    E   VP    G   PA  D  + + G   P  P+ ER E+   G PG      
Sbjct: 590  GEPGKAGE-RGVPGP-PGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPG------ 641

Query: 3013 LRATDFEVLSTKFEMQDLCFLGPFEDPVGLPGPSFLDFEGTASSQGPQSRRTEEA-AGAG 3071
                 F+ L            GP   P     P      G   + GP   R E    G  
Sbjct: 642  -----FQGLP-----------GPAGPPGEAGKPGEQGVPGDLGAPGPSGARGERGFPGER 685

Query: 3072 RAQGRGRPAKGRRASYKCKVCFQRFRSLGELDLHKLAHTPAPPPTCYMCVERRFGSREL- 3130
              QG   PA  R A+           + G       A  P  P           GS+   
Sbjct: 686  GVQGPPGPAGPRGAN----------GAPGNDGAKGDAGAPGAP-----------GSQGAP 724

Query: 3131 -LRGHLQERHAQSKAGPWACGMCLKEVADVWMYNEHLREHAVRFARRGQARRSLGDLPGG 3189
             L+G   ER A    GP                             RG A     D   G
Sbjct: 725  GLQGMPGERGAAGLPGPKG--------------------------DRGDAGPKGAD---G 755

Query: 3190 LEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPGERAKPRARS 3249
              G   V  L   I  P P    G +     +G P  P G  G     +PG+R +P    
Sbjct: 756  SPGKDGVRGLTGPIGPPGPAGAPGDKGESGPSG-PAGPTGARG-----APGDRGEPG--- 806

Query: 3250 TPSNPDGAATPDSAS-----------ATALADAGSPGPPRTTPSPSP 3285
             P  P G A P  A            A A  DAG PGP      P P
Sbjct: 807  -PPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGPPGPAGPAGPPGP 852



 Score = 41.6 bits (96), Expect = 0.016
 Identities = 39/119 (32%), Positives = 46/119 (38%), Gaps = 25/119 (21%)

Query: 3189 GLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPG--------DPWGQEGEAKKDSPG 3240
            G+ G    A L      P PK  RG      A GSPG         P G  G A   +PG
Sbjct: 728  GMPGERGAAGL------PGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPA--GAPG 779

Query: 3241 ERAKPRARSTPSNPDGAATPDSASATALADAGSPGPPRTTPSPSPDPWAGGEPLLQATP 3299
            ++ +       S P G A P  A   A  D G PGPP       P P A G+P  +  P
Sbjct: 780  DKGE-------SGPSGPAGPTGARG-APGDRGEPGPPGPAGFAGP-PGADGQPGAKGEP 829



 Score = 36.2 bits (82), Expect = 0.66
 Identities = 26/105 (24%), Positives = 34/105 (32%)

Query: 3187 PGGLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPGERAKPR 3246
            P G  G       + +  E  P+  RG        G PG P          +PG   +P 
Sbjct: 336  PTGPAGPPGFPGAVGAKGEAGPQGPRGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPG 395

Query: 3247 ARSTPSNPDGAATPDSASATALADAGSPGPPRTTPSPSPDPWAGG 3291
            A+     P  A  P    A   +    PG P      S +P A G
Sbjct: 396  AKGANGAPGIAGAPGFPGARGPSGPQGPGGPPGPKGNSGEPGAPG 440



 Score = 36.2 bits (82), Expect = 0.66
 Identities = 33/110 (30%), Positives = 39/110 (35%), Gaps = 12/110 (10%)

Query: 3209 KHHRGKRSAGKAAGSPGDPWGQEGEAKKDSP-GERAKPRARSTPS--------NPDGAAT 3259
            K HRG        G PG P G++G +    P G R  P +   P          P G   
Sbjct: 1108 KGHRGFSGLQGPPGPPGSP-GEQGPSGASGPAGPRGPPGSAGAPGKDGLNGLPGPIGPPG 1166

Query: 3260 PDSASATALADAGSPGPPRTTPSPSPDPWAGGEPLLQATPVHEACKDPSR 3309
            P   +  A    G PGPP   P P   P AG +      P  E   D  R
Sbjct: 1167 PRGRTGDA-GPVGPPGPP-GPPGPPGPPSAGFDFSFLPQPPQEKAHDGGR 1214



 Score = 35.4 bits (80), Expect = 1.1
 Identities = 38/150 (25%), Positives = 54/150 (36%), Gaps = 11/150 (7%)

Query: 3177 GQARRSLGDLPGGLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKK 3236
            G A +  G  P G  G +     +     P P   +G   A   AG+PG P G +G A +
Sbjct: 899  GPAGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTP-GPQGIAGQ 957

Query: 3237 DS----PGERAKPRARSTPSNPDGAATPDSASAT-ALADAGSPGP--PRTTPSPSPDPWA 3289
                  PG+R +   R  P  P  +  P     + A  + G PGP  P     P  +   
Sbjct: 958  RGVVGLPGQRGE---RGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGR 1014

Query: 3290 GGEPLLQATPVHEACKDPSRDCHHCGKRFP 3319
             G P  + +P  +       D    G   P
Sbjct: 1015 EGAPGAEGSPGRDGSPGAKGDRGETGPAGP 1044



 Score = 35.0 bits (79), Expect = 1.5
 Identities = 39/112 (34%), Positives = 44/112 (39%), Gaps = 30/112 (26%)

Query: 3187 PGGLEGSSAVAHLLNSITEPAPKHHRG-------KRSAGKAA--GSPGDPWGQEGE---- 3233
            P G  G    A L      P  K HRG       K  AG A   G PG P G+ G     
Sbjct: 249  PQGARGLPGTAGL------PGMKGHRGFSGLDGAKGDAGPAGPKGEPGSP-GENGAPGQM 301

Query: 3234 AKKDSPGERAKPRARSTPSNPDGAATPDSASATALADAGSPGPPRTTPSPSP 3285
              +  PGER +P A      P GA   D A+      AG PGP  T P+  P
Sbjct: 302  GPRGLPGERGRPGA----PGPAGARGNDGATGA----AGPPGP--TGPAGPP 343



 Score = 34.7 bits (78), Expect = 1.9
 Identities = 28/83 (33%), Positives = 34/83 (40%), Gaps = 8/83 (9%)

Query: 3203 ITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPGERAKPRARSTPSNPDGAATPDS 3262
            I+ P P    G R      G+PG P G +G      PGE  +P A S P  P G   P  
Sbjct: 175  ISVPGPMGPSGPRGLPGPPGAPG-PQGFQG-----PPGEPGEPGA-SGPMGPRGPPGPPG 227

Query: 3263 ASATALADAGSPGPPRTTPSPSP 3285
             +     +AG PG P     P P
Sbjct: 228  KNGDD-GEAGKPGRPGERGPPGP 249



 Score = 33.1 bits (74), Expect = 5.6
 Identities = 33/118 (27%), Positives = 37/118 (31%), Gaps = 17/118 (14%)

Query: 3187 PGGLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDP-----WGQEGEAKKDS--- 3238
            P G  GS   A    S  E       G   A    GSPG P      G  G A +D    
Sbjct: 507  PAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPDGKTGPPGPAGQDGRPG 566

Query: 3239 ----PGERAKPRARSTPSNPDGAATPDSASATALADAGSPGPPRTTPSPSPDPWAGGE 3292
                PG R +      P     A  P  A      + G PGPP        D  AG +
Sbjct: 567  PPGPPGARGQAGVMGFPGPKGAAGEPGKA-----GERGVPGPPGAVGPAGKDGEAGAQ 619



 Score = 32.7 bits (73), Expect = 7.3
 Identities = 35/123 (28%), Positives = 41/123 (33%), Gaps = 17/123 (13%)

Query: 3187 PGGLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGS------PGDPWGQEGEAKKDSPG 3240
            P G +GS        +   P P+   G+R      G       PG P G  GE  K  P 
Sbjct: 930  PAGEKGSPGADGPAGAPGTPGPQGIAGQRGVVGLPGQRGERGFPGLP-GPSGEPGKQGPS 988

Query: 3241 ERAKPRARSTPSNPDGAATPDSASATALADA--------GSPGPP--RTTPSPSPDPWAG 3290
              +  R    P  P G A P   S    A          GSPG    R    P+  P A 
Sbjct: 989  GASGERGPPGPMGPPGLAGPPGESGREGAPGAEGSPGRDGSPGAKGDRGETGPAGPPGAP 1048

Query: 3291 GEP 3293
            G P
Sbjct: 1049 GAP 1051


>gi|4502955 type IV collagen alpha 5 isoform 1 precursor [Homo
            sapiens]
          Length = 1685

 Score =  103 bits (256), Expect = 4e-21
 Identities = 311/1313 (23%), Positives = 406/1313 (30%), Gaps = 268/1313 (20%)

Query: 28   GHPSQPPLEDNTPATRTTKGAREAGGQAQAMELPEAQPRQARDGELKPPSLRGQ------ 81
            G P  P L    P T  T G +   G      LP  +  +   G   PP L G       
Sbjct: 337  GPPGPPGLVIPRPGTGITIGEK---GNIGLPGLPGEKGERGFPGIQGPPGLPGPPGAAVM 393

Query: 82   ---APSSTPGKRGSP--QTPPGRSPLQAPSRLAGRAEGSPPQRYILGIASSRTKPTLDE- 135
                P   PG+RG    + PPG S +  P  L G+  G+P      G A     P+ DE 
Sbjct: 394  GPPGPPGFPGERGQKGDEGPPGIS-IPGPPGLDGQP-GAPGLPGPPGPAGPHIPPS-DEI 450

Query: 136  ----------TPENPQLEAAQLPEVDTPQ------GPG-TGAPLRPGLPRTEAQPAAEEL 178
                      +P +  L+  Q  + D         G G +G P +PGLP     P +  L
Sbjct: 451  CEPGPPGPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGISGPPGQPGLPGLPGPPGS--L 508

Query: 179  GFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPA 238
            GF     E   +  +     P     P APG P S+G    +PG    +     D     
Sbjct: 509  GFPGQKGEKGQAGATGPKGLPGIPGAPGAPGFPGSKG----EPGDILTFPGMKGDK---- 560

Query: 239  AENSFPGANFGVP--PAEP--EPIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPADVAG 294
             E   PGA  G+P  P  P  + +P    P G P G++F+       G    P    + G
Sbjct: 561  GELGSPGAP-GLPGLPGTPGQDGLPGLPGPKGEPGGITFK-------GERGPPGNPGLPG 612

Query: 295  HAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPGGLNRHSDLSGA 354
                 GP+      P G  P   VG      +   P    +P  +G PG         G 
Sbjct: 613  LPGNIGPM-----GPPGFGPPGPVGEKGIQGVAGNPGQPGIPGPKGDPGQTITQPGKPGL 667

Query: 355  LSSPGAAHSAPRPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRAS 414
              +PG       P    L        P +P     G+  ++G P  +P    PG      
Sbjct: 668  PGNPGRDGDVGLPGDPGL--------PGQP--GLPGIPGSKGEPG-IPGIGLPGPP-GPK 715

Query: 415  GVDTSPGPPDTELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPS-PGQR 473
            G    PGPP     APG P  R+     P    +P P G P  A       G P  PG +
Sbjct: 716  GFPGIPGPP----GAPGTP-GRIGLEGPPGPPGFPGPKGEPGFALPGP--PGPPGLPGFK 768

Query: 474  LCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAG--GPEWQGGSQGALGTAG----KT 527
              L       +P       P P G   L  LP P G  GP  Q G  G  G  G      
Sbjct: 769  GALGPKGDRGFP-----GPPGPPGRTGLDGLPGPKGDVGPNGQPGPMGPPGLPGIGVQGP 823

Query: 528  PGPREKLPAVRSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVG-- 585
            PGP                     G+  P  QP   G+   +  P G P L  P   G  
Sbjct: 824  PGPP--------------------GIPGPIGQPGLHGIPGEKGDP-GPPGLDVPGPPGER 862

Query: 586  ASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETG 645
             SP     P P           + P  S      +  S  PG  G      PP  P   G
Sbjct: 863  GSPGIPGAPGP-----------IGPPGSPGLPGKAGASGFPGTKGEMGMMGPPGPPGPLG 911

Query: 646  SPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGF 705
             P  S  P        Q +P    P P    G++G    L   P P +   +G  G +G 
Sbjct: 912  IPGRSGVPGLKGDDGLQGQPG--LPGPTGEKGSKGE-PGLPGPPGPMDPNLLGSKGEKGE 968

Query: 706  PRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQ 765
            P  P                                 +      + + GL     + G  
Sbjct: 969  PGLP--------------------------------GIPGVSGPKGYQGLPGDPGQPGLS 996

Query: 766  RSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGD---AQAEGKDDPLRTGFLPSLAA 822
              PG PG P P   P +P     GL+         GD      +G + P     +P    
Sbjct: 997  GQPGLPGPPGPKGNPGLP--GQPGLIGPPGLKGTIGDMGFPGPQGVEGPPGPSGVPGQPG 1054

Query: 823  TPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSG 882
            +P  LP    D + D  + S+    L G + +   P    +           G +G S G
Sbjct: 1055 SP-GLPGQKGD-KGDPGISSIGLPGLPGPKGEPGLPGYPGN----------PGIKG-SVG 1101

Query: 883  HPLKSKAGVTPESKAPPPLPA--ATPDPQTPR-----PGDRGCPARGRPKTRSLGLAPTE 935
             P       TP +K  P LP    TP P  P+     PG+ G P  G P     G  P +
Sbjct: 1102 DPGLPGLPGTPGAKGQPGLPGFPGTPGPPGPKGISGPPGNPGLP--GEPGPVGGGGHPGQ 1159

Query: 936  ADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPPRPR 995
               P  G + + G+                G G+ G     GL  ++ DG     P  P 
Sbjct: 1160 PGPP--GEKGKPGQDGIPGPAGQKGEPGQPGFGNPGPPGLPGLSGQKGDGGLPGIPGNPG 1217

Query: 996  RPRTQA-------------PGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKAR 1042
             P  +              PG    P P +      P       R  LP  + P      
Sbjct: 1218 LPGPKGEPGFHGFPGVQGPPGPPGSPGPALEGPKGNPGPQGPPGRPGLPGPEGPPGLPGN 1277

Query: 1043 GGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRGPGFRGRRGRGEKRKEVELTQGP 1102
            GG  G                       E+     P  PG  G +G           QGP
Sbjct: 1278 GGIKG-----------------------EKGNPGQPGLPGLPGLKG----------DQGP 1304

Query: 1103 REDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGAAAREGGPK 1162
               +    R       G  G P  P  PG    GP   P + GP           EG P 
Sbjct: 1305 PGLQGNPGRPGLNGMKGDPGLPGVPGFPG--MKGPSGVPGSAGP-----------EGEPG 1351

Query: 1163 CADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEALRSPPA 1222
                  + P  P  +P  +  S   +     P    +P       P   +       PP 
Sbjct: 1352 L-----IGPPGPPGLPGPSGQSIIIKGDAGPPGIPGQPGLKGLPGPQGPQGLPGPTGPPG 1406

Query: 1223 ----------ACAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSS 1265
                        AG     PGL  P Q P +R   G P P G      P G+S
Sbjct: 1407 DPGRNGLPGFDGAGGRKGDPGL--PGQ-PGTRGLDGPPGPDGLQGPPGPPGTS 1456



 Score = 85.5 bits (210), Expect = 9e-16
 Identities = 193/783 (24%), Positives = 245/783 (31%), Gaps = 176/783 (22%)

Query: 16   GDLQPRQVASSPGHPSQP--PLEDNTPATRTT----KGAREAGGQAQAMELPEAQPRQAR 69
            G   P+ +   PG P  P  P     P    T    KG +   G   A  LP       +
Sbjct: 521  GATGPKGLPGIPGAPGAPGFPGSKGEPGDILTFPGMKGDKGELGSPGAPGLPGLPGTPGQ 580

Query: 70   DGELKPPSLRGQAPSST-PGKRGSPQTP--PGRSPLQAPSRLAGRAEGSPP-QRYILGIA 125
            DG    P  +G+    T  G+RG P  P  PG      P    G     P  ++ I G+A
Sbjct: 581  DGLPGLPGPKGEPGGITFKGERGPPGNPGLPGLPGNIGPMGPPGFGPPGPVGEKGIQGVA 640

Query: 126  SSRTKPTLDETPENPQLEAAQLPEVDTPQGPGT-------------GAPLRPGLPRTEAQ 172
             +  +P +     +P     Q  +   P  PG              G P  PG+P ++ +
Sbjct: 641  GNPGQPGIPGPKGDPGQTITQPGKPGLPGNPGRDGDVGLPGDPGLPGQPGLPGIPGSKGE 700

Query: 173  PAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPA-------PGPPQSRGTSPLQPGSYP 225
            P    +G       PP          P   P  P        PGPP   G     P   P
Sbjct: 701  PGIPGIGL----PGPPGPKGFPGIPGPPGAPGTPGRIGLEGPPGPPGFPG-----PKGEP 751

Query: 226  EYQASGADSWP----------PAAENSFPGANFGVPPAEPE-------PIPKGS-RPGGS 267
             +   G    P          P  +  FPG     PP  P        P PKG   P G 
Sbjct: 752  GFALPGPPGPPGLPGFKGALGPKGDRGFPG-----PPGPPGRTGLDGLPGPKGDVGPNGQ 806

Query: 268  PR--------GVSFQFPF--PALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEA 317
            P         G+  Q P   P + G   +P    + G     GP       P G      
Sbjct: 807  PGPMGPPGLPGIGVQGPPGPPGIPGPIGQPGLHGIPGEKGDPGPPGLDVPGPPGERGSPG 866

Query: 318  VGTGPAYPLPTQPAPSP-LPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSL 376
            +   P  P P  P  SP LP   G  G      ++ G +  PG     P P        +
Sbjct: 867  I---PGAPGPIGPPGSPGLPGKAGASGFPGTKGEM-GMMGPPGP----PGPLGIPGRSGV 918

Query: 377  TKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAA------- 429
              +  +     Q GL    G   S  +   PG           PGP D  L         
Sbjct: 919  PGLKGDDGLQGQPGLPGPTGEKGSKGEPGLPGP----------PGPMDPNLLGSKGEKGE 968

Query: 430  PGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLP 489
            PG P   +P +  P    Y   PG P          GQP       L     LP P    
Sbjct: 969  PGLPG--IPGVSGPKG--YQGLPGDP----------GQPG------LSGQPGLPGP---- 1004

Query: 490  TARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPR----EKLPAVRSSQGGSP 545
               P P G   L   P   G P    G +G +G  G  PGP+       P+    Q GSP
Sbjct: 1005 ---PGPKGNPGLPGQPGLIGPP----GLKGTIGDMG-FPGPQGVEGPPGPSGVPGQPGSP 1056

Query: 546  ALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNTAGSTC 605
             L    G  D G          P +S  G P LP P+       E  LP    N      
Sbjct: 1057 GLPGQKG--DKG---------DPGISSIGLPGLPGPK------GEPGLPGYPGNPGIKGS 1099

Query: 606  SSLSPMSSSPANPSSEESQ-------LPGPLGPSAFFHPPTHPQETGSPFP---SPEPPH 655
                 +   P  P ++           PGP GP     PP +P   G P P      P  
Sbjct: 1100 VGDPGLPGLPGTPGAKGQPGLPGFPGTPGPPGPKGISGPPGNPGLPGEPGPVGGGGHPGQ 1159

Query: 656  SLPTHYQPEPAK-AFPFPADGLGAEGAFQCLEETPFPHEGP--------EVGRGGLQGFP 706
              P   + +P +   P PA   G  G      +  F + GP        + G GGL G P
Sbjct: 1160 PGPPGEKGKPGQDGIPGPAGQKGEPG------QPGFGNPGPPGLPGLSGQKGDGGLPGIP 1213

Query: 707  RAP 709
              P
Sbjct: 1214 GNP 1216



 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 175/691 (25%), Positives = 225/691 (32%), Gaps = 128/691 (18%)

Query: 1    MPGERPRGAPP----PTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQ 56
            +PGE+    PP    P   G+     +  +PG P  PP     P      G     G+  
Sbjct: 841  IPGEKGDPGPPGLDVPGPPGERGSPGIPGAPG-PIGPPGSPGLPGKAGASGFPGTKGEMG 899

Query: 57   AMELPEAQPRQARDGELKPPSLRGQ----------APSSTPGKRGSPQTPPGRSPLQAPS 106
             M  P         G    P L+G            P+   G +G P  P    P+  P+
Sbjct: 900  MMGPPGPPGPLGIPGRSGVPGLKGDDGLQGQPGLPGPTGEKGSKGEPGLPGPPGPMD-PN 958

Query: 107  RLAGRAE-GSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPG 165
             L  + E G P    I G++  +    L   P  P L     P +  P GP  G P  PG
Sbjct: 959  LLGSKGEKGEPGLPGIPGVSGPKGYQGLPGDPGQPGLSGQ--PGLPGPPGP-KGNPGLPG 1015

Query: 166  LPRTEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSY- 224
             P     P  +             +     +  P     PP P     +  SP  PG   
Sbjct: 1016 QPGLIGPPGLK------------GTIGDMGFPGPQGVEGPPGPSGVPGQPGSPGLPGQKG 1063

Query: 225  ----PEYQASGADSWP-PAAENSFPG--ANFGVPPAEPEPIPKGSRPG--GSPRGVSFQF 275
                P   + G    P P  E   PG   N G+  +  +P      PG  G+P G   Q 
Sbjct: 1064 DKGDPGISSIGLPGLPGPKGEPGLPGYPGNPGIKGSVGDP----GLPGLPGTP-GAKGQP 1118

Query: 276  PFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPL 335
              P   G    P P  ++G     G        P    P   VG G     P QP P   
Sbjct: 1119 GLPGFPGTPGPPGPKGISGPPGNPG-------LPGEPGP---VGGGGH---PGQPGP--- 1162

Query: 336  PCYQGQPG--GLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERPPSAQDGLGS 393
            P  +G+PG  G+   +   G    PG  +  P        +     LP  P     GL  
Sbjct: 1163 PGEKGKPGQDGIPGPAGQKGEPGQPGFGNPGPPGLPGLSGQKGDGGLPGIP--GNPGLPG 1220

Query: 394  TRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGPPPARLPQLWDPTAAPYPT-PP 452
             +G P       FPG            GPP       GPP +  P L  P   P P  PP
Sbjct: 1221 PKGEPGF---HGFPGVQ----------GPP-------GPPGSPGPALEGPKGNPGPQGPP 1260

Query: 453  G--------GPLAATRSMFFNGQP-SPGQRLCLPQSAPLPWPQVLP-----TARPSPHGM 498
            G        GP     +    G+  +PGQ   LP    L   Q  P       RP  +GM
Sbjct: 1261 GRPGLPGPEGPPGLPGNGGIKGEKGNPGQP-GLPGLPGLKGDQGPPGLQGNPGRPGLNGM 1319

Query: 499  EMLSRLPFPAGGPEWQG--GSQGALGTAGK-----TPGPREKLPAVRSSQGGSPALFTYN 551
            +    LP   G P  +G  G  G+ G  G+      PGP    P +    G S  +    
Sbjct: 1320 KGDPGLPGVPGFPGMKGPSGVPGSAGPEGEPGLIGPPGP----PGLPGPSGQSIIIKGDA 1375

Query: 552  GMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPM 611
            G      QP   G+  PQ    G   LP P      P  + L  P  + AG         
Sbjct: 1376 GPPGIPGQPGLKGLPGPQ----GPQGLPGPTGPPGDPGRNGL--PGFDGAGG-------R 1422

Query: 612  SSSPANPSSEESQ-LPGPLGPSAFFHPPTHP 641
               P  P    ++ L GP GP     PP  P
Sbjct: 1423 KGDPGLPGQPGTRGLDGPPGPDGLQGPPGPP 1453



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 371/1591 (23%), Positives = 469/1591 (29%), Gaps = 326/1591 (20%)

Query: 2    PGERPR----GAP-PPTMTGDLQPRQVASSPGHPSQP--PLEDNTPATRTTKGAREAGGQ 54
            PG R +    G P PP   G   P  +   PG P  P  P  D  P  +   G     G+
Sbjct: 71   PGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQGIPGCNGTKGE 130

Query: 55   AQAMELPEAQPRQARDGELKPPSLRGQAPS----STPGKRGSP--QTPPGRSPLQAPSRL 108
                  P     Q   G    P ++G+  S    S PG +G+P    PPG   L  P+ +
Sbjct: 131  RGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGNPGYPGPPGIQGLPGPTGI 190

Query: 109  AGRAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPR 168
             G      P     G+      P L     N  L   Q P+ +  +    G P  PG   
Sbjct: 191  PGPIGPPGPP----GLMGPPGPPGLPGPKGNMGLNF-QGPKGEKGEQGLQGPPGPPGQIS 245

Query: 169  TEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQ 228
             + +P   E  F +  Q  P               R P PGPP  RG     PG      
Sbjct: 246  EQKRPIDVE--FQKGDQGLPGD-------------RGP-PGPPGIRGP----PG------ 279

Query: 229  ASGADSWPPAAENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPF 288
                   PP  E    G   G P    +P   G    G P G+      P   G   +  
Sbjct: 280  -------PPGGEKGEKGEQ-GEPGKRGKPGKDGEN--GQP-GIPGLPGDPGYPGEPGRDG 328

Query: 289  PADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPGGLNRH 348
                 G     GP      +P         G      LP +      P  QG PG     
Sbjct: 329  EKGQKGDTGPPGPPGLVIPRPGTGITIGEKGNIGLPGLPGEKGERGFPGIQGPPG----- 383

Query: 349  SDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERPPS--AQDGLGSTRGPPSSLPQRHF 406
              L G    PGAA   P                  PP    + G     GPP        
Sbjct: 384  --LPGP---PGAAVMGP----------------PGPPGFPGERGQKGDEGPPGI----SI 418

Query: 407  PGQAYRASGVDTSPGPPDTELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNG 466
            PG      G+D  PG P      PGPP    P +        P PPG P +         
Sbjct: 419  PGPP----GLDGQPGAP----GLPGPPGPAGPHIPPSDEICEPGPPGPPGSPGDKGLQGE 470

Query: 467  QPSPGQR--LCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTA 524
            Q   G +   C            + T    P G   L  LP P G   + G  +G  G A
Sbjct: 471  QGVKGDKGDTCF---------NCIGTGISGPPGQPGLPGLPGPPGSLGFPG-QKGEKGQA 520

Query: 525  GKTPGPREKLPAVRSSQGGSPALFTYNGMTDPGAQPLFFGVA--QPQVSPHGTPSLPPPR 582
            G T GP+  LP +  + G +P      G  +PG    F G+   + ++   G P LP   
Sbjct: 521  GAT-GPKG-LPGIPGAPG-APGFPGSKG--EPGDILTFPGMKGDKGELGSPGAPGLPGLP 575

Query: 583  VVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPG---PLGPSAFFHPPT 639
                      LP P     G T         +P  P      LPG   P+GP  F  P  
Sbjct: 576  GTPGQDGLPGLPGPKGEPGGITFKGERGPPGNPGLPG-----LPGNIGPMGPPGFGPPGP 630

Query: 640  -----------HPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEET 688
                       +P + G P P  +P  ++    +P      P     +G  G      + 
Sbjct: 631  VGEKGIQGVAGNPGQPGIPGPKGDPGQTITQPGKPG-LPGNPGRDGDVGLPGDPGLPGQP 689

Query: 689  PFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLA 748
              P      G  G+ G     PP P     +                             
Sbjct: 690  GLPGIPGSKGEPGIPGIGLPGPPGPKGFPGIPGPP------------------------- 724

Query: 749  HRQFCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGK 808
                 G      + G +  PGPPG P P   P                F L G     G 
Sbjct: 725  -----GAPGTPGRIGLEGPPGPPGFPGPKGEPG---------------FALPGPPGPPGL 764

Query: 809  DDPLRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVF 868
              P   G L       FP P           LD L              P+         
Sbjct: 765  --PGFKGALGPKGDRGFPGPPGP---PGRTGLDGL------------PGPK--------- 798

Query: 869  ADEEPSGPRGPSSGHPLKSKAGVTPESKAPPPLPAATPDPQTPRPGDRGCPA-RGRPKTR 927
             D  P+G  GP  G P     GV       PP P   P P   +PG  G P  +G P   
Sbjct: 799  GDVGPNGQPGPM-GPPGLPGIGVQG-----PPGPPGIPGP-IGQPGLHGIPGEKGDPGPP 851

Query: 928  SLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLG 987
             L +     +  S G     G             G     G  G   ASG  P     +G
Sbjct: 852  GLDVPGPPGERGSPGIPGAPGPI-----------GPPGSPGLPGKAGASGF-PGTKGEMG 899

Query: 988  ERPPPRPRRP-----RTQAPGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKAR 1042
               PP P  P     R+  PG + D    +     LP  T     +  P    P      
Sbjct: 900  MMGPPGPPGPLGIPGRSGVPGLKGDDG--LQGQPGLPGPTGEKGSKGEPGLPGPP----- 952

Query: 1043 GGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRGPGFRGRRGRGEKRKEVELTQGP 1102
             G     L+                S+ E+ E   P  PG  G +G           QG 
Sbjct: 953  -GPMDPNLL---------------GSKGEKGEPGLPGIPGVSGPKGY----------QGL 986

Query: 1103 REDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLE-TGAAAREGGP 1161
              D  Q          G  G   NP  PG  +PG    P  +G    +   G    EG P
Sbjct: 987  PGDPGQPGLSGQPGLPGPPGPKGNPGLPG--QPGLIGPPGLKGTIGDMGFPGPQGVEGPP 1044

Query: 1162 KCADRPSVAPKDPLQVPTNTETSEETRPSLD------FPQEAKEPETAEESAPDSTEFTE 1215
                 PS  P  P       +  ++  P +        P    EP       P +     
Sbjct: 1045 G----PSGVPGQPGSPGLPGQKGDKGDPGISSIGLPGLPGPKGEPGLP--GYPGNPGIKG 1098

Query: 1216 ALRSPPA-ACAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSLL 1274
            ++  P      G  GA     +P  P       GTP P G    + P G+   PG    +
Sbjct: 1099 SVGDPGLPGLPGTPGAKGQPGLPGFP-------GTPGPPGPKGISGPPGNPGLPGEPGPV 1151

Query: 1275 GGPG--GTQAPVSHNSK------DPPARQPGEFLAP-VANPSSTACPKPSVLSSK--ISS 1323
            GG G  G   P     K        PA Q GE   P   NP     P  S       +  
Sbjct: 1152 GGGGHPGQPGPPGEKGKPGQDGIPGPAGQKGEPGQPGFGNPGPPGLPGLSGQKGDGGLPG 1211

Query: 1324 FGCDPA--GFNRDP--LGVPVAKKGPQPYSSPHSELFLGPKDLAGCFLEELHPKPSARDA 1379
               +P   G   +P   G P  +  P P  SP   L  GPK   G       P     + 
Sbjct: 1212 IPGNPGLPGPKGEPGFHGFPGVQGPPGPPGSPGPAL-EGPKGNPGPQGPPGRPGLPGPEG 1270

Query: 1380 PPASSSCLCQDGEDAGSLEPQLP--------RSPPGTAETEPGRAASPPTLESSSLFPDL 1431
            PP         GE     +P LP        + PPG  +  PGR    P L      P L
Sbjct: 1271 PPGLPGNGGIKGEKGNPGQPGLPGLPGLKGDQGPPG-LQGNPGR----PGLNGMKGDPGL 1325

Query: 1432 PVDRFDPPLYGSLSANRDSGLPFAC---ADPPQKTVPSDP--PYPSFLLLEEVSPMLPSH 1486
            P     P + G       SG+P +     +P     P  P  P PS   +       P  
Sbjct: 1326 PGVPGFPGMKG------PSGVPGSAGPEGEPGLIGPPGPPGLPGPSGQSIIIKGDAGPPG 1379

Query: 1487 FPDLSGGKVLSKTCPPERTVVPGAAPSLPGK 1517
             P   G K L     P+    P   P  PG+
Sbjct: 1380 IPGQPGLKGLPGPQGPQGLPGPTGPPGDPGR 1410



 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 316/1310 (24%), Positives = 398/1310 (30%), Gaps = 204/1310 (15%)

Query: 309  PQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPG--GLNRHSDLSGALSSPGA-AHSAP 365
            P+G   ++ +  GP  P   +  P  LP + G PG  G+  H    G    PG       
Sbjct: 73   PRGQKGDDGI-PGPPGPKGIRGPPG-LPGFPGTPGLPGMPGHDGAPGPQGIPGCNGTKGE 130

Query: 366  RPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDT 425
            R F  S         P  P     GL    GPP     +  PG    +S     PGP   
Sbjct: 131  RGFPGS---------PGFP-----GLQGPPGPPGIPGMKGEPGSIIMSS----LPGPKGN 172

Query: 426  ELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLP-------- 477
                PGPP   +  L  PT  P P  P GP          G P P   + L         
Sbjct: 173  P-GYPGPPG--IQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEK 229

Query: 478  -----QSAPLPWPQVLPTARP----------------SPHGMEMLSRLPFPAGGPEWQGG 516
                 Q  P P  Q+    RP                 P G   +   P P GG + + G
Sbjct: 230  GEQGLQGPPGPPGQISEQKRPIDVEFQKGDQGLPGDRGPPGPPGIRGPPGPPGGEKGEKG 289

Query: 517  SQGALGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTDPG--AQPLFFGVAQPQVSPHG 574
             QG  G  GK PG        +  + G P +    G  DPG   +P   G  + Q    G
Sbjct: 290  EQGEPGKRGK-PG--------KDGENGQPGIPGLPG--DPGYPGEPGRDG-EKGQKGDTG 337

Query: 575  TPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAF 634
             P   PP +V        +P P T   G T      +          E   PG  GP   
Sbjct: 338  PPG--PPGLV--------IPRPGT---GITIGEKGNIGLPGLPGEKGERGFPGIQGPPGL 384

Query: 635  FHPPTHPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEG 694
              PP      G P P   P        +  P  + P P  GL  +     L   P P  G
Sbjct: 385  PGPP-GAAVMGPPGPPGFPGERGQKGDEGPPGISIPGP-PGLDGQPGAPGLPGPPGP-AG 441

Query: 695  PEVGRGGLQGFPRAP-PPYPTHHFSLSSASLDQLDVLLTCRQC-------DRNYSSLAAF 746
            P +        P  P PP       L      + D   TC  C             L   
Sbjct: 442  PHIPPSDEICEPGPPGPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGISGPPGQPGLPGL 501

Query: 747  LAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPA-DAHAGLLSHAKTFL-LAGDAQ 804
                   G    + + G   + GP GLP  P AP  P      G      TF  + GD  
Sbjct: 502  PGPPGSLGFPGQKGEKGQAGATGPKGLPGIPGAPGAPGFPGSKGEPGDILTFPGMKGDKG 561

Query: 805  AEGKDDPLRTGFLPSLAATPFP--LPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDS 862
              G   P   G LP L  TP    LP       +   +         G      NP +  
Sbjct: 562  ELG--SPGAPG-LPGLPGTPGQDGLPGLPGPKGEPGGI------TFKGERGPPGNPGLPG 612

Query: 863  SFIDVFADEEPS-GPRGPSSGHPLKSKAGVTPESKAPPPLPAATPDP-----QTPRPGDR 916
               ++     P  GP GP     ++  AG    +   P +P    DP     Q  +PG  
Sbjct: 613  LPGNIGPMGPPGFGPPGPVGEKGIQGVAG----NPGQPGIPGPKGDPGQTITQPGKPGLP 668

Query: 917  GCPAR----GRPKTRSLGLAPTEADAP-SQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGG 971
            G P R    G P    L   P     P S+G     G  L          G     G+ G
Sbjct: 669  GNPGRDGDVGLPGDPGLPGQPGLPGIPGSKGEPGIPGIGLPGPPGPKGFPGIPGPPGAPG 728

Query: 972  GGRASGLRPRRNDGLGERPPPRPRRPRTQA-PGSRADPAPRVPRAAALPEETRSSRRRRL 1030
                 GL         E PP  P  P  +  PG      P  P              R  
Sbjct: 729  TPGRIGL---------EGPPGPPGFPGPKGEPGFALPGPPGPPGLPGFKGALGPKGDRGF 779

Query: 1031 PPRKDPRKRKARGGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRGPGFRGRRGRG 1090
            P    P  R    G  G +  +    Q   +          +    PP  PG  G+ G  
Sbjct: 780  PGPPGPPGRTGLDGLPGPKGDVGPNGQPGPMGPPGLPGIGVQGPPGPPGIPGPIGQPGLH 839

Query: 1091 EKRKEVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSL 1150
                E      P  D P  P    R   G  GAP  P  P GS   PG++  +  P    
Sbjct: 840  GIPGEKGDPGPPGLDVPGPP--GERGSPGIPGAP-GPIGPPGSPGLPGKAGASGFPGTKG 896

Query: 1151 ETGAAAREGG------PKCADRPSVAPKDPLQ----VPTNT-ETSEETRPSLDFPQEAKE 1199
            E G     G       P  +  P +   D LQ    +P  T E   +  P L  P    +
Sbjct: 897  EMGMMGPPGPPGPLGIPGRSGVPGLKGDDGLQGQPGLPGPTGEKGSKGEPGLPGPPGPMD 956

Query: 1200 P-------ETAEESAP-----DSTEFTEALRSPPAACAGEMGAS--PGLLIPEQP----- 1240
            P       E  E   P        +  + L   P    G+ G S  PGL  P  P     
Sbjct: 957  PNLLGSKGEKGEPGLPGIPGVSGPKGYQGLPGDP----GQPGLSGQPGLPGPPGPKGNPG 1012

Query: 1241 -PPSRHDTGTPKPSGSLAN---TAPHGSSPTPGVGSLLGGPGGTQAPVSHNSKDPPARQ- 1295
             P      G P   G++ +     P G    PG   + G PG    P     K  P    
Sbjct: 1013 LPGQPGLIGPPGLKGTIGDMGFPGPQGVEGPPGPSGVPGQPGSPGLPGQKGDKGDPGISS 1072

Query: 1296 ---PGEFLAPVANPSSTACPKPSVLSSKISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPH 1352
               PG    P   P     P    +   +     DP G    P G P AK  P     P 
Sbjct: 1073 IGLPG-LPGPKGEPGLPGYPGNPGIKGSVG----DP-GLPGLP-GTPGAKGQPGLPGFPG 1125

Query: 1353 SELFLGPKDLAGCFLEELHPKPSARDAPPASSSCLCQDGEDAGSLEPQLPRSPPGTAETE 1412
            +    GPK ++G               PP +     + G   G   P  P  PPG  + +
Sbjct: 1126 TPGPPGPKGISG---------------PPGNPGLPGEPGPVGGGGHPGQP-GPPG-EKGK 1168

Query: 1413 PGRAASPPTLESSSLFPDLPVDRFDPPLYGSLSANR-DSGLPFACADPPQKTVPSDPPYP 1471
            PG+   P                  PP    LS  + D GLP    +P       +P + 
Sbjct: 1169 PGQDGIPGPAGQKGEPGQPGFGNPGPPGLPGLSGQKGDGGLPGIPGNPGLPGPKGEPGFH 1228

Query: 1472 SFLLLEEVSPMLPSHFPDLSGGK-VLSKTCPPERTVVPG--AAPSLPGKG 1518
             F  ++       S  P L G K       PP R  +PG    P LPG G
Sbjct: 1229 GFPGVQGPPGPPGSPGPALEGPKGNPGPQGPPGRPGLPGPEGPPGLPGNG 1278



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 134/539 (24%), Positives = 157/539 (29%), Gaps = 130/539 (24%)

Query: 12   PTMTGDLQPRQVASSPGHPSQPPL--EDNTPATRTTKGAREAGGQAQAMELPEAQPRQAR 69
            P + G   P+     PG P QP L  +   P     KG     GQ   +  P  +     
Sbjct: 972  PGIPGVSGPKGYQGLPGDPGQPGLSGQPGLPGPPGPKGNPGLPGQPGLIGPPGLKGTIGD 1031

Query: 70   DGELKPPSLRGQ-APSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRYILGIASSR 128
             G   P  + G   PS  PG+ GSP  P  +     P      + G P      G+   +
Sbjct: 1032 MGFPGPQGVEGPPGPSGVPGQPGSPGLPGQKGDKGDPGI---SSIGLP------GLPGPK 1082

Query: 129  TKPTLDETPENPQLEAAQLPEVDTPQGPGT-GAPLRPGLPRTEAQPAAEELGFHRCFQEP 187
             +P L   P NP ++ + + +   P  PGT GA  +PGLP     P             P
Sbjct: 1083 GEPGLPGYPGNPGIKGS-VGDPGLPGLPGTPGAKGQPGLPGFPGTPG------------P 1129

Query: 188  PSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWP-PAAENSFPGA 246
            P        + P   P  P    P   G  P QPG   E    G D  P PA +   PG 
Sbjct: 1130 PGP---KGISGPPGNPGLPGEPGPVGGGGHPGQPGPPGEKGKPGQDGIPGPAGQKGEPGQ 1186

Query: 247  -NFGVP--------------------PAEPE-PIPKGSR----------PGGSPRGVSFQ 274
              FG P                    P  P  P PKG            P G P      
Sbjct: 1187 PGFGNPGPPGLPGLSGQKGDGGLPGIPGNPGLPGPKGEPGFHGFPGVQGPPGPPGS---- 1242

Query: 275  FPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTG-PAYP-LPTQPAP 332
             P PAL G    P P    G     GP         G    E    G P  P LP     
Sbjct: 1243 -PGPALEGPKGNPGPQGPPGRPGLPGPEGPPGLPGNGGIKGEKGNPGQPGLPGLPGLKGD 1301

Query: 333  SPLPCYQGQPG-----GLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERPPS- 386
               P  QG PG     G+     L G    PG    +  P S         I P  PP  
Sbjct: 1302 QGPPGLQGNPGRPGLNGMKGDPGLPGVPGFPGMKGPSGVPGSAGPEGEPGLIGPPGPPGL 1361

Query: 387  --------------------AQDGLGSTRGP--PSSLP---------------------- 402
                                 Q GL    GP  P  LP                      
Sbjct: 1362 PGPSGQSIIIKGDAGPPGIPGQPGLKGLPGPQGPQGLPGPTGPPGDPGRNGLPGFDGAGG 1421

Query: 403  ---QRHFPGQAYRAS--------GVDTSPGPPDTELAAPGPPPARLPQLWDPTAAPYPT 450
                   PGQ             G+   PGPP T   A G    R  Q  D    P  T
Sbjct: 1422 RKGDPGLPGQPGTRGLDGPPGPDGLQGPPGPPGTSSVAHGFLITRHSQTTDAPQCPQGT 1480



 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 263/1154 (22%), Positives = 343/1154 (29%), Gaps = 270/1154 (23%)

Query: 1751 EPGTADQPHR----GAPA-PEAFGSPAVHLAP----DLAFQGDGAPPLDATWPFGASPSH 1801
            EPG   +P +    G P  P   G P     P    +   +GD  PP     P G     
Sbjct: 293  EPGKRGKPGKDGENGQPGIPGLPGDPGYPGEPGRDGEKGQKGDTGPP----GPPGLVIPR 348

Query: 1802 AAQGHSAGRAGGHLHPTAGRPGFEGNEFAPA--GASSLTAPRGREAWLVPVPSPACVSNT 1859
               G + G  G    P  G PG +G    P   G   L  P G      P P        
Sbjct: 349  PGTGITIGEKGNIGLP--GLPGEKGERGFPGIQGPPGLPGPPGAAVMGPPGPPG------ 400

Query: 1860 HPSRRSQDPALSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNPS--------- 1910
             P  R Q     PP   + +PGP     + G  GL    P   + P + PS         
Sbjct: 401  FPGERGQKGDEGPP--GISIPGPPGLDGQPGAPGLPG--PPGPAGPHIPPSDEICEPGPP 456

Query: 1911 ---------GLEGGT-VEGGK---------VACGPAQGSPGGVQVTTLPAVAGHQLGLEA 1951
                     GL+G   V+G K                G PG      LP + G    L  
Sbjct: 457  GPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGISGPPGQPG------LPGLPGPPGSLGF 510

Query: 1952 DGHWGLLGQAEKTQGQGTANQLQPENGVSPGGTDNHASVNASPKTALTGPTEGAVLLEKC 2011
             G  G  GQA  T  +G      P    +PG      S    P   LT P          
Sbjct: 511  PGQKGEKGQAGATGPKGL-----PGIPGAPGAPGFPGS-KGEPGDILTFPG--------M 556

Query: 2012 KGSRAAMSLQEEAEPTPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLAT 2071
            KG +  +          SP +P    L                TP +   PGL  P    
Sbjct: 557  KGDKGELG---------SPGAPGLPGLP--------------GTPGQDGLPGLPGPK--- 590

Query: 2072 GDSPAPSVGDLAACAPSPTSAAHMPCSLGPL--PREDPLTSPSRAQG--GLGGQLPASPS 2127
               P           P       +P ++GP+  P   P   P   +G  G+ G  P  P 
Sbjct: 591  -GEPGGITFKGERGPPGNPGLPGLPGNIGPMGPPGFGP-PGPVGEKGIQGVAGN-PGQPG 647

Query: 2128 CRDPPGPQQLLACSPAWAPLEEADGVQATTDTGAEDSPVAP--PSLTTSPCDPKE-ALAG 2184
               P G        P    L    G     D G    P  P  P L   P    E  + G
Sbjct: 648  IPGPKGDPGQTITQPGKPGLPGNPGRDG--DVGLPGDPGLPGQPGLPGIPGSKGEPGIPG 705

Query: 2185 CLLQGEGSPLEDPS-SWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSP 2243
              L G   P   P    PPG+            P       P+      L   PG    P
Sbjct: 706  IGLPGPPGPKGFPGIPGPPGAPGTPGRIGLEGPPGPPGFPGPKGEPGFALPGPPGPPGLP 765

Query: 2244 PLAGAVSPSVAVRATGLSSTPTGDEAQAGRGLPGPDPQSRGAPPHTNPDRMPRGHSSYSP 2303
               GA+ P              GD     RG PGP     G P  T  D +P       P
Sbjct: 766  GFKGALGPK-------------GD-----RGFPGPP----GPPGRTGLDGLPGPKGDVGP 803

Query: 2304 SNTARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSSK-----EPEDPGTP--- 2355
            +         GQ     P   P +   GP  P  + G +G         E  DPG P   
Sbjct: 804  N---------GQPGPMGPPGLPGIGVQGPPGPPGIPGPIGQPGLHGIPGEKGDPGPPGLD 854

Query: 2356 ---ETGRSGATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRNASHQTPQGDPLG 2412
                 G  G+  +P    P     +G   +P        S  P +        P G P G
Sbjct: 855  VPGPPGERGSPGIPGAPGP-----IGPPGSPGLPGKAGASGFPGTKGEMGMMGPPGPP-G 908

Query: 2413 PQDLKQRS-----------RGYKKKPASTENGQWKGQ----APHGPVTCEVCAASFRSG- 2456
            P  +  RS           +G    P  T     KG+     P GP+   +  +    G 
Sbjct: 909  PLGIPGRSGVPGLKGDDGLQGQPGLPGPTGEKGSKGEPGLPGPPGPMDPNLLGSKGEKGE 968

Query: 2457 ------PGLSRHKARKHRPHPGAPAEPSPAALPAQQPLEPLAQKCQPPRKKSHRVSGKER 2510
                  PG+S  K   ++  PG P +P  +  P                       G   
Sbjct: 969  PGLPGIPGVSGPKG--YQGLPGDPGQPGLSGQP-----------------------GLPG 1003

Query: 2511 PNHSRGDPSHVTQP----PPAQGSKEVLRAPGSPHSQQLHPPSPTEHEVDVKTPASKPRP 2566
            P   +G+P    QP    PP  G K  +   G P  Q +  P           P     P
Sbjct: 1004 PPGPKGNPGLPGQPGLIGPP--GLKGTIGDMGFPGPQGVEGP-----------PGPSGVP 1050

Query: 2567 DQAREDELHPKQAEKREGRRWRREPTVDS---PSHSEGKSNKKRGKLRGRRLREESILPV 2623
             Q     L  ++ +K +       P + S   P     K         G    + S+   
Sbjct: 1051 GQPGSPGLPGQKGDKGD-------PGISSIGLPGLPGPKGEPGLPGYPGNPGIKGSVGDP 1103

Query: 2624 SADVISDGRGSRPSPAMASYAASPSHCLSVEGGPEADGEQPPRLATLG-PGVMEGAAETD 2682
                +    G++  P +  +  +P        GP+     P      G PG + G     
Sbjct: 1104 GLPGLPGTPGAKGQPGLPGFPGTPG-----PPGPKGISGPPGNPGLPGEPGPVGGG---- 1154

Query: 2683 QEALCAGETGAQKPPGDRMLCPGRMDGAALGEQPTGQKGASAR-GFWGPRETKALGVCKE 2741
                  G  G   PPG++   PG+ DG      P GQKG   + GF  P      G+  +
Sbjct: 1155 ------GHPGQPGPPGEKGK-PGQ-DGIP---GPAGQKGEPGQPGFGNPGPPGLPGLSGQ 1203

Query: 2742 SGSEPAEDSSRAHSRSEEGVWEENTPPLGPLGFPETSSSPAD-STTSSCLQGLPDNPDTQ 2800
             G     D          G+      P G  GFP     P    +    L+G   NP  Q
Sbjct: 1204 KG-----DGGLPGIPGNPGLPGPKGEP-GFHGFPGVQGPPGPPGSPGPALEGPKGNPGPQ 1257

Query: 2801 G-----GVQGPEGP 2809
            G     G+ GPEGP
Sbjct: 1258 GPPGRPGLPGPEGP 1271



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 117/458 (25%), Positives = 144/458 (31%), Gaps = 74/458 (16%)

Query: 3425 VRRPGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLC 3484
            + +PG PG     L G  P +   V +PG    PG+   P  G      E  +P +    
Sbjct: 659  ITQPGKPG-----LPGN-PGRDGDVGLPGDPGLPGQPGLP--GIPGSKGEPGIPGI---- 706

Query: 3485 SEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGDCALD 3544
                P   KG+P     P  P T    G E P      P P   P   AL    G   L 
Sbjct: 707  GLPGPPGPKGFPGIPGPPGAPGTPGRIGLEGPPGPPGFPGPKGEP-GFALPGPPGPPGLP 765

Query: 3545 G---ALERPENEASPGSPGPLLQQALPLGASLPRP----GARGQDAEGKRAPLVFSGKRR 3597
            G   AL    +   PG PGP  +  L     LP P    G  GQ        L   G + 
Sbjct: 766  GFKGALGPKGDRGFPGPPGPPGRTGLD---GLPGPKGDVGPNGQPGPMGPPGLPGIGVQG 822

Query: 3598 APGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSA 3657
             PG  G   P      H +  EK       +   GP G   +GS   P            
Sbjct: 823  PPGPPGIPGPIGQPGLHGIPGEKGDPGPPGLDVPGPPG--ERGSPGIPG----------- 869

Query: 3658 ASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTKTG 3717
            A  P      P  P KA  S  PG     T+  M    P   PGP      S  PG K  
Sbjct: 870  APGPIGPPGSPGLPGKAGASGFPG-----TKGEMGMMGPPGPPGPLGIPGRSGVPGLKGD 924

Query: 3718 GGSQPQPA-------SGQLQSETATTPAKPSFPS--------RSPAPERLPARAQAKSCT 3762
             G Q QP         G         P  P  P+          P    +P  +  K   
Sbjct: 925  DGLQGQPGLPGPTGEKGSKGEPGLPGPPGPMDPNLLGSKGEKGEPGLPGIPGVSGPKGYQ 984

Query: 3763 KGPREAGEQGPHGSLG----PKEKGESSTKRKKGQVPGPARSESVGSFG-RAPSAPDKPP 3817
              P + G+ G  G  G    P  KG      + G +  P    ++G  G   P   + PP
Sbjct: 985  GLPGDPGQPGLSGQPGLPGPPGPKGNPGLPGQPGLIGPPGLKGTIGDMGFPGPQGVEGPP 1044

Query: 3818 RTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPG 3855
                    PS V      P     P  P  +  K +PG
Sbjct: 1045 -------GPSGV------PGQPGSPGLPGQKGDKGDPG 1069



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 170/687 (24%), Positives = 226/687 (32%), Gaps = 102/687 (14%)

Query: 871  EEPSGPRGPSSGHPLKSKAGVTPES-KAPPPLPAATPDPQTP-RPGDRGCPA-RGRPKTR 927
            E P GPRG      +    G  P+  + PP LP     P  P  PG  G P  +G P   
Sbjct: 68   EGPPGPRGQKGDDGIPGPPG--PKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQGIP--- 122

Query: 928  SLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLR-PRRNDGL 986
              G   T+ +    G     G Q           G     G  G    S L  P+ N G 
Sbjct: 123  --GCNGTKGERGFPGSPGFPGLQ-----GPPGPPGIPGMKGEPGSIIMSSLPGPKGNPGY 175

Query: 987  GERPPPRPRRPRTQAPGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAW 1046
               P  +     T  PG    P P        P      +       + P+  K   G  
Sbjct: 176  PGPPGIQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEKGEQGLQ 235

Query: 1047 GKELILKIVQQKNRLREYDFASESE--EDEQPPPRGPGFRGRRG--RGEKRKEVELTQGP 1102
            G       + ++ R  + +F    +    ++ PP  PG RG  G   GEK ++ E     
Sbjct: 236  GPPGPPGQISEQKRPIDVEFQKGDQGLPGDRGPPGPPGIRGPPGPPGGEKGEKGE----- 290

Query: 1103 REDEPQKPRKAARQ-EAGGDGAPANPEEPGGSRPG-PGRSPQARGPSRSLETGAAAREG- 1159
             + EP K  K  +  E G  G P  P +PG   PG PGR  +     +  +TG     G 
Sbjct: 291  -QGEPGKRGKPGKDGENGQPGIPGLPGDPG--YPGEPGRDGE---KGQKGDTGPPGPPGL 344

Query: 1160 -GPKCADRPSVAPKDPLQVP-TNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEAL 1217
              P+     ++  K  + +P    E  E   P +  P     P  A    P         
Sbjct: 345  VIPRPGTGITIGEKGNIGLPGLPGEKGERGFPGIQGPPGLPGPPGAAVMGPPG------- 397

Query: 1218 RSPPAACAGEMG-----ASPGLLIPEQP-----PPSRHDTGTPKPSG-------SLANTA 1260
               P    GE G       PG+ IP  P     P +    G P P+G        +    
Sbjct: 398  ---PPGFPGERGQKGDEGPPGISIPGPPGLDGQPGAPGLPGPPGPAGPHIPPSDEICEPG 454

Query: 1261 PHGSSPTPGVGSLLGGPG--GTQAPVSHN----SKDPPARQPGEFLAPVANPSSTACPKP 1314
            P G   +PG   L G  G  G +     N        P  QPG    P   P S   P  
Sbjct: 455  PPGPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGISGPPGQPGLPGLP-GPPGSLGFPGQ 513

Query: 1315 SVLSSKISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSEL-FLGPKDLAGCFLEELHPK 1373
                 +  + G  P G    P G P A   P     P   L F G K   G    EL   
Sbjct: 514  KGEKGQAGATG--PKGLPGIP-GAPGAPGFPGSKGEPGDILTFPGMKGDKG----EL-GS 565

Query: 1374 PSARDAPPASSSCLCQDGEDAGSLEPQLPRSPPG--TAETEPGRAASPPTLESSSLFPDL 1431
            P A   P    +     G+D     P  P+  PG  T + E G   +P         P L
Sbjct: 566  PGAPGLPGLPGT----PGQDGLPGLPG-PKGEPGGITFKGERGPPGNPG-------LPGL 613

Query: 1432 P--VDRFDPPLYGSLSANRDSGLPFACADPPQKTVPSDPPYPSFLLLEEVSPMLPSHFPD 1489
            P  +    PP +G      + G+     +P Q  +P     P   + +   P LP + P 
Sbjct: 614  PGNIGPMGPPGFGPPGPVGEKGIQGVAGNPGQPGIPGPKGDPGQTITQPGKPGLPGN-PG 672

Query: 1490 LSGGKVLSKTCPPERTVVPGAAPSLPG 1516
              G   L     P    +PG  P LPG
Sbjct: 673  RDGDVGL-----PGDPGLPG-QPGLPG 693



 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 120/515 (23%), Positives = 165/515 (32%), Gaps = 81/515 (15%)

Query: 3419 PFAFRGVRRPGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLP 3478
            P  ++G+  PG PGQ   + +  LP        PG    PG   PP  G    + +   P
Sbjct: 980  PKGYQGL--PGDPGQPGLSGQPGLPGPPGPKGNPGLPGQPGLIGPP--GLKGTIGDMGFP 1035

Query: 3479 ALLHLCSEVAPSTTKGWPETLERPV------DPVTHPIRGCELPSNHQECPPPSLSPFPA 3532
                +     PS   G P +   P       DP    I    LP    E   P L  +P 
Sbjct: 1036 GPQGVEGPPGPSGVPGQPGSPGLPGQKGDKGDPGISSIGLPGLPGPKGE---PGLPGYP- 1091

Query: 3533 ALADGRGDCALDGALERPENEASPGSPGPLLQQALPLGASLP-RPGARG-------QDAE 3584
                  G+  + G++  P     PG+PG   Q  LP     P  PG +G           
Sbjct: 1092 ------GNPGIKGSVGDPGLPGLPGTPGAKGQPGLPGFPGTPGPPGPKGISGPPGNPGLP 1145

Query: 3585 GKRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATK 3644
            G+  P+   G    PG  G        E     ++     +    E G  G  + G    
Sbjct: 1146 GEPGPVGGGGHPGQPGPPG--------EKGKPGQDGIPGPAGQKGEPGQPGFGNPG---- 1193

Query: 3645 PAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSS 3704
            P G    S  +     P      P +P        PG    G      P  P   PGP+ 
Sbjct: 1194 PPGLPGLSGQKGDGGLPG----IPGNPGLPGPKGEPG--FHGFPGVQGPPGPPGSPGPAL 1247

Query: 3705 QG-SGSP-------RPGTKTGGGSQPQPASGQLQSETATTPAKPSFP--------SRSPA 3748
            +G  G+P       RPG     G    P +G ++ E    P +P  P           P 
Sbjct: 1248 EGPKGNPGPQGPPGRPGLPGPEGPPGLPGNGGIKGEKG-NPGQPGLPGLPGLKGDQGPPG 1306

Query: 3749 PERLPARAQAKSCTKGPREAGEQGPHGSLGPK-EKGESSTKRKKGQV--------PGPA- 3798
             +  P R         P   G  G  G  GP    G +  + + G +        PGP+ 
Sbjct: 1307 LQGNPGRPGLNGMKGDPGLPGVPGFPGMKGPSGVPGSAGPEGEPGLIGPPGPPGLPGPSG 1366

Query: 3799 RSESVGSFGRAPSAPDKP--PRTPRKQATPSRVLPTKP--KPNSQNKPRPPPSEQRKAEP 3854
            +S  +      P  P +P     P  Q       PT P   P     P    +  RK +P
Sbjct: 1367 QSIIIKGDAGPPGIPGQPGLKGLPGPQGPQGLPGPTGPPGDPGRNGLPGFDGAGGRKGDP 1426

Query: 3855 GHTQRKDRLGKAFPQGRPLLR----PPKRGTAVHG 3885
            G   +    G   P G   L+    PP   +  HG
Sbjct: 1427 GLPGQPGTRGLDGPPGPDGLQGPPGPPGTSSVAHG 1461



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 113/463 (24%), Positives = 147/463 (31%), Gaps = 74/463 (15%)

Query: 3432 GQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEVAPST 3491
            G K    E   P       +PG  PGP E  P PRG      +  +P          P  
Sbjct: 42   GIKGEKGERGFPGLEGHPGLPGF-PGP-EGPPGPRGQK---GDDGIPGPPGPKGIRGPPG 96

Query: 3492 TKGWPETLERPV------DPVTHPIRGCELPSNHQECPP----PSLS--PFPAALADGRG 3539
              G+P T   P        P    I GC      +  P     P L   P P  +   +G
Sbjct: 97   LPGFPGTPGLPGMPGHDGAPGPQGIPGCNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKG 156

Query: 3540 DCALDGALERPENEASPGSPGPLLQQALPLGASLP-------------RPGARGQDAEGK 3586
            +         P  + +PG PGP   Q LP    +P              PG  G      
Sbjct: 157  EPGSIIMSSLPGPKGNPGYPGPPGIQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKG 216

Query: 3587 RAPLVFSGKRRAPGARGRCAP-----DHFQEDHLLQKEKEVSSSHMVSEGGPRG-TFHKG 3640
               L F G +   G +G   P        ++   +  E +     +  + GP G    +G
Sbjct: 217  NMGLNFQGPKGEKGEQGLQGPPGPPGQISEQKRPIDVEFQKGDQGLPGDRGPPGPPGIRG 276

Query: 3641 SATKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLA-----PGELARGTENGMKPAT 3695
                P G +    ++       K  K   + +  +  L      PGE  R  E G K  T
Sbjct: 277  PPGPPGGEKGEKGEQGEPGKRGKPGKDGENGQPGIPGLPGDPGYPGEPGRDGEKGQKGDT 336

Query: 3696 PKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPAR 3755
                PGP   G   PRPGT    G +       L  E      +  FP     P  LP  
Sbjct: 337  --GPPGP--PGLVIPRPGTGITIGEKGNIGLPGLPGE----KGERGFPG-IQGPPGLP-- 385

Query: 3756 AQAKSCTKGPREAGEQGPHGSLG-PKEKGESSTKRKKG-QVPGPARSESVGSFGRAPSAP 3813
                    GP  A   GP G  G P E+G+   +   G  +PGP   +        P AP
Sbjct: 386  --------GPPGAAVMGPPGPPGFPGERGQKGDEGPPGISIPGPPGLDG------QPGAP 431

Query: 3814 DKP-PRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPG 3855
              P P  P     P      +P P     P PP S   K   G
Sbjct: 432  GLPGPPGPAGPHIPPSDEICEPGP-----PGPPGSPGDKGLQG 469



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 114/477 (23%), Positives = 150/477 (31%), Gaps = 62/477 (12%)

Query: 3428 PGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILS-EGSLPALLHLCSE 3486
            PG+PG   +A     P  +  + M G    PG    P R   P L  +  L     L   
Sbjct: 877  PGSPGLPGKAGASGFPGTKGEMGMMGPPGPPGPLGIPGRSGVPGLKGDDGLQGQPGLPGP 936

Query: 3487 VAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGDCALDGA 3546
                 +KG P  L  P  P+   + G +      E   P L   P  ++  +G   L G 
Sbjct: 937  TGEKGSKGEPG-LPGPPGPMDPNLLGSK-----GEKGEPGLPGIPG-VSGPKGYQGLPGD 989

Query: 3547 LERPENEASPGSPGPLLQQALPLGASLPR----PGARG----------QDAEGKRAPLVF 3592
              +P     PG PGP   +  P     P     PG +G          Q  EG   P   
Sbjct: 990  PGQPGLSGQPGLPGPPGPKGNPGLPGQPGLIGPPGLKGTIGDMGFPGPQGVEGPPGPSGV 1049

Query: 3593 SGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSS 3652
             G+  +PG  G+            + +  +SS  +    GP+G           G + S 
Sbjct: 1050 PGQPGSPGLPGQKGD---------KGDPGISSIGLPGLPGPKGEPGLPGYPGNPGIKGSV 1100

Query: 3653 KDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRP 3712
             D      P            A G   PG    G      P  PK   GP         P
Sbjct: 1101 GDPGLPGLPGTP--------GAKGQ--PG--LPGFPGTPGPPGPKGISGPPGNPGLPGEP 1148

Query: 3713 GTKTGGGSQPQPA----SGQLQSETATTPA----KPSFPS-RSPAPERLPARAQAKSCTK 3763
            G   GGG   QP      G+   +    PA    +P  P   +P P  LP  +  K    
Sbjct: 1149 GPVGGGGHPGQPGPPGEKGKPGQDGIPGPAGQKGEPGQPGFGNPGPPGLPGLSGQKGDGG 1208

Query: 3764 GPREAGEQGPHGSLG-PKEKGESSTKRKKGQ--VPGPARSESVGSFGRAPSAPDKPPRTP 3820
             P   G  G  G  G P   G    +   G    PGPA     G+ G  P  P   P  P
Sbjct: 1209 LPGIPGNPGLPGPKGEPGFHGFPGVQGPPGPPGSPGPALEGPKGNPG--PQGPPGRPGLP 1266

Query: 3821 RKQATP-----SRVLPTKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRP 3872
              +  P       +   K  P     P  P  +  +  PG      R G    +G P
Sbjct: 1267 GPEGPPGLPGNGGIKGEKGNPGQPGLPGLPGLKGDQGPPGLQGNPGRPGLNGMKGDP 1323



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 115/475 (24%), Positives = 140/475 (29%), Gaps = 62/475 (13%)

Query: 3428 PGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEV 3487
            PG PG      +  LP        PG     GE  PP             P L  L   +
Sbjct: 569  PGLPGLPGTPGQDGLPGLPGPKGEPGGITFKGERGPPGN-----------PGLPGLPGNI 617

Query: 3488 APSTTKGWPETLERPVDPVTHP-IRGCELPSNHQECPPPSLSPFPAALADGRGDCALDGA 3546
             P    G+      P  PV    I+G          P P   P       G+    L G 
Sbjct: 618  GPMGPPGF-----GPPGPVGEKGIQGVAGNPGQPGIPGPKGDPGQTITQPGKP--GLPGN 670

Query: 3547 LERPENEASPGSPGPLLQQALP-LGASLPRPGARGQDAEGKRAPLVF---SGKRRAPGAR 3602
              R  +   PG PG   Q  LP +  S   PG  G    G   P  F    G   APG  
Sbjct: 671  PGRDGDVGLPGDPGLPGQPGLPGIPGSKGEPGIPGIGLPGPPGPKGFPGIPGPPGAPGTP 730

Query: 3603 GRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSAASTPS 3662
            GR   +           K      +    GP G      A  P G      DR     P 
Sbjct: 731  GRIGLEGPPGPPGFPGPKGEPGFALPGPPGPPGLPGFKGALGPKG------DRGFPGPPG 784

Query: 3663 ----------KALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRP 3712
                         K  V P    G + P  L      G  P  P   PGP  Q      P
Sbjct: 785  PPGRTGLDGLPGPKGDVGPNGQPGPMGPPGLPGIGVQG--PPGPPGIPGPIGQPGLHGIP 842

Query: 3713 GTKTGGGSQPQPASGQL-QSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQ 3771
            G K   G       G   +  +   P  P  P   P    LP +A A        E G  
Sbjct: 843  GEKGDPGPPGLDVPGPPGERGSPGIPGAPG-PIGPPGSPGLPGKAGASGFPGTKGEMGMM 901

Query: 3772 GPHGSLGPKE----------KGESSTKRKKGQVPGPARSESVGSFGR----APSAPDKPP 3817
            GP G  GP            KG+   + + G +PGP   +  GS G      P  P  P 
Sbjct: 902  GPPGPPGPLGIPGRSGVPGLKGDDGLQGQPG-LPGPTGEK--GSKGEPGLPGPPGPMDPN 958

Query: 3818 RTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRP 3872
                K       LP  P  +     +  P +    +PG + +    G   P+G P
Sbjct: 959  LLGSKGEKGEPGLPGIPGVSGPKGYQGLPGD--PGQPGLSGQPGLPGPPGPKGNP 1011



 Score = 43.1 bits (100), Expect = 0.005
 Identities = 205/900 (22%), Positives = 270/900 (30%), Gaps = 129/900 (14%)

Query: 1684 GDSRPPQD-VCLPEPSKQPGPQLDAGSLAK---CSPDQELSFPKNKEAASSQESEDSLRL 1739
            G   PP D +C P P   PG   D G   +        +  F       S    +  L  
Sbjct: 441  GPHIPPSDEICEPGPPGPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGISGPPGQPGLPG 500

Query: 1740 LPCEQRGGFLPEPG-TADQPHRGAPAPEAFGSPAVHLAPDL-AFQGDGAPPLDATWPFGA 1797
            LP     G L  PG   ++   GA  P+  G P +  AP    F G    P D    F  
Sbjct: 501  LPGPP--GSLGFPGQKGEKGQAGATGPK--GLPGIPGAPGAPGFPGSKGEPGDIL-TFPG 555

Query: 1798 SPSHAAQGHSAGRAGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLV------PVP 1851
                  +  S G  G       G PG  G +    G   L  P+G    +       P  
Sbjct: 556  MKGDKGELGSPGAPG-----LPGLPGTPGQD----GLPGLPGPKGEPGGITFKGERGPPG 606

Query: 1852 SPACVSNTHPSRRSQDPALSPPIRQLQLPGPGVAKSKDGILGL--QELTPAAQSPP---- 1905
            +P       P        + PP      PGP   K   G+ G   Q   P  +  P    
Sbjct: 607  NPGL-----PGLPGNIGPMGPP--GFGPPGPVGEKGIQGVAGNPGQPGIPGPKGDPGQTI 659

Query: 1906 -RVNPSGLEGGTVEGGKVACGPAQGSPGGVQVTTLPAVAGHQ----LGLEA-DGHWGLLG 1959
             +    GL G     G V      G PG   +  +P   G      +GL    G  G  G
Sbjct: 660  TQPGKPGLPGNPGRDGDVGLPGDPGLPGQPGLPGIPGSKGEPGIPGIGLPGPPGPKGFPG 719

Query: 1960 QAEKTQGQGTANQLQPENGVSPGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMS 2019
                    GT  ++  E    P G          P  AL GP     L     G + A+ 
Sbjct: 720  IPGPPGAPGTPGRIGLE---GPPGPPGFPGPKGEPGFALPGPPGPPGL----PGFKGALG 772

Query: 2020 LQEEAEPTPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAPSV 2079
             + +    P PP P   +    L       G  G+ P     PGL  P +     P P  
Sbjct: 773  PKGD-RGFPGPPGPPGRTGLDGLPGPKGDVGPNGQ-PGPMGPPGL--PGIGVQGPPGPP- 827

Query: 2080 GDLAACAPSPTSAAH-MPCSLG-PLPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQL 2137
                   P      H +P   G P P    +  P   +G  G  +P +P    PPG    
Sbjct: 828  ---GIPGPIGQPGLHGIPGEKGDPGPPGLDVPGPPGERGSPG--IPGAPGPIGPPG---- 878

Query: 2138 LACSPAWAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCDPKEALAGCL----LQGE--- 2190
               SP       A G   T        P  PP     P   +  + G      LQG+   
Sbjct: 879  ---SPGLPGKAGASGFPGTKGEMGMMGPPGPPGPLGIP--GRSGVPGLKGDDGLQGQPGL 933

Query: 2191 -------GSPLEDPSSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSP 2243
                   GS  E     PPG +        G+  +     IP  S  +     PG    P
Sbjct: 934  PGPTGEKGSKGEPGLPGPPGPMDPNLLGSKGEKGEPGLPGIPGVSGPKGYQGLPGDPGQP 993

Query: 2244 PLAGAVSPSVAVRATGLSSTPTGDEAQAGRGLPG-------PDPQSRGAPPHTNPDRMPR 2296
             L+G           G    P         GL G       P PQ    PP   P  +P 
Sbjct: 994  GLSGQPGLPGPPGPKGNPGLPGQPGLIGPPGLKGTIGDMGFPGPQGVEGPP--GPSGVP- 1050

Query: 2297 GHSSYSPSNTARLGHREGQAVTAV-------PTEPPTLQGAGPDSPACLEGEMGTSSKEP 2349
                 SP    + G +    ++++       P   P L G  P +P  ++G +G     P
Sbjct: 1051 -GQPGSPGLPGQKGDKGDPGISSIGLPGLPGPKGEPGLPGY-PGNPG-IKGSVGDPGL-P 1106

Query: 2350 EDPGTP-ETGRSGATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRNASHQTPQG 2408
              PGTP   G+ G    P    P    G+  +  P +     +        +     P G
Sbjct: 1107 GLPGTPGAKGQPGLPGFPGTPGPPGPKGI--SGPPGNPGLPGEPGPVGGGGHPGQPGPPG 1164

Query: 2409 DPLGP-QDLKQRSRGYKKKPASTENGQWKGQAPHGPVTCEVCAASFRSGPGLSRHKARKH 2467
            +   P QD      G K +P     G      P G              PGLS  K    
Sbjct: 1165 EKGKPGQDGIPGPAGQKGEPGQPGFG---NPGPPGL-------------PGLSGQKGDGG 1208

Query: 2468 RPH-PGAPAEPSPAALPAQQPLEPLAQKCQPPRKKSHRVSGKERPNHSRGDPSHVTQPPP 2526
             P  PG P  P P   P       +     PP      + G +     +G P     P P
Sbjct: 1209 LPGIPGNPGLPGPKGEPGFHGFPGVQGPPGPPGSPGPALEGPKGNPGPQGPPGRPGLPGP 1268



 Score = 40.4 bits (93), Expect = 0.035
 Identities = 56/209 (26%), Positives = 69/209 (33%), Gaps = 18/209 (8%)

Query: 3693 PATPKAKPGPSSQGSG---SPRPGTKTGGGSQPQPASGQLQSETATT----PAKPSFPSR 3745
            P  P   PG   +      S  PG K   G    P    L   T       P  P     
Sbjct: 145  PPGPPGIPGMKGEPGSIIMSSLPGPKGNPGYPGPPGIQGLPGPTGIPGPIGPPGPPGLMG 204

Query: 3746 SPAPERLPA-RAQAKSCTKGPR-EAGEQGPHGSLGP-----KEKGESSTKRKKGQ--VPG 3796
             P P  LP  +       +GP+ E GEQG  G  GP     ++K     + +KG   +PG
Sbjct: 205  PPGPPGLPGPKGNMGLNFQGPKGEKGEQGLQGPPGPPGQISEQKRPIDVEFQKGDQGLPG 264

Query: 3797 PARSESVGSFGRAPSAPDKPPRTPRKQATPS-RVLPTKPKPNSQ-NKPRPPPSEQRKAEP 3854
                         P  P        +Q  P  R  P K   N Q   P  P       EP
Sbjct: 265  DRGPPGPPGIRGPPGPPGGEKGEKGEQGEPGKRGKPGKDGENGQPGIPGLPGDPGYPGEP 324

Query: 3855 GHTQRKDRLGKAFPQGRPLLRPPKRGTAV 3883
            G    K + G   P G P L  P+ GT +
Sbjct: 325  GRDGEKGQKGDTGPPGPPGLVIPRPGTGI 353



 Score = 37.7 bits (86), Expect = 0.23
 Identities = 50/197 (25%), Positives = 62/197 (31%), Gaps = 35/197 (17%)

Query: 489 PTARPSPHGMEMLSRLPFPAG-----GPEWQGGSQGALGTAGK-----TPGPREKLPAVR 538
           P   P P G +    +P P G     GP    G  G  G  G       PGP + +P   
Sbjct: 67  PEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGP-QGIPGCN 125

Query: 539 SSQG-----GSPALFTYNGMTDPGAQPLFFG-----VAQPQVSPHGTPSLPPPRVVGASP 588
            ++G     GSP      G   P   P   G     +      P G P  P P  +   P
Sbjct: 126 GTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGNPGYPGPPGIQGLP 185

Query: 589 SESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSA--FFHPPTHPQETGS 646
             + +P P             P    P  P      LPGP G     F  P     E G 
Sbjct: 186 GPTGIPGPIGPPG-------PPGLMGPPGPPG----LPGPKGNMGLNFQGPKGEKGEQGL 234

Query: 647 PFPSPEPPHSLPTHYQP 663
             P P PP  +    +P
Sbjct: 235 QGP-PGPPGQISEQKRP 250



 Score = 37.0 bits (84), Expect = 0.39
 Identities = 169/712 (23%), Positives = 217/712 (30%), Gaps = 136/712 (19%)

Query: 3206 PAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPGERAKPRARSTPSNPDGAATPDSASA 3265
            P P+   G R      G PG P  +        PG    P     P + DGA  P     
Sbjct: 65   PGPEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGH-DGAPGPQGIPG 123

Query: 3266 T--ALADAGSPGPP-----RTTPSPSPDPWAGGEPLLQATPVHEACKDPSRDCHHCG--- 3315
                  + G PG P     +  P P   P   GEP    + +  +   P  +  + G   
Sbjct: 124  CNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEP---GSIIMSSLPGPKGNPGYPGPPG 180

Query: 3316 -KRFPKPFKLQRHLAVHSPQRVYLCPRCPRVYPEHGELLAHLGGAHGLLERPELQHTPLY 3374
             +  P P  +   +    P  +   P  P +    G +  +  G  G      LQ  P  
Sbjct: 181  IQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEKGEQGLQGPPGP 240

Query: 3375 ACELCATVMRIIKKSFACSSCNYTFAKKEQFDRHMNKHLRGGRQPFAFRGVRRPGAP--G 3432
              ++      I          +  F K +Q        L G R P    G+R P  P  G
Sbjct: 241  PGQISEQKRPI----------DVEFQKGDQ-------GLPGDRGPPGPPGIRGPPGPPGG 283

Query: 3433 QKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEVAPSTT 3492
            +K    E   P KR +         PG+D            E   P +            
Sbjct: 284  EKGEKGEQGEPGKRGK---------PGKD-----------GENGQPGI------------ 311

Query: 3493 KGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAA--LADGRGDCALDGAL--- 3547
             G P     P +P     +G +        PP  + P P        +G+  L G     
Sbjct: 312  PGLPGDPGYPGEPGRDGEKG-QKGDTGPPGPPGLVIPRPGTGITIGEKGNIGLPGLPGEK 370

Query: 3548 -ER--PENEASPGSPGPLLQQALPLGASLPR--PGARGQDAEGKRAPLVFS-----GKRR 3597
             ER  P  +  PG PGP    A  +G   P   PG RGQ  +G   P   S     G   
Sbjct: 371  GERGFPGIQGPPGLPGP--PGAAVMGPPGPPGFPGERGQ--KGDEGPPGISIPGPPGLDG 426

Query: 3598 APGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDR-- 3655
             PGA G   P      H       +  S  + E GP G           G Q    D+  
Sbjct: 427  QPGAPGLPGPPGPAGPH-------IPPSDEICEPGPPGPPGSPGDKGLQGEQGVKGDKGD 479

Query: 3656 -------SAASTPSKALKFPVHPRKAVGSLA----PGELARGTENGMK--PATPKAKPGP 3702
                   +  S P      P  P    GSL      GE  +    G K  P  P A   P
Sbjct: 480  TCFNCIGTGISGPPGQPGLPGLPGPP-GSLGFPGQKGEKGQAGATGPKGLPGIPGAPGAP 538

Query: 3703 SSQGS-GSPR-----PGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARA 3756
               GS G P      PG K   G    P +  L     T P +   P   P P+  P   
Sbjct: 539  GFPGSKGEPGDILTFPGMKGDKGELGSPGAPGLPGLPGT-PGQDGLPGL-PGPKGEPGGI 596

Query: 3757 QAKSCTKGPR----------EAGEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSF 3806
              K   +GP             G  GP G   P   GE   +   G    P      G  
Sbjct: 597  TFKG-ERGPPGNPGLPGLPGNIGPMGPPGFGPPGPVGEKGIQGVAGNPGQPGIPGPKGDP 655

Query: 3807 GRAPSAPDKP--PRTPRKQATPSRVLPTKP-KPNSQNKPRPPPSEQRKAEPG 3855
            G+  + P KP  P  P +       LP  P  P     P  P S   K EPG
Sbjct: 656  GQTITQPGKPGLPGNPGRDGDVG--LPGDPGLPGQPGLPGIPGS---KGEPG 702



 Score = 34.3 bits (77), Expect = 2.5
 Identities = 35/133 (26%), Positives = 43/133 (32%), Gaps = 16/133 (12%)

Query: 3183 LGDLPG--GLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPG 3240
            L  LPG  G +G   +     +   P PK   G        G PG   G     +   PG
Sbjct: 1105 LPGLPGTPGAKGQPGLPGFPGTPGPPGPKGISGPPGNPGLPGEPGPVGGGGHPGQPGPPG 1164

Query: 3241 ERAKPRARSTPS--------NPDGAATPDSASATALA----DAGSPGPPRT--TPSPSPD 3286
            E+ KP     P            G   P       L+    D G PG P     P P  +
Sbjct: 1165 EKGKPGQDGIPGPAGQKGEPGQPGFGNPGPPGLPGLSGQKGDGGLPGIPGNPGLPGPKGE 1224

Query: 3287 PWAGGEPLLQATP 3299
            P   G P +Q  P
Sbjct: 1225 PGFHGFPGVQGPP 1237



 Score = 34.3 bits (77), Expect = 2.5
 Identities = 73/312 (23%), Positives = 92/312 (29%), Gaps = 61/312 (19%)

Query: 1623 QGRPGGTWPCPASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQPVQKAGASKTGLCQA 1682
            +G PG     P   +PG   L   + +    G P  P        P  K      G    
Sbjct: 1181 KGEPGQ----PGFGNPGPPGLPGLSGQKGDGGLPGIPGNPGL---PGPKGEPGFHGFPGV 1233

Query: 1683 EGDSRPPQDV--CLPEPSKQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRLL 1740
            +G   PP      L  P   PGPQ   G      P+     P N                
Sbjct: 1234 QGPPGPPGSPGPALEGPKGNPGPQGPPGRPGLPGPEGPPGLPGN---------------- 1277

Query: 1741 PCEQRGGFLPEPGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPS 1800
                 GG   E G   QP  G P     G P +        +GD  PP       G   +
Sbjct: 1278 -----GGIKGEKGNPGQP--GLP-----GLPGL--------KGDQGPP-------GLQGN 1310

Query: 1801 HAAQGHSAGRAGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPACVSNTH 1860
                G +  +    L    G PG +G    P+G      P G E  L+  P P  +    
Sbjct: 1311 PGRPGLNGMKGDPGLPGVPGFPGMKG----PSGVPGSAGPEG-EPGLIGPPGPPGL---- 1361

Query: 1861 PSRRSQDPALSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNPSGLEGGTVEGG 1920
            P    Q   +        +PG    K   G  G Q L      P     +GL G    GG
Sbjct: 1362 PGPSGQSIIIKGDAGPPGIPGQPGLKGLPGPQGPQGLPGPTGPPGDPGRNGLPGFDGAGG 1421

Query: 1921 KVACGPAQGSPG 1932
            +       G PG
Sbjct: 1422 RKGDPGLPGQPG 1433



 Score = 33.9 bits (76), Expect = 3.3
 Identities = 33/121 (27%), Positives = 43/121 (35%), Gaps = 16/121 (13%)

Query: 3186 LPG--GLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPW-----GQEGEAKKDS 3238
            LPG  GL G   +   +  +  P P+   G        G PG P      G +G+    S
Sbjct: 1013 LPGQPGLIGPPGLKGTIGDMGFPGPQGVEGPPGPSGVPGQPGSPGLPGQKGDKGDPGISS 1072

Query: 3239 PGERAKPRARSTPSNPDGAATPDSASATALADAGSPGPPRTTPSPSPDPWAGGEPLLQAT 3298
             G    P  +  P  P     P      ++ D G PG P T       P A G+P L   
Sbjct: 1073 IGLPGLPGPKGEPGLPGYPGNPGIKG--SVGDPGLPGLPGT-------PGAKGQPGLPGF 1123

Query: 3299 P 3299
            P
Sbjct: 1124 P 1124



 Score = 33.1 bits (74), Expect = 5.6
 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 3/55 (5%)

Query: 1232 PGLLIPEQPPPSRH---DTGTPKPSGSLANTAPHGSSPTPGVGSLLGGPGGTQAP 1283
            PG   PE PP  R    D G P P G      P G    PG   L G PG   AP
Sbjct: 62   PGFPGPEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAP 116


>gi|148536825 alpha 1 type IV collagen preproprotein [Homo sapiens]
          Length = 1669

 Score =  102 bits (255), Expect = 6e-21
 Identities = 353/1470 (24%), Positives = 442/1470 (30%), Gaps = 295/1470 (20%)

Query: 4    ERPRGAPPPTMTGDLQPRQVASSPGHPSQ-----PPLEDNTPATRTTKGAREAGGQAQAM 58
            E P+G  PP   GD         PG P       PP     P      G     G     
Sbjct: 69   EGPQG--PPGQKGD------TGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPP 120

Query: 59   ELPEAQPRQARDGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQA-PSRLAGRAEGSPP 117
             +P     +   G L PP L        PG  G+P  PPG   ++  P  + G   G   
Sbjct: 121  GIPGCNGTKGERGPLGPPGL--------PGFAGNP-GPPGLPGMKGDPGEILGHVPG--- 168

Query: 118  QRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPG--TGAPLRPGLPRTEAQPAA 175
                + +   R  P +  TP  P      LP +  P GP   TG P  PG P     P  
Sbjct: 169  ----MLLKGERGFPGIPGTPGPP-----GLPGLQGPVGPPGFTGPPGPPGPP----GPPG 215

Query: 176  EELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSW 235
            E+      FQ P         + P     P  PG  Q +     + G +      G    
Sbjct: 216  EKGQMGLSFQGPKGDKGDQGVSGP-----PGVPGQAQVQ-----EKGDFATKGEKGQKGE 265

Query: 236  PPAAENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFP-FPALHGASTKPFPADVAG 294
            P       PG      P +P P  K  + G      S  FP  P   G   +  P    G
Sbjct: 266  P--GFQGMPGVGEKGEPGKPGPRGKPGKDGDKGEKGSPGFPGEPGYPGLIGRQGPQGEKG 323

Query: 295  HAFTNGPLVFAFHQPQGAWPEEAVGTGP-------AYPLPT----QPAPSPLPCYQGQPG 343
             A   GP            P   +GTGP        YP       +P P   P   GQPG
Sbjct: 324  EAGPPGP------------PGIVIGTGPLGEKGERGYPGTPGPRGEPGPKGFPGLPGQPG 371

Query: 344  --GLNRHSDLSGALSSPG-AAHSAPRPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSS 400
              GL      +GA   PG       R F  +        LP   PS +DGL    G P  
Sbjct: 372  PPGLPVPGQ-AGAPGFPGERGEKGDRGFPGT-------SLP--GPSGRDGLPGPPGSPGP 421

Query: 401  LPQRHFPGQAYRASG-VDTSPGPPDTELAAPGPP--PARLPQLWDP----------TAAP 447
                  PGQ    +G V+  PGPP  +   PG P  P  + ++ +               
Sbjct: 422  ------PGQPGYTNGIVECQPGPPGDQ-GPPGIPGQPGFIGEIGEKGQKGESCLICDIDG 474

Query: 448  YPTPPGGPLAATRSMFFNGQPSPGQRLCLPQS---APLPWPQVL------PTARPSPHGM 498
            Y  PP GP      + F GQP       LP     A +P PQ        P A+  P   
Sbjct: 475  YRGPP-GPQGPPGEIGFPGQPGAKGDRGLPGRDGVAGVPGPQGTPGLIGQPGAKGEPGEF 533

Query: 499  EMLSRLPFPAGGPEWQG--GSQGALGTAGK-----TPGPREKLPAVRSSQGGSPALFTYN 551
                RL    G P + G  G  G  G+ G+      PGP+           GSP      
Sbjct: 534  YFDLRLKGDKGDPGFPGQPGMTGRAGSPGRDGHPGLPGPK-----------GSPGSVGLK 582

Query: 552  GMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVG--------ASPSESPLPSPATNTAGS 603
            G   P     F G ++    P G P   P   +G          P    LP P       
Sbjct: 583  GERGPPGGVGFPG-SRGDTGPPGPPGYGPAGPIGDKGQAGFPGGPGSPGLPGPKGEP--- 638

Query: 604  TCSSLSPMSSSPANPSSEESQ-LPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTHYQ 662
                + P+   P       S   PGP G   F   P  P   G      +P    P    
Sbjct: 639  --GKIVPLPGPPGAEGLPGSPGFPGPQGDRGFPGTPGRPGLPGEKGAVGQPGIGFPGPPG 696

Query: 663  PEPAKAFPFPADGLGAEG--AFQCLEETP---FPHEGPEVGRGGLQGFPRAP--PPYPTH 715
            P+     P      G  G   F  L   P        P VG  GL+G P  P  P  P  
Sbjct: 697  PKGVDGLPGDMGPPGTPGRPGFNGLPGNPGVQGQKGEPGVGLPGLKGLPGLPGIPGTPGE 756

Query: 716  HFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPS 775
              S+    +                             G +      G +  PGPPGLP 
Sbjct: 757  KGSIGVPGVPGEH-------------------------GAIGPPGLQGIRGEPGPPGLPG 791

Query: 776  PPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDPL----RTGFLPSLAATPFPLPASD 831
               +P VP     G           G     G   P       GF P       P P  D
Sbjct: 792  SVGSPGVPGIGPPGARGP------PGGQGPPGLSGPPGIKGEKGF-PGFPGLDMPGPKGD 844

Query: 832  LDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAGV 891
                          + L G+  QS  P +            P  P  P S    K + GV
Sbjct: 845  KG-----------AQGLPGITGQSGLPGLPGQ------QGAPGIPGFPGS----KGEMGV 883

Query: 892  TPESKAPPPLPAATPDPQTP-RPGDRGCPARGRPKTRSLGLAPTEADAPSQGRQQRRGKQ 950
               +   P  P     P  P   GD G P    P+    G    + D    G   + G  
Sbjct: 884  M-GTPGQPGSPGPVGAPGLPGEKGDHGFPGSSGPR----GDPGLKGDKGDVGLPGKPGSM 938

Query: 951  LKLFRKDLDSGGAAEG-SGSGGGGRASGLRPRRND-GLGERPPPRPRRPRTQAPGSRADP 1008
             K+   D+ S    +G  G  G     G +  R D G    P    +  +   PG + DP
Sbjct: 939  DKV---DMGSMKGQKGDQGEKGQIGPIGEKGSRGDPGTPGVPGKDGQAGQPGQPGPKGDP 995

Query: 1009 A-PRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRLREYDFA 1067
                 P A  LP    S     LP     +      G  G   +             D  
Sbjct: 996  GISGTPGAPGLPGPKGSVGGMGLPGTPGEKGVPGIPGPQGSPGL-----------PGDKG 1044

Query: 1068 SESEEDEQPPP--RGPGFRGRRG----------RGEKRKEVELTQGPREDEPQKPRKAAR 1115
            ++ E+ +  PP    PG RG +G           GEK ++  +        P    K + 
Sbjct: 1045 AKGEKGQAGPPGIGIPGLRGEKGDQGIAGFPGSPGEKGEKGSIGIPGMPGSP--GLKGSP 1102

Query: 1116 QEAGGDGAPANPEEPGG-SRPG----PGRSPQARGPSRSLETGAAAREGGPKCADRPSVA 1170
               G  G+P  P E G    PG    PG   +A  P     TG A ++G P     P  A
Sbjct: 1103 GSVGYPGSPGLPGEKGDKGLPGLDGIPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSA 1162

Query: 1171 PKDPLQVPTNTETSEETRPSLDFP------------QEAKEPETAEESAPDSTEFTEALR 1218
                       E  E   P   FP             E   P  A       ++  +   
Sbjct: 1163 ----------GEKGEPGLPGRGFPGFPGAKGDKGSKGEVGFPGLAGSPGIPGSKGEQGFM 1212

Query: 1219 SPPAACAGEMG--ASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSLLGG 1276
             PP    G+ G   SPG    E P   R   G P   G      P G     GV    G 
Sbjct: 1213 GPPGP-QGQPGLPGSPG-HATEGPKGDRGPQGQPGLPGLPGPMGPPGLPGIDGVKGDKGN 1270

Query: 1277 PGGTQAPVSHNSKDPPARQ--PGEFLAPVANPSSTACPKPSV--LSSKISSFGCDPAGFN 1332
            PG   AP     K  P  Q  PG   +P    S      P V          G      +
Sbjct: 1271 PGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGPPGVPGFQGPKGLPGLQGIKGD 1330

Query: 1333 RDPLGVPVAKKGPQPYSSPHSELFLGPKDL 1362
            +   GVP AK  P P   P      GP D+
Sbjct: 1331 QGDQGVPGAKGLPGPPGPP------GPYDI 1354



 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 327/1407 (23%), Positives = 440/1407 (31%), Gaps = 280/1407 (19%)

Query: 2    PGERPR-GAPPPTMTGDLQPRQVASSPGHPSQPPLEDNTP-ATRTTKGAREAGGQAQAME 59
            PGE+ + G       GD   + V+  PG P Q  +++    AT+  KG +   G      
Sbjct: 214  PGEKGQMGLSFQGPKGDKGDQGVSGPPGVPGQAQVQEKGDFATKGEKGQKGEPGF----- 268

Query: 60   LPEAQPRQARDGELKPPSLRGQ-APSSTPGKRGSPQTP-----PGRSPLQAPSRLAGRAE 113
              +  P     GE   P  RG+       G++GSP  P     PG    Q P    G A 
Sbjct: 269  --QGMPGVGEKGEPGKPGPRGKPGKDGDKGEKGSPGFPGEPGYPGLIGRQGPQGEKGEAG 326

Query: 114  GSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQG-PGT----GAPLRPGLPR 168
               P   ++G     T P L E  E         P    P+G PG     G P +PG P 
Sbjct: 327  PPGPPGIVIG-----TGP-LGEKGERGY------PGTPGPRGEPGPKGFPGLPGQPGPPG 374

Query: 169  TEAQPAAEELGFH-RCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEY 227
                  A   GF     ++    F  T+   PS   R   PGPP S G            
Sbjct: 375  LPVPGQAGAPGFPGERGEKGDRGFPGTSLPGPSG--RDGLPGPPGSPG------------ 420

Query: 228  QASGADSWPPAAENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKP 287
                    PP      PG   G+   +P P P    P G P    F              
Sbjct: 421  --------PPGQ----PGYTNGIVECQPGP-PGDQGPPGIPGQPGFIGEIGEKGQKGESC 467

Query: 288  FPADVAGHAFTNGPLVFAFHQPQG--AWPEEAVGTGPAYPLPTQ------PAPSPLPCYQ 339
               D+ G+    GP       P G   +P +    G    LP +      P P   P   
Sbjct: 468  LICDIDGYRGPPGP-----QGPPGEIGFPGQPGAKGDR-GLPGRDGVAGVPGPQGTPGLI 521

Query: 340  GQPGGLNRHSDL------------SGALSSPGAAHSAPRPFSDSLHKSLTKILPERPPSA 387
            GQPG      +              G    PG    A  P  D  H  L    P+  P +
Sbjct: 522  GQPGAKGEPGEFYFDLRLKGDKGDPGFPGQPGMTGRAGSPGRDG-HPGLPG--PKGSPGS 578

Query: 388  QDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGPPPARLPQLWDPTAAP 447
              GL   RGPP  +    FPG    + G    PGPP    A P         + D   A 
Sbjct: 579  V-GLKGERGPPGGVG---FPG----SRGDTGPPGPPGYGPAGP---------IGDKGQAG 621

Query: 448  YPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLP-F 506
            +P  PG P          G P P       +  P    +++P   P P G E L   P F
Sbjct: 622  FPGGPGSP----------GLPGP-------KGEP---GKIVPL--PGPPGAEGLPGSPGF 659

Query: 507  PAGGPEWQGGSQGALGTAGKTPGPREKLPAVRSSQG--GSPALFTYNGMTDPGAQPLFFG 564
            P  GP+   G +G  GT G+   P EK    +   G  G P     +G+  PG       
Sbjct: 660  P--GPQ---GDRGFPGTPGRPGLPGEKGAVGQPGIGFPGPPGPKGVDGL--PG------- 705

Query: 565  VAQPQVSPHGTPSLPPPRVVGASPS-ESPLPSPATNTAGSTCSSLSPMSSSPANPSSEES 623
                 + P GTP  P    +  +P  +     P     G     L  +   P  P  + S
Sbjct: 706  ----DMGPPGTPGRPGFNGLPGNPGVQGQKGEPGVGLPG--LKGLPGLPGIPGTPGEKGS 759

Query: 624  -QLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAF 682
              +PG  G      PP      G P P P  P S+ +   P           G+G  GA 
Sbjct: 760  IGVPGVPGEHGAIGPPGLQGIRGEPGP-PGLPGSVGSPGVP-----------GIGPPGA- 806

Query: 683  QCLEETPFPHEGPEVGRG--GLQGFP-----RAPPPYPTHHFSLSSASLDQLDVLLTCRQ 735
                       GP  G+G  GL G P     +  P +P     +     D+    L    
Sbjct: 807  ----------RGPPGGQGPPGLSGPPGIKGEKGFPGFPG--LDMPGPKGDKGAQGLPGIT 854

Query: 736  CDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAK 795
                   L          G   ++ + G   +PG PG P P  AP +P +       H  
Sbjct: 855  GQSGLPGLPGQQGAPGIPGFPGSKGEMGVMGTPGQPGSPGPVGAPGLPGEKG----DHG- 909

Query: 796  TFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLPASDLDME-------DDAKLDSLITEAL 848
                 G +   G  DP   G    +     P     +DM        D  +   +     
Sbjct: 910  ---FPGSSGPRG--DPGLKGDKGDVGLPGKPGSMDKVDMGSMKGQKGDQGEKGQIGPIGE 964

Query: 849  NGMEYQSDNPEIDSSFIDVFADEEPSGPRG----------PSSGHPLKSKAGV----TPE 894
             G       P +           +P GP+G          P    P  S  G+    TP 
Sbjct: 965  KGSRGDPGTPGVPGKDGQAGQPGQP-GPKGDPGISGTPGAPGLPGPKGSVGGMGLPGTPG 1023

Query: 895  SKAPPPLPAATPDPQTPRPGDRGCPAR----GRPKTRSLGLAPTEAD---APSQGRQQRR 947
             K  P +P     P  P  GD+G        G P     GL   + D   A   G    +
Sbjct: 1024 EKGVPGIPGPQGSPGLP--GDKGAKGEKGQAGPPGIGIPGLRGEKGDQGIAGFPGSPGEK 1081

Query: 948  GKQLKLFRKDLDSGGAAEGS-GSGGGGRASGLRPRRND----GLGERPPPRPRRPRTQAP 1002
            G++  +    +      +GS GS G   + GL   + D    GL   P  +        P
Sbjct: 1082 GEKGSIGIPGMPGSPGLKGSPGSVGYPGSPGLPGEKGDKGLPGLDGIPGVKGEAGLPGTP 1141

Query: 1003 GSRADPAPR-VPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRL 1061
            G       +  P +  +P          LP R  P    A+G              K   
Sbjct: 1142 GPTGPAGQKGEPGSDGIPGSAGEKGEPGLPGRGFPGFPGAKG-------------DKGSK 1188

Query: 1062 REYDFASESEEDEQPPPRGP-GFRGRRGR----GEKRKEVELTQGPREDEPQKPRKAARQ 1116
             E  F   +     P  +G  GF G  G     G        T+GP+ D   + +     
Sbjct: 1189 GEVGFPGLAGSPGIPGSKGEQGFMGPPGPQGQPGLPGSPGHATEGPKGDRGPQGQPGLPG 1248

Query: 1117 EAGGDGAPANPEEPG--GSRPGPG--RSPQARGPSRSLETGAAAREGGPKCADRPSVAPK 1172
              G  G P  P   G  G +  PG   +P   GP      G    +G P     P +   
Sbjct: 1249 LPGPMGPPGLPGIDGVKGDKGNPGWPGAPGVPGPK-----GDPGFQGMPGIGGSPGITGS 1303

Query: 1173 DPLQVPTNTETSEETR--PSLDFPQEAKEPETAEESAPDSTEFTEALRSPPAACAGE--M 1228
                 P      +  +  P L    +  + +  ++  P +    + L  PP        +
Sbjct: 1304 KGDMGPPGVPGFQGPKGLPGL----QGIKGDQGDQGVPGA----KGLPGPPGPPGPYDII 1355

Query: 1229 GASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSLLG--------GPGGT 1280
               PGL  PE PP  +   G P P G    T   G    PG+    G        GP G 
Sbjct: 1356 KGEPGLPGPEGPPGLKGLQGLPGPKGQQGVTGLVGIPGPPGIPGFDGAPGQKGEMGPAGP 1415

Query: 1281 QAPVSHNSKDPPARQPGEFLAPVANPS 1307
              P        P   PG  + P   PS
Sbjct: 1416 TGPRGFPGPPGPDGLPGS-MGPPGTPS 1441



 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 117/468 (25%), Positives = 156/468 (33%), Gaps = 77/468 (16%)

Query: 3392 CSSCNYTFAKKEQFDRHMNKHLRGGRQPFAFRGVRRP----GAPGQKARALEGTLPSKRR 3447
            C  C+    K ++ +R     L G +    F G++ P    G PGQK    E  LP  + 
Sbjct: 36   CGKCDCHGVKGQKGERG----LPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKG 91

Query: 3448 RVAMPGSA--PG-------PGEDRPP-PRGSSPILSEGSLPALLHLCSEVAPSTTKGWPE 3497
                PG++  PG       PG+D PP P G         +P       E  P    G P 
Sbjct: 92   TRGPPGASGYPGNPGLPGIPGQDGPPGPPG---------IPGCNGTKGERGPLGPPGLPG 142

Query: 3498 TLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGDCALDGALERPENEASPG 3557
                P  P    ++G          P   L   P  L   +G+    G    P     PG
Sbjct: 143  FAGNPGPPGLPGMKG---------DPGEILGHVPGMLL--KGERGFPGIPGTPGPPGLPG 191

Query: 3558 SPGPLLQQALPLGASLP--RPGARGQDAEGKRAPLVFSGKRRAPGARGRCAPDHFQEDHL 3615
              GP+     P G + P   PG  G   E  +  L F G +   G +G   P        
Sbjct: 192  LQGPV----GPPGFTGPPGPPGPPGPPGEKGQMGLSFQGPKGDKGDQGVSGPPGVPGQAQ 247

Query: 3616 LQKEKEVSSSHMVSEGGP------RGTFHKGSATKPAGCQSSSKDRSAASTPSKALKFPV 3669
            +Q++ + ++     + G        G   KG   KP       KD       S    FP 
Sbjct: 248  VQEKGDFATKGEKGQKGEPGFQGMPGVGEKGEPGKPGPRGKPGKDGDKGEKGSPG--FPG 305

Query: 3670 HPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQL 3729
             P        PG + R    G K       PGP     G+   G K   G +  P +   
Sbjct: 306  EPG------YPGLIGRQGPQGEKGEA--GPPGPPGIVIGTGPLGEK---GERGYPGTPGP 354

Query: 3730 QSETATTPAKPSFPS--RSPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPKEKGESST 3787
            + E    P    FP     P P  LP   QA      P E GE+G  G  G    G S  
Sbjct: 355  RGE----PGPKGFPGLPGQPGPPGLPVPGQA-GAPGFPGERGEKGDRGFPGTSLPGPSG- 408

Query: 3788 KRKKGQVPGPARSES-VGSFGRAPSAPDKPPRTPRKQATPSRVLPTKP 3834
               +  +PGP  S    G  G      +  P  P  Q  P   +P +P
Sbjct: 409  ---RDGLPGPPGSPGPPGQPGYTNGIVECQPGPPGDQGPPG--IPGQP 451



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 211/963 (21%), Positives = 292/963 (30%), Gaps = 229/963 (23%)

Query: 1684 GDSRPPQDVCLPEPSKQPGPQLDAG-----SLAKCSPDQELSFPKNKEAASSQESED--S 1736
            G   PP ++  P    QPG + D G      +A     Q       +  A  +  E    
Sbjct: 480  GPQGPPGEIGFPG---QPGAKGDRGLPGRDGVAGVPGPQGTPGLIGQPGAKGEPGEFYFD 536

Query: 1737 LRLLPCEQRGGFLPEPGTADQP-------HRGAPAPEAFGSPAVHLAPDLAFQGDGAPPL 1789
            LRL   +   GF  +PG   +        H G P P+  GSP       +  +G+  PP 
Sbjct: 537  LRLKGDKGDPGFPGQPGMTGRAGSPGRDGHPGLPGPK--GSPG-----SVGLKGERGPPG 589

Query: 1790 DATWPFGASPSHAAQGHSAGRAGGHLHPTAGRPGFEGNEFAPAGASS--LTAPRGREAWL 1847
               +P        ++G + G  G   +  AG  G +G    P G  S  L  P+G    +
Sbjct: 590  GVGFP-------GSRGDT-GPPGPPGYGPAGPIGDKGQAGFPGGPGSPGLPGPKGEPGKI 641

Query: 1848 VPVPSPACVSNT--------------------HPSRRSQDPALSPPIRQLQLPGPGVAKS 1887
            VP+P P                           P    +  A+  P   +  PGP   K 
Sbjct: 642  VPLPGPPGAEGLPGSPGFPGPQGDRGFPGTPGRPGLPGEKGAVGQP--GIGFPGPPGPKG 699

Query: 1888 KDGILGLQELTPAAQSPPRVNPSGLEGGT-VEGGKVACGPA-------------QGSPGG 1933
             DG+ G  ++ P   +P R   +GL G   V+G K   G                G+PG 
Sbjct: 700  VDGLPG--DMGPPG-TPGRPGFNGLPGNPGVQGQKGEPGVGLPGLKGLPGLPGIPGTPGE 756

Query: 1934 VQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTANQLQPENGVSPGGTDNHASVNAS 1993
                 +P V G    +   G  G+ G+       G+        G+ P G          
Sbjct: 757  KGSIGVPGVPGEHGAIGPPGLQGIRGEPGPPGLPGSVGS-PGVPGIGPPGARGPPGGQGP 815

Query: 1994 PKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPTPSPPSPNRESLALALTAAHSRSGSEG 2053
            P   L+GP          KG +          P    P P  +  A  L     +SG  G
Sbjct: 816  P--GLSGP-------PGIKGEKGFPGF-----PGLDMPGPKGDKGAQGLPGITGQSGLPG 861

Query: 2054 RTPERASSPGL--------NKPLLATGDSPAPSVGDLAACAPSPTSAAHMPCSLGPLPRE 2105
              P +  +PG+           ++ T   P          +P P  A  +P   G     
Sbjct: 862  -LPGQQGAPGIPGFPGSKGEMGVMGTPGQPG---------SPGPVGAPGLPGEKG--DHG 909

Query: 2106 DPLTSPSRAQGGLGGQ-----LPASPSCRDPPGPQQLLACSPAWAPLEEADGVQATTDTG 2160
             P +S  R   GL G      LP  P   D                +    G +      
Sbjct: 910  FPGSSGPRGDPGLKGDKGDVGLPGKPGSMDK-------------VDMGSMKGQKGDQGEK 956

Query: 2161 AEDSPVAPPSLTTSPCDPKEALAGCLLQGEGSPLEDPSSWPPGSVSAVTCTHSGDTPKDS 2220
             +  P+        P  P            G P +D  +  PG             PK  
Sbjct: 957  GQIGPIGEKGSRGDPGTP------------GVPGKDGQAGQPGQPG----------PKG- 993

Query: 2221 TLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRATGLSSTPTGDEAQAGRGLPG-PD 2279
                            PG + +P   G   P  +V   GL  TP        +G+PG P 
Sbjct: 994  ---------------DPGISGTPGAPGLPGPKGSVGGMGLPGTP------GEKGVPGIPG 1032

Query: 2280 PQSRGAPPHTNPDRMPRGHSSYSPSNTARL-GHREGQAVTAVPTEPPTLQGAG------- 2331
            PQ     P     +  +G +         L G +  Q +   P  P      G       
Sbjct: 1033 PQGSPGLPGDKGAKGEKGQAGPPGIGIPGLRGEKGDQGIAGFPGSPGEKGEKGSIGIPGM 1092

Query: 2332 PDSPACLEGEMGTSSKEPEDPGTP-ETGRSGATKMPRVTCPSTGLGLGRTTAPSSTASDF 2390
            P SP  L+G  G S   P  PG P E G  G   +  +       GL  T  P+  A   
Sbjct: 1093 PGSPG-LKGSPG-SVGYPGSPGLPGEKGDKGLPGLDGIPGVKGEAGLPGTPGPTGPAG-- 1148

Query: 2391 QSDSPQSHRNASHQTPQGDPLGPQDLKQRSRGYKKKPASTENGQWKGQAPHGPVTCEVCA 2450
            Q   P S         +G+P  P       RG+   P +  +   KG         EV  
Sbjct: 1149 QKGEPGSDGIPGSAGEKGEPGLP------GRGFPGFPGAKGDKGSKG---------EVGF 1193

Query: 2451 ASFRSGPGLSRHKARK-------HRPHPGAPAEPSPAAL-------PAQQP-LEPLAQKC 2495
                  PG+   K  +        +  PG P  P  A         P  QP L  L    
Sbjct: 1194 PGLAGSPGIPGSKGEQGFMGPPGPQGQPGLPGSPGHATEGPKGDRGPQGQPGLPGLPGPM 1253

Query: 2496 QPP----------RKKSHRVSGKERPNHSRGDPSHVTQP-----PPAQGSKEVLRAPGSP 2540
             PP           K +    G       +GDP     P     P   GSK  +  PG P
Sbjct: 1254 GPPGLPGIDGVKGDKGNPGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGPPGVP 1313

Query: 2541 HSQ 2543
              Q
Sbjct: 1314 GFQ 1316



 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 115/483 (23%), Positives = 150/483 (31%), Gaps = 70/483 (14%)

Query: 3413 LRGGRQP---FAFRGVRRP-GAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGS 3468
            L+G R P     F G R   G PG       G +  K +    PG    PG   P P+G 
Sbjct: 581  LKGERGPPGGVGFPGSRGDTGPPGPPGYGPAGPIGDKGQ-AGFPGGPGSPG--LPGPKGE 637

Query: 3469 S----PILSEGSLPALLHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPP 3524
                 P+        L        P   +G+P T  RP            LP        
Sbjct: 638  PGKIVPLPGPPGAEGLPGSPGFPGPQGDRGFPGTPGRP-----------GLPGEKGAVGQ 686

Query: 3525 PSLS----PFPAALADGRGDCALDGALERPENEASPGSPGPLLQQALPLGASLP----RP 3576
            P +     P P  +    GD    G   RP     PG+PG   Q+  P G  LP     P
Sbjct: 687  PGIGFPGPPGPKGVDGLPGDMGPPGTPGRPGFNGLPGNPGVQGQKGEP-GVGLPGLKGLP 745

Query: 3577 GARG-QDAEGKRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRG 3635
            G  G     G++  +   G    PG  G   P   Q   +  +         V   G  G
Sbjct: 746  GLPGIPGTPGEKGSIGVPG---VPGEHGAIGPPGLQ--GIRGEPGPPGLPGSVGSPGVPG 800

Query: 3636 TFHKGSATKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPAT 3695
                G+   P G               K   FP  P    G   PG        G+    
Sbjct: 801  IGPPGARGPPGGQGPPGLSGPPGIKGEKG--FPGFP----GLDMPGPKGDKGAQGL---- 850

Query: 3696 PKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPAR 3755
                PG + Q      PG +   G    P S + +     TP +P     SP P   P  
Sbjct: 851  ----PGITGQSGLPGLPGQQGAPGIPGFPGS-KGEMGVMGTPGQPG----SPGPVGAPGL 901

Query: 3756 AQAKSCTKGPREAGEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDK 3815
                     P E G+ G  GS GP  +G+   K  KG V  P +  S+           K
Sbjct: 902  ---------PGEKGDHGFPGSSGP--RGDPGLKGDKGDVGLPGKPGSMDKVDMGSMKGQK 950

Query: 3816 PPRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRPLLR 3875
              +  + Q  P   +  K        P  P  + +  +PG    K   G +   G P L 
Sbjct: 951  GDQGEKGQIGP---IGEKGSRGDPGTPGVPGKDGQAGQPGQPGPKGDPGISGTPGAPGLP 1007

Query: 3876 PPK 3878
             PK
Sbjct: 1008 GPK 1010



 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 304/1293 (23%), Positives = 398/1293 (30%), Gaps = 274/1293 (21%)

Query: 1678 GLCQAEGDSRPPQDVCLPEPSKQPGPQLDAGSLAKC-------SPDQELSFPKNKEA-AS 1729
            GL   +G   PP     P P   PGP  + G +            DQ +S P      A 
Sbjct: 188  GLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGLSFQGPKGDKGDQGVSGPPGVPGQAQ 247

Query: 1730 SQESEDSLRLLPCEQRG--GFLPEPGTADQPHRGAPAPEA----------FGSPAVHLAP 1777
             QE  D        Q+G  GF   PG  ++   G P P             GSP     P
Sbjct: 248  VQEKGDFATKGEKGQKGEPGFQGMPGVGEKGEPGKPGPRGKPGKDGDKGEKGSPGFPGEP 307

Query: 1778 DL----------AFQGDGAPPLDATWPFGASPSHAAQGHSAGRAGGHLHPTAGRPGFEGN 1827
                          +G+  PP       G  P         G  G   +P  G PG  G 
Sbjct: 308  GYPGLIGRQGPQGEKGEAGPPGPPGIVIGTGP--------LGEKGERGYP--GTPGPRG- 356

Query: 1828 EFAPAGASSLTAPRGREAWLVPVPSPACVSNTHPSRRSQ-------DPALSPPIRQLQLP 1880
            E  P G   L    G     +PVP  A      P  R +         +L  P  +  LP
Sbjct: 357  EPGPKGFPGLPGQPGPPG--LPVPGQAGAPG-FPGERGEKGDRGFPGTSLPGPSGRDGLP 413

Query: 1881 G-------PGVAKSKDGILGLQELTPAAQSPP----------RVNPSGLEGGT-----VE 1918
            G       PG     +GI+  Q   P  Q PP           +   G +G +     ++
Sbjct: 414  GPPGSPGPPGQPGYTNGIVECQPGPPGDQGPPGIPGQPGFIGEIGEKGQKGESCLICDID 473

Query: 1919 GGKVACGPAQGSPGGVQVTTLPAVAGHQLGLEA----------DGHWGLLGQAEKTQGQG 1968
            G +   GP QG PG +     P   G + GL             G  GL+GQ       G
Sbjct: 474  GYRGPPGP-QGPPGEIGFPGQPGAKGDR-GLPGRDGVAGVPGPQGTPGLIGQPGAKGEPG 531

Query: 1969 --------TANQLQPENGVSPGGTDNHASVNASPKTALTGP--TEGAVLLEKCKGSRAAM 2018
                      ++  P     PG T    S        L GP  + G+V L+  +G    +
Sbjct: 532  EFYFDLRLKGDKGDPGFPGQPGMTGRAGSPGRDGHPGLPGPKGSPGSVGLKGERGPPGGV 591

Query: 2019 SLQEEAEPTPSPPSPNRESLALALTAAHSRSGSEGRT--PERASSPGLNKPLLATGDSPA 2076
                    T  PP P     A  +       G +G+   P    SPGL  P    G    
Sbjct: 592  GFPGSRGDT-GPPGPPGYGPAGPI-------GDKGQAGFPGGPGSPGLPGPKGEPGK--- 640

Query: 2077 PSVGDLAACAPSPTSAAHMPCSLG-PLPREDPLTSPSRAQGGLGGQLPA----SPSCRDP 2131
                      P P  A  +P S G P P+ D     +  + GL G+  A          P
Sbjct: 641  ------IVPLPGPPGAEGLPGSPGFPGPQGDRGFPGTPGRPGLPGEKGAVGQPGIGFPGP 694

Query: 2132 PGPQQLLACSPAWAPLEEADGVQATTDTGAEDSPVAP--------PSLTTSPCDPKEALA 2183
            PGP+ +             DG+    D G   +P  P        P +     +P   L 
Sbjct: 695  PGPKGV-------------DGLPG--DMGPPGTPGRPGFNGLPGNPGVQGQKGEPGVGLP 739

Query: 2184 GCLLQG-------EGSPLEDPSSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWES 2236
            G  L+G        G+P E  S   PG    V   H    P      I  +     L  S
Sbjct: 740  G--LKGLPGLPGIPGTPGEKGSIGVPG----VPGEHGAIGP-PGLQGIRGEPGPPGLPGS 792

Query: 2237 PGRATSPPLA--GAVSPSVAVRATGLSSTP-----TGDEAQAGRGLPGP--DPQSRGAPP 2287
             G    P +   GA  P       GLS  P      G     G  +PGP  D  ++G P 
Sbjct: 793  VGSPGVPGIGPPGARGPPGGQGPPGLSGPPGIKGEKGFPGFPGLDMPGPKGDKGAQGLPG 852

Query: 2288 HTNPDRMP-RGHSSYSPSNTARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSS 2346
             T    +P       +P      G +    V   P +P +    GP     L GE G   
Sbjct: 853  ITGQSGLPGLPGQQGAPGIPGFPGSKGEMGVMGTPGQPGS---PGPVGAPGLPGEKG--- 906

Query: 2347 KEPEDPGTPETGRSGATKMPRVTCPSTGLGLGRTTAPSSTASDFQSD--SPQSHRNASHQ 2404
                D G P  G SG    P +      +GL     P    S  + D  S +  +    +
Sbjct: 907  ----DHGFP--GSSGPRGDPGLKGDKGDVGL-----PGKPGSMDKVDMGSMKGQKGDQGE 955

Query: 2405 TPQGDPLGPQDLKQRSRGYKKKPA----STENGQWKGQAPHG-PVTCEVCAASFRSGP-- 2457
              Q  P+G    ++ SRG    P       + GQ     P G P       A    GP  
Sbjct: 956  KGQIGPIG----EKGSRGDPGTPGVPGKDGQAGQPGQPGPKGDPGISGTPGAPGLPGPKG 1011

Query: 2458 ---GLSRHKARKHRPHPGAPAEPSPAALPAQQPLEPLAQKCQPPRKKSHRVSGKERPNHS 2514
               G+        +  PG P       LP  +  +    +  PP      + G++     
Sbjct: 1012 SVGGMGLPGTPGEKGVPGIPGPQGSPGLPGDKGAKGEKGQAGPPGIGIPGLRGEKGDQGI 1071

Query: 2515 RGDPSHVTQPPPAQGSKEVLRAPGSPHSQQL--------HPPSP--TEHEVDVKTPASKP 2564
             G P      P  +G K  +  PG P S  L        +P SP     + D   P    
Sbjct: 1072 AGFPG----SPGEKGEKGSIGIPGMPGSPGLKGSPGSVGYPGSPGLPGEKGDKGLPGLDG 1127

Query: 2565 RPDQAREDELHPKQAEKREGRRWRREPTVDSPSHSEGKSNKKRGKLRGRRLREESILPVS 2624
             P    E  L P           + EP  D    S G+  +     RG         P  
Sbjct: 1128 IPGVKGEAGL-PGTPGPTGPAGQKGEPGSDGIPGSAGEKGEPGLPGRG--------FPGF 1178

Query: 2625 ADVISDGRGSRPSPAMASYAASPSHCLSVEGGPEADGEQ----PPRLATLGPGVMEGAAE 2680
                 D +GS+        A SP       G P + GEQ    PP     GP    G   
Sbjct: 1179 PGAKGD-KGSKGEVGFPGLAGSP-------GIPGSKGEQGFMGPP-----GPQGQPGLPG 1225

Query: 2681 TDQEAL--CAGETGAQKPPGDRMLCPGRMDGAALG--EQPTGQKG----ASARGFWGPRE 2732
            +   A     G+ G Q  PG   L PG M    L   +   G KG      A G  GP+ 
Sbjct: 1226 SPGHATEGPKGDRGPQGQPGLPGL-PGPMGPPGLPGIDGVKGDKGNPGWPGAPGVPGPKG 1284

Query: 2733 TKALGVCKESGSEPAEDSSRAHSRSEEGVWEENTPP-----LGPLGFPETSSSPADSTTS 2787
                      G  P    S+           +  PP      GP G P       D    
Sbjct: 1285 DPGFQGMPGIGGSPGITGSKG----------DMGPPGVPGFQGPKGLPGLQGIKGDQGDQ 1334

Query: 2788 SC--LQGLPDNPDTQG---------GVQGPEGP 2809
                 +GLP  P   G         G+ GPEGP
Sbjct: 1335 GVPGAKGLPGPPGPPGPYDIIKGEPGLPGPEGP 1367



 Score = 43.5 bits (101), Expect = 0.004
 Identities = 123/511 (24%), Positives = 156/511 (30%), Gaps = 110/511 (21%)

Query: 1068 SESEEDEQPPPRGPGFRGRRGRGEKRKEVELTQGPREDEPQKPRKAARQEAGGDGAPANP 1127
            ++ E     PP  PGF G  G         +   P E     P    + E G  G P  P
Sbjct: 128  TKGERGPLGPPGLPGFAGNPGPPGLPG---MKGDPGEILGHVPGMLLKGERGFPGIPGTP 184

Query: 1128 EEPG-----GSRPGPGRSPQARGPSRSLETGAAAREG----GPKCADRPSVAPKDPLQVP 1178
              PG     G    PG +     P      G   + G    GPK  D+       P  VP
Sbjct: 185  GPPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGLSFQGPK-GDKGDQGVSGPPGVP 243

Query: 1179 TNTETSEETRPSLDFPQEAKEPETAE---ESAPDSTEFTEALRSPPAACAGEMGAS---- 1231
               +  E+     DF  + ++ +  E   +  P   E  E  +  P    G+ G      
Sbjct: 244  GQAQVQEKG----DFATKGEKGQKGEPGFQGMPGVGEKGEPGKPGPRGKPGKDGDKGEKG 299

Query: 1232 ----------PGLLIPEQPPPSRHDTGTPKPSGSLANTAP---HGSSPTPGVGSLLGGPG 1278
                      PGL+  + P   + + G P P G +  T P    G    PG     G PG
Sbjct: 300  SPGFPGEPGYPGLIGRQGPQGEKGEAGPPGPPGIVIGTGPLGEKGERGYPGTPGPRGEPG 359

Query: 1279 GTQAPVSHNSKDPPARQ-PGEFLAPVANPSSTACPKPSVLSSKISSFGCDPAGFNRDPLG 1337
                P       PP    PG+  AP           P     K         GF    L 
Sbjct: 360  PKGFPGLPGQPGPPGLPVPGQAGAP---------GFPGERGEK------GDRGFPGTSLP 404

Query: 1338 VPVAKKG-PQPYSSPHSELFLGPKDLAGCF--LEELHPKPSARDAPPA------------ 1382
             P  + G P P  SP      GP    G    + E  P P     PP             
Sbjct: 405  GPSGRDGLPGPPGSP------GPPGQPGYTNGIVECQPGPPGDQGPPGIPGQPGFIGEIG 458

Query: 1383 -----SSSCLCQDGEDAGSLEPQLPRSPPGTAETEPGRAASPPTLESSSLFPDLPVDRFD 1437
                   SCL  D +  G   P  P+ PPG     PG+             P    DR  
Sbjct: 459  EKGQKGESCLICDID--GYRGPPGPQGPPGEIGF-PGQ-------------PGAKGDRGL 502

Query: 1438 PPLYGSLSANRDSGLPFACADPPQKTVPSDPPYPSFLLLEEVSPMLPSHFPDLSGGKVLS 1497
            P   G        G P     P  K  P +  +   L  ++  P  P   P ++G     
Sbjct: 503  PGRDGVAGVPGPQGTPGLIGQPGAKGEPGEFYFDLRLKGDKGDPGFPGQ-PGMTG----- 556

Query: 1498 KTCPPERTVVPG--AAPSLPG-KGSGCSVAL 1525
                  R   PG    P LPG KGS  SV L
Sbjct: 557  ------RAGSPGRDGHPGLPGPKGSPGSVGL 581



 Score = 42.4 bits (98), Expect = 0.009
 Identities = 73/293 (24%), Positives = 95/293 (32%), Gaps = 49/293 (16%)

Query: 509 GGPEWQG--GSQGALGTAGKTPGPREKLPAVRSSQG--------GSPALFTYNGMTDPGA 558
           G P  QG  G QG  G  G T  P   LP  + ++G        G+P L    G   P  
Sbjct: 61  GFPGMQGPEGPQGPPGQKGDTGEPG--LPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPG 118

Query: 559 QPLFFGV--AQPQVSPHGTPSLP-------PPRVVG--ASPSESPLPSPATNTAGSTCSS 607
            P   G    + +  P G P LP       PP + G    P E     P     G     
Sbjct: 119 PPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGERGFP 178

Query: 608 LSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTHYQPEPAK 667
             P +  P         L GP+GP  F  PP  P   G P P  E      +   P+  K
Sbjct: 179 GIPGTPGPPGLPG----LQGPVGPPGFTGPPGPP---GPPGPPGEKGQMGLSFQGPKGDK 231

Query: 668 AFPFPADGLGAEGAFQCLEETPFPHEGP--EVGRGGLQGFP----RAPPPYPTHHFSLSS 721
                +   G  G  Q  E+  F  +G   + G  G QG P    +  P  P        
Sbjct: 232 GDQGVSGPPGVPGQAQVQEKGDFATKGEKGQKGEPGFQGMPGVGEKGEPGKPGPRGKPG- 290

Query: 722 ASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLP 774
                       +  D+       F     + GL+  +   G +   GPPG P
Sbjct: 291 ------------KDGDKGEKGSPGFPGEPGYPGLIGRQGPQGEKGEAGPPGPP 331



 Score = 37.7 bits (86), Expect = 0.23
 Identities = 85/349 (24%), Positives = 111/349 (31%), Gaps = 30/349 (8%)

Query: 3531 PAALADGRGDCALDGALERPENEASPGSPGPLLQQALPLGASLP-RPGARGQDAEGKRAP 3589
            P      RGD    G   +      PG PGP     +      P  PG +G    G   P
Sbjct: 961  PIGEKGSRGDPGTPGVPGKDGQAGQPGQPGPKGDPGISGTPGAPGLPGPKG-SVGGMGLP 1019

Query: 3590 LVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQ 3649
                G++  PG  G         D   + EK  +    +   G RG           G  
Sbjct: 1020 GT-PGEKGVPGIPGPQGSPGLPGDKGAKGEKGQAGPPGIGIPGLRGEKGDQGIAGFPGSP 1078

Query: 3650 SSSKDRSAASTPSKALKFPVHP--RKAVGSLA-PGELARGTENGMKPATP-KAKPGPSSQ 3705
                ++ +   P      P  P  + + GS+  PG      E G K        PG   +
Sbjct: 1079 GEKGEKGSIGIPG----MPGSPGLKGSPGSVGYPGSPGLPGEKGDKGLPGLDGIPGVKGE 1134

Query: 3706 GSGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGP 3765
                  PG     G + +P S  +   +A    +P  P R       P    AK      
Sbjct: 1135 AGLPGTPGPTGPAGQKGEPGSDGIPG-SAGEKGEPGLPGRG-----FPGFPGAKGDKGSK 1188

Query: 3766 REAGEQGPHGSLG-PKEKGESSTKRKKGQVPGPARSESV-GSFGRAPSAPDKPPRTPRKQ 3823
             E G  G  GS G P  KGE          PGP     + GS G A   P K  R P+ Q
Sbjct: 1189 GEVGFPGLAGSPGIPGSKGEQGFMGP----PGPQGQPGLPGSPGHATEGP-KGDRGPQGQ 1243

Query: 3824 ATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRP 3872
                  LP  P P     P  P  +  K + G+       G   P+G P
Sbjct: 1244 PG----LPGLPGP--MGPPGLPGIDGVKGDKGNPGWPGAPGVPGPKGDP 1286



 Score = 37.0 bits (84), Expect = 0.39
 Identities = 119/525 (22%), Positives = 156/525 (29%), Gaps = 119/525 (22%)

Query: 3428 PGAPGQKA----RALEGT-LPSKRRRVAMPGSA-------------------PGPGEDRP 3463
            PG PG++     R   GT LP    R  +PG                     PGP  D+ 
Sbjct: 384  PGFPGERGEKGDRGFPGTSLPGPSGRDGLPGPPGSPGPPGQPGYTNGIVECQPGPPGDQG 443

Query: 3464 PPR--GSSPILSE-------GSLPALLHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCE 3514
            PP   G    + E       G    +  +     P   +G P  +  P  P     RG  
Sbjct: 444  PPGIPGQPGFIGEIGEKGQKGESCLICDIDGYRGPPGPQGPPGEIGFPGQPGAKGDRGLP 503

Query: 3515 LPSNHQECPPPSLSP----------------FPAALADGRGDCA------LDGALERPEN 3552
                    P P  +P                F   L   +GD        + G    P  
Sbjct: 504  GRDGVAGVPGPQGTPGLIGQPGAKGEPGEFYFDLRLKGDKGDPGFPGQPGMTGRAGSPGR 563

Query: 3553 EASPGSPGPLLQQALPLGASLPRPGARGQDAEGKRAPLVFSGKRRAPGARGRCAPDHFQE 3612
            +  PG PGP              PG+ G   +G+R P    G    PG+RG   P     
Sbjct: 564  DGHPGLPGP-----------KGSPGSVG--LKGERGP---PGGVGFPGSRGDTGP----- 602

Query: 3613 DHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSAASTPSKALKFPVHPR 3672
                               GP G   KG A  P G  S          P K +  P  P 
Sbjct: 603  ----------PGPPGYGPAGPIG--DKGQAGFPGGPGSPGLP-GPKGEPGKIVPLPGPPG 649

Query: 3673 KAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSE 3732
                  +PG      + G  P TP  +PG   +     +PG    G   P+   G L  +
Sbjct: 650  AEGLPGSPGFPGPQGDRGF-PGTP-GRPGLPGEKGAVGQPGIGFPGPPGPKGVDG-LPGD 706

Query: 3733 TAT--TPAKPSFPSRSPAP----------ERLPARAQAKSCTKGPREAGEQ--------- 3771
                 TP +P F      P            LP           P   GE+         
Sbjct: 707  MGPPGTPGRPGFNGLPGNPGVQGQKGEPGVGLPGLKGLPGLPGIPGTPGEKGSIGVPGVP 766

Query: 3772 GPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPP--RTPRKQATPSRV 3829
            G HG++GP   G    + + G    P    S G  G  P     PP  + P   + P  +
Sbjct: 767  GEHGAIGP--PGLQGIRGEPGPPGLPGSVGSPGVPGIGPPGARGPPGGQGPPGLSGPPGI 824

Query: 3830 LPTKPKPNSQNKPRPPPSEQRKAE--PGHTQRKDRLGKAFPQGRP 3872
               K  P       P P   + A+  PG T +    G    QG P
Sbjct: 825  KGEKGFPGFPGLDMPGPKGDKGAQGLPGITGQSGLPGLPGQQGAP 869



 Score = 35.8 bits (81), Expect = 0.86
 Identities = 46/186 (24%), Positives = 59/186 (31%), Gaps = 17/186 (9%)

Query: 1237 PEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSLLGGPG--GTQAPVSHNSKDPPAR 1294
            P+ PP  + DTG P   G+     P G+S  PG   L G PG  G   P      +    
Sbjct: 71   PQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKG 130

Query: 1295 QPGEFLAPVANPSSTACPKPSVLSSKISS----FGCDPAGFNRDPLGVPVAKKGPQPYSS 1350
            + G  L P   P     P P  L           G  P    +   G P     P P   
Sbjct: 131  ERGP-LGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGERGFPGIPGTPGPPGL 189

Query: 1351 PHSELFLGPKDLAGCFLEELHPKPSARDAPPASSSCLCQDGE----DAGSLEPQLPRSPP 1406
            P  +  +GP    G       P P     PP     +    +    D G      P   P
Sbjct: 190  PGLQGPVGPPGFTG------PPGPPGPPGPPGEKGQMGLSFQGPKGDKGDQGVSGPPGVP 243

Query: 1407 GTAETE 1412
            G A+ +
Sbjct: 244  GQAQVQ 249



 Score = 33.5 bits (75), Expect = 4.3
 Identities = 50/203 (24%), Positives = 67/203 (33%), Gaps = 36/203 (17%)

Query: 3686 GTENGMKPATPKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFP-- 3743
            GT+    P  P   PG +        PG K   G       G L       P  P  P  
Sbjct: 127  GTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGERGFPGIPGTPGP 186

Query: 3744 ---------------SRSPAPERLPA----RAQAKSCTKGPREAGEQGPHGSLGP----- 3779
                           +  P P   P     + Q     +GP+  G++G  G  GP     
Sbjct: 187  PGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGLSFQGPK--GDKGDQGVSGPPGVPG 244

Query: 3780 ----KEKGESSTKRKKGQ--VPGPARSESVGSFGR--APSAPDKPPRTPRKQATPSRVLP 3831
                +EKG+ +TK +KGQ   PG      VG  G    P    KP +   K    S   P
Sbjct: 245  QAQVQEKGDFATKGEKGQKGEPGFQGMPGVGEKGEPGKPGPRGKPGKDGDKGEKGSPGFP 304

Query: 3832 TKPKPNSQNKPRPPPSEQRKAEP 3854
             +P        + P  E+ +A P
Sbjct: 305  GEPGYPGLIGRQGPQGEKGEAGP 327



 Score = 32.3 bits (72), Expect = 9.5
 Identities = 57/220 (25%), Positives = 73/220 (33%), Gaps = 45/220 (20%)

Query: 2325 PTLQGA-GPDSPACLEGEMGTSSKEPEDPGTPET-GRSGATKMPRVTCPSTGLGLGRTTA 2382
            P +QG  GP  P   +G+ G    EP  PGT  T G  GA+  P           G    
Sbjct: 63   PGMQGPEGPQGPPGQKGDTG----EPGLPGTKGTRGPPGASGYP-----------GNPGL 107

Query: 2383 PSSTASDFQSDSPQSHRNASHQTPQGDPLGPQDLKQRSRGYKKKPASTENGQWKGQAPHG 2442
            P     D     P      +    +  PLGP  L     G+   P        KG    G
Sbjct: 108  PGIPGQD-GPPGPPGIPGCNGTKGERGPLGPPGLP----GFAGNPGPPGLPGMKGDP--G 160

Query: 2443 PVTCEVCAASFRSGPGLSRHKARKHRPHPGAPAEPSPAALPA-QQPLEPLA--------Q 2493
             +   V        PG+     +  R  PG P  P P  LP  Q P+ P           
Sbjct: 161  EILGHV--------PGML---LKGERGFPGIPGTPGPPGLPGLQGPVGPPGFTGPPGPPG 209

Query: 2494 KCQPPRKKSHRVSGKERPNHSRGDPSHVTQPPPAQGSKEV 2533
               PP +K       + P   +GD   V+ PP   G  +V
Sbjct: 210  PPGPPGEKGQMGLSFQGPKGDKGDQG-VSGPPGVPGQAQV 248


>gi|15890086 type IV collagen alpha 5 isoform 2 precursor [Homo
            sapiens]
          Length = 1691

 Score =  102 bits (253), Expect = 1e-20
 Identities = 312/1322 (23%), Positives = 413/1322 (31%), Gaps = 280/1322 (21%)

Query: 28   GHPSQPPLEDNTPATRTTKGAREAGGQAQAMELPEAQPRQARDGELKPPSLRGQ------ 81
            G P  P L    P T  T G +   G      LP  +  +   G   PP L G       
Sbjct: 337  GPPGPPGLVIPRPGTGITIGEK---GNIGLPGLPGEKGERGFPGIQGPPGLPGPPGAAVM 393

Query: 82   ---APSSTPGKRGSP--QTPPGRSPLQAPSRLAGRAEGSPPQRYILGIASSRTKPTLDE- 135
                P   PG+RG    + PPG S +  P  L G+  G+P      G A     P+ DE 
Sbjct: 394  GPPGPPGFPGERGQKGDEGPPGIS-IPGPPGLDGQP-GAPGLPGPPGPAGPHIPPS-DEI 450

Query: 136  ----------TPENPQLEAAQLPEVDTPQ------GPG-TGAPLRPGLPRTEAQPAAEEL 178
                      +P +  L+  Q  + D         G G +G P +PGLP     P +  L
Sbjct: 451  CEPGPPGPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGISGPPGQPGLPGLPGPPGS--L 508

Query: 179  GFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPA 238
            GF     E   +  +     P     P APG P S+G    +PG    +     D     
Sbjct: 509  GFPGQKGEKGQAGATGPKGLPGIPGAPGAPGFPGSKG----EPGDILTFPGMKGDK---- 560

Query: 239  AENSFPGANFGVP--PAEP--EPIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPADVAG 294
             E   PGA  G+P  P  P  + +P    P G P G++F+       G    P    + G
Sbjct: 561  GELGSPGAP-GLPGLPGTPGQDGLPGLPGPKGEPGGITFK-------GERGPPGNPGLPG 612

Query: 295  HAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPGGLNRHSDLSGA 354
                 GP+      P G  P   VG      +   P    +P  +G PG         G 
Sbjct: 613  LPGNIGPM-----GPPGFGPPGPVGEKGIQGVAGNPGQPGIPGPKGDPGQTITQPGKPGL 667

Query: 355  LSSPGAAHSAPRPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRAS 414
              +PG       P    L        P +P     G+  ++G P  +P    PG      
Sbjct: 668  PGNPGRDGDVGLPGDPGL--------PGQP--GLPGIPGSKGEPG-IPGIGLPGPP-GPK 715

Query: 415  GVDTSPGPPDTELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPS-PGQR 473
            G    PGPP     APG P  R+     P    +P P G P  A       G P  PG +
Sbjct: 716  GFPGIPGPP----GAPGTP-GRIGLEGPPGPPGFPGPKGEPGFALPGP--PGPPGLPGFK 768

Query: 474  LCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAG--GPEWQGGSQGALGTAG----KT 527
              L       +P       P P G   L  LP P G  GP  Q G  G  G  G      
Sbjct: 769  GALGPKGDRGFP-----GPPGPPGRTGLDGLPGPKGDVGPNGQPGPMGPPGLPGIGVQGP 823

Query: 528  PGPREKLPAVRSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVG-- 585
            PGP                     G+  P  QP   G+   +  P G P L  P   G  
Sbjct: 824  PGPP--------------------GIPGPIGQPGLHGIPGEKGDP-GPPGLDVPGPPGER 862

Query: 586  ASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETG 645
             SP     P P           + P  S      +  S  PG  G      PP  P   G
Sbjct: 863  GSPGIPGAPGP-----------IGPPGSPGLPGKAGASGFPGTKGEMGMMGPPGPPGPLG 911

Query: 646  SPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGF 705
             P  S  P        Q +P    P P    G++G    L   P P +   +G  G +G 
Sbjct: 912  IPGRSGVPGLKGDDGLQGQPG--LPGPTGEKGSKGE-PGLPGPPGPMDPNLLGSKGEKGE 968

Query: 706  PRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQ 765
            P  P                                 +      + + GL     + G  
Sbjct: 969  PGLP--------------------------------GIPGVSGPKGYQGLPGDPGQPGLS 996

Query: 766  RSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGD---AQAEGKDDPLRTGFLPSLAA 822
              PG PG P P   P +P     GL+         GD      +G + P     +P    
Sbjct: 997  GQPGLPGPPGPKGNPGLP--GQPGLIGPPGLKGTIGDMGFPGPQGVEGPPGPSGVPGQPG 1054

Query: 823  TPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSG 882
            +P  LP    D + D  + S+    L G + +   P    +           G +G S G
Sbjct: 1055 SP-GLPGQKGD-KGDPGISSIGLPGLPGPKGEPGLPGYPGN----------PGIKG-SVG 1101

Query: 883  HPLKSKAGVTPESKAPPPLPA--ATPDPQTPR-----PGDRGCPARGRPKTRSLGLAPTE 935
             P       TP +K  P LP    TP P  P+     PG+ G P  G P     G  P +
Sbjct: 1102 DPGLPGLPGTPGAKGQPGLPGFPGTPGPPGPKGISGPPGNPGLP--GEPGPVGGGGHPGQ 1159

Query: 936  ADAPSQ----------GRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGL------- 978
               P +          G   ++G+  +    +    G    SG  G G   G+       
Sbjct: 1160 PGPPGEKGKPGQDGIPGPAGQKGEPGQPGFGNPGPPGLPGLSGQKGDGGLPGIPGNPGLP 1219

Query: 979  RPRRNDGLG-----ERPPPRPRRPRTQAPGSRADPAPRVPRAAALPEETRSSRRRRLPPR 1033
             P+   G       + PP  P  P     G + +P P+ P     P     +  + LP  
Sbjct: 1220 GPKGEPGFHGFPGVQGPPGPPGSPGPALEGPKGNPGPQGP-----PGRPGPTGFQGLPGP 1274

Query: 1034 KDPRKRKARGGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRGPGFRGRRGRGEKR 1093
            + P      GG  G                       E+     P  PG  G +G     
Sbjct: 1275 EGPPGLPGNGGIKG-----------------------EKGNPGQPGLPGLPGLKG----- 1306

Query: 1094 KEVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETG 1153
                  QGP   +    R       G  G P  P  PG    GP   P + GP       
Sbjct: 1307 -----DQGPPGLQGNPGRPGLNGMKGDPGLPGVPGFPG--MKGPSGVPGSAGP------- 1352

Query: 1154 AAAREGGPKCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEF 1213
                EG P       + P  P  +P  +  S   +     P    +P       P   + 
Sbjct: 1353 ----EGEPGL-----IGPPGPPGLPGPSGQSIIIKGDAGPPGIPGQPGLKGLPGPQGPQG 1403

Query: 1214 TEALRSPPA----------ACAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHG 1263
                  PP             AG     PGL  P Q P +R   G P P G      P G
Sbjct: 1404 LPGPTGPPGDPGRNGLPGFDGAGGRKGDPGL--PGQ-PGTRGLDGPPGPDGLQGPPGPPG 1460

Query: 1264 SS 1265
            +S
Sbjct: 1461 TS 1462



 Score = 86.3 bits (212), Expect = 6e-16
 Identities = 325/1384 (23%), Positives = 425/1384 (30%), Gaps = 260/1384 (18%)

Query: 2    PGERPR----GAP-PPTMTGDLQPRQVASSPGHPSQP--PLEDNTPATRTTKGAREAGGQ 54
            PG R +    G P PP   G   P  +   PG P  P  P  D  P  +   G     G+
Sbjct: 71   PGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQGIPGCNGTKGE 130

Query: 55   AQAMELPEAQPRQARDGELKPPSLRGQAPS----STPGKRGSP--QTPPGRSPLQAPSRL 108
                  P     Q   G    P ++G+  S    S PG +G+P    PPG   L  P+ +
Sbjct: 131  RGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGNPGYPGPPGIQGLPGPTGI 190

Query: 109  AGRAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPR 168
             G      P     G+      P L     N  L   Q P+ +  +    G P  PG   
Sbjct: 191  PGPIGPPGPP----GLMGPPGPPGLPGPKGNMGLNF-QGPKGEKGEQGLQGPPGPPGQIS 245

Query: 169  TEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPA----PGPPQSRGTSPLQPGSY 224
             + +P   E  F +  Q  P              P PP     PGPP        + G  
Sbjct: 246  EQKRPIDVE--FQKGDQGLPGD---------RGPPGPPGIRGPPGPPGGEKGEKGEQGEP 294

Query: 225  PEYQASGADSWPPAAENSFPGANFGVP-----PAEP-------------EPIPKG---SR 263
             +    G D      EN  PG   G+P     P EP              P P G    R
Sbjct: 295  GKRGKPGKDG-----ENGQPGIP-GLPGDPGYPGEPGRDGEKGQKGDTGPPGPPGLVIPR 348

Query: 264  PG-GSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQG--AWPEEAVGT 320
            PG G   G       P L G   +     + G     GP   A   P G   +P E    
Sbjct: 349  PGTGITIGEKGNIGLPGLPGEKGERGFPGIQGPPGLPGPPGAAVMGPPGPPGFPGERGQK 408

Query: 321  GPAYPLPTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKIL 380
            G   P P    P P P   GQPG         G    PG A                   
Sbjct: 409  GDEGP-PGISIPGP-PGLDGQPGA-------PGLPGPPGPAG------------------ 441

Query: 381  PERPPSAQDGLGSTRGPPSSLPQRHFPG-QAYRASGVDTSPGPPDTELAAPGPPPARLPQ 439
            P  PPS +       GPP S   +   G Q  +    DT      T ++ P   P  LP 
Sbjct: 442  PHIPPSDEICEPGPPGPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGISGPPGQPG-LPG 500

Query: 440  LWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPTARPSPHGME 499
            L        P PPG  L         GQ        LP     P     P ++  P  + 
Sbjct: 501  L--------PGPPGS-LGFPGQKGEKGQAGATGPKGLPGIPGAPGAPGFPGSKGEPGDI- 550

Query: 500  MLSRLPFPA-GGPEWQGGSQGALGTAGK--TPGPREKLPAVRSSQGGSPALFTYNGMTDP 556
                L FP   G + + GS GA G  G   TPG ++ LP +   +G  P   T+ G   P
Sbjct: 551  ----LTFPGMKGDKGELGSPGAPGLPGLPGTPG-QDGLPGLPGPKG-EPGGITFKGERGP 604

Query: 557  GAQPLFFGVAQPQVSPHGTPSLPPPRVVG--------ASPSESPLPSPATNTAGSTCSSL 608
               P   G+    + P G P   PP  VG         +P +  +P P  +   +     
Sbjct: 605  PGNPGLPGLPG-NIGPMGPPGFGPPGPVGEKGIQGVAGNPGQPGIPGPKGDPGQTITQPG 663

Query: 609  SPMSSSPANPSSE-ESQLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTHYQPEPAK 667
             P    P NP  + +  LPG  G       P  P   G P     P   LP    P+   
Sbjct: 664  KP--GLPGNPGRDGDVGLPGDPGLPGQPGLPGIPGSKGEP---GIPGIGLPGPPGPKGFP 718

Query: 668  AFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLSSASLDQL 727
              P P    G  G    LE  P P   P  G  G  GF    PP P              
Sbjct: 719  GIPGPPGAPGTPGRIG-LEGPPGPPGFP--GPKGEPGFALPGPPGPP------------- 762

Query: 728  DVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPADAH 787
                           L  F           A    G +  PGPPG P       +P    
Sbjct: 763  --------------GLPGFKG---------ALGPKGDRGFPGPPGPPGRTGLDGLPGPK- 798

Query: 788  AGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITE- 846
                         GD    G+  P+    LP +     P P           +   I + 
Sbjct: 799  -------------GDVGPNGQPGPMGPPGLPGIGVQGPPGPPG---------IPGPIGQP 836

Query: 847  ALNGMEYQSDNPEIDSSFIDVFADEEPS-------GPRGPSSGHPLKSKAGVT--PESKA 897
             L+G+  +  +P      +     E  S       GP GP     L  KAG +  P +K 
Sbjct: 837  GLHGIPGEKGDPGPPGLDVPGPPGERGSPGIPGAPGPIGPPGSPGLPGKAGASGFPGTKG 896

Query: 898  PPPLPAATPDPQTPR--PGDRGCPA-------RGRPKTRSLGLAPTEADAPSQGRQQRRG 948
               +    P P  P   PG  G P        +G+P     GL     +  S+G     G
Sbjct: 897  EMGM-MGPPGPPGPLGIPGRSGVPGLKGDDGLQGQP-----GLPGPTGEKGSKGEPGLPG 950

Query: 949  KQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERP--PPRPRRPRTQAP-GSR 1005
                +    L S G     G  G    SG  P+   GL   P  P    +P    P G +
Sbjct: 951  PPGPMDPNLLGSKGEKGEPGLPGIPGVSG--PKGYQGLPGDPGQPGLSGQPGLPGPPGPK 1008

Query: 1006 ADPA-PRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRLREY 1064
             +P  P  P     P    +      P  +         G  G+     +  QK    + 
Sbjct: 1009 GNPGLPGQPGLIGPPGLKGTIGDMGFPGPQGVEGPPGPSGVPGQPGSPGLPGQKGDKGDP 1068

Query: 1065 DFASESEEDEQPPPRG-------------------PGFRGRRGRGEKRKEVELTQGPRED 1105
              +S       P P+G                   PG  G  G    + +  L   P   
Sbjct: 1069 GISSIGLPG-LPGPKGEPGLPGYPGNPGIKGSVGDPGLPGLPGTPGAKGQPGLPGFPGTP 1127

Query: 1106 EPQKPRKAARQEAGGDGAPANPEEPG----GSRPGPGRSPQARG-PSRSLETGAAAREGG 1160
             P  P+  +    G  G P  P EPG    G  PG    P  +G P +    G A ++G 
Sbjct: 1128 GPPGPKGIS----GPPGNPGLPGEPGPVGGGGHPGQPGPPGEKGKPGQDGIPGPAGQKGE 1183

Query: 1161 PKCADRPSVAPKDPLQVP-TNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEALRS 1219
            P    +P      P  +P  + +  +   P +  P     P    E         +    
Sbjct: 1184 P---GQPGFGNPGPPGLPGLSGQKGDGGLPGI--PGNPGLPGPKGEPGFHGFPGVQGPPG 1238

Query: 1220 PPAACAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSLLGGPGG 1279
            PP +    +    G   P+ PP      G P P+G      P G    PG G + G  G 
Sbjct: 1239 PPGSPGPALEGPKGNPGPQGPP------GRPGPTGFQGLPGPEGPPGLPGNGGIKGEKGN 1292

Query: 1280 TQAP 1283
               P
Sbjct: 1293 PGQP 1296



 Score = 82.8 bits (203), Expect = 6e-15
 Identities = 173/692 (25%), Positives = 218/692 (31%), Gaps = 157/692 (22%)

Query: 1    MPGERPRGAPP----PTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQ 56
            +PGE+    PP    P   G+     +  +PG P  PP     P      G     G+  
Sbjct: 841  IPGEKGDPGPPGLDVPGPPGERGSPGIPGAPG-PIGPPGSPGLPGKAGASGFPGTKGEMG 899

Query: 57   AMELPEAQPRQARDGELKPPSLRGQ----------APSSTPGKRGSPQTPPGRSPLQAPS 106
             M  P         G    P L+G            P+   G +G P  P    P+  P+
Sbjct: 900  MMGPPGPPGPLGIPGRSGVPGLKGDDGLQGQPGLPGPTGEKGSKGEPGLPGPPGPMD-PN 958

Query: 107  RLAGRAE-GSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPG 165
             L  + E G P    I G++  +    L   P  P L     P +  P GP  G P  PG
Sbjct: 959  LLGSKGEKGEPGLPGIPGVSGPKGYQGLPGDPGQPGLSGQ--PGLPGPPGP-KGNPGLPG 1015

Query: 166  LPRTEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSY- 224
             P     P  +             +     +  P     PP P     +  SP  PG   
Sbjct: 1016 QPGLIGPPGLK------------GTIGDMGFPGPQGVEGPPGPSGVPGQPGSPGLPGQKG 1063

Query: 225  ----PEYQASGADSWP-PAAENSFPG--ANFGVPPAEPEPIPKGSRPG--GSPRGVSFQF 275
                P   + G    P P  E   PG   N G+  +  +P      PG  G+P G   Q 
Sbjct: 1064 DKGDPGISSIGLPGLPGPKGEPGLPGYPGNPGIKGSVGDP----GLPGLPGTP-GAKGQP 1118

Query: 276  PFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPL 335
              P   G    P P  ++G     G        P    P   VG G     P QP P   
Sbjct: 1119 GLPGFPGTPGPPGPKGISGPPGNPG-------LPGEPGP---VGGGGH---PGQPGP--- 1162

Query: 336  PCYQGQPG--GLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERPPSAQDGLGS 393
            P  +G+PG  G+   +   G    PG  +  P        +     LP  P     GL  
Sbjct: 1163 PGEKGKPGQDGIPGPAGQKGEPGQPGFGNPGPPGLPGLSGQKGDGGLPGIP--GNPGLPG 1220

Query: 394  TRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGPPPARLPQLWDPTAAPYPTPPG 453
             +G P       FPG            GPP       GPP +  P L  P   P P  P 
Sbjct: 1221 PKGEPGF---HGFPGVQ----------GPP-------GPPGSPGPALEGPKGNPGPQGPP 1260

Query: 454  GPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGP-- 511
            G                                     RP P G +    LP P G P  
Sbjct: 1261 G-------------------------------------RPGPTGFQ---GLPGPEGPPGL 1280

Query: 512  EWQGGSQGALGTAGKTPGPREKLPAVRSSQG-----GSPALFTYNGMT-DPG--AQPLFF 563
               GG +G  G  G+   P   LP ++  QG     G+P     NGM  DPG    P F 
Sbjct: 1281 PGNGGIKGEKGNPGQPGLP--GLPGLKGDQGPPGLQGNPGRPGLNGMKGDPGLPGVPGFP 1338

Query: 564  GVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEES 623
            G+  P   P        P ++G  P    LP P         S  S +    A P     
Sbjct: 1339 GMKGPSGVPGSAGPEGEPGLIG-PPGPPGLPGP---------SGQSIIIKGDAGPPGIPG 1388

Query: 624  Q-----LPGPLGPSAF---FHPPTHPQETGSP 647
            Q     LPGP GP        PP  P   G P
Sbjct: 1389 QPGLKGLPGPQGPQGLPGPTGPPGDPGRNGLP 1420



 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 315/1316 (23%), Positives = 396/1316 (30%), Gaps = 210/1316 (15%)

Query: 309  PQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPG--GLNRHSDLSGALSSPGA-AHSAP 365
            P+G   ++ +  GP  P   +  P  LP + G PG  G+  H    G    PG       
Sbjct: 73   PRGQKGDDGI-PGPPGPKGIRGPPG-LPGFPGTPGLPGMPGHDGAPGPQGIPGCNGTKGE 130

Query: 366  RPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDT 425
            R F  S         P  P     GL    GPP     +  PG    +S     PGP   
Sbjct: 131  RGFPGS---------PGFP-----GLQGPPGPPGIPGMKGEPGSIIMSS----LPGPKGN 172

Query: 426  ELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLP-------- 477
                PGPP   +  L  PT  P P  P GP          G P P   + L         
Sbjct: 173  P-GYPGPPG--IQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEK 229

Query: 478  -----QSAPLPWPQVLPTARP----------------SPHGMEMLSRLPFPAGGPEWQGG 516
                 Q  P P  Q+    RP                 P G   +   P P GG + + G
Sbjct: 230  GEQGLQGPPGPPGQISEQKRPIDVEFQKGDQGLPGDRGPPGPPGIRGPPGPPGGEKGEKG 289

Query: 517  SQGALGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTDPG--AQPLFFGVAQPQVSPHG 574
             QG  G  GK PG        +  + G P +    G  DPG   +P   G  + Q    G
Sbjct: 290  EQGEPGKRGK-PG--------KDGENGQPGIPGLPG--DPGYPGEPGRDG-EKGQKGDTG 337

Query: 575  TPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAF 634
             P   PP +V        +P P T   G T      +          E   PG  GP   
Sbjct: 338  PPG--PPGLV--------IPRPGT---GITIGEKGNIGLPGLPGEKGERGFPGIQGPPGL 384

Query: 635  FHPPTHPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEG 694
              PP      G P P   P        +  P  + P P  GL  +     L   P P  G
Sbjct: 385  PGPP-GAAVMGPPGPPGFPGERGQKGDEGPPGISIPGP-PGLDGQPGAPGLPGPPGP-AG 441

Query: 695  PEVGRGGLQGFPRAP-PPYPTHHFSLSSASLDQLDVLLTCRQC-------DRNYSSLAAF 746
            P +        P  P PP       L      + D   TC  C             L   
Sbjct: 442  PHIPPSDEICEPGPPGPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGISGPPGQPGLPGL 501

Query: 747  LAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPA-DAHAGLLSHAKTFL-LAGDAQ 804
                   G    + + G   + GP GLP  P AP  P      G      TF  + GD  
Sbjct: 502  PGPPGSLGFPGQKGEKGQAGATGPKGLPGIPGAPGAPGFPGSKGEPGDILTFPGMKGDKG 561

Query: 805  AEGKDDPLRTGFLPSLAATPFP--LPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDS 862
              G   P   G LP L  TP    LP       +   +         G      NP +  
Sbjct: 562  ELG--SPGAPG-LPGLPGTPGQDGLPGLPGPKGEPGGI------TFKGERGPPGNPGLPG 612

Query: 863  SFIDVFADEEPS-GPRGPSSGHPLKSKAGVTPESKAPPPLPAATPDP-----QTPRPGDR 916
               ++     P  GP GP     ++  AG    +   P +P    DP     Q  +PG  
Sbjct: 613  LPGNIGPMGPPGFGPPGPVGEKGIQGVAG----NPGQPGIPGPKGDPGQTITQPGKPGLP 668

Query: 917  GCPAR----GRPKTRSLGLAPTEADAP-SQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGG 971
            G P R    G P    L   P     P S+G     G  L          G     G+ G
Sbjct: 669  GNPGRDGDVGLPGDPGLPGQPGLPGIPGSKGEPGIPGIGLPGPPGPKGFPGIPGPPGAPG 728

Query: 972  GGRASGLRPRRNDGLGERPPPRPRRPRTQA-PGSRADPAPRVPRAAALPEETRSSRRRRL 1030
                 GL         E PP  P  P  +  PG      P  P              R  
Sbjct: 729  TPGRIGL---------EGPPGPPGFPGPKGEPGFALPGPPGPPGLPGFKGALGPKGDRGF 779

Query: 1031 PPRKDPRKRKARGGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRGPGFRGRRGRG 1090
            P    P  R    G  G +  +    Q   +          +    PP  PG  G+ G  
Sbjct: 780  PGPPGPPGRTGLDGLPGPKGDVGPNGQPGPMGPPGLPGIGVQGPPGPPGIPGPIGQPGLH 839

Query: 1091 EKRKEVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSL 1150
                E      P  D P  P    R   G  GAP  P  P GS   PG++  +  P    
Sbjct: 840  GIPGEKGDPGPPGLDVPGPP--GERGSPGIPGAP-GPIGPPGSPGLPGKAGASGFPGTKG 896

Query: 1151 ETGAAAREGG------PKCADRPSVAPKDPLQ----VPTNT-ETSEETRPSLDFPQEAKE 1199
            E G     G       P  +  P +   D LQ    +P  T E   +  P L  P    +
Sbjct: 897  EMGMMGPPGPPGPLGIPGRSGVPGLKGDDGLQGQPGLPGPTGEKGSKGEPGLPGPPGPMD 956

Query: 1200 P-------ETAEESAP-----DSTEFTEALRSPPAACAGEMGAS--PGLLIPEQP----- 1240
            P       E  E   P        +  + L   P    G+ G S  PGL  P  P     
Sbjct: 957  PNLLGSKGEKGEPGLPGIPGVSGPKGYQGLPGDP----GQPGLSGQPGLPGPPGPKGNPG 1012

Query: 1241 -PPSRHDTGTPKPSGSLAN---TAPHGSSPTPGVGSLLGGPGGTQAPVSHNSKDPPARQ- 1295
             P      G P   G++ +     P G    PG   + G PG    P     K  P    
Sbjct: 1013 LPGQPGLIGPPGLKGTIGDMGFPGPQGVEGPPGPSGVPGQPGSPGLPGQKGDKGDPGISS 1072

Query: 1296 ---PGEFLAPVANPSSTACPKPSVLSSKISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPH 1352
               PG    P   P     P    +   +     DP G    P G P AK  P     P 
Sbjct: 1073 IGLPG-LPGPKGEPGLPGYPGNPGIKGSVG----DP-GLPGLP-GTPGAKGQPGLPGFPG 1125

Query: 1353 SELFLGPKDLAGCFLEELHPKPSARDAPPASSSCLCQDGEDAGSLEPQLPRSPPGTAETE 1412
            +    GPK ++G               PP +     + G   G   P  P  PPG  + +
Sbjct: 1126 TPGPPGPKGISG---------------PPGNPGLPGEPGPVGGGGHPGQP-GPPG-EKGK 1168

Query: 1413 PGRAASPPTLESSSLFPDLPVDRFDPPLYGSLSANR-DSGLPFACADPPQKTVPSDPPYP 1471
            PG+   P                  PP    LS  + D GLP    +P       +P + 
Sbjct: 1169 PGQDGIPGPAGQKGEPGQPGFGNPGPPGLPGLSGQKGDGGLPGIPGNPGLPGPKGEPGFH 1228

Query: 1472 SFLLLEEVSPMLPSHFPDLSGGK-VLSKTCPPER--------TVVPGAAPSLPGKG 1518
             F  ++       S  P L G K       PP R           P   P LPG G
Sbjct: 1229 GFPGVQGPPGPPGSPGPALEGPKGNPGPQGPPGRPGPTGFQGLPGPEGPPGLPGNG 1284



 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 116/457 (25%), Positives = 139/457 (30%), Gaps = 77/457 (16%)

Query: 20   PRQVASSPGHPSQPPLEDNT--PATRTTKGAREAGGQAQAMELPEAQPRQARDGELKPPS 77
            P+     PG+P  P ++ +   P      G   A GQ      P         G   PP 
Sbjct: 1081 PKGEPGLPGYPGNPGIKGSVGDPGLPGLPGTPGAKGQPGLPGFP---------GTPGPPG 1131

Query: 78   LRG-QAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRYILGIASSRTKPTLDET 136
             +G   P   PG  G P    G      P     +  G P Q  I G A  + +P     
Sbjct: 1132 PKGISGPPGNPGLPGEPGPVGGGGHPGQPGPPGEK--GKPGQDGIPGPAGQKGEPG---Q 1186

Query: 137  PENPQLEAAQLPEVDTPQGPG--TGAPLRPGLPRTEAQPAAEELGFHRC--FQEPPSSFT 192
            P         LP +   +G G   G P  PGLP  + +P     GFH     Q PP    
Sbjct: 1187 PGFGNPGPPGLPGLSGQKGDGGLPGIPGNPGLPGPKGEP-----GFHGFPGVQGPPG--- 1238

Query: 193  STNYTSPSATPRPPAPGPPQSRGTS--PLQPGSYPEYQASGADSWPPAAENSFPGANFGV 250
                  P  +P P   GP  + G    P +PG        G +  P    N       G 
Sbjct: 1239 ------PPGSPGPALEGPKGNPGPQGPPGRPGPTGFQGLPGPEGPPGLPGNGGIKGEKGN 1292

Query: 251  PPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQ 310
            P     P   G +    P G+      P L+G    P    V G     GP       P 
Sbjct: 1293 PGQPGLPGLPGLKGDQGPPGLQGNPGRPGLNGMKGDPGLPGVPGFPGMKGPSGV----PG 1348

Query: 311  GAWPEEAVGT-GPAYPLPTQPAPSPLPCY---QGQPGGLNRHSDLSGALSSPGAAHSAPR 366
             A PE   G  GP  P P  P PS           P G+     L G L  P      P 
Sbjct: 1349 SAGPEGEPGLIGPPGP-PGLPGPSGQSIIIKGDAGPPGIPGQPGLKG-LPGPQGPQGLPG 1406

Query: 367  PFSDSLHKSLTKILPERPPSAQ-----DGLGSTRGPPSSLPQRHFPGQAYRAS------- 414
            P             P   P        DG G  +G P        PGQ            
Sbjct: 1407 PTG-----------PPGDPGRNGLPGFDGAGGRKGDPG------LPGQPGTRGLDGPPGP 1449

Query: 415  -GVDTSPGPPDTELAAPGPPPARLPQLWDPTAAPYPT 450
             G+   PGPP T   A G    R  Q  D    P  T
Sbjct: 1450 DGLQGPPGPPGTSSVAHGFLITRHSQTTDAPQCPQGT 1486



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 117/458 (25%), Positives = 144/458 (31%), Gaps = 74/458 (16%)

Query: 3425 VRRPGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLC 3484
            + +PG PG     L G  P +   V +PG    PG+   P  G      E  +P +    
Sbjct: 659  ITQPGKPG-----LPGN-PGRDGDVGLPGDPGLPGQPGLP--GIPGSKGEPGIPGI---- 706

Query: 3485 SEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGDCALD 3544
                P   KG+P     P  P T    G E P      P P   P   AL    G   L 
Sbjct: 707  GLPGPPGPKGFPGIPGPPGAPGTPGRIGLEGPPGPPGFPGPKGEP-GFALPGPPGPPGLP 765

Query: 3545 G---ALERPENEASPGSPGPLLQQALPLGASLPRP----GARGQDAEGKRAPLVFSGKRR 3597
            G   AL    +   PG PGP  +  L     LP P    G  GQ        L   G + 
Sbjct: 766  GFKGALGPKGDRGFPGPPGPPGRTGLD---GLPGPKGDVGPNGQPGPMGPPGLPGIGVQG 822

Query: 3598 APGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSA 3657
             PG  G   P      H +  EK       +   GP G   +GS   P            
Sbjct: 823  PPGPPGIPGPIGQPGLHGIPGEKGDPGPPGLDVPGPPG--ERGSPGIPG----------- 869

Query: 3658 ASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTKTG 3717
            A  P      P  P KA  S  PG     T+  M    P   PGP      S  PG K  
Sbjct: 870  APGPIGPPGSPGLPGKAGASGFPG-----TKGEMGMMGPPGPPGPLGIPGRSGVPGLKGD 924

Query: 3718 GGSQPQPA-------SGQLQSETATTPAKPSFPS--------RSPAPERLPARAQAKSCT 3762
             G Q QP         G         P  P  P+          P    +P  +  K   
Sbjct: 925  DGLQGQPGLPGPTGEKGSKGEPGLPGPPGPMDPNLLGSKGEKGEPGLPGIPGVSGPKGYQ 984

Query: 3763 KGPREAGEQGPHGSLG----PKEKGESSTKRKKGQVPGPARSESVGSFG-RAPSAPDKPP 3817
              P + G+ G  G  G    P  KG      + G +  P    ++G  G   P   + PP
Sbjct: 985  GLPGDPGQPGLSGQPGLPGPPGPKGNPGLPGQPGLIGPPGLKGTIGDMGFPGPQGVEGPP 1044

Query: 3818 RTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPG 3855
                    PS V      P     P  P  +  K +PG
Sbjct: 1045 -------GPSGV------PGQPGSPGLPGQKGDKGDPG 1069



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 170/687 (24%), Positives = 226/687 (32%), Gaps = 102/687 (14%)

Query: 871  EEPSGPRGPSSGHPLKSKAGVTPES-KAPPPLPAATPDPQTP-RPGDRGCPA-RGRPKTR 927
            E P GPRG      +    G  P+  + PP LP     P  P  PG  G P  +G P   
Sbjct: 68   EGPPGPRGQKGDDGIPGPPG--PKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQGIP--- 122

Query: 928  SLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLR-PRRNDGL 986
              G   T+ +    G     G Q           G     G  G    S L  P+ N G 
Sbjct: 123  --GCNGTKGERGFPGSPGFPGLQ-----GPPGPPGIPGMKGEPGSIIMSSLPGPKGNPGY 175

Query: 987  GERPPPRPRRPRTQAPGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAW 1046
               P  +     T  PG    P P        P      +       + P+  K   G  
Sbjct: 176  PGPPGIQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEKGEQGLQ 235

Query: 1047 GKELILKIVQQKNRLREYDFASESE--EDEQPPPRGPGFRGRRG--RGEKRKEVELTQGP 1102
            G       + ++ R  + +F    +    ++ PP  PG RG  G   GEK ++ E     
Sbjct: 236  GPPGPPGQISEQKRPIDVEFQKGDQGLPGDRGPPGPPGIRGPPGPPGGEKGEKGE----- 290

Query: 1103 REDEPQKPRKAARQ-EAGGDGAPANPEEPGGSRPG-PGRSPQARGPSRSLETGAAAREG- 1159
             + EP K  K  +  E G  G P  P +PG   PG PGR  +     +  +TG     G 
Sbjct: 291  -QGEPGKRGKPGKDGENGQPGIPGLPGDPG--YPGEPGRDGE---KGQKGDTGPPGPPGL 344

Query: 1160 -GPKCADRPSVAPKDPLQVP-TNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEAL 1217
              P+     ++  K  + +P    E  E   P +  P     P  A    P         
Sbjct: 345  VIPRPGTGITIGEKGNIGLPGLPGEKGERGFPGIQGPPGLPGPPGAAVMGPPG------- 397

Query: 1218 RSPPAACAGEMG-----ASPGLLIPEQP-----PPSRHDTGTPKPSG-------SLANTA 1260
               P    GE G       PG+ IP  P     P +    G P P+G        +    
Sbjct: 398  ---PPGFPGERGQKGDEGPPGISIPGPPGLDGQPGAPGLPGPPGPAGPHIPPSDEICEPG 454

Query: 1261 PHGSSPTPGVGSLLGGPG--GTQAPVSHN----SKDPPARQPGEFLAPVANPSSTACPKP 1314
            P G   +PG   L G  G  G +     N        P  QPG    P   P S   P  
Sbjct: 455  PPGPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGISGPPGQPGLPGLP-GPPGSLGFPGQ 513

Query: 1315 SVLSSKISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSEL-FLGPKDLAGCFLEELHPK 1373
                 +  + G  P G    P G P A   P     P   L F G K   G    EL   
Sbjct: 514  KGEKGQAGATG--PKGLPGIP-GAPGAPGFPGSKGEPGDILTFPGMKGDKG----EL-GS 565

Query: 1374 PSARDAPPASSSCLCQDGEDAGSLEPQLPRSPPG--TAETEPGRAASPPTLESSSLFPDL 1431
            P A   P    +     G+D     P  P+  PG  T + E G   +P         P L
Sbjct: 566  PGAPGLPGLPGT----PGQDGLPGLPG-PKGEPGGITFKGERGPPGNPG-------LPGL 613

Query: 1432 P--VDRFDPPLYGSLSANRDSGLPFACADPPQKTVPSDPPYPSFLLLEEVSPMLPSHFPD 1489
            P  +    PP +G      + G+     +P Q  +P     P   + +   P LP + P 
Sbjct: 614  PGNIGPMGPPGFGPPGPVGEKGIQGVAGNPGQPGIPGPKGDPGQTITQPGKPGLPGN-PG 672

Query: 1490 LSGGKVLSKTCPPERTVVPGAAPSLPG 1516
              G   L     P    +PG  P LPG
Sbjct: 673  RDGDVGL-----PGDPGLPG-QPGLPG 693



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 113/463 (24%), Positives = 147/463 (31%), Gaps = 74/463 (15%)

Query: 3432 GQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEVAPST 3491
            G K    E   P       +PG  PGP E  P PRG      +  +P          P  
Sbjct: 42   GIKGEKGERGFPGLEGHPGLPGF-PGP-EGPPGPRGQK---GDDGIPGPPGPKGIRGPPG 96

Query: 3492 TKGWPETLERPV------DPVTHPIRGCELPSNHQECPP----PSLS--PFPAALADGRG 3539
              G+P T   P        P    I GC      +  P     P L   P P  +   +G
Sbjct: 97   LPGFPGTPGLPGMPGHDGAPGPQGIPGCNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKG 156

Query: 3540 DCALDGALERPENEASPGSPGPLLQQALPLGASLP-------------RPGARGQDAEGK 3586
            +         P  + +PG PGP   Q LP    +P              PG  G      
Sbjct: 157  EPGSIIMSSLPGPKGNPGYPGPPGIQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKG 216

Query: 3587 RAPLVFSGKRRAPGARGRCAP-----DHFQEDHLLQKEKEVSSSHMVSEGGPRG-TFHKG 3640
               L F G +   G +G   P        ++   +  E +     +  + GP G    +G
Sbjct: 217  NMGLNFQGPKGEKGEQGLQGPPGPPGQISEQKRPIDVEFQKGDQGLPGDRGPPGPPGIRG 276

Query: 3641 SATKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLA-----PGELARGTENGMKPAT 3695
                P G +    ++       K  K   + +  +  L      PGE  R  E G K  T
Sbjct: 277  PPGPPGGEKGEKGEQGEPGKRGKPGKDGENGQPGIPGLPGDPGYPGEPGRDGEKGQKGDT 336

Query: 3696 PKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPAR 3755
                PGP   G   PRPGT    G +       L  E      +  FP     P  LP  
Sbjct: 337  --GPPGP--PGLVIPRPGTGITIGEKGNIGLPGLPGE----KGERGFPG-IQGPPGLP-- 385

Query: 3756 AQAKSCTKGPREAGEQGPHGSLG-PKEKGESSTKRKKG-QVPGPARSESVGSFGRAPSAP 3813
                    GP  A   GP G  G P E+G+   +   G  +PGP   +        P AP
Sbjct: 386  --------GPPGAAVMGPPGPPGFPGERGQKGDEGPPGISIPGPPGLDG------QPGAP 431

Query: 3814 DKP-PRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPG 3855
              P P  P     P      +P P     P PP S   K   G
Sbjct: 432  GLPGPPGPAGPHIPPSDEICEPGP-----PGPPGSPGDKGLQG 469



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 95/368 (25%), Positives = 119/368 (32%), Gaps = 95/368 (25%)

Query: 3427 RPGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPR-GSSPILSEGSLPALLHLCS 3485
            +PG PG+K +  +  +P    +   PG  PG G   PP   G S    +G LP +     
Sbjct: 1159 QPGPPGEKGKPGQDGIPGPAGQKGEPGQ-PGFGNPGPPGLPGLSGQKGDGGLPGI----- 1212

Query: 3486 EVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGDCALDG 3545
                    G P       +P  H   G + P      P P  SP PA          L+G
Sbjct: 1213 -------PGNPGLPGPKGEPGFHGFPGVQGP------PGPPGSPGPA----------LEG 1249

Query: 3546 ALERPENEASPGSPGPLLQQALPLGASLPRPGARGQDA-EGKRAPLVFSGKRRAPGARGR 3604
                P  +  PG PGP   Q LP G   P PG  G    +G++      G    PG +G 
Sbjct: 1250 PKGNPGPQGPPGRPGPTGFQGLP-GPEGP-PGLPGNGGIKGEKGNPGQPGLPGLPGLKG- 1306

Query: 3605 CAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSAASTPSKA 3664
                                     + GP G   +G+  +P G      D      P   
Sbjct: 1307 -------------------------DQGPPGL--QGNPGRP-GLNGMKGDPGLPGVPG-- 1336

Query: 3665 LKFP--VHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQ-----GSGSP-----RP 3712
              FP    P    GS  P     G    + P  P   PGPS Q     G   P     +P
Sbjct: 1337 --FPGMKGPSGVPGSAGP----EGEPGLIGPPGPPGLPGPSGQSIIIKGDAGPPGIPGQP 1390

Query: 3713 GTKTGGGSQ-PQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQ 3771
            G K   G Q PQ   G            P+ P   P    LP    A      P   G+ 
Sbjct: 1391 GLKGLPGPQGPQGLPG------------PTGPPGDPGRNGLPGFDGAGGRKGDPGLPGQP 1438

Query: 3772 GPHGSLGP 3779
            G  G  GP
Sbjct: 1439 GTRGLDGP 1446



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 115/475 (24%), Positives = 140/475 (29%), Gaps = 62/475 (13%)

Query: 3428 PGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEV 3487
            PG PG      +  LP        PG     GE  PP             P L  L   +
Sbjct: 569  PGLPGLPGTPGQDGLPGLPGPKGEPGGITFKGERGPPGN-----------PGLPGLPGNI 617

Query: 3488 APSTTKGWPETLERPVDPVTHP-IRGCELPSNHQECPPPSLSPFPAALADGRGDCALDGA 3546
             P    G+      P  PV    I+G          P P   P       G+    L G 
Sbjct: 618  GPMGPPGF-----GPPGPVGEKGIQGVAGNPGQPGIPGPKGDPGQTITQPGKP--GLPGN 670

Query: 3547 LERPENEASPGSPGPLLQQALP-LGASLPRPGARGQDAEGKRAPLVF---SGKRRAPGAR 3602
              R  +   PG PG   Q  LP +  S   PG  G    G   P  F    G   APG  
Sbjct: 671  PGRDGDVGLPGDPGLPGQPGLPGIPGSKGEPGIPGIGLPGPPGPKGFPGIPGPPGAPGTP 730

Query: 3603 GRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSAASTPS 3662
            GR   +           K      +    GP G      A  P G      DR     P 
Sbjct: 731  GRIGLEGPPGPPGFPGPKGEPGFALPGPPGPPGLPGFKGALGPKG------DRGFPGPPG 784

Query: 3663 ----------KALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRP 3712
                         K  V P    G + P  L      G  P  P   PGP  Q      P
Sbjct: 785  PPGRTGLDGLPGPKGDVGPNGQPGPMGPPGLPGIGVQG--PPGPPGIPGPIGQPGLHGIP 842

Query: 3713 GTKTGGGSQPQPASGQL-QSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQ 3771
            G K   G       G   +  +   P  P  P   P    LP +A A        E G  
Sbjct: 843  GEKGDPGPPGLDVPGPPGERGSPGIPGAPG-PIGPPGSPGLPGKAGASGFPGTKGEMGMM 901

Query: 3772 GPHGSLGPKE----------KGESSTKRKKGQVPGPARSESVGSFGR----APSAPDKPP 3817
            GP G  GP            KG+   + + G +PGP   +  GS G      P  P  P 
Sbjct: 902  GPPGPPGPLGIPGRSGVPGLKGDDGLQGQPG-LPGPTGEK--GSKGEPGLPGPPGPMDPN 958

Query: 3818 RTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRP 3872
                K       LP  P  +     +  P +    +PG + +    G   P+G P
Sbjct: 959  LLGSKGEKGEPGLPGIPGVSGPKGYQGLPGD--PGQPGLSGQPGLPGPPGPKGNP 1011



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 117/515 (22%), Positives = 162/515 (31%), Gaps = 75/515 (14%)

Query: 3419 PFAFRGVRRPGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLP 3478
            P  ++G+  PG PGQ   + +  LP        PG    PG   PP  G    + +   P
Sbjct: 980  PKGYQGL--PGDPGQPGLSGQPGLPGPPGPKGNPGLPGQPGLIGPP--GLKGTIGDMGFP 1035

Query: 3479 ALLHLCSEVAPSTTKGWPETLERPV------DPVTHPIRGCELPSNHQECPPPSLSPFPA 3532
                +     PS   G P +   P       DP    I    LP    E   P L  +P 
Sbjct: 1036 GPQGVEGPPGPSGVPGQPGSPGLPGQKGDKGDPGISSIGLPGLPGPKGE---PGLPGYP- 1091

Query: 3533 ALADGRGDCALDGALERPENEASPGSPGPLLQQALPLGASLPRP-GARGQDAE------- 3584
                  G+  + G++  P     PG+PG   Q  LP     P P G +G           
Sbjct: 1092 ------GNPGIKGSVGDPGLPGLPGTPGAKGQPGLPGFPGTPGPPGPKGISGPPGNPGLP 1145

Query: 3585 GKRAPLV---FSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRG----TF 3637
            G+  P+      G+   PG +G+   D          +K           GP G    + 
Sbjct: 1146 GEPGPVGGGGHPGQPGPPGEKGKPGQDGIPGP---AGQKGEPGQPGFGNPGPPGLPGLSG 1202

Query: 3638 HKGSATKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPK 3697
             KG    P    +                    P    GS  PG    G +    P  P 
Sbjct: 1203 QKGDGGLPGIPGNPGLPGPKGEPGFHGFPGVQGPPGPPGS--PGPALEGPKGNPGPQGPP 1260

Query: 3698 AKPGPSS-QGSGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFP--------SRSPA 3748
             +PGP+  QG   P        G    P +G ++ E    P +P  P           P 
Sbjct: 1261 GRPGPTGFQGLPGPE-------GPPGLPGNGGIKGEKG-NPGQPGLPGLPGLKGDQGPPG 1312

Query: 3749 PERLPARAQAKSCTKGPREAGEQGPHGSLGPK-EKGESSTKRKKGQV--------PGPA- 3798
             +  P R         P   G  G  G  GP    G +  + + G +        PGP+ 
Sbjct: 1313 LQGNPGRPGLNGMKGDPGLPGVPGFPGMKGPSGVPGSAGPEGEPGLIGPPGPPGLPGPSG 1372

Query: 3799 RSESVGSFGRAPSAPDKP--PRTPRKQATPSRVLPTKP--KPNSQNKPRPPPSEQRKAEP 3854
            +S  +      P  P +P     P  Q       PT P   P     P    +  RK +P
Sbjct: 1373 QSIIIKGDAGPPGIPGQPGLKGLPGPQGPQGLPGPTGPPGDPGRNGLPGFDGAGGRKGDP 1432

Query: 3855 GHTQRKDRLGKAFPQGRPLLR----PPKRGTAVHG 3885
            G   +    G   P G   L+    PP   +  HG
Sbjct: 1433 GLPGQPGTRGLDGPPGPDGLQGPPGPPGTSSVAHG 1467



 Score = 43.5 bits (101), Expect = 0.004
 Identities = 199/866 (22%), Positives = 253/866 (29%), Gaps = 161/866 (18%)

Query: 1752 PGTADQPHR-GAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPSHAAQGHSAGR 1810
            PG   QP   G P P     P +  + ++   G   PP       G+      QG    +
Sbjct: 422  PGLDGQPGAPGLPGPPGPAGPHIPPSDEICEPGPPGPP-------GSPGDKGLQGEQGVK 474

Query: 1811 A----------GGHLHPTAGRPGFEGNEFAPA-----------GASSLTAPRGREAWLVP 1849
                       G  +    G+PG  G    P            G +  T P+G    L  
Sbjct: 475  GDKGDTCFNCIGTGISGPPGQPGLPGLPGPPGSLGFPGQKGEKGQAGATGPKG----LPG 530

Query: 1850 VPSPACVSNTHPSRRSQDPALSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNP 1909
            +P         P       +   P   L  PG    K + G  G   L     +P +   
Sbjct: 531  IPGA-------PGAPGFPGSKGEPGDILTFPGMKGDKGELGSPGAPGLPGLPGTPGQDGL 583

Query: 1910 SGLEGGTVEGGKVACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGT 1969
             GL G   E G +     +G PG   +  LP   G  +G    G  G +G  EK      
Sbjct: 584  PGLPGPKGEPGGITFKGERGPPGNPGLPGLPGNIG-PMGPPGFGPPGPVG--EKGIQGVA 640

Query: 1970 ANQLQPENGVSPGGTDNHASVNASPKTALTG--PTEGAVLLEKCKGSRAAMSLQ----EE 2023
             N  QP  G+     D   ++    K  L G    +G V L    G      L      +
Sbjct: 641  GNPGQP--GIPGPKGDPGQTITQPGKPGLPGNPGRDGDVGLPGDPGLPGQPGLPGIPGSK 698

Query: 2024 AEP------TPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAP 2077
             EP       P PP P                G+ G TP R    GL  P    G  P P
Sbjct: 699  GEPGIPGIGLPGPPGPK------GFPGIPGPPGAPG-TPGRI---GLEGPPGPPG-FPGP 747

Query: 2078 SVGDLAACAPSPTSAAHMPCSLGPLPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQL 2137
              G+     P P     +P   G L        P   +G  G           PPGP   
Sbjct: 748  K-GEPGFALPGPPGPPGLPGFKGAL-------GPKGDRGFPG-----------PPGP--- 785

Query: 2138 LACSPAWAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCDPKEALAGCLLQGEGSPLEDP 2197
                P    L+   G +       +  P+ PP            L G  +QG   P   P
Sbjct: 786  ----PGRTGLDGLPGPKGDVGPNGQPGPMGPP-----------GLPGIGVQGPPGPPGIP 830

Query: 2198 SSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRA 2257
               P G             P    L +P           PG   SP + GA  P     +
Sbjct: 831  G--PIGQPGLHGIPGEKGDPGPPGLDVP---------GPPGERGSPGIPGAPGPIGPPGS 879

Query: 2258 TGL-----SSTPTGDEAQAG-RGLPGPD-----PQSRGAPPHTNPDRMPRGHSSYSPSNT 2306
             GL     +S   G + + G  G PGP      P   G P     D +        P+  
Sbjct: 880  PGLPGKAGASGFPGTKGEMGMMGPPGPPGPLGIPGRSGVPGLKGDDGLQGQPGLPGPTGE 939

Query: 2307 ARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSSKE-----PEDPGTPETGRSG 2361
                   G      P +P  L   G      L G  G S  +     P DPG P  G SG
Sbjct: 940  KGSKGEPGLPGPPGPMDPNLLGSKGEKGEPGLPGIPGVSGPKGYQGLPGDPGQP--GLSG 997

Query: 2362 ATKMPRVTCPSTGLGL----GRTTAP--SSTASDFQSDSPQSHRNASHQTPQGDPLGP-Q 2414
               +P    P    GL    G    P    T  D     PQ         P G P  P  
Sbjct: 998  QPGLPGPPGPKGNPGLPGQPGLIGPPGLKGTIGDMGFPGPQGVEGP--PGPSGVPGQPGS 1055

Query: 2415 DLKQRSRGYKKKPASTENGQWKGQAPHG-------PVTCEVCAASFRSG-PGLSRHKARK 2466
                  +G K  P  +  G      P G       P    +  +    G PGL      K
Sbjct: 1056 PGLPGQKGDKGDPGISSIGLPGLPGPKGEPGLPGYPGNPGIKGSVGDPGLPGLPGTPGAK 1115

Query: 2467 HRP----HPGAPAEPSPAALPAQQPLEPLAQKCQPPRKKSHRVSGKERPNHSRGDPSHVT 2522
             +P     PG P  P P  +        L  +  P     H   G+  P   +G P    
Sbjct: 1116 GQPGLPGFPGTPGPPGPKGISGPPGNPGLPGEPGPVGGGGH--PGQPGPPGEKGKPGQDG 1173

Query: 2523 QPPPAQGSKEVLRAPGSPHSQQLHPP 2548
             P PA    E    PG P      PP
Sbjct: 1174 IPGPAGQKGE----PGQPGFGNPGPP 1195



 Score = 42.4 bits (98), Expect = 0.009
 Identities = 276/1195 (23%), Positives = 359/1195 (30%), Gaps = 236/1195 (19%)

Query: 1684 GDSRPPQD-VCLPEPSKQPGPQLDAGSLAK---CSPDQELSFPKNKEAASSQESEDSLRL 1739
            G   PP D +C P P   PG   D G   +        +  F       S    +  L  
Sbjct: 441  GPHIPPSDEICEPGPPGPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGISGPPGQPGLPG 500

Query: 1740 LPCEQRGGFLPEPG-TADQPHRGAPAPEAFGSPAVHLAPDL-AFQGDGAPPLDATWPFGA 1797
            LP     G L  PG   ++   GA  P+  G P +  AP    F G    P D    F  
Sbjct: 501  LPGPP--GSLGFPGQKGEKGQAGATGPK--GLPGIPGAPGAPGFPGSKGEPGDIL-TFPG 555

Query: 1798 SPSHAAQGHSAGRAGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLV------PVP 1851
                  +  S G  G       G PG  G +    G   L  P+G    +       P  
Sbjct: 556  MKGDKGELGSPGAPG-----LPGLPGTPGQD----GLPGLPGPKGEPGGITFKGERGPPG 606

Query: 1852 SPACVSNTHPSRRSQDPALSPPIRQLQLPGPGVAKSKDGILGL--QELTPAAQSPP---- 1905
            +P       P        + PP      PGP   K   G+ G   Q   P  +  P    
Sbjct: 607  NPGL-----PGLPGNIGPMGPP--GFGPPGPVGEKGIQGVAGNPGQPGIPGPKGDPGQTI 659

Query: 1906 -RVNPSGLEGGTVEGGKVACGPAQGSPGGVQVTTLPAVAGHQ----LGLEA-DGHWGLLG 1959
             +    GL G     G V      G PG   +  +P   G      +GL    G  G  G
Sbjct: 660  TQPGKPGLPGNPGRDGDVGLPGDPGLPGQPGLPGIPGSKGEPGIPGIGLPGPPGPKGFPG 719

Query: 1960 QAEKTQGQGTANQLQPENGVSPGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMS 2019
                    GT  ++  E    P G          P  AL GP     L     G + A+ 
Sbjct: 720  IPGPPGAPGTPGRIGLE---GPPGPPGFPGPKGEPGFALPGPPGPPGL----PGFKGALG 772

Query: 2020 LQEEAEPTPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAPSV 2079
             + +    P PP P   +    L       G  G+ P     PGL  P +     P P  
Sbjct: 773  PKGD-RGFPGPPGPPGRTGLDGLPGPKGDVGPNGQ-PGPMGPPGL--PGIGVQGPPGPP- 827

Query: 2080 GDLAACAPSPTSAAH-MPCSLG-PLPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQL 2137
                   P      H +P   G P P    +  P   +G  G  +P +P    PPG    
Sbjct: 828  ---GIPGPIGQPGLHGIPGEKGDPGPPGLDVPGPPGERGSPG--IPGAPGPIGPPG---- 878

Query: 2138 LACSPAWAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCDPKEALAGCLLQGEGSPLEDP 2197
               SP       A G   T        P  PP     P   +  + G  L+G+      P
Sbjct: 879  ---SPGLPGKAGASGFPGTKGEMGMMGPPGPPGPLGIP--GRSGVPG--LKGDDGLQGQP 931

Query: 2198 SSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRA 2257
                P        T    +  +  L  P       L  S G    P L G    S     
Sbjct: 932  GLPGP--------TGEKGSKGEPGLPGPPGPMDPNLLGSKGEKGEPGLPGIPGVSGPKGY 983

Query: 2258 TGLSSTPTGDEAQAGRGLPGPDPQSRGAPPHTNPDRMPRGHSSYSPSNTARLGHREGQAV 2317
             GL   P         GLPGP P  +G P                P     +G       
Sbjct: 984  QGLPGDPGQPGLSGQPGLPGP-PGPKGNPG--------------LPGQPGLIG------- 1021

Query: 2318 TAVPTEPPTLQGA----GPDSPACLEGEMGTSS--KEPEDPGTPETGRSGATKMPRVTCP 2371
                  PP L+G     G   P  +EG  G S    +P  PG P  G+ G    P +   
Sbjct: 1022 ------PPGLKGTIGDMGFPGPQGVEGPPGPSGVPGQPGSPGLP--GQKGDKGDPGI--- 1070

Query: 2372 STGLGLGRTTAPSSTASDFQSDSPQSHRNASHQTPQGDPLGPQDLKQRSRGYKKKPASTE 2431
             + +GL     P       +   P    N   +   GDP  P        G    P +  
Sbjct: 1071 -SSIGLPGLPGPKG-----EPGLPGYPGNPGIKGSVGDPGLP--------GLPGTPGA-- 1114

Query: 2432 NGQWKGQAPHGPVTCEVCAASFRSGPGLSRHKARKHRP-HPGAPAEPSPAALPAQQPLEP 2490
                KGQ P  P         F   PG    K     P +PG P EP P       P +P
Sbjct: 1115 ----KGQ-PGLP--------GFPGTPGPPGPKGISGPPGNPGLPGEPGPVG-GGGHPGQP 1160

Query: 2491 LAQKCQPPRKK----SHRVSGKERPNHSRGDPSHVTQPPPA----QGSKEVLRAPGSPHS 2542
                  PP +K       + G        G P      PP      G K     PG P +
Sbjct: 1161 -----GPPGEKGKPGQDGIPGPAGQKGEPGQPGFGNPGPPGLPGLSGQKGDGGLPGIPGN 1215

Query: 2543 QQLHPP--SPTEHEV-DVKTPASKP-RPDQAREDELHPKQAEKREGRRWRREPT----VD 2594
              L  P   P  H    V+ P   P  P  A E    PK     +G   R  PT    + 
Sbjct: 1216 PGLPGPKGEPGFHGFPGVQGPPGPPGSPGPALEG---PKGNPGPQGPPGRPGPTGFQGLP 1272

Query: 2595 SPSHSEGKSNKKRGKLRGRRLRE-ESILPVSADVISDGRGSRPSPAMASYAASPSHCLSV 2653
             P    G      G ++G +    +  LP    +    +G +  P +      P     +
Sbjct: 1273 GPEGPPGLPG--NGGIKGEKGNPGQPGLPGLPGL----KGDQGPPGLQGNPGRPG-LNGM 1325

Query: 2654 EGGPEADGEQPPRLATLGPGVMEGAAETDQEALCAGETGAQKPPGDRMLCPGRMDGAALG 2713
            +G P   G  P      GP  + G+A  +      GE G   PPG   L PG    + + 
Sbjct: 1326 KGDPGLPG-VPGFPGMKGPSGVPGSAGPE------GEPGLIGPPGPPGL-PGPSGQSIII 1377

Query: 2714 EQPTGQKG----ASARGFWGPRETKALGVCKESGSEPAEDSSRAHSRSEEGVWEENTPPL 2769
            +   G  G       +G  GP+  + L                               P 
Sbjct: 1378 KGDAGPPGIPGQPGLKGLPGPQGPQGL-----------------------------PGPT 1408

Query: 2770 GPLGFPETSSSPADSTTSSCL--QGLPDNPDTQG--------GVQGPEGPTPDAS 2814
            GP G P  +  P            GLP  P T+G        G+QGP GP   +S
Sbjct: 1409 GPPGDPGRNGLPGFDGAGGRKGDPGLPGQPGTRGLDGPPGPDGLQGPPGPPGTSS 1463



 Score = 40.4 bits (93), Expect = 0.035
 Identities = 56/209 (26%), Positives = 69/209 (33%), Gaps = 18/209 (8%)

Query: 3693 PATPKAKPGPSSQGSG---SPRPGTKTGGGSQPQPASGQLQSETATT----PAKPSFPSR 3745
            P  P   PG   +      S  PG K   G    P    L   T       P  P     
Sbjct: 145  PPGPPGIPGMKGEPGSIIMSSLPGPKGNPGYPGPPGIQGLPGPTGIPGPIGPPGPPGLMG 204

Query: 3746 SPAPERLPA-RAQAKSCTKGPR-EAGEQGPHGSLGP-----KEKGESSTKRKKGQ--VPG 3796
             P P  LP  +       +GP+ E GEQG  G  GP     ++K     + +KG   +PG
Sbjct: 205  PPGPPGLPGPKGNMGLNFQGPKGEKGEQGLQGPPGPPGQISEQKRPIDVEFQKGDQGLPG 264

Query: 3797 PARSESVGSFGRAPSAPDKPPRTPRKQATPS-RVLPTKPKPNSQ-NKPRPPPSEQRKAEP 3854
                         P  P        +Q  P  R  P K   N Q   P  P       EP
Sbjct: 265  DRGPPGPPGIRGPPGPPGGEKGEKGEQGEPGKRGKPGKDGENGQPGIPGLPGDPGYPGEP 324

Query: 3855 GHTQRKDRLGKAFPQGRPLLRPPKRGTAV 3883
            G    K + G   P G P L  P+ GT +
Sbjct: 325  GRDGEKGQKGDTGPPGPPGLVIPRPGTGI 353



 Score = 37.7 bits (86), Expect = 0.23
 Identities = 50/197 (25%), Positives = 62/197 (31%), Gaps = 35/197 (17%)

Query: 489 PTARPSPHGMEMLSRLPFPAG-----GPEWQGGSQGALGTAGK-----TPGPREKLPAVR 538
           P   P P G +    +P P G     GP    G  G  G  G       PGP + +P   
Sbjct: 67  PEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGP-QGIPGCN 125

Query: 539 SSQG-----GSPALFTYNGMTDPGAQPLFFG-----VAQPQVSPHGTPSLPPPRVVGASP 588
            ++G     GSP      G   P   P   G     +      P G P  P P  +   P
Sbjct: 126 GTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGNPGYPGPPGIQGLP 185

Query: 589 SESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSA--FFHPPTHPQETGS 646
             + +P P             P    P  P      LPGP G     F  P     E G 
Sbjct: 186 GPTGIPGPIGPPG-------PPGLMGPPGPPG----LPGPKGNMGLNFQGPKGEKGEQGL 234

Query: 647 PFPSPEPPHSLPTHYQP 663
             P P PP  +    +P
Sbjct: 235 QGP-PGPPGQISEQKRP 250



 Score = 37.0 bits (84), Expect = 0.39
 Identities = 169/712 (23%), Positives = 217/712 (30%), Gaps = 136/712 (19%)

Query: 3206 PAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPGERAKPRARSTPSNPDGAATPDSASA 3265
            P P+   G R      G PG P  +        PG    P     P + DGA  P     
Sbjct: 65   PGPEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGH-DGAPGPQGIPG 123

Query: 3266 T--ALADAGSPGPP-----RTTPSPSPDPWAGGEPLLQATPVHEACKDPSRDCHHCG--- 3315
                  + G PG P     +  P P   P   GEP    + +  +   P  +  + G   
Sbjct: 124  CNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEP---GSIIMSSLPGPKGNPGYPGPPG 180

Query: 3316 -KRFPKPFKLQRHLAVHSPQRVYLCPRCPRVYPEHGELLAHLGGAHGLLERPELQHTPLY 3374
             +  P P  +   +    P  +   P  P +    G +  +  G  G      LQ  P  
Sbjct: 181  IQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEKGEQGLQGPPGP 240

Query: 3375 ACELCATVMRIIKKSFACSSCNYTFAKKEQFDRHMNKHLRGGRQPFAFRGVRRPGAP--G 3432
              ++      I          +  F K +Q        L G R P    G+R P  P  G
Sbjct: 241  PGQISEQKRPI----------DVEFQKGDQ-------GLPGDRGPPGPPGIRGPPGPPGG 283

Query: 3433 QKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEVAPSTT 3492
            +K    E   P KR +         PG+D            E   P +            
Sbjct: 284  EKGEKGEQGEPGKRGK---------PGKD-----------GENGQPGI------------ 311

Query: 3493 KGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAA--LADGRGDCALDGAL--- 3547
             G P     P +P     +G +        PP  + P P        +G+  L G     
Sbjct: 312  PGLPGDPGYPGEPGRDGEKG-QKGDTGPPGPPGLVIPRPGTGITIGEKGNIGLPGLPGEK 370

Query: 3548 -ER--PENEASPGSPGPLLQQALPLGASLPR--PGARGQDAEGKRAPLVFS-----GKRR 3597
             ER  P  +  PG PGP    A  +G   P   PG RGQ  +G   P   S     G   
Sbjct: 371  GERGFPGIQGPPGLPGP--PGAAVMGPPGPPGFPGERGQ--KGDEGPPGISIPGPPGLDG 426

Query: 3598 APGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDR-- 3655
             PGA G   P      H       +  S  + E GP G           G Q    D+  
Sbjct: 427  QPGAPGLPGPPGPAGPH-------IPPSDEICEPGPPGPPGSPGDKGLQGEQGVKGDKGD 479

Query: 3656 -------SAASTPSKALKFPVHPRKAVGSLA----PGELARGTENGMK--PATPKAKPGP 3702
                   +  S P      P  P    GSL      GE  +    G K  P  P A   P
Sbjct: 480  TCFNCIGTGISGPPGQPGLPGLPGPP-GSLGFPGQKGEKGQAGATGPKGLPGIPGAPGAP 538

Query: 3703 SSQGS-GSPR-----PGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARA 3756
               GS G P      PG K   G    P +  L     T P +   P   P P+  P   
Sbjct: 539  GFPGSKGEPGDILTFPGMKGDKGELGSPGAPGLPGLPGT-PGQDGLPGL-PGPKGEPGGI 596

Query: 3757 QAKSCTKGPR----------EAGEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSF 3806
              K   +GP             G  GP G   P   GE   +   G    P      G  
Sbjct: 597  TFKG-ERGPPGNPGLPGLPGNIGPMGPPGFGPPGPVGEKGIQGVAGNPGQPGIPGPKGDP 655

Query: 3807 GRAPSAPDKP--PRTPRKQATPSRVLPTKP-KPNSQNKPRPPPSEQRKAEPG 3855
            G+  + P KP  P  P +       LP  P  P     P  P S   K EPG
Sbjct: 656  GQTITQPGKPGLPGNPGRDGDVG--LPGDPGLPGQPGLPGIPGS---KGEPG 702



 Score = 36.2 bits (82), Expect = 0.66
 Identities = 105/488 (21%), Positives = 148/488 (30%), Gaps = 82/488 (16%)

Query: 2101 PLPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQLLAC-----------------SPA 2143
            P P+  P  + ++ + G  G  P  P  + PPGP  +                    +P 
Sbjct: 116  PGPQGIPGCNGTKGERGFPGS-PGFPGLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGNPG 174

Query: 2144 WAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCDP----KEALAGCLLQG-EGSPLEDPS 2198
            +       G+   T       P  PP L   P  P     +   G   QG +G   E   
Sbjct: 175  YPGPPGIQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEKGEQGL 234

Query: 2199 SWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRAT 2258
              PPG    ++        +   + +      + L    G    P + G   P    +  
Sbjct: 235  QGPPGPPGQIS-------EQKRPIDVEFQKGDQGLPGDRGPPGPPGIRGPPGPPGGEKGE 287

Query: 2259 GLSSTPTGDEAQAGR----------GLPGPDPQSRGAPPH---------TNPDRMPRGHS 2299
                   G   + G+          GLPG DP   G P           T P   P G  
Sbjct: 288  KGEQGEPGKRGKPGKDGENGQPGIPGLPG-DPGYPGEPGRDGEKGQKGDTGPPGPP-GLV 345

Query: 2300 SYSPSNTARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSSKEPEDP-GTP-ET 2357
               P     +G +    +  +P E       G   P  L G  G +   P  P G P E 
Sbjct: 346  IPRPGTGITIGEKGNIGLPGLPGEKGERGFPGIQGPPGLPGPPGAAVMGPPGPPGFPGER 405

Query: 2358 GRSGATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRNASHQTPQGDPLGPQDLK 2417
            G+ G    P ++ P      G+  AP        +     H   S +  +  P GP    
Sbjct: 406  GQKGDEGPPGISIPGPPGLDGQPGAPGLPGPPGPAGP---HIPPSDEICEPGPPGPPG-- 460

Query: 2418 QRSRGYKKKPASTENGQWKGQAPHGPVTCEVCAASFRSGP----GLSRHKARKHRPHPGA 2473
              S G K           KG       TC  C  +  SGP    GL           PG 
Sbjct: 461  --SPGDKGLQGEQGVKGDKGD------TCFNCIGTGISGPPGQPGL-----------PGL 501

Query: 2474 PAEPSPAALPAQQPLEPLAQKCQPPRKKS-HRVSGKERPNHSRGDPSHVTQPPPAQGSKE 2532
            P  P     P Q+  +  A    P          G      S+G+P  +   P  +G K 
Sbjct: 502  PGPPGSLGFPGQKGEKGQAGATGPKGLPGIPGAPGAPGFPGSKGEPGDILTFPGMKGDKG 561

Query: 2533 VLRAPGSP 2540
             L +PG+P
Sbjct: 562  ELGSPGAP 569



 Score = 34.3 bits (77), Expect = 2.5
 Identities = 35/133 (26%), Positives = 43/133 (32%), Gaps = 16/133 (12%)

Query: 3183 LGDLPG--GLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPG 3240
            L  LPG  G +G   +     +   P PK   G        G PG   G     +   PG
Sbjct: 1105 LPGLPGTPGAKGQPGLPGFPGTPGPPGPKGISGPPGNPGLPGEPGPVGGGGHPGQPGPPG 1164

Query: 3241 ERAKPRARSTPS--------NPDGAATPDSASATALA----DAGSPGPPRT--TPSPSPD 3286
            E+ KP     P            G   P       L+    D G PG P     P P  +
Sbjct: 1165 EKGKPGQDGIPGPAGQKGEPGQPGFGNPGPPGLPGLSGQKGDGGLPGIPGNPGLPGPKGE 1224

Query: 3287 PWAGGEPLLQATP 3299
            P   G P +Q  P
Sbjct: 1225 PGFHGFPGVQGPP 1237



 Score = 33.9 bits (76), Expect = 3.3
 Identities = 33/121 (27%), Positives = 43/121 (35%), Gaps = 16/121 (13%)

Query: 3186 LPG--GLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPW-----GQEGEAKKDS 3238
            LPG  GL G   +   +  +  P P+   G        G PG P      G +G+    S
Sbjct: 1013 LPGQPGLIGPPGLKGTIGDMGFPGPQGVEGPPGPSGVPGQPGSPGLPGQKGDKGDPGISS 1072

Query: 3239 PGERAKPRARSTPSNPDGAATPDSASATALADAGSPGPPRTTPSPSPDPWAGGEPLLQAT 3298
             G    P  +  P  P     P      ++ D G PG P T       P A G+P L   
Sbjct: 1073 IGLPGLPGPKGEPGLPGYPGNPGIKG--SVGDPGLPGLPGT-------PGAKGQPGLPGF 1123

Query: 3299 P 3299
            P
Sbjct: 1124 P 1124



 Score = 33.1 bits (74), Expect = 5.6
 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 3/55 (5%)

Query: 1232 PGLLIPEQPPPSRH---DTGTPKPSGSLANTAPHGSSPTPGVGSLLGGPGGTQAP 1283
            PG   PE PP  R    D G P P G      P G    PG   L G PG   AP
Sbjct: 62   PGFPGPEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAP 116


>gi|15890088 type IV collagen alpha 5 isoform 3 precursor [Homo
            sapiens]
          Length = 1688

 Score =  101 bits (252), Expect = 1e-20
 Identities = 326/1413 (23%), Positives = 429/1413 (30%), Gaps = 239/1413 (16%)

Query: 1    MPGERPRGAPPPTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQAMEL 60
            +PG  P G P P   G   P  +   PG P  P  + N       +G +   G+ Q ++ 
Sbjct: 184  LPG--PTGIPGPI--GPPGPPGLMGPPGPPGLPGPKGNMGLN--FQGPKGEKGE-QGLQG 236

Query: 61   PEAQPRQARDGELKPPSLRGQ-APSSTPGKRGSPQTPPGRSPLQAPSRLAGRA--EGSPP 117
            P   P Q  + + +P  +  Q      PG RG P  P  R P   P    G    +G P 
Sbjct: 237  PPGPPGQISE-QKRPIDVEFQKGDQGLPGDRGPPGPPGIRGPPGPPGGEKGEKGEQGEPG 295

Query: 118  QRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGL--PRTEAQPAA 175
            +R   G      +P +   P +P        + +  Q   TG P  PGL  PR       
Sbjct: 296  KRGKPGKDGENGQPGIPGLPGDPGYPGEPGRDGEKGQKGDTGPPGPPGLVIPRPGTGITI 355

Query: 176  EELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSW 235
             E G       P           P     P  PGPP +    P  P  +P  +    D  
Sbjct: 356  GEKGN---IGLPGLPGEKGERGFPGIQGPPGLPGPPGAAVMGPPGPPGFPGERGQKGDEG 412

Query: 236  PPAAENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPADVAGH 295
            PP      P    G P A   P P G  P G     S +   P   G    P    + G 
Sbjct: 413  PPGISIPGPPGLDGQPGAPGLPGPPG--PAGPHIPPSDEICEPGPPGPPGSPGDKGLQGE 470

Query: 296  AFTNGPLVFAFHQPQGAWPEEAVGTGPAYP-----LPTQPAPSPLPCYQGQPG------- 343
                G         +G      +GTG + P     LP  P P     + GQ G       
Sbjct: 471  QGVKG--------DKGDTCFNCIGTGISGPPGQPGLPGLPGPPGSLGFPGQKGEKGQAGA 522

Query: 344  -GLNRHSDLSGALSSPGAAHSAPRP-----------FSDSLHKSLTKILPERPPS-AQDG 390
             G      + GA  +PG   S   P               L       LP  P +  QDG
Sbjct: 523  TGPKGLPGIPGAPGAPGFPGSKGEPGDILTFPGMKGDKGELGSPGAPGLPGLPGTPGQDG 582

Query: 391  LGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDT--ELAAPGPPPARLP---------- 438
            L    GP        F G+     G   +PG P     +   GPP    P          
Sbjct: 583  LPGLPGPKGEPGGITFKGE----RGPPGNPGLPGLPGNIGPMGPPGFGPPGPVGEKGIQG 638

Query: 439  QLWDPTAAPYPTPPGGP---LAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLP------ 489
               +P     P P G P   +         G P     + LP    LP    LP      
Sbjct: 639  VAGNPGQPGIPGPKGDPGQTITQPGKPGLPGNPGRDGDVGLPGDPGLPGQPGLPGIPGSK 698

Query: 490  -------TARPSPHGMEMLSRLPFPAGGPEWQG--GSQGALGTAGKTPGPREKLPAVRSS 540
                      P P G +    +P P G P   G  G +G  G  G  PGP+ +       
Sbjct: 699  GEPGIPGIGLPGPPGPKGFPGIPGPPGAPGTPGRIGLEGPPGPPG-FPGPKGEPGFALPG 757

Query: 541  QGGSPALFTYNGMTDPGAQPLFFGVAQP--------------QVSPHGTPS-LPPPRVVG 585
              G P L  + G   P     F G   P               V P+G P  + PP + G
Sbjct: 758  PPGPPGLPGFKGALGPKGDRGFPGPPGPPGRTGLDGLPGPKGDVGPNGQPGPMGPPGLPG 817

Query: 586  ----ASPSESPLPSPATNTA-----GSTCSSLSPMSSSPANPSSEESQ----LPGPLGPS 632
                  P    +P P          G       P    P  P    S      PGP+GP 
Sbjct: 818  IGVQGPPGPPGIPGPIGQPGLHGIPGEKGDPGPPGLDVPGPPGERGSPGIPGAPGPIGPP 877

Query: 633  AFFHPPTHPQETG-SPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFP 691
                 P  P + G S FP  +    +     P      P  +   G +G      +   P
Sbjct: 878  G---SPGLPGKAGASGFPGTKGEMGMMGPPGPPGPLGIPGRSGVPGLKGDDGLQGQPGLP 934

Query: 692  HEGPEVGRGGLQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQ 751
                E G  G  G P   PP P     L S             + +     +      + 
Sbjct: 935  GPTGEKGSKGEPGLP--GPPGPMDPNLLGSKG----------EKGEPGLPGIPGVSGPKG 982

Query: 752  FCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGD---AQAEGK 808
            + GL     + G    PG PG P P   P +P     GL+         GD      +G 
Sbjct: 983  YQGLPGDPGQPGLSGQPGLPGPPGPKGNPGLP--GQPGLIGPPGLKGTIGDMGFPGPQGV 1040

Query: 809  DDPLRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVF 868
            + P     +P    +P  LP    D + D  + S+    L G + +   P    +     
Sbjct: 1041 EGPPGPSGVPGQPGSP-GLPGQKGD-KGDPGISSIGLPGLPGPKGEPGLPGYPGN----- 1093

Query: 869  ADEEPSGPRGPSSGHPLKSKAGVTPESKAPPPLPA--ATPDPQTPR-----PGDRGCPAR 921
                  G +G S G P       TP +K  P LP    TP P  P+     PG+ G P  
Sbjct: 1094 -----PGIKG-SVGDPGLPGLPGTPGAKGQPGLPGFPGTPGPPGPKGISGPPGNPGLP-- 1145

Query: 922  GRPKTRSLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPR 981
            G P     G  P +   P  G + + G+                G G+ G     GL  +
Sbjct: 1146 GEPGPVGGGGHPGQPGPP--GEKGKPGQDGIPGPAGQKGEPGQPGFGNPGPPGLPGLSGQ 1203

Query: 982  RNDGLGERPPPRPRRPRTQA-PGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRK 1040
            + DG     P  P  P  +  PG    P  + P                 PP        
Sbjct: 1204 KGDGGLPGIPGNPGLPGPKGEPGFHGFPGVQGPPG---------------PP-------- 1240

Query: 1041 ARGGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRGPGFRGRRGRGEKRKEVELTQ 1100
               G+ G  L                  +     Q PP  PGF+G  G           +
Sbjct: 1241 ---GSPGPAL---------------EGPKGNPGPQGPPGRPGFQGLPG----------PE 1272

Query: 1101 GPREDEPQKPRKAA-RQEAGGDGAPANPEEPG--GSRPGPGRSPQARGPSRSLETGAAAR 1157
            GP    P  P     + E G  G P  P  PG  G +  PG       P R    G    
Sbjct: 1273 GP----PGLPGNGGIKGEKGNPGQPGLPGLPGLKGDQGPPGLQ---GNPGRPGLNGMKGD 1325

Query: 1158 EGGPKCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEAL 1217
             G P     P +  K P  VP +     E  P L  P     P       P         
Sbjct: 1326 PGLPGVPGFPGM--KGPSGVPGS--AGPEGEPGLIGP-----PGPPGLPGPSGQSIIIKG 1376

Query: 1218 RSPPAACAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSLLGGP 1277
             + P    G+ G   GL  P+ P       G P P+G   +   +G     G G   G P
Sbjct: 1377 DAGPPGIPGQPGLK-GLPGPQGP------QGLPGPTGPPGDPGRNGLPGFDGAGGRKGDP 1429

Query: 1278 GGTQAPVSHNSKDPPARQPGEFLAPVANPSSTA 1310
            G    P +     PP   P     P   P +++
Sbjct: 1430 GLPGQPGTRGLDGPPG--PDGLQGPPGPPGTSS 1460



 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 372/1580 (23%), Positives = 470/1580 (29%), Gaps = 321/1580 (20%)

Query: 2    PGERPR----GAP-PPTMTGDLQPRQVASSPGHPSQP--PLEDNTPATRTTKGAREAGGQ 54
            PG R +    G P PP   G   P  +   PG P  P  P  D  P  +   G     G+
Sbjct: 71   PGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQGIPGCNGTKGE 130

Query: 55   AQAMELPEAQPRQARDGELKPPSLRGQAPS----STPGKRGSP--QTPPGRSPLQAPSRL 108
                  P     Q   G    P ++G+  S    S PG +G+P    PPG   L  P+ +
Sbjct: 131  RGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGNPGYPGPPGIQGLPGPTGI 190

Query: 109  AGRAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPR 168
             G      P     G+      P L     N  L   Q P+ +  +    G P  PG   
Sbjct: 191  PGPIGPPGPP----GLMGPPGPPGLPGPKGNMGLNF-QGPKGEKGEQGLQGPPGPPGQIS 245

Query: 169  TEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQ 228
             + +P   E  F +  Q  P               R P PGPP  RG     PG      
Sbjct: 246  EQKRPIDVE--FQKGDQGLPGD-------------RGP-PGPPGIRGP----PG------ 279

Query: 229  ASGADSWPPAAENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPF 288
                   PP  E    G   G P    +P   G    G P G+      P   G   +  
Sbjct: 280  -------PPGGEKGEKGEQ-GEPGKRGKPGKDGEN--GQP-GIPGLPGDPGYPGEPGRDG 328

Query: 289  PADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPGGLNRH 348
                 G     GP      +P         G      LP +      P  QG PG     
Sbjct: 329  EKGQKGDTGPPGPPGLVIPRPGTGITIGEKGNIGLPGLPGEKGERGFPGIQGPPG----- 383

Query: 349  SDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERPPS--AQDGLGSTRGPPSSLPQRHF 406
              L G    PGAA   P                  PP    + G     GPP        
Sbjct: 384  --LPGP---PGAAVMGP----------------PGPPGFPGERGQKGDEGPPGI----SI 418

Query: 407  PGQAYRASGVDTSPGPPDTELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNG 466
            PG      G+D  PG P      PGPP    P +        P PPG P +         
Sbjct: 419  PGPP----GLDGQPGAP----GLPGPPGPAGPHIPPSDEICEPGPPGPPGSPGDKGLQGE 470

Query: 467  QPSPGQR--LCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTA 524
            Q   G +   C            + T    P G   L  LP P G   + G  +G  G A
Sbjct: 471  QGVKGDKGDTCF---------NCIGTGISGPPGQPGLPGLPGPPGSLGFPG-QKGEKGQA 520

Query: 525  GKTPGPREKLPAVRSSQGGSPALFTYNGMTDPGAQPLFFGVA--QPQVSPHGTPSLPPPR 582
            G T GP+  LP +  + G +P      G  +PG    F G+   + ++   G P LP   
Sbjct: 521  GAT-GPKG-LPGIPGAPG-APGFPGSKG--EPGDILTFPGMKGDKGELGSPGAPGLPGLP 575

Query: 583  VVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPG---PLGPSAFFHPPT 639
                      LP P     G T         +P  P      LPG   P+GP  F  P  
Sbjct: 576  GTPGQDGLPGLPGPKGEPGGITFKGERGPPGNPGLPG-----LPGNIGPMGPPGFGPPGP 630

Query: 640  -----------HPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEET 688
                       +P + G P P  +P  ++    +P      P     +G  G      + 
Sbjct: 631  VGEKGIQGVAGNPGQPGIPGPKGDPGQTITQPGKPG-LPGNPGRDGDVGLPGDPGLPGQP 689

Query: 689  PFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLA 748
              P      G  G+ G     PP P     +                             
Sbjct: 690  GLPGIPGSKGEPGIPGIGLPGPPGPKGFPGIPGPP------------------------- 724

Query: 749  HRQFCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGK 808
                 G      + G +  PGPPG P P   P                F L G     G 
Sbjct: 725  -----GAPGTPGRIGLEGPPGPPGFPGPKGEPG---------------FALPGPPGPPGL 764

Query: 809  DDPLRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVF 868
              P   G L       FP P           LD L              P+         
Sbjct: 765  --PGFKGALGPKGDRGFPGPPGP---PGRTGLDGL------------PGPK--------- 798

Query: 869  ADEEPSGPRGPSSGHPLKSKAGVTPESKAPPPLPAATPDPQTPRPGDRGCPA-RGRPKTR 927
             D  P+G  GP  G P     GV       PP P   P P   +PG  G P  +G P   
Sbjct: 799  GDVGPNGQPGPM-GPPGLPGIGVQG-----PPGPPGIPGP-IGQPGLHGIPGEKGDPGPP 851

Query: 928  SLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLG 987
             L +     +  S G     G             G     G  G   ASG  P     +G
Sbjct: 852  GLDVPGPPGERGSPGIPGAPGPI-----------GPPGSPGLPGKAGASGF-PGTKGEMG 899

Query: 988  ERPPPRPRRP-----RTQAPGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKAR 1042
               PP P  P     R+  PG + D    +     LP  T     +  P    P      
Sbjct: 900  MMGPPGPPGPLGIPGRSGVPGLKGDDG--LQGQPGLPGPTGEKGSKGEPGLPGPP----- 952

Query: 1043 GGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRGPGFRGRRGRGEKRKEVELTQGP 1102
             G     L+                S+ E+ E   P  PG  G +G           QG 
Sbjct: 953  -GPMDPNLL---------------GSKGEKGEPGLPGIPGVSGPKGY----------QGL 986

Query: 1103 REDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLE-TGAAAREGGP 1161
              D  Q          G  G   NP  PG  +PG    P  +G    +   G    EG P
Sbjct: 987  PGDPGQPGLSGQPGLPGPPGPKGNPGLPG--QPGLIGPPGLKGTIGDMGFPGPQGVEGPP 1044

Query: 1162 KCADRPSVAPKDPLQVPTNTETSEETRPSLD------FPQEAKEPETAEESAPDSTEFTE 1215
                 PS  P  P       +  ++  P +        P    EP       P +     
Sbjct: 1045 G----PSGVPGQPGSPGLPGQKGDKGDPGISSIGLPGLPGPKGEPGLP--GYPGNPGIKG 1098

Query: 1216 ALRSPPA-ACAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSLL 1274
            ++  P      G  GA     +P  P       GTP P G    + P G+   PG    +
Sbjct: 1099 SVGDPGLPGLPGTPGAKGQPGLPGFP-------GTPGPPGPKGISGPPGNPGLPGEPGPV 1151

Query: 1275 GGPG--GTQAPVSHNSK------DPPARQPGEFLAP-VANPSSTACPKPSVLSSKISSFG 1325
            GG G  G   P     K        PA Q GE   P   NP     P    LS +    G
Sbjct: 1152 GGGGHPGQPGPPGEKGKPGQDGIPGPAGQKGEPGQPGFGNPGPPGLPG---LSGQKGDGG 1208

Query: 1326 CDPAGFNRDPLGVPVAKKGPQPYSSPHSELFLGPKDLAGCFLEELHPKPSARDAPPASSS 1385
                G   +P G+P  K  P  +  P  +   GP    G  LE     P  +  PP    
Sbjct: 1209 L--PGIPGNP-GLPGPKGEPGFHGFPGVQGPPGPPGSPGPALEGPKGNPGPQ-GPPGRPG 1264

Query: 1386 CLCQDGEDAGSLEPQLPRSPPGTAETEPGRAASP-----PTLESSSLFPDLPVDRFDPPL 1440
                 G +     P LP +  G  + E G    P     P L+     P L  +   P L
Sbjct: 1265 FQGLPGPEG---PPGLPGN--GGIKGEKGNPGQPGLPGLPGLKGDQGPPGLQGNPGRPGL 1319

Query: 1441 YGSLSANRDSGLPFACADPPQKTVPSDPPYPSFLLLEE--VSPMLPSHFPDLSGGKVLSK 1498
             G      D GLP     P  K  PS  P  +    E   + P  P   P  SG  ++ K
Sbjct: 1320 NG---MKGDPGLPGVPGFPGMKG-PSGVPGSAGPEGEPGLIGPPGPPGLPGPSGQSIIIK 1375

Query: 1499 --TCPPERTVVPGAAPSLPG 1516
                PP     PG    LPG
Sbjct: 1376 GDAGPPGIPGQPG-LKGLPG 1394



 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 315/1313 (23%), Positives = 396/1313 (30%), Gaps = 207/1313 (15%)

Query: 309  PQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPG--GLNRHSDLSGALSSPGA-AHSAP 365
            P+G   ++ +  GP  P   +  P  LP + G PG  G+  H    G    PG       
Sbjct: 73   PRGQKGDDGI-PGPPGPKGIRGPPG-LPGFPGTPGLPGMPGHDGAPGPQGIPGCNGTKGE 130

Query: 366  RPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDT 425
            R F  S         P  P     GL    GPP     +  PG    +S     PGP   
Sbjct: 131  RGFPGS---------PGFP-----GLQGPPGPPGIPGMKGEPGSIIMSS----LPGPKGN 172

Query: 426  ELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLP-------- 477
                PGPP   +  L  PT  P P  P GP          G P P   + L         
Sbjct: 173  P-GYPGPPG--IQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEK 229

Query: 478  -----QSAPLPWPQVLPTARP----------------SPHGMEMLSRLPFPAGGPEWQGG 516
                 Q  P P  Q+    RP                 P G   +   P P GG + + G
Sbjct: 230  GEQGLQGPPGPPGQISEQKRPIDVEFQKGDQGLPGDRGPPGPPGIRGPPGPPGGEKGEKG 289

Query: 517  SQGALGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTDPG--AQPLFFGVAQPQVSPHG 574
             QG  G  GK PG        +  + G P +    G  DPG   +P   G  + Q    G
Sbjct: 290  EQGEPGKRGK-PG--------KDGENGQPGIPGLPG--DPGYPGEPGRDG-EKGQKGDTG 337

Query: 575  TPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAF 634
             P   PP +V        +P P T   G T      +          E   PG  GP   
Sbjct: 338  PPG--PPGLV--------IPRPGT---GITIGEKGNIGLPGLPGEKGERGFPGIQGPPGL 384

Query: 635  FHPPTHPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEG 694
              PP      G P P   P        +  P  + P P  GL  +     L   P P  G
Sbjct: 385  PGPP-GAAVMGPPGPPGFPGERGQKGDEGPPGISIPGP-PGLDGQPGAPGLPGPPGP-AG 441

Query: 695  PEVGRGGLQGFPRAP-PPYPTHHFSLSSASLDQLDVLLTCRQC-------DRNYSSLAAF 746
            P +        P  P PP       L      + D   TC  C             L   
Sbjct: 442  PHIPPSDEICEPGPPGPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGISGPPGQPGLPGL 501

Query: 747  LAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPA-DAHAGLLSHAKTFL-LAGDAQ 804
                   G    + + G   + GP GLP  P AP  P      G      TF  + GD  
Sbjct: 502  PGPPGSLGFPGQKGEKGQAGATGPKGLPGIPGAPGAPGFPGSKGEPGDILTFPGMKGDKG 561

Query: 805  AEGKDDPLRTGFLPSLAATPFP--LPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDS 862
              G   P   G LP L  TP    LP       +   +         G      NP +  
Sbjct: 562  ELG--SPGAPG-LPGLPGTPGQDGLPGLPGPKGEPGGI------TFKGERGPPGNPGLPG 612

Query: 863  SFIDVFADEEPS-GPRGPSSGHPLKSKAGVTPESKAPPPLPAATPDP-----QTPRPGDR 916
               ++     P  GP GP     ++  AG    +   P +P    DP     Q  +PG  
Sbjct: 613  LPGNIGPMGPPGFGPPGPVGEKGIQGVAG----NPGQPGIPGPKGDPGQTITQPGKPGLP 668

Query: 917  GCPAR----GRPKTRSLGLAPTEADAP-SQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGG 971
            G P R    G P    L   P     P S+G     G  L          G     G+ G
Sbjct: 669  GNPGRDGDVGLPGDPGLPGQPGLPGIPGSKGEPGIPGIGLPGPPGPKGFPGIPGPPGAPG 728

Query: 972  GGRASGLRPRRNDGLGERPPPRPRRPRTQA-PGSRADPAPRVPRAAALPEETRSSRRRRL 1030
                 GL         E PP  P  P  +  PG      P  P              R  
Sbjct: 729  TPGRIGL---------EGPPGPPGFPGPKGEPGFALPGPPGPPGLPGFKGALGPKGDRGF 779

Query: 1031 PPRKDPRKRKARGGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRGPGFRGRRGRG 1090
            P    P  R    G  G +  +    Q   +          +    PP  PG  G+ G  
Sbjct: 780  PGPPGPPGRTGLDGLPGPKGDVGPNGQPGPMGPPGLPGIGVQGPPGPPGIPGPIGQPGLH 839

Query: 1091 EKRKEVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSL 1150
                E      P  D P  P    R   G  GAP  P  P GS   PG++  +  P    
Sbjct: 840  GIPGEKGDPGPPGLDVPGPP--GERGSPGIPGAP-GPIGPPGSPGLPGKAGASGFPGTKG 896

Query: 1151 ETGAAAREGG------PKCADRPSVAPKDPLQ----VPTNT-ETSEETRPSLDFPQEAKE 1199
            E G     G       P  +  P +   D LQ    +P  T E   +  P L  P    +
Sbjct: 897  EMGMMGPPGPPGPLGIPGRSGVPGLKGDDGLQGQPGLPGPTGEKGSKGEPGLPGPPGPMD 956

Query: 1200 P-------ETAEESAP-----DSTEFTEALRSPPAACAGEMGAS--PGLLIPEQP----- 1240
            P       E  E   P        +  + L   P    G+ G S  PGL  P  P     
Sbjct: 957  PNLLGSKGEKGEPGLPGIPGVSGPKGYQGLPGDP----GQPGLSGQPGLPGPPGPKGNPG 1012

Query: 1241 -PPSRHDTGTPKPSGSLAN---TAPHGSSPTPGVGSLLGGPGGTQAPVSHNSKDPPARQ- 1295
             P      G P   G++ +     P G    PG   + G PG    P     K  P    
Sbjct: 1013 LPGQPGLIGPPGLKGTIGDMGFPGPQGVEGPPGPSGVPGQPGSPGLPGQKGDKGDPGISS 1072

Query: 1296 ---PGEFLAPVANPSSTACPKPSVLSSKISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPH 1352
               PG    P   P     P    +   +     DP G    P G P AK  P     P 
Sbjct: 1073 IGLPG-LPGPKGEPGLPGYPGNPGIKGSVG----DP-GLPGLP-GTPGAKGQPGLPGFPG 1125

Query: 1353 SELFLGPKDLAGCFLEELHPKPSARDAPPASSSCLCQDGEDAGSLEPQLPRSPPGTAETE 1412
            +    GPK ++G               PP +     + G   G   P  P  PPG  + +
Sbjct: 1126 TPGPPGPKGISG---------------PPGNPGLPGEPGPVGGGGHPGQP-GPPG-EKGK 1168

Query: 1413 PGRAASPPTLESSSLFPDLPVDRFDPPLYGSLSANR-DSGLPFACADPPQKTVPSDPPYP 1471
            PG+   P                  PP    LS  + D GLP    +P       +P + 
Sbjct: 1169 PGQDGIPGPAGQKGEPGQPGFGNPGPPGLPGLSGQKGDGGLPGIPGNPGLPGPKGEPGFH 1228

Query: 1472 SFLLLEEVSPMLPSHFPDLSGGK-VLSKTCPPERTVV-----PGAAPSLPGKG 1518
             F  ++       S  P L G K       PP R        P   P LPG G
Sbjct: 1229 GFPGVQGPPGPPGSPGPALEGPKGNPGPQGPPGRPGFQGLPGPEGPPGLPGNG 1281



 Score = 59.3 bits (142), Expect = 7e-08
 Identities = 120/461 (26%), Positives = 144/461 (31%), Gaps = 88/461 (19%)

Query: 20   PRQVASSPGHPSQPPLEDNT--PATRTTKGAREAGGQAQAMELPEAQPRQARDGELKPPS 77
            P+     PG+P  P ++ +   P      G   A GQ      P         G   PP 
Sbjct: 1081 PKGEPGLPGYPGNPGIKGSVGDPGLPGLPGTPGAKGQPGLPGFP---------GTPGPPG 1131

Query: 78   LRG-QAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRYILGIASSRTKPTLDET 136
             +G   P   PG  G P    G      P     +  G P Q  I G A  + +P     
Sbjct: 1132 PKGISGPPGNPGLPGEPGPVGGGGHPGQPGPPGEK--GKPGQDGIPGPAGQKGEPG---Q 1186

Query: 137  PENPQLEAAQLPEVDTPQGPG--TGAPLRPGLPRTEAQPAAEELGFHRC--FQEPPSSFT 192
            P         LP +   +G G   G P  PGLP  + +P     GFH     Q PP    
Sbjct: 1187 PGFGNPGPPGLPGLSGQKGDGGLPGIPGNPGLPGPKGEP-----GFHGFPGVQGPPG--- 1238

Query: 193  STNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPAAENSFPGANFGVP- 251
                  P  +P P   GP  + G  P  P   P +Q       PP      PG N G+  
Sbjct: 1239 ------PPGSPGPALEGPKGNPG--PQGPPGRPGFQGLPGPEGPPG----LPG-NGGIKG 1285

Query: 252  ----PAEPE-PIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAF 306
                P +P  P   G +    P G+      P L+G    P    V G     GP     
Sbjct: 1286 EKGNPGQPGLPGLPGLKGDQGPPGLQGNPGRPGLNGMKGDPGLPGVPGFPGMKGPSGV-- 1343

Query: 307  HQPQGAWPEEAVGT-GPAYPLPTQPAPSPLPCY---QGQPGGLNRHSDLSGALSSPGAAH 362
              P  A PE   G  GP  P P  P PS           P G+     L G L  P    
Sbjct: 1344 --PGSAGPEGEPGLIGPPGP-PGLPGPSGQSIIIKGDAGPPGIPGQPGLKG-LPGPQGPQ 1399

Query: 363  SAPRPFSDSLHKSLTKILPERPPSAQ-----DGLGSTRGPPSSLPQRHFPGQAYRAS--- 414
              P P             P   P        DG G  +G P        PGQ        
Sbjct: 1400 GLPGPTG-----------PPGDPGRNGLPGFDGAGGRKGDPG------LPGQPGTRGLDG 1442

Query: 415  -----GVDTSPGPPDTELAAPGPPPARLPQLWDPTAAPYPT 450
                 G+   PGPP T   A G    R  Q  D    P  T
Sbjct: 1443 PPGPDGLQGPPGPPGTSSVAHGFLITRHSQTTDAPQCPQGT 1483



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 117/458 (25%), Positives = 144/458 (31%), Gaps = 74/458 (16%)

Query: 3425 VRRPGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLC 3484
            + +PG PG     L G  P +   V +PG    PG+   P  G      E  +P +    
Sbjct: 659  ITQPGKPG-----LPGN-PGRDGDVGLPGDPGLPGQPGLP--GIPGSKGEPGIPGI---- 706

Query: 3485 SEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGDCALD 3544
                P   KG+P     P  P T    G E P      P P   P   AL    G   L 
Sbjct: 707  GLPGPPGPKGFPGIPGPPGAPGTPGRIGLEGPPGPPGFPGPKGEP-GFALPGPPGPPGLP 765

Query: 3545 G---ALERPENEASPGSPGPLLQQALPLGASLPRP----GARGQDAEGKRAPLVFSGKRR 3597
            G   AL    +   PG PGP  +  L     LP P    G  GQ        L   G + 
Sbjct: 766  GFKGALGPKGDRGFPGPPGPPGRTGLD---GLPGPKGDVGPNGQPGPMGPPGLPGIGVQG 822

Query: 3598 APGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSA 3657
             PG  G   P      H +  EK       +   GP G   +GS   P            
Sbjct: 823  PPGPPGIPGPIGQPGLHGIPGEKGDPGPPGLDVPGPPG--ERGSPGIPG----------- 869

Query: 3658 ASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTKTG 3717
            A  P      P  P KA  S  PG     T+  M    P   PGP      S  PG K  
Sbjct: 870  APGPIGPPGSPGLPGKAGASGFPG-----TKGEMGMMGPPGPPGPLGIPGRSGVPGLKGD 924

Query: 3718 GGSQPQPA-------SGQLQSETATTPAKPSFPS--------RSPAPERLPARAQAKSCT 3762
             G Q QP         G         P  P  P+          P    +P  +  K   
Sbjct: 925  DGLQGQPGLPGPTGEKGSKGEPGLPGPPGPMDPNLLGSKGEKGEPGLPGIPGVSGPKGYQ 984

Query: 3763 KGPREAGEQGPHGSLG----PKEKGESSTKRKKGQVPGPARSESVGSFG-RAPSAPDKPP 3817
              P + G+ G  G  G    P  KG      + G +  P    ++G  G   P   + PP
Sbjct: 985  GLPGDPGQPGLSGQPGLPGPPGPKGNPGLPGQPGLIGPPGLKGTIGDMGFPGPQGVEGPP 1044

Query: 3818 RTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPG 3855
                    PS V      P     P  P  +  K +PG
Sbjct: 1045 -------GPSGV------PGQPGSPGLPGQKGDKGDPG 1069



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 170/687 (24%), Positives = 226/687 (32%), Gaps = 102/687 (14%)

Query: 871  EEPSGPRGPSSGHPLKSKAGVTPES-KAPPPLPAATPDPQTP-RPGDRGCPA-RGRPKTR 927
            E P GPRG      +    G  P+  + PP LP     P  P  PG  G P  +G P   
Sbjct: 68   EGPPGPRGQKGDDGIPGPPG--PKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQGIP--- 122

Query: 928  SLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLR-PRRNDGL 986
              G   T+ +    G     G Q           G     G  G    S L  P+ N G 
Sbjct: 123  --GCNGTKGERGFPGSPGFPGLQ-----GPPGPPGIPGMKGEPGSIIMSSLPGPKGNPGY 175

Query: 987  GERPPPRPRRPRTQAPGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAW 1046
               P  +     T  PG    P P        P      +       + P+  K   G  
Sbjct: 176  PGPPGIQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEKGEQGLQ 235

Query: 1047 GKELILKIVQQKNRLREYDFASESE--EDEQPPPRGPGFRGRRG--RGEKRKEVELTQGP 1102
            G       + ++ R  + +F    +    ++ PP  PG RG  G   GEK ++ E     
Sbjct: 236  GPPGPPGQISEQKRPIDVEFQKGDQGLPGDRGPPGPPGIRGPPGPPGGEKGEKGE----- 290

Query: 1103 REDEPQKPRKAARQ-EAGGDGAPANPEEPGGSRPG-PGRSPQARGPSRSLETGAAAREG- 1159
             + EP K  K  +  E G  G P  P +PG   PG PGR  +     +  +TG     G 
Sbjct: 291  -QGEPGKRGKPGKDGENGQPGIPGLPGDPG--YPGEPGRDGE---KGQKGDTGPPGPPGL 344

Query: 1160 -GPKCADRPSVAPKDPLQVP-TNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEAL 1217
              P+     ++  K  + +P    E  E   P +  P     P  A    P         
Sbjct: 345  VIPRPGTGITIGEKGNIGLPGLPGEKGERGFPGIQGPPGLPGPPGAAVMGPPG------- 397

Query: 1218 RSPPAACAGEMG-----ASPGLLIPEQP-----PPSRHDTGTPKPSG-------SLANTA 1260
               P    GE G       PG+ IP  P     P +    G P P+G        +    
Sbjct: 398  ---PPGFPGERGQKGDEGPPGISIPGPPGLDGQPGAPGLPGPPGPAGPHIPPSDEICEPG 454

Query: 1261 PHGSSPTPGVGSLLGGPG--GTQAPVSHN----SKDPPARQPGEFLAPVANPSSTACPKP 1314
            P G   +PG   L G  G  G +     N        P  QPG    P   P S   P  
Sbjct: 455  PPGPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGISGPPGQPGLPGLP-GPPGSLGFPGQ 513

Query: 1315 SVLSSKISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSEL-FLGPKDLAGCFLEELHPK 1373
                 +  + G  P G    P G P A   P     P   L F G K   G    EL   
Sbjct: 514  KGEKGQAGATG--PKGLPGIP-GAPGAPGFPGSKGEPGDILTFPGMKGDKG----EL-GS 565

Query: 1374 PSARDAPPASSSCLCQDGEDAGSLEPQLPRSPPG--TAETEPGRAASPPTLESSSLFPDL 1431
            P A   P    +     G+D     P  P+  PG  T + E G   +P         P L
Sbjct: 566  PGAPGLPGLPGT----PGQDGLPGLPG-PKGEPGGITFKGERGPPGNPG-------LPGL 613

Query: 1432 P--VDRFDPPLYGSLSANRDSGLPFACADPPQKTVPSDPPYPSFLLLEEVSPMLPSHFPD 1489
            P  +    PP +G      + G+     +P Q  +P     P   + +   P LP + P 
Sbjct: 614  PGNIGPMGPPGFGPPGPVGEKGIQGVAGNPGQPGIPGPKGDPGQTITQPGKPGLPGN-PG 672

Query: 1490 LSGGKVLSKTCPPERTVVPGAAPSLPG 1516
              G   L     P    +PG  P LPG
Sbjct: 673  RDGDVGL-----PGDPGLPG-QPGLPG 693



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 113/463 (24%), Positives = 147/463 (31%), Gaps = 74/463 (15%)

Query: 3432 GQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEVAPST 3491
            G K    E   P       +PG  PGP E  P PRG      +  +P          P  
Sbjct: 42   GIKGEKGERGFPGLEGHPGLPGF-PGP-EGPPGPRGQK---GDDGIPGPPGPKGIRGPPG 96

Query: 3492 TKGWPETLERPV------DPVTHPIRGCELPSNHQECPP----PSLS--PFPAALADGRG 3539
              G+P T   P        P    I GC      +  P     P L   P P  +   +G
Sbjct: 97   LPGFPGTPGLPGMPGHDGAPGPQGIPGCNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKG 156

Query: 3540 DCALDGALERPENEASPGSPGPLLQQALPLGASLP-------------RPGARGQDAEGK 3586
            +         P  + +PG PGP   Q LP    +P              PG  G      
Sbjct: 157  EPGSIIMSSLPGPKGNPGYPGPPGIQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKG 216

Query: 3587 RAPLVFSGKRRAPGARGRCAP-----DHFQEDHLLQKEKEVSSSHMVSEGGPRG-TFHKG 3640
               L F G +   G +G   P        ++   +  E +     +  + GP G    +G
Sbjct: 217  NMGLNFQGPKGEKGEQGLQGPPGPPGQISEQKRPIDVEFQKGDQGLPGDRGPPGPPGIRG 276

Query: 3641 SATKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLA-----PGELARGTENGMKPAT 3695
                P G +    ++       K  K   + +  +  L      PGE  R  E G K  T
Sbjct: 277  PPGPPGGEKGEKGEQGEPGKRGKPGKDGENGQPGIPGLPGDPGYPGEPGRDGEKGQKGDT 336

Query: 3696 PKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPAR 3755
                PGP   G   PRPGT    G +       L  E      +  FP     P  LP  
Sbjct: 337  --GPPGP--PGLVIPRPGTGITIGEKGNIGLPGLPGE----KGERGFPG-IQGPPGLP-- 385

Query: 3756 AQAKSCTKGPREAGEQGPHGSLG-PKEKGESSTKRKKG-QVPGPARSESVGSFGRAPSAP 3813
                    GP  A   GP G  G P E+G+   +   G  +PGP   +        P AP
Sbjct: 386  --------GPPGAAVMGPPGPPGFPGERGQKGDEGPPGISIPGPPGLDG------QPGAP 431

Query: 3814 DKP-PRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPG 3855
              P P  P     P      +P P     P PP S   K   G
Sbjct: 432  GLPGPPGPAGPHIPPSDEICEPGP-----PGPPGSPGDKGLQG 469



 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 119/518 (22%), Positives = 164/518 (31%), Gaps = 84/518 (16%)

Query: 3419 PFAFRGVRRPGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLP 3478
            P  ++G+  PG PGQ   + +  LP        PG    PG   PP  G    + +   P
Sbjct: 980  PKGYQGL--PGDPGQPGLSGQPGLPGPPGPKGNPGLPGQPGLIGPP--GLKGTIGDMGFP 1035

Query: 3479 ALLHLCSEVAPSTTKGWPETLERPV------DPVTHPIRGCELPSNHQECPPPSLSPFPA 3532
                +     PS   G P +   P       DP    I    LP    E   P L  +P 
Sbjct: 1036 GPQGVEGPPGPSGVPGQPGSPGLPGQKGDKGDPGISSIGLPGLPGPKGE---PGLPGYP- 1091

Query: 3533 ALADGRGDCALDGALERPENEASPGSPGPLLQQALPLGASLP-RPGARG-------QDAE 3584
                  G+  + G++  P     PG+PG   Q  LP     P  PG +G           
Sbjct: 1092 ------GNPGIKGSVGDPGLPGLPGTPGAKGQPGLPGFPGTPGPPGPKGISGPPGNPGLP 1145

Query: 3585 GKRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATK 3644
            G+  P+   G    PG  G        E     ++     +    E G  G  + G    
Sbjct: 1146 GEPGPVGGGGHPGQPGPPG--------EKGKPGQDGIPGPAGQKGEPGQPGFGNPG---- 1193

Query: 3645 PAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSS 3704
            P G    S  +     P      P +P        PG    G      P  P   PGP+ 
Sbjct: 1194 PPGLPGLSGQKGDGGLPG----IPGNPGLPGPKGEPG--FHGFPGVQGPPGPPGSPGPAL 1247

Query: 3705 QG-SGSPRP----------GTKTGGGSQPQPASGQLQSETATTPAKPSFP--------SR 3745
            +G  G+P P          G     G    P +G ++ E    P +P  P          
Sbjct: 1248 EGPKGNPGPQGPPGRPGFQGLPGPEGPPGLPGNGGIKGEKG-NPGQPGLPGLPGLKGDQG 1306

Query: 3746 SPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPK-EKGESSTKRKKGQV--------PG 3796
             P  +  P R         P   G  G  G  GP    G +  + + G +        PG
Sbjct: 1307 PPGLQGNPGRPGLNGMKGDPGLPGVPGFPGMKGPSGVPGSAGPEGEPGLIGPPGPPGLPG 1366

Query: 3797 PA-RSESVGSFGRAPSAPDKP--PRTPRKQATPSRVLPTKP--KPNSQNKPRPPPSEQRK 3851
            P+ +S  +      P  P +P     P  Q       PT P   P     P    +  RK
Sbjct: 1367 PSGQSIIIKGDAGPPGIPGQPGLKGLPGPQGPQGLPGPTGPPGDPGRNGLPGFDGAGGRK 1426

Query: 3852 AEPGHTQRKDRLGKAFPQGRPLLR----PPKRGTAVHG 3885
             +PG   +    G   P G   L+    PP   +  HG
Sbjct: 1427 GDPGLPGQPGTRGLDGPPGPDGLQGPPGPPGTSSVAHG 1464



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 115/475 (24%), Positives = 140/475 (29%), Gaps = 62/475 (13%)

Query: 3428 PGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEV 3487
            PG PG      +  LP        PG     GE  PP             P L  L   +
Sbjct: 569  PGLPGLPGTPGQDGLPGLPGPKGEPGGITFKGERGPPGN-----------PGLPGLPGNI 617

Query: 3488 APSTTKGWPETLERPVDPVTHP-IRGCELPSNHQECPPPSLSPFPAALADGRGDCALDGA 3546
             P    G+      P  PV    I+G          P P   P       G+    L G 
Sbjct: 618  GPMGPPGF-----GPPGPVGEKGIQGVAGNPGQPGIPGPKGDPGQTITQPGKP--GLPGN 670

Query: 3547 LERPENEASPGSPGPLLQQALP-LGASLPRPGARGQDAEGKRAPLVF---SGKRRAPGAR 3602
              R  +   PG PG   Q  LP +  S   PG  G    G   P  F    G   APG  
Sbjct: 671  PGRDGDVGLPGDPGLPGQPGLPGIPGSKGEPGIPGIGLPGPPGPKGFPGIPGPPGAPGTP 730

Query: 3603 GRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSAASTPS 3662
            GR   +           K      +    GP G      A  P G      DR     P 
Sbjct: 731  GRIGLEGPPGPPGFPGPKGEPGFALPGPPGPPGLPGFKGALGPKG------DRGFPGPPG 784

Query: 3663 ----------KALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRP 3712
                         K  V P    G + P  L      G  P  P   PGP  Q      P
Sbjct: 785  PPGRTGLDGLPGPKGDVGPNGQPGPMGPPGLPGIGVQG--PPGPPGIPGPIGQPGLHGIP 842

Query: 3713 GTKTGGGSQPQPASGQL-QSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQ 3771
            G K   G       G   +  +   P  P  P   P    LP +A A        E G  
Sbjct: 843  GEKGDPGPPGLDVPGPPGERGSPGIPGAPG-PIGPPGSPGLPGKAGASGFPGTKGEMGMM 901

Query: 3772 GPHGSLGPKE----------KGESSTKRKKGQVPGPARSESVGSFGR----APSAPDKPP 3817
            GP G  GP            KG+   + + G +PGP   +  GS G      P  P  P 
Sbjct: 902  GPPGPPGPLGIPGRSGVPGLKGDDGLQGQPG-LPGPTGEK--GSKGEPGLPGPPGPMDPN 958

Query: 3818 RTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRP 3872
                K       LP  P  +     +  P +    +PG + +    G   P+G P
Sbjct: 959  LLGSKGEKGEPGLPGIPGVSGPKGYQGLPGD--PGQPGLSGQPGLPGPPGPKGNP 1011



 Score = 43.5 bits (101), Expect = 0.004
 Identities = 199/866 (22%), Positives = 253/866 (29%), Gaps = 161/866 (18%)

Query: 1752 PGTADQPHR-GAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPSHAAQGHSAGR 1810
            PG   QP   G P P     P +  + ++   G   PP       G+      QG    +
Sbjct: 422  PGLDGQPGAPGLPGPPGPAGPHIPPSDEICEPGPPGPP-------GSPGDKGLQGEQGVK 474

Query: 1811 A----------GGHLHPTAGRPGFEGNEFAPA-----------GASSLTAPRGREAWLVP 1849
                       G  +    G+PG  G    P            G +  T P+G    L  
Sbjct: 475  GDKGDTCFNCIGTGISGPPGQPGLPGLPGPPGSLGFPGQKGEKGQAGATGPKG----LPG 530

Query: 1850 VPSPACVSNTHPSRRSQDPALSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNP 1909
            +P         P       +   P   L  PG    K + G  G   L     +P +   
Sbjct: 531  IPGA-------PGAPGFPGSKGEPGDILTFPGMKGDKGELGSPGAPGLPGLPGTPGQDGL 583

Query: 1910 SGLEGGTVEGGKVACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGT 1969
             GL G   E G +     +G PG   +  LP   G  +G    G  G +G  EK      
Sbjct: 584  PGLPGPKGEPGGITFKGERGPPGNPGLPGLPGNIG-PMGPPGFGPPGPVG--EKGIQGVA 640

Query: 1970 ANQLQPENGVSPGGTDNHASVNASPKTALTG--PTEGAVLLEKCKGSRAAMSLQ----EE 2023
             N  QP  G+     D   ++    K  L G    +G V L    G      L      +
Sbjct: 641  GNPGQP--GIPGPKGDPGQTITQPGKPGLPGNPGRDGDVGLPGDPGLPGQPGLPGIPGSK 698

Query: 2024 AEP------TPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAP 2077
             EP       P PP P                G+ G TP R    GL  P    G  P P
Sbjct: 699  GEPGIPGIGLPGPPGPK------GFPGIPGPPGAPG-TPGRI---GLEGPPGPPG-FPGP 747

Query: 2078 SVGDLAACAPSPTSAAHMPCSLGPLPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQL 2137
              G+     P P     +P   G L        P   +G  G           PPGP   
Sbjct: 748  K-GEPGFALPGPPGPPGLPGFKGAL-------GPKGDRGFPG-----------PPGP--- 785

Query: 2138 LACSPAWAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCDPKEALAGCLLQGEGSPLEDP 2197
                P    L+   G +       +  P+ PP            L G  +QG   P   P
Sbjct: 786  ----PGRTGLDGLPGPKGDVGPNGQPGPMGPP-----------GLPGIGVQGPPGPPGIP 830

Query: 2198 SSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRA 2257
               P G             P    L +P           PG   SP + GA  P     +
Sbjct: 831  G--PIGQPGLHGIPGEKGDPGPPGLDVP---------GPPGERGSPGIPGAPGPIGPPGS 879

Query: 2258 TGL-----SSTPTGDEAQAG-RGLPGPD-----PQSRGAPPHTNPDRMPRGHSSYSPSNT 2306
             GL     +S   G + + G  G PGP      P   G P     D +        P+  
Sbjct: 880  PGLPGKAGASGFPGTKGEMGMMGPPGPPGPLGIPGRSGVPGLKGDDGLQGQPGLPGPTGE 939

Query: 2307 ARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSSKE-----PEDPGTPETGRSG 2361
                   G      P +P  L   G      L G  G S  +     P DPG P  G SG
Sbjct: 940  KGSKGEPGLPGPPGPMDPNLLGSKGEKGEPGLPGIPGVSGPKGYQGLPGDPGQP--GLSG 997

Query: 2362 ATKMPRVTCPSTGLGL----GRTTAP--SSTASDFQSDSPQSHRNASHQTPQGDPLGP-Q 2414
               +P    P    GL    G    P    T  D     PQ         P G P  P  
Sbjct: 998  QPGLPGPPGPKGNPGLPGQPGLIGPPGLKGTIGDMGFPGPQGVEGP--PGPSGVPGQPGS 1055

Query: 2415 DLKQRSRGYKKKPASTENGQWKGQAPHG-------PVTCEVCAASFRSG-PGLSRHKARK 2466
                  +G K  P  +  G      P G       P    +  +    G PGL      K
Sbjct: 1056 PGLPGQKGDKGDPGISSIGLPGLPGPKGEPGLPGYPGNPGIKGSVGDPGLPGLPGTPGAK 1115

Query: 2467 HRP----HPGAPAEPSPAALPAQQPLEPLAQKCQPPRKKSHRVSGKERPNHSRGDPSHVT 2522
             +P     PG P  P P  +        L  +  P     H   G+  P   +G P    
Sbjct: 1116 GQPGLPGFPGTPGPPGPKGISGPPGNPGLPGEPGPVGGGGH--PGQPGPPGEKGKPGQDG 1173

Query: 2523 QPPPAQGSKEVLRAPGSPHSQQLHPP 2548
             P PA    E    PG P      PP
Sbjct: 1174 IPGPAGQKGE----PGQPGFGNPGPP 1195



 Score = 43.5 bits (101), Expect = 0.004
 Identities = 236/1003 (23%), Positives = 303/1003 (30%), Gaps = 218/1003 (21%)

Query: 1684 GDSRPPQD-VCLPEPSKQPGPQLDAG-------------SLAKC---------------- 1713
            G   PP D +C P P   PG   D G             +   C                
Sbjct: 441  GPHIPPSDEICEPGPPGPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGISGPPGQPGLPG 500

Query: 1714 --SPDQELSFP--KNKEAASSQESEDSLRLLPCE-----------QRGGFLPEPG-TADQ 1757
               P   L FP  K ++  +       L  +P             + G  L  PG   D+
Sbjct: 501  LPGPPGSLGFPGQKGEKGQAGATGPKGLPGIPGAPGAPGFPGSKGEPGDILTFPGMKGDK 560

Query: 1758 PHRGAPA----PEAFGSPAVHLAPDL----------AFQGDGAPPLDATWPFGASPSHAA 1803
               G+P     P   G+P     P L           F+G+  PP +   P    P +  
Sbjct: 561  GELGSPGAPGLPGLPGTPGQDGLPGLPGPKGEPGGITFKGERGPPGNPGLP--GLPGNIG 618

Query: 1804 QGHSAGRAGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVP-SPACVSNTHPS 1862
                 G  G       G  G +G    P G   +  P+G     +  P  P    N  P 
Sbjct: 619  ---PMGPPGFGPPGPVGEKGIQGVAGNP-GQPGIPGPKGDPGQTITQPGKPGLPGN--PG 672

Query: 1863 RRSQ-----DPAL--------------SPPIRQLQLPGPGVAKSKDGILGLQEL--TP-- 1899
            R        DP L               P I  + LPGP   K   GI G      TP  
Sbjct: 673  RDGDVGLPGDPGLPGQPGLPGIPGSKGEPGIPGIGLPGPPGPKGFPGIPGPPGAPGTPGR 732

Query: 1900 -AAQSPPRVNPSGLEGGTVEGGKVACGPAQGSPGGVQVTTLPAVAGHQLGLEAD-GHWGL 1957
               + PP   P G  G   E G    GP  G PG      LP   G  LG + D G  G 
Sbjct: 733  IGLEGPP--GPPGFPGPKGEPGFALPGP-PGPPG------LPGFKG-ALGPKGDRGFPGP 782

Query: 1958 LGQAEKTQGQGTANQLQPENGVSPGGTDNHASVNASPKTALTGP-----------TEGAV 2006
             G   +T   G      P+  V P G          P   + GP             G  
Sbjct: 783  PGPPGRTGLDGLPG---PKGDVGPNGQPGPMGPPGLPGIGVQGPPGPPGIPGPIGQPGLH 839

Query: 2007 LLEKCKGSRAAMSLQEEAEP-------TPSPPSPNRESLALALTAAHSRSGSEGRTPERA 2059
             +   KG      L     P        P  P P     +  L      SG  G   E  
Sbjct: 840  GIPGEKGDPGPPGLDVPGPPGERGSPGIPGAPGPIGPPGSPGLPGKAGASGFPGTKGEMG 899

Query: 2060 --SSPGLNKPLLATGDSPAPSV-GDLAACA----PSPT---SAAHMPCSLGPLPREDPLT 2109
                PG   PL   G S  P + GD         P PT    +   P   GP    DP  
Sbjct: 900  MMGPPGPPGPLGIPGRSGVPGLKGDDGLQGQPGLPGPTGEKGSKGEPGLPGPPGPMDPNL 959

Query: 2110 SPSRAQGGLGGQLPASPSCRDPPGPQQLLACSPAWAPLEEADGVQATTDTGAEDSPVAP- 2168
              S+ + G  G LP  P    P G Q L    P    L    G+      G + +P  P 
Sbjct: 960  LGSKGEKGEPG-LPGIPGVSGPKGYQGLPG-DPGQPGLSGQPGLPG--PPGPKGNPGLPG 1015

Query: 2169 -PSLTTSPCDPKEALAGCLLQG----EGSPLEDPSSWP--PGSVSAVTCTHSGDTPKDST 2221
             P L   P   K  +      G    EG P   PS  P  PGS            P  S+
Sbjct: 1016 QPGL-IGPPGLKGTIGDMGFPGPQGVEGPP--GPSGVPGQPGSPGLPGQKGDKGDPGISS 1072

Query: 2222 LRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRATGLSSTPTGDEAQAGRGLPGPDPQ 2281
            + +P     +     PG   +P + G+V         GL   P    A+   GLPG  P 
Sbjct: 1073 IGLPGLPGPKGEPGLPGYPGNPGIKGSVGD------PGLPGLPGTPGAKGQPGLPG-FPG 1125

Query: 2282 SRGAPPHTNPDRMPRGHSSYSPSNTARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGE 2341
            + G P        P+G S   P N              +P EP  + G G        GE
Sbjct: 1126 TPGPPG-------PKGISG-PPGN------------PGLPGEPGPVGGGGHPGQPGPPGE 1165

Query: 2342 MGTSSK--------EPEDPGTPETGRSGATKMPRVTCPSTGLGLGRTTAPSSTASDFQSD 2393
             G   +        +  +PG P  G  G   +P ++      GL     P +        
Sbjct: 1166 KGKPGQDGIPGPAGQKGEPGQPGFGNPGPPGLPGLSGQKGDGGL--PGIPGNPGLPGPKG 1223

Query: 2394 SPQSHRNASHQTPQGDPLGPQDLKQRSRGYKKKPASTENGQWKG-QAPHGPVTCEVCAAS 2452
             P  H     Q P G P  P    +  +G            ++G   P GP         
Sbjct: 1224 EPGFHGFPGVQGPPGPPGSPGPALEGPKGNPGPQGPPGRPGFQGLPGPEGP--------- 1274

Query: 2453 FRSGPGLSRHKARK-HRPHPGAPAEPSPAALPAQQPLEPLAQKCQPPRKKSHRVSGKERP 2511
                PGL  +   K  + +PG P  P    L   Q          PP  + +   G+   
Sbjct: 1275 ----PGLPGNGGIKGEKGNPGQPGLPGLPGLKGDQ---------GPPGLQGN--PGRPGL 1319

Query: 2512 NHSRGDPSHVTQPPPAQGSKEVLRAPGS--PHSQQ--LHPPSP 2550
            N  +GDP  +   P   G K     PGS  P  +   + PP P
Sbjct: 1320 NGMKGDPG-LPGVPGFPGMKGPSGVPGSAGPEGEPGLIGPPGP 1361



 Score = 40.4 bits (93), Expect = 0.035
 Identities = 56/209 (26%), Positives = 69/209 (33%), Gaps = 18/209 (8%)

Query: 3693 PATPKAKPGPSSQGSG---SPRPGTKTGGGSQPQPASGQLQSETATT----PAKPSFPSR 3745
            P  P   PG   +      S  PG K   G    P    L   T       P  P     
Sbjct: 145  PPGPPGIPGMKGEPGSIIMSSLPGPKGNPGYPGPPGIQGLPGPTGIPGPIGPPGPPGLMG 204

Query: 3746 SPAPERLPA-RAQAKSCTKGPR-EAGEQGPHGSLGP-----KEKGESSTKRKKGQ--VPG 3796
             P P  LP  +       +GP+ E GEQG  G  GP     ++K     + +KG   +PG
Sbjct: 205  PPGPPGLPGPKGNMGLNFQGPKGEKGEQGLQGPPGPPGQISEQKRPIDVEFQKGDQGLPG 264

Query: 3797 PARSESVGSFGRAPSAPDKPPRTPRKQATPS-RVLPTKPKPNSQ-NKPRPPPSEQRKAEP 3854
                         P  P        +Q  P  R  P K   N Q   P  P       EP
Sbjct: 265  DRGPPGPPGIRGPPGPPGGEKGEKGEQGEPGKRGKPGKDGENGQPGIPGLPGDPGYPGEP 324

Query: 3855 GHTQRKDRLGKAFPQGRPLLRPPKRGTAV 3883
            G    K + G   P G P L  P+ GT +
Sbjct: 325  GRDGEKGQKGDTGPPGPPGLVIPRPGTGI 353



 Score = 37.7 bits (86), Expect = 0.23
 Identities = 50/197 (25%), Positives = 62/197 (31%), Gaps = 35/197 (17%)

Query: 489 PTARPSPHGMEMLSRLPFPAG-----GPEWQGGSQGALGTAGK-----TPGPREKLPAVR 538
           P   P P G +    +P P G     GP    G  G  G  G       PGP + +P   
Sbjct: 67  PEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGP-QGIPGCN 125

Query: 539 SSQG-----GSPALFTYNGMTDPGAQPLFFG-----VAQPQVSPHGTPSLPPPRVVGASP 588
            ++G     GSP      G   P   P   G     +      P G P  P P  +   P
Sbjct: 126 GTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGNPGYPGPPGIQGLP 185

Query: 589 SESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSA--FFHPPTHPQETGS 646
             + +P P             P    P  P      LPGP G     F  P     E G 
Sbjct: 186 GPTGIPGPIGPPG-------PPGLMGPPGPPG----LPGPKGNMGLNFQGPKGEKGEQGL 234

Query: 647 PFPSPEPPHSLPTHYQP 663
             P P PP  +    +P
Sbjct: 235 QGP-PGPPGQISEQKRP 250



 Score = 37.0 bits (84), Expect = 0.39
 Identities = 169/712 (23%), Positives = 217/712 (30%), Gaps = 136/712 (19%)

Query: 3206 PAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPGERAKPRARSTPSNPDGAATPDSASA 3265
            P P+   G R      G PG P  +        PG    P     P + DGA  P     
Sbjct: 65   PGPEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGH-DGAPGPQGIPG 123

Query: 3266 T--ALADAGSPGPP-----RTTPSPSPDPWAGGEPLLQATPVHEACKDPSRDCHHCG--- 3315
                  + G PG P     +  P P   P   GEP    + +  +   P  +  + G   
Sbjct: 124  CNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEP---GSIIMSSLPGPKGNPGYPGPPG 180

Query: 3316 -KRFPKPFKLQRHLAVHSPQRVYLCPRCPRVYPEHGELLAHLGGAHGLLERPELQHTPLY 3374
             +  P P  +   +    P  +   P  P +    G +  +  G  G      LQ  P  
Sbjct: 181  IQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEKGEQGLQGPPGP 240

Query: 3375 ACELCATVMRIIKKSFACSSCNYTFAKKEQFDRHMNKHLRGGRQPFAFRGVRRPGAP--G 3432
              ++      I          +  F K +Q        L G R P    G+R P  P  G
Sbjct: 241  PGQISEQKRPI----------DVEFQKGDQ-------GLPGDRGPPGPPGIRGPPGPPGG 283

Query: 3433 QKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEVAPSTT 3492
            +K    E   P KR +         PG+D            E   P +            
Sbjct: 284  EKGEKGEQGEPGKRGK---------PGKD-----------GENGQPGI------------ 311

Query: 3493 KGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAA--LADGRGDCALDGAL--- 3547
             G P     P +P     +G +        PP  + P P        +G+  L G     
Sbjct: 312  PGLPGDPGYPGEPGRDGEKG-QKGDTGPPGPPGLVIPRPGTGITIGEKGNIGLPGLPGEK 370

Query: 3548 -ER--PENEASPGSPGPLLQQALPLGASLPR--PGARGQDAEGKRAPLVFS-----GKRR 3597
             ER  P  +  PG PGP    A  +G   P   PG RGQ  +G   P   S     G   
Sbjct: 371  GERGFPGIQGPPGLPGP--PGAAVMGPPGPPGFPGERGQ--KGDEGPPGISIPGPPGLDG 426

Query: 3598 APGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDR-- 3655
             PGA G   P      H       +  S  + E GP G           G Q    D+  
Sbjct: 427  QPGAPGLPGPPGPAGPH-------IPPSDEICEPGPPGPPGSPGDKGLQGEQGVKGDKGD 479

Query: 3656 -------SAASTPSKALKFPVHPRKAVGSLA----PGELARGTENGMK--PATPKAKPGP 3702
                   +  S P      P  P    GSL      GE  +    G K  P  P A   P
Sbjct: 480  TCFNCIGTGISGPPGQPGLPGLPGPP-GSLGFPGQKGEKGQAGATGPKGLPGIPGAPGAP 538

Query: 3703 SSQGS-GSPR-----PGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARA 3756
               GS G P      PG K   G    P +  L     T P +   P   P P+  P   
Sbjct: 539  GFPGSKGEPGDILTFPGMKGDKGELGSPGAPGLPGLPGT-PGQDGLPGL-PGPKGEPGGI 596

Query: 3757 QAKSCTKGPR----------EAGEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSF 3806
              K   +GP             G  GP G   P   GE   +   G    P      G  
Sbjct: 597  TFKG-ERGPPGNPGLPGLPGNIGPMGPPGFGPPGPVGEKGIQGVAGNPGQPGIPGPKGDP 655

Query: 3807 GRAPSAPDKP--PRTPRKQATPSRVLPTKP-KPNSQNKPRPPPSEQRKAEPG 3855
            G+  + P KP  P  P +       LP  P  P     P  P S   K EPG
Sbjct: 656  GQTITQPGKPGLPGNPGRDGDVG--LPGDPGLPGQPGLPGIPGS---KGEPG 702



 Score = 36.6 bits (83), Expect = 0.50
 Identities = 60/248 (24%), Positives = 80/248 (32%), Gaps = 28/248 (11%)

Query: 1689 PQDVCLPEPSKQPG----PQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRLLPCEQ 1744
            P +  LP P  +PG    P +        SP   L  PK              + LP  +
Sbjct: 1213 PGNPGLPGPKGEPGFHGFPGVQGPPGPPGSPGPALEGPKGNPGPQGPPGRPGFQGLPGPE 1272

Query: 1745 RGGFLPEPGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPSHAAQ 1804
                LP  G   +  +G P     G P +   P L  +GD  PP       G   +    
Sbjct: 1273 GPPGLPGNGGI-KGEKGNP-----GQPGLPGLPGL--KGDQGPP-------GLQGNPGRP 1317

Query: 1805 GHSAGRAGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPACVSNTHPSRR 1864
            G +  +    L    G PG +G    P+G      P G E  L+  P P  +    P   
Sbjct: 1318 GLNGMKGDPGLPGVPGFPGMKG----PSGVPGSAGPEG-EPGLIGPPGPPGL----PGPS 1368

Query: 1865 SQDPALSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNPSGLEGGTVEGGKVAC 1924
             Q   +        +PG    K   G  G Q L      P     +GL G    GG+   
Sbjct: 1369 GQSIIIKGDAGPPGIPGQPGLKGLPGPQGPQGLPGPTGPPGDPGRNGLPGFDGAGGRKGD 1428

Query: 1925 GPAQGSPG 1932
                G PG
Sbjct: 1429 PGLPGQPG 1436



 Score = 36.2 bits (82), Expect = 0.66
 Identities = 105/488 (21%), Positives = 148/488 (30%), Gaps = 82/488 (16%)

Query: 2101 PLPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQLLAC-----------------SPA 2143
            P P+  P  + ++ + G  G  P  P  + PPGP  +                    +P 
Sbjct: 116  PGPQGIPGCNGTKGERGFPGS-PGFPGLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGNPG 174

Query: 2144 WAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCDP----KEALAGCLLQG-EGSPLEDPS 2198
            +       G+   T       P  PP L   P  P     +   G   QG +G   E   
Sbjct: 175  YPGPPGIQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEKGEQGL 234

Query: 2199 SWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRAT 2258
              PPG    ++        +   + +      + L    G    P + G   P    +  
Sbjct: 235  QGPPGPPGQIS-------EQKRPIDVEFQKGDQGLPGDRGPPGPPGIRGPPGPPGGEKGE 287

Query: 2259 GLSSTPTGDEAQAGR----------GLPGPDPQSRGAPPH---------TNPDRMPRGHS 2299
                   G   + G+          GLPG DP   G P           T P   P G  
Sbjct: 288  KGEQGEPGKRGKPGKDGENGQPGIPGLPG-DPGYPGEPGRDGEKGQKGDTGPPGPP-GLV 345

Query: 2300 SYSPSNTARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSSKEPEDP-GTP-ET 2357
               P     +G +    +  +P E       G   P  L G  G +   P  P G P E 
Sbjct: 346  IPRPGTGITIGEKGNIGLPGLPGEKGERGFPGIQGPPGLPGPPGAAVMGPPGPPGFPGER 405

Query: 2358 GRSGATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRNASHQTPQGDPLGPQDLK 2417
            G+ G    P ++ P      G+  AP        +     H   S +  +  P GP    
Sbjct: 406  GQKGDEGPPGISIPGPPGLDGQPGAPGLPGPPGPAGP---HIPPSDEICEPGPPGPPG-- 460

Query: 2418 QRSRGYKKKPASTENGQWKGQAPHGPVTCEVCAASFRSGP----GLSRHKARKHRPHPGA 2473
              S G K           KG       TC  C  +  SGP    GL           PG 
Sbjct: 461  --SPGDKGLQGEQGVKGDKGD------TCFNCIGTGISGPPGQPGL-----------PGL 501

Query: 2474 PAEPSPAALPAQQPLEPLAQKCQPPRKKS-HRVSGKERPNHSRGDPSHVTQPPPAQGSKE 2532
            P  P     P Q+  +  A    P          G      S+G+P  +   P  +G K 
Sbjct: 502  PGPPGSLGFPGQKGEKGQAGATGPKGLPGIPGAPGAPGFPGSKGEPGDILTFPGMKGDKG 561

Query: 2533 VLRAPGSP 2540
             L +PG+P
Sbjct: 562  ELGSPGAP 569



 Score = 34.3 bits (77), Expect = 2.5
 Identities = 35/133 (26%), Positives = 43/133 (32%), Gaps = 16/133 (12%)

Query: 3183 LGDLPG--GLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPG 3240
            L  LPG  G +G   +     +   P PK   G        G PG   G     +   PG
Sbjct: 1105 LPGLPGTPGAKGQPGLPGFPGTPGPPGPKGISGPPGNPGLPGEPGPVGGGGHPGQPGPPG 1164

Query: 3241 ERAKPRARSTPS--------NPDGAATPDSASATALA----DAGSPGPPRT--TPSPSPD 3286
            E+ KP     P            G   P       L+    D G PG P     P P  +
Sbjct: 1165 EKGKPGQDGIPGPAGQKGEPGQPGFGNPGPPGLPGLSGQKGDGGLPGIPGNPGLPGPKGE 1224

Query: 3287 PWAGGEPLLQATP 3299
            P   G P +Q  P
Sbjct: 1225 PGFHGFPGVQGPP 1237



 Score = 33.9 bits (76), Expect = 3.3
 Identities = 33/121 (27%), Positives = 43/121 (35%), Gaps = 16/121 (13%)

Query: 3186 LPG--GLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPW-----GQEGEAKKDS 3238
            LPG  GL G   +   +  +  P P+   G        G PG P      G +G+    S
Sbjct: 1013 LPGQPGLIGPPGLKGTIGDMGFPGPQGVEGPPGPSGVPGQPGSPGLPGQKGDKGDPGISS 1072

Query: 3239 PGERAKPRARSTPSNPDGAATPDSASATALADAGSPGPPRTTPSPSPDPWAGGEPLLQAT 3298
             G    P  +  P  P     P      ++ D G PG P T       P A G+P L   
Sbjct: 1073 IGLPGLPGPKGEPGLPGYPGNPGIKG--SVGDPGLPGLPGT-------PGAKGQPGLPGF 1123

Query: 3299 P 3299
            P
Sbjct: 1124 P 1124



 Score = 33.1 bits (74), Expect = 5.6
 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 3/55 (5%)

Query: 1232 PGLLIPEQPPPSRH---DTGTPKPSGSLANTAPHGSSPTPGVGSLLGGPGGTQAP 1283
            PG   PE PP  R    D G P P G      P G    PG   L G PG   AP
Sbjct: 62   PGFPGPEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAP 116


>gi|91208420 bassoon protein [Homo sapiens]
          Length = 3926

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 355/1598 (22%), Positives = 500/1598 (31%), Gaps = 249/1598 (15%)

Query: 80   GQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRYILGIASSRTKPTLDETPEN 139
            G   S   G    P  P G  P   P    G   G PP     G           + P  
Sbjct: 2    GNEVSLEGGAGDGPLPPGGAGPGPGPG--PGPGAGKPPSAPAGG----------GQLPAA 49

Query: 140  PQLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAEELGFHRCFQEPP--SSFTSTNYT 197
                +  +P V  P GPG G    PG       P  E LG  R     P  +S T+  + 
Sbjct: 50   GAARSTAVPPVPGP-GPGPGPGPGPGSTSRRLDPK-EPLGNQRAASPTPKQASATTPGHE 107

Query: 198  SPSATPRPPAPGPPQSRGTSP---LQPGSYPEYQASGADSWPPAAENSFPGANFGVPPAE 254
            SP  T    A GP       P   LQ  S    Q SG          S P + + VP   
Sbjct: 108  SPRETR---AQGPAGQEADGPRRTLQVDS--RTQRSGRSPSVSPDRGSTPTSPYSVPQIA 162

Query: 255  PEP------IPKGSRPGGSPRGVSFQFPFPALH------GASTKPFPADVAGHAFTNGPL 302
            P P      I K S    +P   +F       +      G +  P    V      N  +
Sbjct: 163  PLPSSTLCPICKTSDLTSTPSQPNFNTCTQCHNKVCNQCGFNPNPHLTQVKEWLCLNCQM 222

Query: 303  VFAFHQPQGAWPEE-------AVGTGPAYPLPTQPAPSPLPCYQGQPGGL---NRHSDLS 352
              A        P         +    PA+    QP   P       PGG    +R ++ +
Sbjct: 223  QRALGMDMTTAPRSKSQQQLHSPALSPAHSPAKQPLGKPDQERSRGPGGPQPGSRQAETA 282

Query: 353  GALSSPGAAHSAPRPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYR 412
             A S PG A +A  P        + ++ P+ P   +      R P    P +        
Sbjct: 283  RATSVPGPAQAAAPP-------EVGRVSPQPPQPTKPSTAEPRPPAGEAPAKSATAVPAG 335

Query: 413  ASGVDTSPGPPDTELAAPGPP---PARLPQLWDPTAAPYPTPPGGPLAATRSMFFNG--- 466
                + +      +L   G      A       P A     P   P   T  + FN    
Sbjct: 336  LGATEQTQEGLTGKLFGLGASLLTQASTLMSVQPEADTQGQP--APSKGTPKIVFNDASK 393

Query: 467  QPSPGQRLCLPQSAPLPWPQVLPTARPSP-HGMEMLSRLPFPAGGPEWQGGSQGALGTAG 525
            +  P      P   P P  +  P AR  P  G   L +          +   Q A   A 
Sbjct: 394  EAGPKPLGSGPGPGPAPGAKTEPGARMGPGSGPGALPKTGGTTSPKHGRAEHQAASKAAA 453

Query: 526  KT---PGPREKLPAVRSSQG-GSPALFTYNGMTDPGAQPLFFGVAQPQVSPH-------- 573
            K    P  R   P  ++    GS +   YN  T    Q        P  +PH        
Sbjct: 454  KPKTMPKERAICPLCQAELNVGSKSPANYNTCTTCRLQVCNLCGFNP--TPHLVEKTEWL 511

Query: 574  --------------GTPS-LPPP-----------RVVGASPSESPLPSPATNTAGSTCSS 607
                          G P+ LPPP           R  G SP +   P      +G   + 
Sbjct: 512  CLNCQTKRLLEGSLGEPTPLPPPTSQQPPVGAPHRASGTSPLKQKGPQGLGQPSGPLPAK 571

Query: 608  LSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTHYQPEPAK 667
             SP+S+  +   S+ S    PL  S     P+  QE  +  P+   P   P      P +
Sbjct: 572  ASPLSTKASPLPSKASPQAKPLRASEPSKTPSSVQEKKTRVPTKAEPMPKP------PPE 625

Query: 668  AFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLSSASLDQL 727
              P PA      G  +    TP     PE  +GG +       PY +   S S  SL   
Sbjct: 626  TTPTPATPKVKSGVRRAEPATPVVKAVPEAPKGG-EAEDLVGKPY-SQDASRSPQSLS-- 681

Query: 728  DVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPADAH 787
                     D  YSS     +  +  G++    +     S G  G P PP+    P++ H
Sbjct: 682  ---------DTGYSSDGISSSQSEITGVVQQEVE--QLDSAGVTG-PHPPS----PSEIH 725

Query: 788  AGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEA 847
              + S  +  L A       +  PL +G        P  L  +    + D +L+ ++ E 
Sbjct: 726  K-VGSSMRPLLQAQGLAPSERSKPLSSGTGEEQKQRPHSLSITPEAFDSDEELEDILEED 784

Query: 848  LNGMEY-----QSDNPEIDSSFIDV----FADEEPSGPRGPSSGHPLKSKAGVTPESKAP 898
             +  E+     Q D  E    F       + ++   G   P    P    A +T E    
Sbjct: 785  EDSAEWRRRREQQDTAESSDDFGSQLRHDYVEDSSEGGLSPLPPQPPARAAELTDEDFMR 844

Query: 899  PPLPAATPDPQTPRPGDRGCPARGRPKTRSLGLAPTEADAPSQGRQQRRGKQLKL----- 953
              +   + +       D     RG  K  +    P     PSQ       ++L       
Sbjct: 845  RQILEMSAEEDNLEEDDTATSGRGLAKHGTQKGGPRPRPEPSQEPAALPKRRLPHNATTG 904

Query: 954  FRKDLDSGGAAE---GSGSGGGG---------RASGLRPRRNDGLGERPPPR-PRRPRTQ 1000
            + + L  GG+AE   GSG+  GG          ++G      D LG+ P P   R P  +
Sbjct: 905  YEELLPEGGSAEATDGSGTLQGGLRRFKTIELNSTGSYGHELD-LGQGPDPSLDREPELE 963

Query: 1001 APGSRADPAPRV--PRAAALPEETRS---------------------SRRRRLPPRKDPR 1037
                   P  R     ++ LP  T S                     SRR+RL   K  R
Sbjct: 964  MESLTGSPEDRSRGEHSSTLPASTPSYTSGTSPTSLSSLEEDSDSSPSRRQRLEEAKQQR 1023

Query: 1038 KRKARGGAWGKELILKIVQQKNRLREYDFASESE---EDEQPPPRGPGFRGRRGRGEKRK 1094
            K + R        I    +++    E +   E E   E EQ   R    + RR + E R 
Sbjct: 1024 KARHRSHGPLLPTIEDSSEEEELREEEELLREQEKMREVEQQRIRSTARKTRRDKEELR- 1082

Query: 1095 EVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQAR-GPSRSLETG 1153
                 Q  RE     P   +  E   D +P              RS  +   PS SL++ 
Sbjct: 1083 ----AQRRRERSKTPPSNLSPIE---DASPTEELRQAAEMEELHRSSCSEYSPSPSLDSE 1135

Query: 1154 AAAREGGP----KCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPD 1209
            A A +GGP    K     ++     L  PT T +   T PS   P      ++AEE+  +
Sbjct: 1136 AEALDGGPSRLYKSGSEYNLPTFMSLYSPTETPSGSSTTPSSGRPL-----KSAEEAYEE 1190

Query: 1210 STEFTEALRSPPAACAGEMGASPGLLIPEQPPPSR------HDTGTPKPSGSLANTAPHG 1263
                 E L+      AG  G   G   P QP   R      +   T +  G  A  A  G
Sbjct: 1191 MMRKAELLQRQQGQAAGARGPHGG---PSQPTGPRGLGSFEYQDTTDREYGQAAQPAAEG 1247

Query: 1264 SSPTPGVG---SLLGGPGGTQAPVSHNSKD---------------------PPARQPGEF 1299
            +  + G      +L            +S+D                      P +Q G  
Sbjct: 1248 TPASLGAAVYEEILQTSQSIVRMRQASSRDLAFAEDKKKEKQFLNAESAYMDPMKQNGGP 1307

Query: 1300 LAPVANPSSTACPKPSVLSSKISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSELFLGP 1359
            L P  +P+  A P     S+  SS   D +G    P  V V +   +    P  +L   P
Sbjct: 1308 LTPGTSPTQLAAPVS--FSTPTSS---DSSGGRVIP-DVRVTQHFAKETQDP-LKLHSSP 1360

Query: 1360 KDLAGCFLEELHPKPSARDAPPASSSCLCQDGEDAGSLEPQLP---RSPPGTAETEPGRA 1416
               +    E   P       P  ++   C  G   G + P  P      P  + T     
Sbjct: 1361 ASPSSASKEIGMPFSQGPGTPATTAVAPCPAGLPRGYMTPASPAGSERSPSPSSTAHSYG 1420

Query: 1417 ASPPTLESSSLFPDLPVDRFDPPLYGSLSANRDSGLPFACADPPQKTVPSDPPYPSFLLL 1476
             SP T    S   DLP  +    L  +  A R+   P + +D    T      Y  F   
Sbjct: 1421 HSPTTANYGSQTEDLP--QAPSGLAAAGRAAREK--PLSASDGEGGTPQPSRAYSYFASS 1476

Query: 1477 E-EVSPMLPSHFPDLSGGKVLSKTCPPERTVVPGAAPS 1513
               +SP  PS  P  S GK+  +      T  P  AP+
Sbjct: 1477 SPPLSPSSPSESPTFSPGKMGPRATAEFSTQTPSPAPA 1514



 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 175/788 (22%), Positives = 258/788 (32%), Gaps = 155/788 (19%)

Query: 1783 GDGAPPLDATWPFGASPSHAAQGHSAGRAGGHLHPTAGRPGFEGNEFAPAGASSLTAP-R 1841
            GDG  P     P GA P     G   G       P AG+P       APAG   L A   
Sbjct: 12   GDGPLP-----PGGAGPG---PGPGPG-------PGAGKP-----PSAPAGGGQLPAAGA 51

Query: 1842 GREAWLVPVPSPACVSNTHPSRRSQDPALSP--PIRQLQLPGPGVAKSKDGILGLQELTP 1899
             R   + PVP P       P   S    L P  P+   +   P   ++          TP
Sbjct: 52   ARSTAVPPVPGPGPGPGPGPGPGSTSRRLDPKEPLGNQRAASPTPKQAS-------ATTP 104

Query: 1900 AAQSPPRVNPSGLEGGTVEGGKVACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLLG 1959
              +SP                  A GPA                    G EADG    L 
Sbjct: 105  GHESPRETR--------------AQGPA--------------------GQEADGPRRTLQ 130

Query: 1960 QAEKTQGQGTANQLQPENGVSPGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMS 2019
               +TQ  G +  + P+ G +P       S  + P+ A   P   + L   CK S     
Sbjct: 131  VDSRTQRSGRSPSVSPDRGSTP------TSPYSVPQIA---PLPSSTLCPICKTS----- 176

Query: 2020 LQEEAEPTPSPPSPNRESLALALTAAHSRSGSE-GRTPERASSPGLN--KPLLATGDSPA 2076
               +   TPS P+ N        T  H++  ++ G  P    +P L   K  L       
Sbjct: 177  ---DLTSTPSQPNFN------TCTQCHNKVCNQCGFNP----NPHLTQVKEWLCLNCQMQ 223

Query: 2077 PSVGDLAACAPSPTSAAHMPCSLGPLPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQ 2136
             ++G     AP   S   +       P   P  SP++   G     P     R P GPQ 
Sbjct: 224  RALGMDMTTAPRSKSQQQLHS-----PALSPAHSPAKQPLG----KPDQERSRGPGGPQ- 273

Query: 2137 LLACSPAWAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCDP---KEALAGCLLQGEGSP 2193
                        +A+  +AT+  G   +   P     SP  P   K + A        +P
Sbjct: 274  --------PGSRQAETARATSVPGPAQAAAPPEVGRVSPQPPQPTKPSTAEPRPPAGEAP 325

Query: 2194 LEDPSSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATS--PPLAGAVSP 2251
             +  ++ P G + A   T  G T K   L     ++   L      A +   P     +P
Sbjct: 326  AKSATAVPAG-LGATEQTQEGLTGKLFGLGASLLTQASTLMSVQPEADTQGQPAPSKGTP 384

Query: 2252 SVAVRATGLSSTPTGDEAQAGRGLPGPDPQSRGAP-----PHTNPDRMPRGHSSYSPSNT 2306
             +        + P    +  G   PGP P ++  P     P + P  +P+   + SP + 
Sbjct: 385  KIVFNDASKEAGPKPLGSGPG---PGPAPGAKTEPGARMGPGSGPGALPKTGGTTSPKH- 440

Query: 2307 ARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSSKEPEDPGTPETGRSGATKMP 2366
               G  E QA +    +P T+       P C + E+   SK P +  T  T R       
Sbjct: 441  ---GRAEHQAASKAAAKPKTMPKERAICPLC-QAELNVGSKSPANYNTCTTCR------- 489

Query: 2367 RVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRNASHQTPQGDPLGPQDLKQRSRGYKKK 2426
               C   G      T      +++   + Q+ R       +  PL P   +Q   G   +
Sbjct: 490  LQVCNLCGF---NPTPHLVEKTEWLCLNCQTKRLLEGSLGEPTPLPPPTSQQPPVGAPHR 546

Query: 2427 PASTENGQWKGQ----APHGPVTCEVCAASFRSGPGLSRHKARKHRPHPGAPAEPSPAAL 2482
             + T   + KG      P GP+  +    S ++ P  S+      +  P   +EPS    
Sbjct: 547  ASGTSPLKQKGPQGLGQPSGPLPAKASPLSTKASPLPSK---ASPQAKPLRASEPSKTPS 603

Query: 2483 PAQQPLEPLAQKCQ-----PPRKKSHRVSGKERPNHSRGDPSH--VTQPPPAQGSKEVLR 2535
              Q+    +  K +     PP       + K +    R +P+   V   P A    E   
Sbjct: 604  SVQEKKTRVPTKAEPMPKPPPETTPTPATPKVKSGVRRAEPATPVVKAVPEAPKGGEAED 663

Query: 2536 APGSPHSQ 2543
              G P+SQ
Sbjct: 664  LVGKPYSQ 671



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 334/1501 (22%), Positives = 485/1501 (32%), Gaps = 239/1501 (15%)

Query: 54   QAQAMELPEAQPRQARDGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAE 113
            +A  M++  A PR     +L  P+L             SP   P + PL  P +   R  
Sbjct: 224  RALGMDMTTA-PRSKSQQQLHSPAL-------------SPAHSPAKQPLGKPDQERSRGP 269

Query: 114  GSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPRT-EAQ 172
            G P          SR   T   T      +AA  PEV    G  +  P +P  P T E +
Sbjct: 270  GGPQP-------GSRQAETARATSVPGPAQAAAPPEV----GRVSPQPPQPTKPSTAEPR 318

Query: 173  PAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGA 232
            P A E    +     P+   +T  T    T +    G       S L     PE    G 
Sbjct: 319  PPAGEAPA-KSATAVPAGLGATEQTQEGLTGKLFGLGASLLTQASTLM-SVQPEADTQGQ 376

Query: 233  DSWPPAAENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPADV 292
                PA     P   F     E  P P GS PG  P             GA T+P     
Sbjct: 377  ----PAPSKGTPKIVFNDASKEAGPKPLGSGPGPGP-----------APGAKTEPGARMG 421

Query: 293  AGHAFTNGPLVFAFHQPQ-GAWPEEAVGTGPAYP--LPTQPAPSPL---PCYQGQPGGLN 346
             G      P       P+ G    +A     A P  +P + A  PL       G     N
Sbjct: 422  PGSGPGALPKTGGTTSPKHGRAEHQAASKAAAKPKTMPKERAICPLCQAELNVGSKSPAN 481

Query: 347  RHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERPPSAQDG-LGSTRGPPSSLPQRH 405
             ++  +  L         P P    + K+    L  +     +G LG     P    Q+ 
Sbjct: 482  YNTCTTCRLQVCNLCGFNPTP--HLVEKTEWLCLNCQTKRLLEGSLGEPTPLPPPTSQQP 539

Query: 406  FPGQAYRASGVDTSPGPPDTELAAP-GPPPARLPQLWDPTAAPYP---TPPGGPLAATRS 461
              G  +RASG           L  P GP PA+   L    A+P P   +P   PL A+  
Sbjct: 540  PVGAPHRASGTSPLKQKGPQGLGQPSGPLPAKASPL-STKASPLPSKASPQAKPLRASEP 598

Query: 462  MFFNGQPSPGQ--RLCLPQSAPLPWPQVLPTARPSPHGMEMLSRL-------PFPAGGPE 512
               +  PS  Q  +  +P  A  P P+  P   P+P   ++ S +       P     PE
Sbjct: 599  ---SKTPSSVQEKKTRVPTKAE-PMPKPPPETTPTPATPKVKSGVRRAEPATPVVKAVPE 654

Query: 513  WQGGSQGALGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQVSP 572
               G     G A    G      A RS Q  S   ++ +G++   +Q    GV Q +V  
Sbjct: 655  APKG-----GEAEDLVGKPYSQDASRSPQSLSDTGYSSDGIS--SSQSEITGVVQQEVE- 706

Query: 573  HGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPS 632
                 L    V G  P       P+ +      SS+ P+  +     SE S+        
Sbjct: 707  ----QLDSAGVTGPHP-------PSPSEIHKVGSSMRPLLQAQGLAPSERSK-------- 747

Query: 633  AFFHPPTHPQETGSPFPSPEPPHSL---PTHYQPEPAKAFPFPADGLGAEGAFQCLEE-- 687
                    P  +G+     + PHSL   P  +  +         D   AE   +  ++  
Sbjct: 748  --------PLSSGTGEEQKQRPHSLSITPEAFDSDEELEDILEEDEDSAEWRRRREQQDT 799

Query: 688  --------TPFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRN 739
                    +   H+  E    G  G    PP  P     L+     +  +L    + D  
Sbjct: 800  AESSDDFGSQLRHDYVEDSSEG--GLSPLPPQPPARAAELTDEDFMRRQILEMSAEEDNL 857

Query: 740  YSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAP------RVPADAHAGLLSH 793
                 A        GL    AK G Q+  GP   P P   P      R+P +A  G   +
Sbjct: 858  EEDDTATSGR----GL----AKHGTQKG-GPRPRPEPSQEPAALPKRRLPHNATTG---Y 905

Query: 794  AKTFLLAGDAQAEGKDDPLRTGF----LPSLAATPFPLPASDLDMEDDAKLD---SLITE 846
             +     G A+A      L+ G        L +T       DL    D  LD    L  E
Sbjct: 906  EELLPEGGSAEATDGSGTLQGGLRRFKTIELNSTGSYGHELDLGQGPDPSLDREPELEME 965

Query: 847  ALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAGVTPESKAPPPLPAATP 906
            +L G        E  S+         P+     +SG    S + +  +S + P       
Sbjct: 966  SLTGSPEDRSRGEHSSTL--------PASTPSYTSGTSPTSLSSLEEDSDSSPSRRQRLE 1017

Query: 907  DPQTPRPGDRGCPARGRPKTRSLG-LAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAE 965
            + +  R          + + RS G L PT  D+ S+  + R  ++L    ++ +     E
Sbjct: 1018 EAKQQR----------KARHRSHGPLLPTIEDS-SEEEELREEEEL---LREQEKMREVE 1063

Query: 966  GSGSGGGGRASGLRPRRNDGLGERPPPRPRRPRTQAPGSR------ADPAPRVPRAAALP 1019
                    R++  + RR+    E    + RR R++ P S       A P   + +AA + 
Sbjct: 1064 QQRI----RSTARKTRRDK---EELRAQRRRERSKTPPSNLSPIEDASPTEELRQAAEME 1116

Query: 1020 EETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPR 1079
            E  RSS     P      + +A  G  G   + K   + N        S +E      P 
Sbjct: 1117 ELHRSSCSEYSPSPSLDSEAEALDG--GPSRLYKSGSEYNLPTFMSLYSPTE-----TPS 1169

Query: 1080 GPGFRGRRGRGEKRKEVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGR 1139
            G       GR  K  E    +  R+ E  + ++   Q AG  G    P +P G R     
Sbjct: 1170 GSSTTPSSGRPLKSAEEAYEEMMRKAELLQRQQG--QAAGARGPHGGPSQPTGPRGLGSF 1227

Query: 1140 SPQARGPSRSLETGAAAREGGPKCADRPSVAPKDPLQVPTN-TETSEETRPSLDFPQEAK 1198
              Q        +    A EG P  A   +   ++ LQ   +     + +   L F ++ K
Sbjct: 1228 EYQDTTDREYGQAAQPAAEGTP--ASLGAAVYEEILQTSQSIVRMRQASSRDLAFAEDKK 1285

Query: 1199 EPE---TAEESAPDSTEFTEALRSP---PAACAGEMG--------ASPGLLIPEQPPPSR 1244
            + +    AE +  D  +      +P   P   A  +         +S G +IP+      
Sbjct: 1286 KEKQFLNAESAYMDPMKQNGGPLTPGTSPTQLAAPVSFSTPTSSDSSGGRVIPDVRVTQH 1345

Query: 1245 HDTGTPKPSGSLANTAPHGSSPTPGVGSLLG-GPGGTQAPVSHNSKDPPARQPGEFLAPV 1303
                T  P   L ++    SS +  +G     GPG    P +      PA  P  ++ P 
Sbjct: 1346 FAKETQDPL-KLHSSPASPSSASKEIGMPFSQGPG---TPATTAVAPCPAGLPRGYMTPA 1401

Query: 1304 ANPSSTACPKPSVLSSKISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSELFLGPKDLA 1363
            +   S   P P   SS   S+G  P   N               Y S   +L   P  LA
Sbjct: 1402 SPAGSERSPSP---SSTAHSYGHSPTTAN---------------YGSQTEDLPQAPSGLA 1443

Query: 1364 GCFLEELHPKPSARDAPPASSSCLCQDGEDAGSLEPQLPRSPPGTAETEPGRAASPPTLE 1423
                       SA D    +          A S  P  P SP  +    PG+     T E
Sbjct: 1444 AAGRAAREKPLSASDGEGGTPQPSRAYSYFASSSPPLSPSSPSESPTFSPGKMGPRATAE 1503

Query: 1424 SSSLFPDLPVDRFDPPLYGSLSANRDSGLPFACADPPQKTVPSDPPYPSFLLLEEVSPML 1483
             S+  P  P    D P        R  G P       Q T     P    L+ +E S   
Sbjct: 1504 FSTQTPS-PAPASDMP--------RSPGAPTPSPMVAQGTQTPHRPSTPRLVWQESSQEA 1554

Query: 1484 P 1484
            P
Sbjct: 1555 P 1555



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 75/322 (23%), Positives = 110/322 (34%), Gaps = 59/322 (18%)

Query: 3588 APLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAG 3647
            AP+ FS    +  + GR  PD     H  ++ ++    H  S   P       SA+K  G
Sbjct: 1319 APVSFSTPTSSDSSGGRVIPDVRVTQHFAKETQDPLKLHS-SPASP------SSASKEIG 1371

Query: 3648 CQSSSKDRSAAST-----PSKALKFPVHPRKAVGS-LAPGELARGTENGMKPAT------ 3695
               S    + A+T     P+   +  + P    GS  +P   +     G  P T      
Sbjct: 1372 MPFSQGPGTPATTAVAPCPAGLPRGYMTPASPAGSERSPSPSSTAHSYGHSPTTANYGSQ 1431

Query: 3696 ----PKAKPGPSSQGSGSPRP--GTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAP 3749
                P+A  G ++ G  +         G G  PQP+       +++ P  PS PS SP  
Sbjct: 1432 TEDLPQAPSGLAAAGRAAREKPLSASDGEGGTPQPSRAYSYFASSSPPLSPSSPSESP-- 1489

Query: 3750 ERLPARAQAKSCTKGPREAGEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRA 3809
                        T  P         G +GP+   E ST     Q P PA +  +    R+
Sbjct: 1490 ------------TFSP---------GKMGPRATAEFST-----QTPSPAPASDM---PRS 1520

Query: 3810 PSAPDKPPRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQ 3869
            P AP   P   +   TP R  P+ P+   Q   +  P             + R+  A   
Sbjct: 1521 PGAPTPSPMVAQGTQTPHR--PSTPRLVWQESSQEAPF-MVITLASDASSQTRMVHASAS 1577

Query: 3870 GRPLLRPPKRGTAVHGAEPAEP 3891
              PL  P +     HG     P
Sbjct: 1578 TSPLCSPTETQPTTHGYSQTTP 1599



 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 163/724 (22%), Positives = 230/724 (31%), Gaps = 123/724 (16%)

Query: 3222 GSPGD---PWGQEGEAKKDSPGERAKPRARSTPSNPDGAAT-PDSASATALADAGSPGPP 3277
            G  GD   P G  G      PG    P A   PS P G    P + +A + A    PGP 
Sbjct: 9    GGAGDGPLPPGGAGPGPGPGPG----PGAGKPPSAPAGGGQLPAAGAARSTAVPPVPGPG 64

Query: 3278 RTTPSPSPDPWAGG--------EPL-------------LQATPVHEACKDPSRDCHHCGK 3316
               P P P P  G         EPL                TP HE+ ++ +R     G+
Sbjct: 65   ---PGPGPGPGPGSTSRRLDPKEPLGNQRAASPTPKQASATTPGHESPRE-TRAQGPAGQ 120

Query: 3317 RFPKPFKLQRHLAVHSPQRVYLCPRCPRVYPEHGELLAHLGGAHGLLERPELQHTPLYAC 3376
                P   +R L V S  R     R P V P+ G           +   P     P+  C
Sbjct: 121  EADGP---RRTLQVDS--RTQRSGRSPSVSPDRGSTPTSPYSVPQIAPLPSSTLCPI--C 173

Query: 3377 ELCATVMRIIKKSF-ACSSCNYTFAKKEQFDRHMNKHLRGGRQPFAFR-------GVRRP 3428
            +         + +F  C+ C+     +  F+   N HL   ++            G+   
Sbjct: 174  KTSDLTSTPSQPNFNTCTQCHNKVCNQCGFNP--NPHLTQVKEWLCLNCQMQRALGMDMT 231

Query: 3429 GAPGQKAR------ALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLH 3482
             AP  K++      AL       ++ +  P      G   P P         GS  A   
Sbjct: 232  TAPRSKSQQQLHSPALSPAHSPAKQPLGKPDQERSRGPGGPQP---------GSRQAETA 282

Query: 3483 LCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGDCA 3542
              + V        P  + R       P +    PS  +  PP   +P  +A A   G  A
Sbjct: 283  RATSVPGPAQAAAPPEVGRVSPQPPQPTK----PSTAEPRPPAGEAPAKSATAVPAGLGA 338

Query: 3543 LDGALERPENEASPGSPGPLLQQALPLGASLPRPGARGQDAEGKRAP-LVFSGKRRAPGA 3601
             +   E    +   G    LL QA  L +  P    +GQ A  K  P +VF+   +  G 
Sbjct: 339  TEQTQEGLTGKLF-GLGASLLTQASTLMSVQPEADTQGQPAPSKGTPKIVFNDASKEAGP 397

Query: 3602 RGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSAASTP 3661
            +   +             K    + M    GP      G+  K  G  S    R+     
Sbjct: 398  KPLGSGPG---PGPAPGAKTEPGARMGPGSGP------GALPKTGGTTSPKHGRAEHQAA 448

Query: 3662 SKALKFP--VHPRKAVGSLAPGELARGTE---NGMKPATPKAKPGPSSQGSGSPRPGTKT 3716
            SKA   P  +   +A+  L   EL  G++   N     T + +       + +P    KT
Sbjct: 449  SKAAAKPKTMPKERAICPLCQAELNVGSKSPANYNTCTTCRLQVCNLCGFNPTPHLVEKT 508

Query: 3717 GGGSQPQPASGQLQSETAT-TPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQGPHG 3775
                        L+      TP  P  P+    P   P RA   S  K   + G QG   
Sbjct: 509  EWLCLNCQTKRLLEGSLGEPTPLPP--PTSQQPPVGAPHRASGTSPLK---QKGPQGLGQ 563

Query: 3776 SLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQATPSRVLPTKPK 3835
              GP     S    K   +P  A  ++       P    +P +TP         +PTK +
Sbjct: 564  PSGPLPAKASPLSTKASPLPSKASPQA------KPLRASEPSKTPSSVQEKKTRVPTKAE 617

Query: 3836 PNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPPKRGTAVHGAEPAEPHTHR 3895
            P     P+PPP                      +  P    PK  + V  AEPA P    
Sbjct: 618  P----MPKPPP----------------------ETTPTPATPKVKSGVRRAEPATPVVKA 651

Query: 3896 TAEA 3899
              EA
Sbjct: 652  VPEA 655



 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 99/391 (25%), Positives = 129/391 (32%), Gaps = 89/391 (22%)

Query: 2324 PPTLQGAGPDSPACLEGEMGTSSKEPEDPG----TPETGRSGATKMPRVTCPSTGLGLGR 2379
            PP   G GP       G    + K P  P      P  G + +T +P V  P  G G G 
Sbjct: 17   PPGGAGPGPGP-----GPGPGAGKPPSAPAGGGQLPAAGAARSTAVPPVPGPGPGPGPG- 70

Query: 2380 TTAPSSTASDFQSDSPQSHRNASHQTPQGDPLGPQDLKQRSRGYKKKPASTENGQWKGQA 2439
               P ST+       P  ++ A+  TP+            + G++  P  T      GQ 
Sbjct: 71   -PGPGSTSRRLDPKEPLGNQRAASPTPK-------QASATTPGHES-PRETRAQGPAGQE 121

Query: 2440 PHGPV-TCEVCAASFRSGPGLSRHKARKHRPHPGAPAEPSPAALPAQQPLEPLAQKCQPP 2498
              GP  T +V + + RSG   S    R   P        SP ++P   PL P +  C P 
Sbjct: 122  ADGPRRTLQVDSRTQRSGRSPSVSPDRGSTP-------TSPYSVPQIAPL-PSSTLC-PI 172

Query: 2499 RKKSHRVSGKERPNHSRGDPSH--------VTQPPPAQGSKEVL---------------R 2535
             K S   S   +PN +     H            P     KE L                
Sbjct: 173  CKTSDLTSTPSQPNFNTCTQCHNKVCNQCGFNPNPHLTQVKEWLCLNCQMQRALGMDMTT 232

Query: 2536 APGSPHSQQLHPPSPTEHEVDVKTPASKPRPDQAREDELHPKQAEKREGRRWRREPTVDS 2595
            AP S   QQLH P+ +      K P  K  PDQ R                         
Sbjct: 233  APRSKSQQQLHSPALSPAHSPAKQPLGK--PDQER------------------------- 265

Query: 2596 PSHSEGKSNKKRGKLRGRRLREESILPVSADVISDGRGSRPSPAMASYAASPSHCLSVEG 2655
               S G    + G  +    R  S+ P  A   +     R SP        P+   + E 
Sbjct: 266  ---SRGPGGPQPGSRQAETARATSV-PGPAQAAAPPEVGRVSP----QPPQPTKPSTAEP 317

Query: 2656 GPEADGEQPPRLATLGPGVMEGAAETDQEAL 2686
             P A GE P + AT  P  + GA E  QE L
Sbjct: 318  RPPA-GEAPAKSATAVPAGL-GATEQTQEGL 346



 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 87/381 (22%), Positives = 121/381 (31%), Gaps = 64/381 (16%)

Query: 2222 LRIPEDSRKEK-------LWESPGRATSPPLAGAVSPSVAVRATGLSSTPTGDEAQAGRG 2274
            L   ED +KEK        +  P +    PL    SP+        S TPT  ++  GR 
Sbjct: 1278 LAFAEDKKKEKQFLNAESAYMDPMKQNGGPLTPGTSPTQLAAPVSFS-TPTSSDSSGGRV 1336

Query: 2275 LPGPDPQSRGAPPHTNPDRMPRGHSS-YSPSNTAR---LGHREGQAVTAVPTEPPTLQGA 2330
            +P        A    +P ++   HSS  SPS+ ++   +   +G    A     P   G 
Sbjct: 1337 IPDVRVTQHFAKETQDPLKL---HSSPASPSSASKEIGMPFSQGPGTPATTAVAPCPAGL 1393

Query: 2331 G-----PDSPACLEGEMGTSSKEPEDPGTPETGRSGATKMPRVTCPSTGLGLGRTTAPSS 2385
                  P SPA  E     SS       +P T   G+        PS     GR      
Sbjct: 1394 PRGYMTPASPAGSERSPSPSSTAHSYGHSPTTANYGSQTEDLPQAPSGLAAAGRAAREKP 1453

Query: 2386 -TASDFQSDSPQSHRNASHQTPQGDPLGPQDLKQRSRGYKKKPASTENGQWKGQAPHGPV 2444
             +ASD +  +PQ  R  S+      PL P    +       K       ++  Q P    
Sbjct: 1454 LSASDGEGGTPQPSRAYSYFASSSPPLSPSSPSESPTFSPGKMGPRATAEFSTQTP---- 1509

Query: 2445 TCEVCAASFRSGPGLSRHKARKHRPHPGAPAEPSPAALPAQQPLEPLAQKCQPPRKKS-- 2502
                                        APA   P +  A  P   +AQ  Q P + S  
Sbjct: 1510 --------------------------SPAPASDMPRSPGAPTPSPMVAQGTQTPHRPSTP 1543

Query: 2503 ---HRVSGKERP---NHSRGDPSHVTQPPPAQGSKEVLRAPGSPHS-----QQLHPPSPT 2551
                + S +E P        D S  T+   A  S   L +P           Q  PPS +
Sbjct: 1544 RLVWQESSQEAPFMVITLASDASSQTRMVHASASTSPLCSPTETQPTTHGYSQTTPPSVS 1603

Query: 2552 EHEVDVKTPASKPRPDQARED 2572
            +   +   P   PR   A  D
Sbjct: 1604 QLPPEPPGPPGFPRVPSAGAD 1624



 Score = 43.5 bits (101), Expect = 0.004
 Identities = 91/344 (26%), Positives = 122/344 (35%), Gaps = 59/344 (17%)

Query: 141  QLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAEELGFHRCFQEPPSSFTSTNYTSPS 200
            +L   +L    TP G     P     P T + P A        FQ+P     +  Y++ S
Sbjct: 3016 ELNQLRLQGCTTPAGQFVDFPATAAAPATPSGPTA--------FQQPRFQPPAPQYSAGS 3067

Query: 201  ATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPAAENSFPGANFGVPPAEPE-PIP 259
                    G P   G    Q  +YP      A ++P       PGA++   PAEP  P  
Sbjct: 3068 --------GGPTQNGFPAHQAPTYPGPSTYPAPAFP-------PGASY---PAEPGLPNQ 3109

Query: 260  KGSRPGG-------SPRGVSFQFPFPALHGAS-TKPFP---ADVAGHAFTNGPLVFAFHQ 308
            +  RP G        P   S  FP PA   A   KP     AD+     TN  ++ +   
Sbjct: 3110 QAFRPTGHYAGQTPMPTTQSTLFPVPADSRAPLQKPRQTSLADLEQKVPTNYEVIASPVV 3169

Query: 309  PQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPF 368
            P  + P E   +GPA     +         QG+   + R  D      SP     AP   
Sbjct: 3170 PMSSAPSETSYSGPAVSSGYE---------QGKVPEVPRAGDRGSVSQSP-----APTYP 3215

Query: 369  SDSLHKSLTKILPERPPSAQDGLGSTRGPPSSLP--QRHFPGQAYRASGVDTSPGPPDTE 426
            SDS + SL + +P       D    T+   S+ P  QR  P     +      PG P   
Sbjct: 3216 SDSHYTSLEQNVPRNYVMIDDISELTKDSTSTAPDSQRLEPLGPGSSGRPGKEPGEPGV- 3274

Query: 427  LAAPGPPPARLPQLWDPTAAPY-PTPPGGPLAATRSMFFNGQPS 469
            L  P  P        +     Y P   GG L   RSM  NG+P+
Sbjct: 3275 LDGPTLPCCYARGEEESEEDSYDPRGKGGHL---RSMESNGRPA 3315



 Score = 42.7 bits (99), Expect = 0.007
 Identities = 168/743 (22%), Positives = 230/743 (30%), Gaps = 186/743 (25%)

Query: 2651 LSVEGGPEADGEQPPRLATLGPGVMEGAAETDQEALCAGETGAQKP-------------- 2696
            +S+EGG   DG  PP  A  GPG   G       +  AG  G Q P              
Sbjct: 5    VSLEGGA-GDGPLPPGGAGPGPGPGPGPGAGKPPSAPAG--GGQLPAAGAARSTAVPPVP 61

Query: 2697 -----------PGD--RMLCPGRMDGAALGEQPTG-QKGASARGFWGPRETKALGVCKES 2742
                       PG   R L P    G      PT  Q  A+  G   PRET+A G   + 
Sbjct: 62   GPGPGPGPGPGPGSTSRRLDPKEPLGNQRAASPTPKQASATTPGHESPRETRAQGPAGQE 121

Query: 2743 GSEP-----AEDSSRAHSRSEEGVWEENTPPLGPLGFPETSSSPADSTTSSC----LQGL 2793
               P      +  ++   RS     +  + P  P   P+ +  P+ +    C    L   
Sbjct: 122  ADGPRRTLQVDSRTQRSGRSPSVSPDRGSTPTSPYSVPQIAPLPSSTLCPICKTSDLTST 181

Query: 2794 PDNPDTQGGVQGPEGPTPDASGSSAKDPPSLFDDEVSFSQLFPPGGRLTRKRNPHVYGKR 2853
            P  P+     Q                      ++V     F P   LT+          
Sbjct: 182  PSQPNFNTCTQ--------------------CHNKVCNQCGFNPNPHLTQV--------- 212

Query: 2854 CEKPVLPLPTQPSFEEGGDPTLGPARLPTDLSDSSSLCLCHEDPWEDEDPAGLPESFLLD 2913
              K  L L  Q     G D T  P         S +L   H      + P G P+     
Sbjct: 213  --KEWLCLNCQMQRALGMDMTTAPRSKSQQQLHSPALSPAHSPA---KQPLGKPDQE--- 264

Query: 2914 GFLNSRVPGIDPWAPGLSLWALEPSREAGAEKLPSHCPEDDRPEAIPELHMVPAAWRGLE 2973
                SR PG     PG        SR+A   +  S  P   +  A PE+        G  
Sbjct: 265  ---RSRGPGGPQ--PG--------SRQAETARATS-VPGPAQAAAPPEV--------GRV 302

Query: 2974 MPAPADDSSSSLGDVSPEPPSLER---------------ERCDGGLPGNTHLLPLRATDF 3018
             P P   +  S  +  P PP+ E                E+   GL G   L  L A+  
Sbjct: 303  SPQPPQPTKPSTAE--PRPPAGEAPAKSATAVPAGLGATEQTQEGLTGK--LFGLGASLL 358

Query: 3019 EVLSTKFEMQDLCFLGPFEDPVGLPGPSF----LDFEGTASSQGPQ------------SR 3062
               ST   +Q      P  D  G P PS     + F   +   GP+              
Sbjct: 359  TQASTLMSVQ------PEADTQGQPAPSKGTPKIVFNDASKEAGPKPLGSGPGPGPAPGA 412

Query: 3063 RTEEAAGAGRAQGRGR-PAKGRRASYKCKVCFQRFRSLGELDLHKLAHTPAPPPT----- 3116
            +TE  A  G   G G  P  G   S K           G  +    +   A P T     
Sbjct: 413  KTEPGARMGPGSGPGALPKTGGTTSPKH----------GRAEHQAASKAAAKPKTMPKER 462

Query: 3117 --CYMC-VERRFGSRELLRGHLQERHAQSKAGPWACGMCLKEVADVWMYNE--HLREHAV 3171
              C +C  E   GS+             S A    C  C  +V ++  +N   HL E   
Sbjct: 463  AICPLCQAELNVGSK-------------SPANYNTCTTCRLQVCNLCGFNPTPHLVEKTE 509

Query: 3172 RFARRGQARR----SLGD---LPGGLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAG-- 3222
                  Q +R    SLG+   LP        V    +  +  +P   +G +  G+ +G  
Sbjct: 510  WLCLNCQTKRLLEGSLGEPTPLPPPTSQQPPVG-APHRASGTSPLKQKGPQGLGQPSGPL 568

Query: 3223 -SPGDPWGQEGEAKKDSPGERAKPRARSTPSNPDGAATPDSASATALADAGSPGPPRTTP 3281
             +   P   +          +AKP   S PS    +           A+     PP TTP
Sbjct: 569  PAKASPLSTKASPLPSKASPQAKPLRASEPSKTPSSVQEKKTRVPTKAEPMPKPPPETTP 628

Query: 3282 SP-SPDPWAGGEPLLQATPVHEA 3303
            +P +P   +G      ATPV +A
Sbjct: 629  TPATPKVKSGVRRAEPATPVVKA 651



 Score = 42.4 bits (98), Expect = 0.009
 Identities = 71/273 (26%), Positives = 96/273 (35%), Gaps = 42/273 (15%)

Query: 47   GAREAGGQAQAMELP----EAQPRQARDGELKPPSLRGQA-PSSTPGKRGSPQTPPGRSP 101
            G  EA   +Q    P    + QP      E   PS    A   ++  K+GS Q   G + 
Sbjct: 3675 GRHEARPHSQPSSAPAMPKKGQPGYPSSAEYSQPSRASSAYHHASDSKKGSRQAHSGPAA 3734

Query: 102  LQ------APSRLAGRAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQG 155
            LQ      A  +L GR     PQ+      SSR  P+       PQ +  Q       QG
Sbjct: 3735 LQSKAEPQAQPQLQGRQAAPGPQQS--QSPSSRQIPS-GAASRQPQTQQQQ-------QG 3784

Query: 156  PGTGAPLRPGLPRTEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRG 215
             G              QP  + L   R  Q+   S  +T  ++P+A+     P P  S  
Sbjct: 3785 LGL-------------QPPQQALTQARLQQQ---SQPTTRGSAPAASQPAGKPQPGPSTA 3828

Query: 216  TSPLQPGSYPEYQASGADSWPPAAENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQF 275
            T P   G     Q +G+     A +          P   P  +  G+RPGG+P   + Q 
Sbjct: 3829 TGPQPAGPPRAEQTNGSKGTAKAPQQGRAPQAQPAPGPGPAGVKAGARPGGTPGAPAGQ- 3887

Query: 276  PFPALHGAS--TKPFPADVAGHAFTNGPLVFAF 306
              P   G S  +K  P   A  A      V AF
Sbjct: 3888 --PGADGESVFSKILPGGAAEQAGKLTEAVSAF 3918



 Score = 42.0 bits (97), Expect = 0.012
 Identities = 96/500 (19%), Positives = 145/500 (29%), Gaps = 78/500 (15%)

Query: 2397 SHRNASHQTPQGDPLGPQDLKQRSRGYKKKPASTENGQWKGQAPHGPVTCEVCAASFRSG 2456
            S R+ +     G+ L   D     +GY+++  + E  Q  G  P          +S    
Sbjct: 3440 SSRSRAPSAYSGEKLSSHDFSGWGKGYEREREAVERLQKAGPKP----------SSLSMA 3489

Query: 2457 PGLSRHKARKHRPHPGAPAEPSPAALPAQQPLEPLAQKCQP-------PRKKSHRVSGKE 2509
                R   R       +P  P     PA  PL P    C         P  + H   G  
Sbjct: 3490 HSRVRPPMRSQASEEESPVSPLGRPRPAGGPLPPGGDTCPQFCSSHSMPDVQEHVKDGPR 3549

Query: 2510 RPNHSRG-----DPSHVTQPP----------------PAQGSKEVLRAPG----SPHSQQ 2544
               + R      D SH                     P     +  R  G    S  SQ+
Sbjct: 3550 AHAYKREEGYILDDSHCVVSDSEAYHLGQEETDWFDKPRDARSDRFRHHGGHAVSSSSQK 3609

Query: 2545 LHPPSPTEHEVDVKTPASKPRPDQAREDELHPKQAEKREGRRWRREPTVDSPSHSEGKSN 2604
              P   + H+ D + P     P        H    E R G   R      S  H+  +  
Sbjct: 3610 RGPARHSYHDYD-EPPEEGLWPHDEGGPGRHASAKEHRHGDHGRH-----SGRHTGEEPG 3663

Query: 2605 KKRGKLRGRRLREESILPVSADVISDGRGSRPSPAMASYA--ASPSHCLSVEGGPEADGE 2662
            ++  K   R L      P S    +     +  P   S A  + PS   S      +D +
Sbjct: 3664 RRAAKPHARDLGRHEARPHSQPSSAPAMPKKGQPGYPSSAEYSQPSRASSAYHHA-SDSK 3722

Query: 2663 QPPRLATLGPGVMEGAAETDQEALCAGETGAQKPPGDRMLCPGRMDGAALGEQPTGQKGA 2722
            +  R A  GP  ++  AE   +    G   A  P   +     ++   A   QP  Q+  
Sbjct: 3723 KGSRQAHSGPAALQSKAEPQAQPQLQGRQAAPGPQQSQSPSSRQIPSGAASRQPQTQQQQ 3782

Query: 2723 SARGFWGPRE--TKAL-------------------------GVCKESGSEPAEDSSRAHS 2755
               G   P++  T+A                          G    +G +PA       +
Sbjct: 3783 QGLGLQPPQQALTQARLQQQSQPTTRGSAPAASQPAGKPQPGPSTATGPQPAGPPRAEQT 3842

Query: 2756 RSEEGVWEENTPPLGPLGFPETSSSPADSTTSSCLQGLPDNPDTQGGVQGPEGPTPDASG 2815
               +G  +       P   P     PA     +   G P  P  Q G  G    +    G
Sbjct: 3843 NGSKGTAKAPQQGRAPQAQPAPGPGPAGVKAGARPGGTPGAPAGQPGADGESVFSKILPG 3902

Query: 2816 SSAKDPPSLFDDEVSFSQLF 2835
             +A+    L +   +F + F
Sbjct: 3903 GAAEQAGKLTEAVSAFGKKF 3922



 Score = 41.6 bits (96), Expect = 0.016
 Identities = 76/308 (24%), Positives = 105/308 (34%), Gaps = 79/308 (25%)

Query: 407  PGQAYRASGVDTSPGPPDTELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNG 466
            P  A +  G+  S GP      A  P PA LP+        Y T P  P  + RS     
Sbjct: 1363 PSSASKEIGMPFSQGPGTPATTAVAPCPAGLPR-------GYMT-PASPAGSERS----- 1409

Query: 467  QPSPGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAG-GPEWQGGSQGALGTAG 525
             PSP                   TA    H        P  A  G + +   Q   G A 
Sbjct: 1410 -PSPSS-----------------TAHSYGHS-------PTTANYGSQTEDLPQAPSGLAA 1444

Query: 526  KTPGPREKLPAVRSSQGGSP---ALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPR 582
                 REK  +    +GG+P     ++Y   + P   P     + P  SP  +P    PR
Sbjct: 1445 AGRAAREKPLSASDGEGGTPQPSRAYSYFASSSPPLSP-----SSPSESPTFSPGKMGPR 1499

Query: 583  VVGASPSESPLPSPATNTAGST-CSSLSPM----SSSPANPSS-----EESQLPGP---- 628
                  +++P P+PA++   S    + SPM    + +P  PS+     +ES    P    
Sbjct: 1500 ATAEFSTQTPSPAPASDMPRSPGAPTPSPMVAQGTQTPHRPSTPRLVWQESSQEAPFMVI 1559

Query: 629  ------------LGPSAFFHP---PTHPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFP- 672
                        +  SA   P   PT  Q T   +    PP    +   PEP     FP 
Sbjct: 1560 TLASDASSQTRMVHASASTSPLCSPTETQPTTHGYSQTTPPS--VSQLPPEPPGPPGFPR 1617

Query: 673  ADGLGAEG 680
                GA+G
Sbjct: 1618 VPSAGADG 1625



 Score = 40.8 bits (94), Expect = 0.027
 Identities = 53/187 (28%), Positives = 72/187 (38%), Gaps = 35/187 (18%)

Query: 3683 LARGTENGMKP---ATPKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETATTPAK 3739
            L  G  +G  P   A P   PGP   G G+ +P +   GG Q  PA+G  +S TA  P  
Sbjct: 7    LEGGAGDGPLPPGGAGPGPGPGP---GPGAGKPPSAPAGGGQ-LPAAGAARS-TAVPPVP 61

Query: 3740 PSFPSRSPAP------ERL-------------PARAQAKSCTKG---PREAGEQGPHGSL 3777
               P   P P       RL             P   QA + T G   PRE   QGP    
Sbjct: 62   GPGPGPGPGPGPGSTSRRLDPKEPLGNQRAASPTPKQASATTPGHESPRETRAQGP---A 118

Query: 3778 GPKEKGESSTKRKKGQVPGPARSESVG-SFGRAPSAPDKPPR-TPRKQATPSRVLPTKPK 3835
            G +  G   T +   +     RS SV    G  P++P   P+  P   +T   +  T   
Sbjct: 119  GQEADGPRRTLQVDSRTQRSGRSPSVSPDRGSTPTSPYSVPQIAPLPSSTLCPICKTSDL 178

Query: 3836 PNSQNKP 3842
             ++ ++P
Sbjct: 179  TSTPSQP 185



 Score = 40.8 bits (94), Expect = 0.027
 Identities = 70/281 (24%), Positives = 98/281 (34%), Gaps = 30/281 (10%)

Query: 2    PGERPRGAPPPTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQAMELP 61
            P   PRG   P      +     SS  H            ++T    +   G A A    
Sbjct: 1390 PAGLPRGYMTPASPAGSERSPSPSSTAHSYGHSPTTANYGSQTEDLPQAPSGLAAAGRAA 1449

Query: 62   EAQPRQARDGE---LKPPSLRGQAPSSTPGKRGSPQTP--PGRSPLQAPSRLAGRAEGSP 116
              +P  A DGE    +P        SS+P     P +P  P  SP  +P ++  RA    
Sbjct: 1450 REKPLSASDGEGGTPQPSRAYSYFASSSP-----PLSPSSPSESPTFSPGKMGPRATAE- 1503

Query: 117  PQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAE 176
                      S   P+     + P+   A  P     QG  T  P RP  PR   Q +++
Sbjct: 1504 ---------FSTQTPSPAPASDMPRSPGAPTPSPMVAQG--TQTPHRPSTPRLVWQESSQ 1552

Query: 177  ELGFH-RCFQEPPSSFTSTNYTSPSATPR-PPAPGPPQSRGTSPLQPGSYPEY--QASGA 232
            E  F         SS T   + S S +P   P    P + G S   P S  +   +  G 
Sbjct: 1553 EAPFMVITLASDASSQTRMVHASASTSPLCSPTETQPTTHGYSQTTPPSVSQLPPEPPGP 1612

Query: 233  DSWP--PAAENSFPGA--NFGVPPAEPEPIPKGSRPGGSPR 269
              +P  P+A    P A   +G  PAE   + + S   G+ R
Sbjct: 1613 PGFPRVPSAGADGPLALYGWGALPAENISLCRISSVPGTSR 1653



 Score = 40.8 bits (94), Expect = 0.027
 Identities = 42/146 (28%), Positives = 62/146 (42%), Gaps = 23/146 (15%)

Query: 3671 PRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQ 3730
            P++A+      + ++ T  G  PA        +SQ +G P+PG  T  G  PQPA     
Sbjct: 3790 PQQALTQARLQQQSQPTTRGSAPA--------ASQPAGKPQPGPSTATG--PQPAGPPRA 3839

Query: 3731 SETATTPAKPSFPSRSPAPERLPARAQAKSCTK-GPREAGEQG-PHGSLGPKEKGESSTK 3788
             +T  +      P +  AP+  PA     +  K G R  G  G P G   P   GES   
Sbjct: 3840 EQTNGSKGTAKAPQQGRAPQAQPAPGPGPAGVKAGARPGGTPGAPAGQ--PGADGESVFS 3897

Query: 3789 RKKGQVPGPAR------SESVGSFGR 3808
            +    +PG A       +E+V +FG+
Sbjct: 3898 K---ILPGGAAEQAGKLTEAVSAFGK 3920



 Score = 40.0 bits (92), Expect = 0.046
 Identities = 108/444 (24%), Positives = 139/444 (31%), Gaps = 105/444 (23%)

Query: 211  PQSRGTSPLQPGSYPEYQASGADSWPPAAENSFPG-------ANFGVPPAEPEPIPKGSR 263
            P  +   PL PG+ P   A+      P + +S  G                 +P+   S 
Sbjct: 1300 PMKQNGGPLTPGTSPTQLAAPVSFSTPTSSDSSGGRVIPDVRVTQHFAKETQDPLKLHSS 1359

Query: 264  PGGSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPA 323
            P  SP   S +   P   G  T   PA  A      G        P+G          PA
Sbjct: 1360 P-ASPSSASKEIGMPFSQGPGT---PATTAVAPCPAG-------LPRGYMT-------PA 1401

Query: 324  YPLPTQPAPSP---LPCYQGQPGGLNRHS---DLSGALSSPGAAHSAPRPFSDSLHKSLT 377
             P  ++ +PSP      Y   P   N  S   DL  A S   AA  A R           
Sbjct: 1402 SPAGSERSPSPSSTAHSYGHSPTTANYGSQTEDLPQAPSGLAAAGRAAR----------- 1450

Query: 378  KILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGPPPARL 437
                E+P SA DG G T       PQ   P +AY      + P  P +   +P   P ++
Sbjct: 1451 ----EKPLSASDGEGGT-------PQ---PSRAYSYFASSSPPLSPSSPSESPTFSPGKM 1496

Query: 438  PQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQS--APLPWPQVLPTARPSP 495
                            GP A     F    PSP     +P+S  AP P P V    + +P
Sbjct: 1497 ----------------GPRATAE--FSTQTPSPAPASDMPRSPGAPTPSPMVAQGTQ-TP 1537

Query: 496  H--------GMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKLPAVRSSQGGSPAL 547
            H          E     PF          SQ  +  A  +  P      + S     P  
Sbjct: 1538 HRPSTPRLVWQESSQEAPFMVITLASDASSQTRMVHASASTSP------LCSPTETQPTT 1591

Query: 548  FTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSS 607
              Y+  T P        V+Q    P G P  P     GA   + PL         +   S
Sbjct: 1592 HGYSQTTPP-------SVSQLPPEPPGPPGFPRVPSAGA---DGPLALYGWGALPAENIS 1641

Query: 608  LSPMSSSPANPSSEESQLPGPLGP 631
            L  +SS P     E    PGP  P
Sbjct: 1642 LCRISSVPGTSRVE----PGPRTP 1661



 Score = 40.0 bits (92), Expect = 0.046
 Identities = 51/242 (21%), Positives = 77/242 (31%), Gaps = 13/242 (5%)

Query: 3593 SGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQS-- 3650
            S K    G  GR +  H  E+      +  +  H    G      H   ++ PA  +   
Sbjct: 3641 SAKEHRHGDHGRHSGRHTGEE----PGRRAAKPHARDLGRHEARPHSQPSSAPAMPKKGQ 3696

Query: 3651 ----SSKDRSAASTPSKALKFPVHPRKAVGSL--APGELARGTENGMKPATPKAKPGPSS 3704
                SS + S  S  S A       +K        P  L    E   +P     +  P  
Sbjct: 3697 PGYPSSAEYSQPSRASSAYHHASDSKKGSRQAHSGPAALQSKAEPQAQPQLQGRQAAPGP 3756

Query: 3705 QGSGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKG 3764
            Q S SP       G +  QP + Q Q      P + +        +  P    +      
Sbjct: 3757 QQSQSPSSRQIPSGAASRQPQTQQQQQGLGLQPPQQALTQARLQQQSQPTTRGSAPAASQ 3816

Query: 3765 PREAGEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQA 3824
            P    + GP  + GP+  G    ++  G   G A++   G   +A  AP   P   +  A
Sbjct: 3817 PAGKPQPGPSTATGPQPAGPPRAEQTNGS-KGTAKAPQQGRAPQAQPAPGPGPAGVKAGA 3875

Query: 3825 TP 3826
             P
Sbjct: 3876 RP 3877



 Score = 39.3 bits (90), Expect = 0.078
 Identities = 106/447 (23%), Positives = 145/447 (32%), Gaps = 97/447 (21%)

Query: 5    RPRGAPPPTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAG----------GQ 54
            RP G P P   GD  P Q  SS   P       + P     K  RE G            
Sbjct: 3515 RPAGGPLPP-GGDTCP-QFCSSHSMPDVQEHVKDGPRAHAYK--REEGYILDDSHCVVSD 3570

Query: 55   AQAMELPEAQ------PRQARDGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRL 108
            ++A  L + +      PR AR    +     G A SS+  KRG             P+R 
Sbjct: 3571 SEAYHLGQEETDWFDKPRDARSDRFRHHG--GHAVSSSSQKRG-------------PARH 3615

Query: 109  AGRAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPR 168
            +      PP+  +            DE        A +    D  +  G      PG  R
Sbjct: 3616 SYHDYDEPPEEGLW---------PHDEGGPGRHASAKEHRHGDHGRHSGRHTGEEPG--R 3664

Query: 169  TEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQ 228
              A+P A +LG H           +  ++ PS+ P  P  G P         P S    Q
Sbjct: 3665 RAAKPHARDLGRHE----------ARPHSQPSSAPAMPKKGQPG-------YPSSAEYSQ 3707

Query: 229  ASGADSWPPAAENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPF 288
             S A S    A +S  G+      + P  +   + P   P+          L G    P 
Sbjct: 3708 PSRASSAYHHASDSKKGSRQA--HSGPAALQSKAEPQAQPQ----------LQGRQAAPG 3755

Query: 289  PADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPGGLNRH 348
            P      +    P   A  QPQ    ++ +G  P     TQ               L + 
Sbjct: 3756 PQQSQSPSSRQIPSGAASRQPQTQQQQQGLGLQPPQQALTQ-------------ARLQQQ 3802

Query: 349  SDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPG 408
            S  +   S+P A+  A +P       + T   P  PP A+   GS     +  PQ+    
Sbjct: 3803 SQPTTRGSAPAASQPAGKPQPGP--STATGPQPAGPPRAEQTNGSK--GTAKAPQQGRAP 3858

Query: 409  QAYRASGVDTSPGPPDTELAA-PGPPP 434
            QA  A G    PGP   +  A PG  P
Sbjct: 3859 QAQPAPG----PGPAGVKAGARPGGTP 3881



 Score = 38.9 bits (89), Expect = 0.10
 Identities = 58/234 (24%), Positives = 80/234 (34%), Gaps = 30/234 (12%)

Query: 422  PPDTELAAPGPPPARLPQLWDPTAAPYPTPPGGPLA---ATRSMFFNGQPSPGQRLCLPQ 478
            P     +AP  P    P    P++A Y  P     A   A+ S   + Q   G      +
Sbjct: 3681 PHSQPSSAPAMPKKGQPGY--PSSAEYSQPSRASSAYHHASDSKKGSRQAHSGPAALQSK 3738

Query: 479  SAPLPWPQVLPT-ARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKLPAV 537
            + P   PQ+    A P P   +  S    P+G    Q  +Q      G  P P++ L   
Sbjct: 3739 AEPQAQPQLQGRQAAPGPQQSQSPSSRQIPSGAASRQPQTQQQQQGLGLQP-PQQALTQA 3797

Query: 538  RSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPA 597
            R  Q                +QP   G A     P G P   P    G  P+    P  A
Sbjct: 3798 RLQQQ---------------SQPTTRGSAPAASQPAGKPQPGPSTATGPQPAG---PPRA 3839

Query: 598  TNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSPFPSP 651
              T GS  ++ +P       P ++ +  PGP G  A   P   P   G+P   P
Sbjct: 3840 EQTNGSKGTAKAPQQGRA--PQAQPAPGPGPAGVKAGARPGGTP---GAPAGQP 3888



 Score = 38.1 bits (87), Expect = 0.17
 Identities = 133/590 (22%), Positives = 196/590 (33%), Gaps = 155/590 (26%)

Query: 628  PLGPSAF----FHPPTHPQETGSPFPSPE--PPHSLPTHYQPE--PAKAFP----FPAD- 674
            P GP+AF    F PP      GS  P+    P H  PT+  P   PA AFP    +PA+ 
Sbjct: 3045 PSGPTAFQQPRFQPPAPQYSAGSGGPTQNGFPAHQAPTYPGPSTYPAPAFPPGASYPAEP 3104

Query: 675  GLGAEGAFQCLEETPFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCR 734
            GL  + AF+     P  H   +              P PT   +L     D    L   R
Sbjct: 3105 GLPNQQAFR-----PTGHYAGQT-------------PMPTTQSTLFPVPADSRAPLQKPR 3146

Query: 735  QCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHA 794
            Q     +SLA                 D  Q+ P    + + P  P   A +     S++
Sbjct: 3147 Q-----TSLA-----------------DLEQKVPTNYEVIASPVVPMSSAPSET---SYS 3181

Query: 795  KTFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLPASD---LDMEDDAKLDSLITEALNGM 851
               + +G  Q +  + P R G   S++ +P P   SD     +E +   + ++ + ++ +
Sbjct: 3182 GPAVSSGYEQGKVPEVP-RAGDRGSVSQSPAPTYPSDSHYTSLEQNVPRNYVMIDDISEL 3240

Query: 852  EYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAGVTPESKAPPPLPAATPDPQTP 911
               S +   DS  +      EP GP   SSG P K            P  P     P  P
Sbjct: 3241 TKDSTSTAPDSQRL------EPLGP--GSSGRPGKE-----------PGEPGVLDGPTLP 3281

Query: 912  RPGDRGCPARGRPKTRSLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGG 971
                  C ARG  ++      P             RGK           GG      S G
Sbjct: 3282 -----CCYARGEEESEEDSYDP-------------RGK-----------GGHLRSMESNG 3312

Query: 972  GGRASGLRPRRNDGLGERPPPRPRRPRTQAPGSRADPAPRVPRAAALPEETRSSRRRRLP 1031
                   RP      G+       R     PG      P    A A     RS  R++  
Sbjct: 3313 -------RPASTHYYGDSDYRHGARVEKYGPGPMGPKHPSKSLAPAAISSKRSKHRKQ-- 3363

Query: 1032 PRKDPRKRKARGGAWGKELILKIVQQKNRLREYDFASESEED--EQPPPRGPGFRGRRGR 1089
                           G E      Q+ ++    + A + E D    PPP        RGR
Sbjct: 3364 ---------------GME------QKISKFSPIEEAKDVESDLASYPPPAVSSSLVSRGR 3402

Query: 1090 GEKRKEVELTQGPRED--EPQKPRKAARQEA-------GGDGAPANPEEPGGSR-PGPGR 1139
               + + E+T G +++  E QK    + ++A       GG      P    G +      
Sbjct: 3403 ---KFQDEITYGLKKNVYEQQKYYGMSSRDAVEDDRIYGGSSRSRAPSAYSGEKLSSHDF 3459

Query: 1140 SPQARGPSRSLETGAAAREGGPKCADRPSVAPKDPLQVPTNTETSEETRP 1189
            S   +G  R  E     ++ GPK +       +  ++ P  ++ SEE  P
Sbjct: 3460 SGWGKGYEREREAVERLQKAGPKPSSLSMAHSR--VRPPMRSQASEEESP 3507



 Score = 38.1 bits (87), Expect = 0.17
 Identities = 60/219 (27%), Positives = 76/219 (34%), Gaps = 36/219 (16%)

Query: 328  TQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDS------LHKSLTKILP 381
            +QP+ +P    +GQPG  +     S   S P  A SA    SDS       H     +  
Sbjct: 3683 SQPSSAPAMPKKGQPGYPS-----SAEYSQPSRASSAYHHASDSKKGSRQAHSGPAALQS 3737

Query: 382  ERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPG----PPP--- 434
            +  P AQ  L   +  P    Q   P      SG  +    P T+    G    PP    
Sbjct: 3738 KAEPQAQPQLQGRQAAPGP-QQSQSPSSRQIPSGAASRQ--PQTQQQQQGLGLQPPQQAL 3794

Query: 435  --ARLPQLWDPT--------AAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPW 484
              ARL Q   PT        + P   P  GP  AT      G P   Q      +A  P 
Sbjct: 3795 TQARLQQQSQPTTRGSAPAASQPAGKPQPGPSTATGPQPA-GPPRAEQTNGSKGTAKAPQ 3853

Query: 485  ----PQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQG 519
                PQ  P   P P G++  +R     G P  Q G+ G
Sbjct: 3854 QGRAPQAQPAPGPGPAGVKAGARPGGTPGAPAGQPGADG 3892



 Score = 37.7 bits (86), Expect = 0.23
 Identities = 41/161 (25%), Positives = 58/161 (36%), Gaps = 24/161 (14%)

Query: 566  AQPQVSPH--GTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEES 623
            A+PQ  P   G  + P P+    SPS   +PS A +    T      +   P   +  ++
Sbjct: 3739 AEPQAQPQLQGRQAAPGPQQ-SQSPSSRQIPSGAASRQPQTQQQQQGLGLQPPQQALTQA 3797

Query: 624  QLPGPLGPSAFFHPPTHPQETGSPFPSPE---------PPHSLPTHYQPEPAKAFPFPAD 674
            +L     P+     P   Q  G P P P          PP +  T+     AKA   P  
Sbjct: 3798 RLQQQSQPTTRGSAPAASQPAGKPQPGPSTATGPQPAGPPRAEQTNGSKGTAKA---PQQ 3854

Query: 675  GLGAEGAFQCLEETPFPHEGPEVGRGGLQ--GFPRAPPPYP 713
            G       +  +  P P  GP   + G +  G P AP   P
Sbjct: 3855 G-------RAPQAQPAPGPGPAGVKAGARPGGTPGAPAGQP 3888



 Score = 37.7 bits (86), Expect = 0.23
 Identities = 38/165 (23%), Positives = 54/165 (32%), Gaps = 18/165 (10%)

Query: 12   PTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQAMELPEAQPRQARDG 71
            P     LQ RQ A  P     P          + +   +   Q   ++ P+    QAR  
Sbjct: 3741 PQAQPQLQGRQAAPGPQQSQSPSSRQIPSGAASRQPQTQQQQQGLGLQPPQQALTQARLQ 3800

Query: 72   ELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRYILGIASSRTKP 131
            +   P+ RG AP++         + P   P   PS   G     PP+       + +T  
Sbjct: 3801 QQSQPTTRGSAPAA---------SQPAGKPQPGPSTATGPQPAGPPR-------AEQTNG 3844

Query: 132  TLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAE 176
            +        Q  A Q      P   G  A  RPG   T   PA +
Sbjct: 3845 SKGTAKAPQQGRAPQAQPAPGPGPAGVKAGARPG--GTPGAPAGQ 3887



 Score = 37.4 bits (85), Expect = 0.30
 Identities = 31/103 (30%), Positives = 42/103 (40%), Gaps = 13/103 (12%)

Query: 79   RGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSP-PQRYILGIASSRTKPTLDETP 137
            R  APS  P    +   PP   P+      A +A G+  P R  + + ++R +P    TP
Sbjct: 2260 RYPAPSRFPI---ASSVPPAEGPVYLGKPAAAKAPGAGGPSRPEMPVGAAREEPLPTTTP 2316

Query: 138  EN---------PQLEAAQLPEVDTPQGPGTGAPLRPGLPRTEA 171
                       P   A Q P  D   G G+GA  RPG  + EA
Sbjct: 2317 AAIKEAAGAPAPAPLAGQKPPADAAPGGGSGALSRPGFEKEEA 2359



 Score = 37.0 bits (84), Expect = 0.39
 Identities = 53/229 (23%), Positives = 77/229 (33%), Gaps = 40/229 (17%)

Query: 1981 PGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPTPSPPSPNRESLAL 2040
            P G        ASP  +   P+  +        S    +   + E  P  PS    +   
Sbjct: 1390 PAGLPRGYMTPASPAGSERSPSPSSTA-HSYGHSPTTANYGSQTEDLPQAPSGLAAAGRA 1448

Query: 2041 ALTAAHSRSGSEGRTPE--------RASSPGLN------KPLLATGDSPAPSVGDLAACA 2086
            A     S S  EG TP+         +SSP L+       P  + G     +  + +   
Sbjct: 1449 AREKPLSASDGEGGTPQPSRAYSYFASSSPPLSPSSPSESPTFSPGKMGPRATAEFSTQT 1508

Query: 2087 PSPTSAAHMPCSLGPLPREDPLTSPSRAQGGLGGQLPASPS-----------------CR 2129
            PSP  A+ MP S G      P  SP  AQG      P++P                    
Sbjct: 1509 PSPAPASDMPRSPGA-----PTPSPMVAQGTQTPHRPSTPRLVWQESSQEAPFMVITLAS 1563

Query: 2130 DPPGPQQLLACSPAWAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCDP 2178
            D     +++  S + +PL      Q TT      S   PPS++  P +P
Sbjct: 1564 DASSQTRMVHASASTSPLCSPTETQPTTH---GYSQTTPPSVSQLPPEP 1609



 Score = 37.0 bits (84), Expect = 0.39
 Identities = 65/258 (25%), Positives = 83/258 (32%), Gaps = 51/258 (19%)

Query: 1751 EPGT-ADQPH-RGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATW--PFGASPS-HAAQG 1805
            EPG  A +PH R     EA        AP +  +G    P  A +  P  AS + H A  
Sbjct: 3661 EPGRRAAKPHARDLGRHEARPHSQPSSAPAMPKKGQPGYPSSAEYSQPSRASSAYHHASD 3720

Query: 1806 HSAGRAGGHLHPTA--------GRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPACVS 1857
               G    H  P A         +P  +G + AP G     +P  R+     +PS A   
Sbjct: 3721 SKKGSRQAHSGPAALQSKAEPQAQPQLQGRQAAP-GPQQSQSPSSRQ-----IPSGAASR 3774

Query: 1858 NTHPSRRSQDPALSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNPSGLEGGTV 1917
                 ++ Q   L PP +                  L +     QS P          T 
Sbjct: 3775 QPQTQQQQQGLGLQPPQQ-----------------ALTQARLQQQSQP----------TT 3807

Query: 1918 EGGKVACGPAQGSPG-GVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTANQLQPE 1976
             G   A     G P  G    T P  AG     + +G  G      K   QG A Q QP 
Sbjct: 3808 RGSAPAASQPAGKPQPGPSTATGPQPAGPPRAEQTNGSKG----TAKAPQQGRAPQAQPA 3863

Query: 1977 NGVSPGGTDNHASVNASP 1994
             G  P G    A    +P
Sbjct: 3864 PGPGPAGVKAGARPGGTP 3881



 Score = 36.2 bits (82), Expect = 0.66
 Identities = 54/200 (27%), Positives = 75/200 (37%), Gaps = 30/200 (15%)

Query: 869  ADEEPSGPRGPSSGHP-LKSKAGVTPESKAPPPLPA--ATPDPQTPR-PGDRGCP---AR 921
            A +   G R   SG   L+SKA    E +A P L    A P PQ  + P  R  P   A 
Sbjct: 3718 ASDSKKGSRQAHSGPAALQSKA----EPQAQPQLQGRQAAPGPQQSQSPSSRQIPSGAAS 3773

Query: 922  GRPKTRS----LGLAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASG 977
             +P+T+     LGL P     P Q   Q R +Q         S     GS       A  
Sbjct: 3774 RQPQTQQQQQGLGLQP-----PQQALTQARLQQ--------QSQPTTRGSAPAASQPAGK 3820

Query: 978  LRPRRNDGLGERP--PPRPRRPRTQAPGSRADPAPRVPRAAALPEETRSSRRRRLPPRKD 1035
             +P  +   G +P  PPR  +       ++A    R P+A   P    +  +    P   
Sbjct: 3821 PQPGPSTATGPQPAGPPRAEQTNGSKGTAKAPQQGRAPQAQPAPGPGPAGVKAGARPGGT 3880

Query: 1036 PRKRKARGGAWGKELILKIV 1055
            P     + GA G+ +  KI+
Sbjct: 3881 PGAPAGQPGADGESVFSKIL 3900



 Score = 34.3 bits (77), Expect = 2.5
 Identities = 42/176 (23%), Positives = 58/176 (32%), Gaps = 27/176 (15%)

Query: 321  GPAYPLPTQPAPSPLPC---YQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSLT 377
            G A  +  +P P P P    ++  P  L  H     AL      H+      +    ++T
Sbjct: 1822 GTAQSIGLKPGPVPEPGAEPHRATPAELRSH-----ALPGARKPHTVVVQMGEGTAGTVT 1876

Query: 378  KILPERPPSAQDGLGSTRGPPSSLP----QRHFPGQAYRASGVDTSPGPPDTELAAPGPP 433
             +LPE P  A D  G    P S L         P  +        +P  P+  +A   PP
Sbjct: 1877 TLLPEEPAGALDLTGMR--PESQLACCDMVYKLPFGSSCTGTFHPAPSVPEKSMADAAPP 1934

Query: 434  PARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLP 489
                   + P     P PP        +    G   PG     P     P+PQ LP
Sbjct: 1935 GQSSSPFYGPRDPEPPEPP--------TYRAQGVVGPG-----PHEEQRPYPQGLP 1977



 Score = 33.9 bits (76), Expect = 3.3
 Identities = 120/515 (23%), Positives = 174/515 (33%), Gaps = 137/515 (26%)

Query: 3452 PGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCS-------EVAPSTTKGWPETL--ERP 3502
            PG  P PG    P     P    G+LP      S         A S     P+T+  ER 
Sbjct: 404  PGPGPAPGAKTEPGARMGPGSGPGALPKTGGTTSPKHGRAEHQAASKAAAKPKTMPKERA 463

Query: 3503 VDPVTHPIR--GCELPSNHQECPPPSL--------SPFPAALADGRG---DCALDGALER 3549
            + P+       G + P+N+  C    L        +P P  +        +C     LE 
Sbjct: 464  ICPLCQAELNVGSKSPANYNTCTTCRLQVCNLCGFNPTPHLVEKTEWLCLNCQTKRLLEG 523

Query: 3550 PENEASPGSPGPLLQQALPLGASLPRPGARGQDAEGKRAPLVFSGKRRAPGARGR-CAPD 3608
               E +P  P P  QQ  P+GA     G          +PL    K++ P   G+   P 
Sbjct: 524  SLGEPTP-LPPPTSQQP-PVGAPHRASGT---------SPL----KQKGPQGLGQPSGPL 568

Query: 3609 HFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSAASTPSKALKFP 3668
              +   L  K     +S + S+  P+    +  A++P+   SS +++     P+KA   P
Sbjct: 569  PAKASPLSTK-----ASPLPSKASPQAKPLR--ASEPSKTPSSVQEKK-TRVPTKAEPMP 620

Query: 3669 VHPRKAVGSLAPGELARGTENGMKPATPKAKPGP----------------SSQGSGSPRP 3712
              P +   + A  ++  G     +PATP  K  P                S   S SP+ 
Sbjct: 621  KPPPETTPTPATPKVKSGVRRA-EPATPVVKAVPEAPKGGEAEDLVGKPYSQDASRSPQS 679

Query: 3713 GTKTGGGSQ------------PQPASGQLQSETATTPAKPSFPSR------SPAP----E 3750
             + TG  S              Q    QL S   T P  PS PS       S  P    +
Sbjct: 680  LSDTGYSSDGISSSQSEITGVVQQEVEQLDSAGVTGPHPPS-PSEIHKVGSSMRPLLQAQ 738

Query: 3751 RLPARAQAKSCTKGPREAGEQGPHG-SLGPK------------EKGESST--KRKKGQVP 3795
             L    ++K  + G  E  +Q PH  S+ P+            E+ E S   +R++ Q  
Sbjct: 739  GLAPSERSKPLSSGTGEEQKQRPHSLSITPEAFDSDEELEDILEEDEDSAEWRRRREQQD 798

Query: 3796 GPARSESVGS------------FGRAPSAPDKPPRTP--------RKQ------------ 3823
                S+  GS             G +P  P  P R          R+Q            
Sbjct: 799  TAESSDDFGSQLRHDYVEDSSEGGLSPLPPQPPARAAELTDEDFMRRQILEMSAEEDNLE 858

Query: 3824 ----ATPSRVLPTKPKPNSQNKPRPPPSEQRKAEP 3854
                AT  R L          +PRP PS++  A P
Sbjct: 859  EDDTATSGRGLAKHGTQKGGPRPRPEPSQEPAALP 893



 Score = 33.1 bits (74), Expect = 5.6
 Identities = 56/233 (24%), Positives = 79/233 (33%), Gaps = 47/233 (20%)

Query: 1104 EDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGAAAREGGPKC 1163
            ED PQ P   A   A G  A    E+P  +  G G +PQ   PSR+    A++       
Sbjct: 1433 EDLPQAPSGLA---AAGRAA---REKPLSASDGEGGTPQ---PSRAYSYFASS------- 1476

Query: 1164 ADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEALRSPPAA 1223
               P ++P  P + PT +      R + +F                      + ++P  A
Sbjct: 1477 --SPPLSPSSPSESPTFSPGKMGPRATAEF----------------------STQTPSPA 1512

Query: 1224 CAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSLLGGPGGTQAP 1283
             A +M  SPG   P   P     T TP    +        S   P +   L     +Q  
Sbjct: 1513 PASDMPRSPG--APTPSPMVAQGTQTPHRPSTPRLVWQESSQEAPFMVITLASDASSQTR 1570

Query: 1284 VSH-NSKDPPARQPGEFLAPVANPSSTACPKPSVLSSKISSFGCDPAGFNRDP 1335
            + H ++   P   P E        S T  P  S L  +       P GF R P
Sbjct: 1571 MVHASASTSPLCSPTETQPTTHGYSQTTPPSVSQLPPEPPG----PPGFPRVP 1619



 Score = 33.1 bits (74), Expect = 5.6
 Identities = 52/219 (23%), Positives = 81/219 (36%), Gaps = 22/219 (10%)

Query: 967  SGSGGGGRASGLRPRRNDGLGERPPPRPRRPRTQAPGSRADPAPRVPRAAALPEETRSSR 1026
            +G   G RA+  +P   D LG R   RP    + AP       P  P +A   + +R+S 
Sbjct: 3658 TGEEPGRRAA--KPHARD-LG-RHEARPHSQPSSAPAMPKKGQPGYPSSAEYSQPSRASS 3713

Query: 1027 RRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRLREYDFASESEEDEQPP----PRGPG 1082
                        R+A  G    +   +  Q + +L+    A   ++ + P     P G  
Sbjct: 3714 AYHHASDSKKGSRQAHSGPAALQSKAE-PQAQPQLQGRQAAPGPQQSQSPSSRQIPSGAA 3772

Query: 1083 FRG------RRGRGEKRKEVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSR-- 1134
             R       ++G G +  +  LTQ   + + Q      R  A     PA   +PG S   
Sbjct: 3773 SRQPQTQQQQQGLGLQPPQQALTQARLQQQSQP---TTRGSAPAASQPAGKPQPGPSTAT 3829

Query: 1135 -PGPGRSPQARGPSRSLETGAAAREG-GPKCADRPSVAP 1171
             P P   P+A   + S  T  A ++G  P+    P   P
Sbjct: 3830 GPQPAGPPRAEQTNGSKGTAKAPQQGRAPQAQPAPGPGP 3868



 Score = 32.7 bits (73), Expect = 7.3
 Identities = 26/110 (23%), Positives = 38/110 (34%), Gaps = 1/110 (0%)

Query: 4    ERPRGAPPPTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQAMELPEA 63
            + P     P+     QP+      G   QPP +  T A    +      G A A   P  
Sbjct: 3760 QSPSSRQIPSGAASRQPQTQQQQQGLGLQPPQQALTQARLQQQSQPTTRGSAPAASQPAG 3819

Query: 64   QPRQARDGELKPPSLRGQAPSSTPGKRGSPQTP-PGRSPLQAPSRLAGRA 112
            +P+        P          T G +G+ + P  GR+P   P+   G A
Sbjct: 3820 KPQPGPSTATGPQPAGPPRAEQTNGSKGTAKAPQQGRAPQAQPAPGPGPA 3869



 Score = 32.3 bits (72), Expect = 9.5
 Identities = 28/88 (31%), Positives = 33/88 (37%), Gaps = 12/88 (13%)

Query: 3215 RSAGKAAGSP-GDPWGQEGEAKKDSPGERAKPRARSTPSNPDGAATPDSASATALADAGS 3273
            R +  AA  P G P  Q G +    P     PRA  T  +   A  P    A     A  
Sbjct: 3808 RGSAPAASQPAGKP--QPGPSTATGPQPAGPPRAEQTNGSKGTAKAPQQGRAPQAQPAPG 3865

Query: 3274 PGP--------PRTTP-SPSPDPWAGGE 3292
            PGP        P  TP +P+  P A GE
Sbjct: 3866 PGPAGVKAGARPGGTPGAPAGQPGADGE 3893


>gi|239746149 PREDICTED: hypothetical protein LOC80164 [Homo
           sapiens]
          Length = 816

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 179/738 (24%), Positives = 246/738 (33%), Gaps = 131/738 (17%)

Query: 10  PPPTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQAME---------L 60
           P     G L PR     PG P  PP    TPA     GA  A G+    E         +
Sbjct: 17  PAARAPGLLTPRP----PGSPRPPP--PVTPAALRVLGAAGAVGRKPLAERAGGIGGATI 70

Query: 61  PEAQPRQARDGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRY 120
           PE+ PR         P+   + P+S  G+R  P       P+ +P R +G     P  + 
Sbjct: 71  PESAPRAG-------PTRTSRPPASGRGERAPPAKNTSPGPVSSPGRASGTTRPGPLGQK 123

Query: 121 ILGIASSRT--KPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAEEL 178
            L I++  T  +    E P+   L A    +   P  PGT +P         ++ A  E+
Sbjct: 124 GLRISAEETVARGKATEAPKRSALSAGARRDTSGPT-PGTPSPAM----ARRSRAAGTEV 178

Query: 179 GFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPA 238
           G  R               +PSA PRPP  GP +S  ++      +   + S A    P+
Sbjct: 179 GLPR--------------PAPSARPRPPTEGPRKSVSSA----SEHSTTEPSPAARRRPS 220

Query: 239 AENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKP------FPADV 292
           A             +   P+   +R G S RG     P    H +  KP       P  V
Sbjct: 221 AGGGLQRPASRSLSSSATPLSSPARSGPSARGT----PRAPAHPSQPKPKGLQALRPPQV 276

Query: 293 AGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYP-----LPTQPA--PSPLPCYQGQPGGL 345
                   P +        A P  +    P+ P     LP+ PA  PS      G P   
Sbjct: 277 TPPRKDAAPALGPLSSSPLATPSPSAPPSPSAPPSLQTLPSPPATPPSQATTSLGSPTLQ 336

Query: 346 NRHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERPPS-AQDGLGSTRGPPSSLPQR 404
             HS     L SP  +  A  P             P+ PP+ A   L +   PP+S P  
Sbjct: 337 ATHS----FLPSPPLSPLATPP-------------PQAPPALALPPLQAPPSPPASPPLS 379

Query: 405 HF---PGQAYRASGVDT-----SPGPPDTELAAPGPPPARLPQLWDPTAAPYPTPPGGPL 456
                  QA  A  V       SP PP   + AP  PPA       P  +P  TPP    
Sbjct: 380 PLATPSPQAPNALAVHLLQAPFSP-PPSPPVQAPFSPPA------SPPVSPSATPPSQAP 432

Query: 457 AATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGG 516
            +  +      PSP      P S P+      P+A P P     L+  P     P  Q  
Sbjct: 433 PSLAAPPLQVPPSP------PASPPMS-----PSATPPPQAPPPLAAPPLQLAKPPPQAP 481

Query: 517 SQGALGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTDPGAQPLFFG-VAQPQVSPHGT 575
              A       P P    P        +    +      P A P+    + Q   SP  +
Sbjct: 482 PALATPPLQALPSPPASFPGQAPFSPSASLPMSPLATPPPQAPPVLAAPLLQVPPSPPAS 541

Query: 576 PSLPPPR----------------VVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPS 619
           P+L  PR                 +  +P   P PS + ++  S        SS+ + P 
Sbjct: 542 PTLQAPRRPPTPGPDTSVSGPRLTLALAPGPPPPPSRSPSSTLSGPDLAGHSSSATSTPE 601

Query: 620 SEESQLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTHYQPEPAKAFPF-PADGLGA 678
                  GP G +A   PP        P      P + P  ++  P    P+ PA G G+
Sbjct: 602 ELRGYDSGPEGGAAASPPPDAELAACHPAAWSRGP-APPLAFRGAPGAPLPWPPATGPGS 660

Query: 679 EGAFQCLEETPFPHEGPE 696
                 + ET    EGPE
Sbjct: 661 ADGLCTIYET----EGPE 674



 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 155/607 (25%), Positives = 205/607 (33%), Gaps = 123/607 (20%)

Query: 8   GAPPPTMTGDLQPRQVASSPGHPSQPPLEDNTPATR-TTKGAREAGGQAQAMELPEAQPR 66
           G P P M    + R   +  G P   P     P T    K    A   +     P A+ R
Sbjct: 161 GTPSPAMAR--RSRAAGTEVGLPRPAPSARPRPPTEGPRKSVSSASEHSTTEPSPAARRR 218

Query: 67  QARDGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRYILGIAS 126
            +  G L+ P+ R  + S+TP    +   P  R   +AP+         P Q    G+ +
Sbjct: 219 PSAGGGLQRPASRSLSSSATPLSSPARSGPSARGTPRAPAH--------PSQPKPKGLQA 270

Query: 127 SR----TKPTLDETPENPQLEAAQL--PEVDTPQGPGTGAPLR--PGLPRTEAQPAAEEL 178
            R    T P  D  P    L ++ L  P    P  P     L+  P  P T    A   L
Sbjct: 271 LRPPQVTPPRKDAAPALGPLSSSPLATPSPSAPPSPSAPPSLQTLPSPPATPPSQATTSL 330

Query: 179 G------FHRCFQEPP-SSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASG 231
           G       H     PP S   +    +P A   PP   PP    + PL P + P  QA  
Sbjct: 331 GSPTLQATHSFLPSPPLSPLATPPPQAPPALALPPLQAPPSPPASPPLSPLATPSPQAPN 390

Query: 232 A---------DSWPPAAENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVS---FQFP--F 277
           A          S PP+     P +    PPA P   P  + P  +P  ++    Q P   
Sbjct: 391 ALAVHLLQAPFSPPPSPPVQAPFS----PPASPPVSPSATPPSQAPPSLAAPPLQVPPSP 446

Query: 278 PALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPC 337
           PA    S    P   A       PL  A   PQ      A+ T P   LP+ PA  P   
Sbjct: 447 PASPPMSPSATPPPQAPPPLAAPPLQLAKPPPQA---PPALATPPLQALPSPPASFP--- 500

Query: 338 YQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERPPSAQDGLGSTRGP 397
             GQ       +  S + S P +  + P P +  +  +    +P  PP A   L + R P
Sbjct: 501 --GQ-------APFSPSASLPMSPLATPPPQAPPVLAAPLLQVPPSPP-ASPTLQAPRRP 550

Query: 398 PSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGPPPARLPQ--LWDPTAAPYPT----- 450
           P+  P     G     +    +PGPP        PPP+R P   L  P  A + +     
Sbjct: 551 PTPGPDTSVSGPRLTLA---LAPGPP--------PPPSRSPSSTLSGPDLAGHSSSATST 599

Query: 451 -------------------PPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPTA 491
                              PP   LAA     ++  P+P         APLPWP      
Sbjct: 600 PEELRGYDSGPEGGAAASPPPDAELAACHPAAWSRGPAPPLAFRGAPGAPLPWP------ 653

Query: 492 RPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKLPAVRSSQGGSPALFTYN 551
                          PA GP    GS   L T  +T GP    PA  +   G P+  T  
Sbjct: 654 ---------------PATGP----GSADGLCTIYETEGPESATPAPGALDPG-PSPGTSG 693

Query: 552 GMTDPGA 558
           G    GA
Sbjct: 694 GKAAAGA 700



 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 152/575 (26%), Positives = 198/575 (34%), Gaps = 119/575 (20%)

Query: 202 TPRPP-APGPPQSRGTSPLQPGSYPEYQASGADSWPPAAENSFPGANFGVPPAEPEPIP- 259
           TPRPP +P PP      P+ P +     A+GA    P AE +       +P + P   P 
Sbjct: 26  TPRPPGSPRPPP-----PVTPAALRVLGAAGAVGRKPLAERAGGIGGATIPESAPRAGPT 80

Query: 260 KGSRPGGSPRGVSFQFPFPALHGASTKPFPADVAGHAFTN---GPLVFAFHQPQGAWPEE 316
           + SRP  S RG        A    +T P P    G A      GPL     +      EE
Sbjct: 81  RTSRPPASGRGER------APPAKNTSPGPVSSPGRASGTTRPGPLG---QKGLRISAEE 131

Query: 317 AVGTGPAYPLPTQPAPS---------PLPCYQGQPG-GLNRHSDLSGA-LSSPGAAHSA- 364
            V  G A   P + A S         P P   G P   + R S  +G  +  P  A SA 
Sbjct: 132 TVARGKATEAPKRSALSAGARRDTSGPTP---GTPSPAMARRSRAAGTEVGLPRPAPSAR 188

Query: 365 PRPFSDSLHKSLTKI----------LPERPPSAQDGLG-------STRGPPSSLPQRHFP 407
           PRP ++   KS++               R PSA  GL        S+   P S P R  P
Sbjct: 189 PRPPTEGPRKSVSSASEHSTTEPSPAARRRPSAGGGLQRPASRSLSSSATPLSSPARSGP 248

Query: 408 GQAYRASGVDTSPGPPDTELAAPGPPPARLPQLWDPTAAPY---PTPPGGPLAATRSMFF 464
                A G   +P  P        P P  L  L  P   P      P  GPL+       
Sbjct: 249 S----ARGTPRAPAHPSQ------PKPKGLQALRPPQVTPPRKDAAPALGPLS------- 291

Query: 465 NGQPSPGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQG----GSQGA 520
                         S+PL  P   P+A PSP     L  LP P   P  Q     GS   
Sbjct: 292 --------------SSPLATPS--PSAPPSPSAPPSLQTLPSPPATPPSQATTSLGSPTL 335

Query: 521 LGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPP 580
             T    P P   L  + +    +P       +  P + P     A P +SP  TPS   
Sbjct: 336 QATHSFLPSP--PLSPLATPPPQAPPALALPPLQAPPSPP-----ASPPLSPLATPSPQA 388

Query: 581 PRVVG--------ASPSESPLPSPATNTAGSTCS-SLSPMSSSPANPSSEESQLPG---- 627
           P  +         + P   P+ +P +  A    S S +P S +P + ++   Q+P     
Sbjct: 389 PNALAVHLLQAPFSPPPSPPVQAPFSPPASPPVSPSATPPSQAPPSLAAPPLQVPPSPPA 448

Query: 628 --PLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCL 685
             P+ PSA   P   P     P    +PP   P      P +A P P      +  F   
Sbjct: 449 SPPMSPSATPPPQAPPPLAAPPLQLAKPPPQAPPALATPPLQALPSPPASFPGQAPFSPS 508

Query: 686 EETPF------PHEGPEVGRGGLQGFPRAPPPYPT 714
              P       P + P V    L   P +PP  PT
Sbjct: 509 ASLPMSPLATPPPQAPPVLAAPLLQVPPSPPASPT 543



 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 161/648 (24%), Positives = 212/648 (32%), Gaps = 112/648 (17%)

Query: 875  GPRGPSSGHPLKSKAG-----VTPESKAPPPLPAATPDPQTPRPGDRGCPARGRPKTRSL 929
            G  G     PL  +AG       PES AP   P  T  P     G+R  PA    K  S 
Sbjct: 48   GAAGAVGRKPLAERAGGIGGATIPES-APRAGPTRTSRPPASGRGERAPPA----KNTSP 102

Query: 930  GLAPTEADAPSQGRQQRRG-KQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGE 988
            G   +   A    R    G K L++  ++  + G A  +       A   R       G 
Sbjct: 103  GPVSSPGRASGTTRPGPLGQKGLRISAEETVARGKATEAPKRSALSAGARRDTSGPTPGT 162

Query: 989  RPPPRPRRPRTQAPGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWGK 1048
              P   RR R  A G+             LP    S+R R  PP + PRK  +       
Sbjct: 163  PSPAMARRSR--AAGTE----------VGLPRPAPSARPR--PPTEGPRKSVSSAS---- 204

Query: 1049 ELILKIVQQKNRLREYDFASESEEDEQPPPRGPGFRGRRGRGEKRKEVELTQGPREDEPQ 1108
                          E+     S    + P  G G +    R        L+         
Sbjct: 205  --------------EHSTTEPSPAARRRPSAGGGLQRPASRSLSSSATPLS--------- 241

Query: 1109 KPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGAAAREGGPKCADRPS 1168
             P ++     G   APA+P +P        R PQ   P +            P     PS
Sbjct: 242  SPARSGPSARGTPRAPAHPSQPKPKGLQALRPPQVTPPRKDAAPALGPLSSSPLATPSPS 301

Query: 1169 VAPK-------DPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEALRSPP 1221
              P          L  P  T  S+ T  SL  P   +   +   S P S   T   ++PP
Sbjct: 302  APPSPSAPPSLQTLPSPPATPPSQAT-TSLGSP-TLQATHSFLPSPPLSPLATPPPQAPP 359

Query: 1222 AACAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSLA---NTAPHGSSPTPGVGSLLGGPG 1278
            A     + A P    P  PP S   T +P+   +LA     AP    P+P V        
Sbjct: 360  ALALPPLQAPPS--PPASPPLSPLATPSPQAPNALAVHLLQAPFSPPPSPPV-------- 409

Query: 1279 GTQAPVSHNSKDPPARQPGEFLAPVANPSSTACPKPSVLSSKISSFGCDPAGFNRDPLGV 1338
              QAP S     PPA  P   ++P A P S A   PS+ +  +      PA     P   
Sbjct: 410  --QAPFS-----PPASPP---VSPSATPPSQA--PPSLAAPPLQVPPSPPASPPMSPSAT 457

Query: 1339 PVAKKGPQPYSSPHSELFLGPKDLAGCFLEELHPKPSARDAPPASSSCLCQDGEDAGSLE 1398
            P   + P P ++P  +L   P            P   A  +PPAS       G+   S  
Sbjct: 458  P-PPQAPPPLAAPPLQLAKPPPQAPPALAT---PPLQALPSPPASF-----PGQAPFSPS 508

Query: 1399 PQLPRSPPGTAETEPGRAASPPTLE---SSSLFPDLPVDRFDPPLYGSLSANRDSGLPFA 1455
              LP SP  T   +     + P L+   S    P L   R  PP  G  ++     L  A
Sbjct: 509  ASLPMSPLATPPPQAPPVLAAPLLQVPPSPPASPTLQAPR-RPPTPGPDTSVSGPRLTLA 567

Query: 1456 CADPPQKTVPSDPPYPSFLLLEEVSPMLPSHFPDLSGGKVLSKTCPPE 1503
             A       P  PP PS       SP      PDL+G    + + P E
Sbjct: 568  LA-------PGPPPPPS------RSPSSTLSGPDLAGHSSSATSTPEE 602



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 165/692 (23%), Positives = 225/692 (32%), Gaps = 98/692 (14%)

Query: 1761 GAPAPEAF--GSPAVHLAPDLAFQGDGAPPLDATWPFGASPSHAAQGHSAGRAGGHLHP- 1817
            GA  PE+     P     P  + +G+ APP   T P   S        S GRA G   P 
Sbjct: 67   GATIPESAPRAGPTRTSRPPASGRGERAPPAKNTSPGPVS--------SPGRASGTTRPG 118

Query: 1818 TAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPACVSNTHPSRRSQDPALSPPIR-- 1875
              G+ G   +          T    R A    + + A    + P+  +  PA++   R  
Sbjct: 119  PLGQKGLRISAEETVARGKATEAPKRSA----LSAGARRDTSGPTPGTPSPAMARRSRAA 174

Query: 1876 --QLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNPSGLEGGTVEGGKVACG-PAQGSPG 1932
              ++ LP P  +             P  + P +   S  E  T E    A   P+ G  G
Sbjct: 175  GTEVGLPRPAPSARP---------RPPTEGPRKSVSSASEHSTTEPSPAARRRPSAG--G 223

Query: 1933 GVQVTTLPAVAGHQLGLEADGHWGLLGQ------AEKTQGQGTANQLQPENGVSPGGTDN 1986
            G+Q     +++     L +    G   +      A  +Q +    Q      V+P   D 
Sbjct: 224  GLQRPASRSLSSSATPLSSPARSGPSARGTPRAPAHPSQPKPKGLQALRPPQVTPPRKDA 283

Query: 1987 HASVNASPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPTPSPPSPNRESLAL-ALTAA 2045
              ++     + L  P+  A          A  SLQ    P  +PPS    SL    L A 
Sbjct: 284  APALGPLSSSPLATPSPSAP-----PSPSAPPSLQTLPSPPATPPSQATTSLGSPTLQAT 338

Query: 2046 HSRSGSEG----RTPERASSPGLNKPLLATGDSPAPSVGDLAACAPSPTSAAHMPCSLGP 2101
            HS   S       TP   + P L  P L    SP  S        PSP +   +   L  
Sbjct: 339  HSFLPSPPLSPLATPPPQAPPALALPPLQAPPSPPASPPLSPLATPSPQAPNALAVHLLQ 398

Query: 2102 LPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQLLACSPAWAPLEEADGVQATTDTGA 2161
             P   P + P +A        P SPS   P      LA  P   P   +          A
Sbjct: 399  APFSPPPSPPVQAPFSPPASPPVSPSATPPSQAPPSLAAPPLQVP--PSPPASPPMSPSA 456

Query: 2162 EDSPVAPPSLTTSPC-------DPKEALAGCLLQGEGSPLEDPSSWPPGSVSAVTCTHSG 2214
               P APP L   P            ALA   LQ   SP   P+S+P            G
Sbjct: 457  TPPPQAPPPLAAPPLQLAKPPPQAPPALATPPLQALPSP---PASFP------------G 501

Query: 2215 DTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVSP--SVAVRATGLSSTPTGDEAQAG 2272
              P   +  +P         ++P    +P L    SP  S  ++A     TP  D + +G
Sbjct: 502  QAPFSPSASLPMSPLATPPPQAPPVLAAPLLQVPPSPPASPTLQAPRRPPTPGPDTSVSG 561

Query: 2273 RGL-----PGPDPQSRGAPPHTNPDRMPRGHSSYSPSNTARL-GHREGQAVTAVPTEPPT 2326
              L     PGP P    +P  T       GHSS + S    L G+  G    A  + PP 
Sbjct: 562  PRLTLALAPGPPPPPSRSPSSTLSGPDLAGHSSSATSTPEELRGYDSGPEGGAAASPPPD 621

Query: 2327 LQGA---------GPDSPACLEGEMGTSSKEP--EDPGTPE--------TGRSGATKMPR 2367
             + A         GP  P    G  G     P    PG+ +         G   AT  P 
Sbjct: 622  AELAACHPAAWSRGPAPPLAFRGAPGAPLPWPPATGPGSADGLCTIYETEGPESATPAPG 681

Query: 2368 VTCPSTGLGLGRTTAPSSTASDFQSDSPQSHR 2399
               P    G     A +   +   S SP+  R
Sbjct: 682  ALDPGPSPGTSGGKAAAGAGAGASSRSPKQAR 713



 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 198/785 (25%), Positives = 264/785 (33%), Gaps = 130/785 (16%)

Query: 1109 KPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGAAAREGGPKCADRPS 1168
            K   AAR  A        P  PG  RP P  +P A    R L  GAA   G    A+R  
Sbjct: 9    KAGAAARTPAARAPGLLTPRPPGSPRPPPPVTPAA---LRVL--GAAGAVGRKPLAERAG 63

Query: 1169 VAPKDPLQVPTNTETSEETRPSLDFPQEAKEPETAE-ESAPDSTEFTEALRSPPAACAGE 1227
                          T  E+ P     + ++ P +   E AP +   +    S P   +G 
Sbjct: 64   ---------GIGGATIPESAPRAGPTRTSRPPASGRGERAPPAKNTSPGPVSSPGRASGT 114

Query: 1228 MGASP----GLLIPEQPPPSR-HDTGTPKPSGSLANTAPHGSSPTPGVGS--------LL 1274
                P    GL I  +   +R   T  PK S   A      S PTPG  S          
Sbjct: 115  TRPGPLGQKGLRISAEETVARGKATEAPKRSALSAGARRDTSGPTPGTPSPAMARRSRAA 174

Query: 1275 GGPGGTQAPVSHNSKDPPARQPGEFLAPVANPSSTACPKPSVLSSKISSFGCD-PAGFNR 1333
            G   G   P       PP   P + ++  A+  ST  P P+      +  G   PA  + 
Sbjct: 175  GTEVGLPRPAPSARPRPPTEGPRKSVSS-ASEHSTTEPSPAARRRPSAGGGLQRPASRSL 233

Query: 1334 DPLGVPV---AKKGPQPYSSPHSELFLGPKDLAGCFLEELHP---KPSARDAPPA----S 1383
                 P+   A+ GP    +P +          G  L+ L P    P  +DA PA    S
Sbjct: 234  SSSATPLSSPARSGPSARGTPRAPAHPSQPKPKG--LQALRPPQVTPPRKDAAPALGPLS 291

Query: 1384 SSCLCQDGEDAGSLEPQLPRSPPGTAETEPGRAASPPTLESSSL-FPDLPVDRF---DPP 1439
            SS L      A    P  P +PP + +T P   A+PP+  ++SL  P L         PP
Sbjct: 292  SSPLATPSPSA----PPSPSAPP-SLQTLPSPPATPPSQATTSLGSPTLQATHSFLPSPP 346

Query: 1440 LYGSLSANRDSGLPFACADPPQKTVPSDPPYPSFLLLEEVSPMLPSHFP-DLSGGKVLSK 1498
            L  S  A      P A A PP +  PS P  P    L   SP  P+     L        
Sbjct: 347  L--SPLATPPPQAPPALALPPLQAPPSPPASPPLSPLATPSPQAPNALAVHLLQAPFSPP 404

Query: 1499 TCPP-ERTVVPGAAPSLPGKGSGCSVALMSHLSEDELEIQKLVTELESQLQRSKDTRGAP 1557
              PP +    P A+P +    +  S A  S L+   L++             +     AP
Sbjct: 405  PSPPVQAPFSPPASPPVSPSATPPSQAPPS-LAAPPLQVPPSPPASPPMSPSATPPPQAP 463

Query: 1558 RELAEAESVGRVELGTGTEPPSQRRTCQATVPHEDTFSAADLTRVGESTAHREGAESAVA 1617
              LA       ++L    +PP Q     AT P                            
Sbjct: 464  PPLAAPP----LQL---AKPPPQAPPALATPP---------------------------- 488

Query: 1618 TVEAVQGRPGGTWPCPASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQPVQKAGASKT 1677
                +Q  P      PASF PG A   P A   +   A   P+       P+ +   S  
Sbjct: 489  ----LQALPSP----PASF-PGQAPFSPSASLPMSPLATPPPQAPPVLAAPLLQVPPSPP 539

Query: 1678 GLCQAEGDSRPP---QDVCLPEP----SKQPGPQLDAGSLAKCSPDQELSFPK-NKEAAS 1729
                 +   RPP    D  +  P    +  PGP          SP   LS P     ++S
Sbjct: 540  ASPTLQAPRRPPTPGPDTSVSGPRLTLALAPGPPPPPSR----SPSSTLSGPDLAGHSSS 595

Query: 1730 SQESEDSLRLLPCEQRGGFLPEPGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPL 1789
            +  + + LR       GG    P    +     PA  + G      AP LAF+  GAP  
Sbjct: 596  ATSTPEELRGYDSGPEGGAAASPPPDAELAACHPAAWSRGP-----APPLAFR--GAPGA 648

Query: 1790 DATWPFGASPSHA--------AQG-HSAGRAGGHLH--PTAGRPGFEGNEFAPAGASSLT 1838
               WP    P  A         +G  SA  A G L   P+ G  G +    A AGASS +
Sbjct: 649  PLPWPPATGPGSADGLCTIYETEGPESATPAPGALDPGPSPGTSGGKAAAGAGAGASSRS 708

Query: 1839 APRGR 1843
              + R
Sbjct: 709  PKQAR 713



 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 104/390 (26%), Positives = 130/390 (33%), Gaps = 69/390 (17%)

Query: 2   PGERPRGAPPPTMTGDLQPRQVASSPGHPSQPPLED-NTPATRTTKGAREAGGQAQAMEL 60
           P   P   PPP     L    + + P  P+ PPL    TP+ +           A A+ L
Sbjct: 345 PPLSPLATPPPQAPPALALPPLQAPPSPPASPPLSPLATPSPQAP--------NALAVHL 396

Query: 61  PEAQPRQARDGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRY 120
            +A           PPS   QAP S P     P +P    P QAP  LA      PP   
Sbjct: 397 LQAP-------FSPPPSPPVQAPFSPPA--SPPVSPSATPPSQAPPSLAAPPLQVPP--- 444

Query: 121 ILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAEELGF 180
                           P +P +  +  P    P  P    PL+   P  +A PA      
Sbjct: 445 --------------SPPASPPMSPSATPPPQAPP-PLAAPPLQLAKPPPQAPPALATPPL 489

Query: 181 HRCFQEPPSSFTSTNYTSPSAT------PRPPAPGPPQSRG---TSPLQPGSYPEYQASG 231
            +    PP+SF      SPSA+        PP   PP         P  P + P  QA  
Sbjct: 490 -QALPSPPASFPGQAPFSPSASLPMSPLATPPPQAPPVLAAPLLQVPPSPPASPTLQAPR 548

Query: 232 ADSWP-PAAENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPA 290
               P P    S P     + P  P P      P  SP   +   P  A H +S    P 
Sbjct: 549 RPPTPGPDTSVSGPRLTLALAPGPPPP------PSRSPSS-TLSGPDLAGHSSSATSTPE 601

Query: 291 DVAGHAFTNGPLVFAFHQPQ-----GAWPEEAVGTGPAYPL-----PTQPAPSPLPCYQG 340
           ++ G  + +GP   A   P       A    A   GPA PL     P  P P P     G
Sbjct: 602 ELRG--YDSGPEGGAAASPPPDAELAACHPAAWSRGPAPPLAFRGAPGAPLPWPPATGPG 659

Query: 341 QPGGLNRHSDLSG---ALSSPGAAHSAPRP 367
              GL    +  G   A  +PGA    P P
Sbjct: 660 SADGLCTIYETEGPESATPAPGALDPGPSP 689



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 118/486 (24%), Positives = 164/486 (33%), Gaps = 94/486 (19%)

Query: 3458 PGEDRPPPRGSSPILSEGSLPALLHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPS 3517
            PG  RPPP    P+      PA L +         K        P+      I G  +P 
Sbjct: 30   PGSPRPPP----PVT-----PAALRVLGAAGAVGRK--------PLAERAGGIGGATIPE 72

Query: 3518 NHQECPPPSLSPFPAALADGRGDCALDGALERPENEASPGS------PGPLLQQALPLGA 3571
            +     P   S  PA+   GRG+ A       P   +SPG       PGPL Q+ L + A
Sbjct: 73   SAPRAGPTRTSRPPAS---GRGERAPPAKNTSPGPVSSPGRASGTTRPGPLGQKGLRISA 129

Query: 3572 SLPRPGARGQDAEGKRAPLVFSGKRR-----APGARG-----------------RCAPDH 3609
                  ARG+  E  +   + +G RR      PG                    R AP  
Sbjct: 130  E--ETVARGKATEAPKRSALSAGARRDTSGPTPGTPSPAMARRSRAAGTEVGLPRPAPSA 187

Query: 3610 FQEDHLLQKEKEVSSS--HMVSEGGP---RGTFHKGSATKPAGCQSSSKDRSAASTPSKA 3664
                      K VSS+  H  +E  P   R     G   +PA  +S S   +  S+P+++
Sbjct: 188  RPRPPTEGPRKSVSSASEHSTTEPSPAARRRPSAGGGLQRPAS-RSLSSSATPLSSPARS 246

Query: 3665 -------LKFPVHPR----KAVGSLAPGELARGTEN-----GMKPATPKAKPGPSSQGSG 3708
                    + P HP     K + +L P ++    ++     G   ++P A P PS+  S 
Sbjct: 247  GPSARGTPRAPAHPSQPKPKGLQALRPPQVTPPRKDAAPALGPLSSSPLATPSPSAPPSP 306

Query: 3709 SPRPGTKTGGGSQPQP--------ASGQLQSETATTPAKPSFPSRSPAPERLPARAQAK- 3759
            S  P  +T       P         S  LQ+  +  P+ P  P  +P P+  PA A    
Sbjct: 307  SAPPSLQTLPSPPATPPSQATTSLGSPTLQATHSFLPSPPLSPLATPPPQAPPALALPPL 366

Query: 3760 SCTKGPREAGEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPPRT 3819
                 P  +    P  +  P+     +    +     P        F    S P  P  T
Sbjct: 367  QAPPSPPASPPLSPLATPSPQAPNALAVHLLQAPFSPPPSPPVQAPFSPPASPPVSPSAT 426

Query: 3820 PRKQATPSRVLPTKPKPNSQNKPRPPPSEQR--------KAEPGHTQRKDRLGKAFPQGR 3871
            P  QA PS   P       Q  P PP S           +A P       +L K  PQ  
Sbjct: 427  PPSQAPPSLAAPPL-----QVPPSPPASPPMSPSATPPPQAPPPLAAPPLQLAKPPPQAP 481

Query: 3872 PLLRPP 3877
            P L  P
Sbjct: 482  PALATP 487



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 94/377 (24%), Positives = 138/377 (36%), Gaps = 53/377 (14%)

Query: 3523 PPPSLSPFPAALADGRGDCALDGALERPENEASPGSPGPLLQQALPLGASL--PRPGARG 3580
            PPP ++P    +    G         +P  E + G  G  + ++ P        RP A G
Sbjct: 35   PPPPVTPAALRVLGAAGAVG-----RKPLAERAGGIGGATIPESAPRAGPTRTSRPPASG 89

Query: 3581 QDAEGKRAPLVFSGKRRAPG---ARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTF 3637
            +   G+RAP     K  +PG   + GR A    +   L QK   +S+   V+        
Sbjct: 90   R---GERAP---PAKNTSPGPVSSPGR-ASGTTRPGPLGQKGLRISAEETVA-------- 134

Query: 3638 HKGSATK-PAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATP 3696
             +G AT+ P     S+  R   S P+     P   R++         A GTE G+    P
Sbjct: 135  -RGKATEAPKRSALSAGARRDTSGPTPGTPSPAMARRS--------RAAGTEVGLPRPAP 185

Query: 3697 KAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETA--TTPAKPSFPSRSPAPERLPA 3754
             A+P P ++G             ++P PA+ +  S       PA  S  S S  P   PA
Sbjct: 186  SARPRPPTEGPRKSVSSASEHSTTEPSPAARRRPSAGGGLQRPASRSL-SSSATPLSSPA 244

Query: 3755 RAQAKSCTKGPREAG-EQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAP 3813
            R+       GP   G  + P     PK KG  + +  +   P    + ++G    +P A 
Sbjct: 245  RS-------GPSARGTPRAPAHPSQPKPKGLQALRPPQVTPPRKDAAPALGPLSSSPLAT 297

Query: 3814 DKPPRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRPL 3873
              P   P   A PS  L T P P     P  PPS+   +    T +        P   PL
Sbjct: 298  PSPSAPPSPSAPPS--LQTLPSP-----PATPPSQATTSLGSPTLQATHSFLPSPPLSPL 350

Query: 3874 LRPPKRGTAVHGAEPAE 3890
              PP +        P +
Sbjct: 351  ATPPPQAPPALALPPLQ 367



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 132/540 (24%), Positives = 171/540 (31%), Gaps = 79/540 (14%)

Query: 876  PRGPSSGHPLKSKAGVTPESKAPPPLPAATPDPQT----PRPGDRGC---------PARG 922
            PR P+ G P KS +  +  S   P  PAA   P       RP  R           PAR 
Sbjct: 189  PRPPTEG-PRKSVSSASEHSTTEPS-PAARRRPSAGGGLQRPASRSLSSSATPLSSPARS 246

Query: 923  RPKTRSLGLAPTEADAPS-QGRQQRRGKQLKLFRKDLDSG-GAAEGSGSGGGGRASGLRP 980
             P  R    AP     P  +G Q  R  Q+   RKD     G    S       ++   P
Sbjct: 247  GPSARGTPRAPAHPSQPKPKGLQALRPPQVTPPRKDAAPALGPLSSSPLATPSPSAPPSP 306

Query: 981  RRNDGLGERPPPRPRRPRTQAPGSRADPA--------PRVPRAAALPEETRSSRRRRLPP 1032
                 L   P P P  P +QA  S   P         P  P +       ++     LPP
Sbjct: 307  SAPPSLQTLPSP-PATPPSQATTSLGSPTLQATHSFLPSPPLSPLATPPPQAPPALALPP 365

Query: 1033 RKDPRKRKARGGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRGPGFRGRRGRGEK 1092
             + P    A        L     Q  N L  +   +       PPP  P           
Sbjct: 366  LQAPPSPPASPPL--SPLATPSPQAPNALAVHLLQAPFS----PPPSPP----------- 408

Query: 1093 RKEVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLET 1152
               V+    P    P  P      +A    A    + P      P  SP A  P ++   
Sbjct: 409  ---VQAPFSPPASPPVSPSATPPSQAPPSLAAPPLQVPPSPPASPPMSPSATPPPQA--- 462

Query: 1153 GAAAREGGPKCADRPSVAPKDPLQVPTNTET---SEETRPSLDFPQEAKEPETAEESAPD 1209
                    P  A  P    K P Q P    T        P   FP +A  P +   S P 
Sbjct: 463  -------PPPLAAPPLQLAKPPPQAPPALATPPLQALPSPPASFPGQA--PFSPSASLPM 513

Query: 1210 STEFTEALRSPPAACAGEMG------ASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHG 1263
            S   T   ++PP   A  +       ASP L  P +PP    DT    P  +LA      
Sbjct: 514  SPLATPPPQAPPVLAAPLLQVPPSPPASPTLQAPRRPPTPGPDTSVSGPRLTLALAPGPP 573

Query: 1264 SSPTPGVGSLLGGPGGTQAPVSHNSKDPPARQPGEFLAPVANPSSTACPKPSVLSSKISS 1323
              P+    S L GP    A  S ++   P    G    P    +++  P   + +     
Sbjct: 574  PPPSRSPSSTLSGP--DLAGHSSSATSTPEELRGYDSGPEGGAAASPPPDAELAA----- 626

Query: 1324 FGCDPAGFNRDPLGVPVAKKGPQPYSSPHSELFLGPKDLAG-CFLEELHPKPSARDAPPA 1382
              C PA ++R P   P+A +G      P      GP    G C + E     SA  AP A
Sbjct: 627  --CHPAAWSRGP-APPLAFRGAPGAPLPWPPA-TGPGSADGLCTIYETEGPESATPAPGA 682



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 194/790 (24%), Positives = 249/790 (31%), Gaps = 142/790 (17%)

Query: 428  AAPGPPPARLPQLWD--PTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWP 485
            AA   P AR P L    P  +P P PP  P AA R +   G      R  L + A     
Sbjct: 12   AAARTPAARAPGLLTPRPPGSPRPPPPVTP-AALRVL---GAAGAVGRKPLAERAGGIGG 67

Query: 486  QVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKLPAVRSSQGGSP 545
              +P + P   G    SR P              A G   + P  +   P   SS G + 
Sbjct: 68   ATIPESAPRA-GPTRTSRPP--------------ASGRGERAPPAKNTSPGPVSSPGRA- 111

Query: 546  ALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPA-TNTAGST 604
                 +G T PG  PL  G    ++S   T +         +P  S L + A  +T+G T
Sbjct: 112  -----SGTTRPG--PL--GQKGLRISAEETVARGK---ATEAPKRSALSAGARRDTSGPT 159

Query: 605  CSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTHYQPE 664
              + SP  +  +  +  E  LP P  PSA   PPT   E      S    HS     +P 
Sbjct: 160  PGTPSPAMARRSRAAGTEVGLPRP-APSARPRPPT---EGPRKSVSSASEHSTT---EPS 212

Query: 665  PAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLSSASL 724
            PA      A G     A + L  +  P   P       +G PRA P +P+        +L
Sbjct: 213  PAARRRPSAGGGLQRPASRSLSSSATPLSSPARSGPSARGTPRA-PAHPSQPKPKGLQAL 271

Query: 725  DQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPP----GLPSPPAAP 780
                V    +        L++           LA        SP  P     LPSPPA P
Sbjct: 272  RPPQVTPPRKDAAPALGPLSS---------SPLATPSPSAPPSPSAPPSLQTLPSPPATP 322

Query: 781  RVPADAHAG--LLSHAKTFLLAGDAQAEGKDDPLRTG--FLPSLAATPFP---LPASDLD 833
               A    G   L    +FL +          P       LP L A P P    P S L 
Sbjct: 323  PSQATTSLGSPTLQATHSFLPSPPLSPLATPPPQAPPALALPPLQAPPSPPASPPLSPLA 382

Query: 834  MEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAG--- 890
                   ++L    L        +P + + F         S P  PS+  P ++      
Sbjct: 383  TPSPQAPNALAVHLLQAPFSPPPSPPVQAPF-----SPPASPPVSPSATPPSQAPPSLAA 437

Query: 891  ----VTPESKAPPPL-PAATPDPQTP-----------RPGDRGCPARGRPKTRSLGLAPT 934
                V P   A PP+ P+ATP PQ P           +P  +  PA   P  ++L   P 
Sbjct: 438  PPLQVPPSPPASPPMSPSATPPPQAPPPLAAPPLQLAKPPPQAPPALATPPLQALPSPP- 496

Query: 935  EADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPPRP 994
             A  P Q                     +A    S          P     L + PP  P
Sbjct: 497  -ASFPGQA----------------PFSPSASLPMSPLATPPPQAPPVLAAPLLQVPPSPP 539

Query: 995  RRPRTQAPGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELI--- 1051
              P  QAP  R  P P    + + P  T +      P    P  R       G +L    
Sbjct: 540  ASPTLQAP--RRPPTPGPDTSVSGPRLTLA----LAPGPPPPPSRSPSSTLSGPDLAGHS 593

Query: 1052 LKIVQQKNRLREYDFASESEEDEQPPP-------------RGP----GFRGRRGRGEKRK 1094
                     LR YD   E      PPP             RGP     FRG  G      
Sbjct: 594  SSATSTPEELRGYDSGPEGGAAASPPPDAELAACHPAAWSRGPAPPLAFRGAPG------ 647

Query: 1095 EVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGA 1154
               L   P              E   +G  +    PG   PGP  SP   G   +   GA
Sbjct: 648  -APLPWPPATGPGSADGLCTIYET--EGPESATPAPGALDPGP--SPGTSGGKAAAGAGA 702

Query: 1155 AAREGGPKCA 1164
             A    PK A
Sbjct: 703  GASSRSPKQA 712



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 148/596 (24%), Positives = 179/596 (30%), Gaps = 118/596 (19%)

Query: 3193 SSAVAHLLNSITEPAPKHHRG-------KRSAGKAAGSPGDPWGQEGEAKKDSPGERAKP 3245
            SSA  H   S TEP+P   R        +R A ++  S   P        +  P  R  P
Sbjct: 201  SSASEH---STTEPSPAARRRPSAGGGLQRPASRSLSSSATPLSSPA---RSGPSARGTP 254

Query: 3246 RARSTPSNPDG----AATPDSASATALADAGSPGP----PRTTPSPSPDPWAGGEPLLQA 3297
            RA + PS P      A  P   +      A + GP    P  TPSPS  P     P LQ 
Sbjct: 255  RAPAHPSQPKPKGLQALRPPQVTPPRKDAAPALGPLSSSPLATPSPSAPPSPSAPPSLQT 314

Query: 3298 TPVHEACKDPSRDCHHCGKRFPKPFKLQRHLAVHSPQRVYLCPRCPRVYPEHGELLAHLG 3357
             P   A   PS+     G     P     H  + SP    L    P+  P          
Sbjct: 315  LPSPPATP-PSQATTSLGS----PTLQATHSFLPSPPLSPLATPPPQAPPA--------- 360

Query: 3358 GAHGLLERPELQHTPLYACELCATVMRIIKKSFACSSCNYTFAKKEQFDRHMNKHLRGGR 3417
                 L  P LQ  P                  A    +       Q    +  HL   +
Sbjct: 361  -----LALPPLQAPP---------------SPPASPPLSPLATPSPQAPNALAVHLL--Q 398

Query: 3418 QPFAFRGVRRPGAPGQKARALEGTLPSKRRRVAMPGSAP----GPGEDRPPPRGSSPILS 3473
             PF+      P +P  +A       P        P  AP     P    PP   +SP +S
Sbjct: 399  APFS-----PPPSPPVQAPFSPPASPPVSPSATPPSQAPPSLAAPPLQVPPSPPASPPMS 453

Query: 3474 EGSLPALLHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAA 3533
              + P         AP      P  L +P  P   P      P      PP S   FP  
Sbjct: 454  PSATPP------PQAPPPLAAPPLQLAKP--PPQAPPALATPPLQALPSPPAS---FPGQ 502

Query: 3534 LADGRGDCALDGALERPENEASPGSPGPLLQ-----QALPLGASLPRPGARGQDAE--GK 3586
                         L  P  +A P    PLLQ      A P   +  RP   G D    G 
Sbjct: 503  APFSPSASLPMSPLATPPPQAPPVLAAPLLQVPPSPPASPTLQAPRRPPTPGPDTSVSGP 562

Query: 3587 RAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPA 3646
            R  L  +     P +R                    S S  +S  GP    H  SAT   
Sbjct: 563  RLTLALAPGPPPPPSR--------------------SPSSTLS--GPDLAGHSSSATSTP 600

Query: 3647 ----GCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGP 3702
                G  S  +  +AAS P  A     HP       AP    RG      P  P   PG 
Sbjct: 601  EELRGYDSGPEGGAAASPPPDAELAACHPAAWSRGPAPPLAFRGAPGAPLPWPPATGPG- 659

Query: 3703 SSQG------SGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERL 3752
            S+ G      +  P   T   G   P P+ G      A   A     SRSP   RL
Sbjct: 660  SADGLCTIYETEGPESATPAPGALDPGPSPG-TSGGKAAAGAGAGASSRSPKQARL 714



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 186/763 (24%), Positives = 248/763 (32%), Gaps = 125/763 (16%)

Query: 2014 SRAAMSLQEEAEPTPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGD 2073
            +RA   L      +P PP P   +    L AA    G+ GR P    + G+     AT  
Sbjct: 19   ARAPGLLTPRPPGSPRPPPPVTPAALRVLGAA----GAVGRKPLAERAGGIGG---ATIP 71

Query: 2074 SPAPSVGDLAACAPSPTSAAHMPCSLGPLPREDPLTSPSRAQGGLGGQLPASPSCRDPPG 2133
              AP  G      P P S               P++SP RA G          + R  P 
Sbjct: 72   ESAPRAGPTRTSRP-PASGRGERAPPAKNTSPGPVSSPGRASG----------TTRPGPL 120

Query: 2134 PQQLLACSP----AWAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCDPKEALAGCLLQG 2189
             Q+ L  S     A     EA    A +  GA      P   T SP   + + A     G
Sbjct: 121  GQKGLRISAEETVARGKATEAPKRSALS-AGARRDTSGPTPGTPSPAMARRSRAAGTEVG 179

Query: 2190 EGSPLEDPSSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAV 2249
               P       PP            + P+ S     E S  E    SP  A   P AG  
Sbjct: 180  LPRPAPSARPRPPT-----------EGPRKSVSSASEHSTTEP---SPA-ARRRPSAGGG 224

Query: 2250 SPSVAVRATGLSSTPTGDEAQAG---RGLPG-------PDPQSRGA--PPHTNPDRMPRG 2297
                A R+   S+TP    A++G   RG P        P P+   A  PP   P R    
Sbjct: 225  LQRPASRSLSSSATPLSSPARSGPSARGTPRAPAHPSQPKPKGLQALRPPQVTPPRKDAA 284

Query: 2298 HSSYSPSNTARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSSKEPEDPGT--- 2354
              +  P +++ L      A  + P+ PP+LQ   P  PA    +  TS   P    T   
Sbjct: 285  -PALGPLSSSPLATPSPSAPPS-PSAPPSLQTL-PSPPATPPSQATTSLGSPTLQATHSF 341

Query: 2355 -PETGRSGATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRNASHQTPQGDPLGP 2413
             P    S     P    P+  L L    AP S         P S   +   TP   P  P
Sbjct: 342  LPSPPLSPLATPPPQAPPA--LALPPLQAPPSP--------PASPPLSPLATPS--PQAP 389

Query: 2414 QDLKQRSRGYKKKPASTENGQWKGQAPHGPVTCEVCAASFRSGPGLSRHKARKHRPHPGA 2473
              L          P  +   Q     P  P          ++ P L+   A   +  P  
Sbjct: 390  NALAVHLLQAPFSPPPSPPVQAPFSPPASPPVSPSATPPSQAPPSLA---APPLQVPPSP 446

Query: 2474 PAEP--SPAALPAQQPLEPLA----QKCQPPRKKSHRVS---------------GKERPN 2512
            PA P  SP+A P  Q   PLA    Q  +PP +    ++               G+   +
Sbjct: 447  PASPPMSPSATPPPQAPPPLAAPPLQLAKPPPQAPPALATPPLQALPSPPASFPGQAPFS 506

Query: 2513 HSRGDPSHVTQPPPAQG----SKEVLRAPGSPHSQQL-----HPPSPTEHEVDVKTPASK 2563
             S   P      PP Q     +  +L+ P SP +         PP+P        T  S 
Sbjct: 507  PSASLPMSPLATPPPQAPPVLAAPLLQVPPSPPASPTLQAPRRPPTP-----GPDTSVSG 561

Query: 2564 PRPDQAREDELHPKQAEKREGRRWRREPTVDSPSHSEGKSNKKRGKLRGRRLREESILPV 2623
            PR   A      P     R        P  D   HS   ++    +LRG     E     
Sbjct: 562  PRLTLALAP--GPPPPPSRSPSSTLSGP--DLAGHSSSATSTPE-ELRGYDSGPEGGAAA 616

Query: 2624 SADVISDGRGSRPSPAMASYAASPSHCLSVEGGPEADGEQPPRLATLGPGVMEGAAETDQ 2683
            S    ++     P    A+++  P+  L+  G P A    PP     GPG  +G     +
Sbjct: 617  SPPPDAELAACHP----AAWSRGPAPPLAFRGAPGAPLPWPP---ATGPGSADGLCTIYE 669

Query: 2684 EALCAGETGAQKPPGDRMLCPGRMDGAALGEQPTGQ-KGASAR 2725
                 G   A   PG   L PG   G + G+   G   GAS+R
Sbjct: 670  ---TEGPESATPAPG--ALDPGPSPGTSGGKAAAGAGAGASSR 707



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 123/503 (24%), Positives = 162/503 (32%), Gaps = 84/503 (16%)

Query: 3424 GVRRPGAPGQKARAL--EGTLPSKRRRVAMPGSAPGPGEDR----PPPRGSSPILSEGSL 3477
            G  RPG  GQK   +  E T+   +   A   SA   G  R    P P   SP ++  S 
Sbjct: 113  GTTRPGPLGQKGLRISAEETVARGKATEAPKRSALSAGARRDTSGPTPGTPSPAMARRSR 172

Query: 3478 PALLHLCSEVAPSTTKGWPETLE--RPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALA 3535
             A           T  G P      RP  P   P +     S H      +  P PAA  
Sbjct: 173  AA----------GTEVGLPRPAPSARPRPPTEGPRKSVSSASEHS-----TTEPSPAA-- 215

Query: 3536 DGRGDCALDGALERPENEASPGSPGPLLQQAL--PLGASLPRPGARGQDAEGK-----RA 3588
              R   +  G L+RP + +   S  PL   A   P     PR  A     + K     R 
Sbjct: 216  --RRRPSAGGGLQRPASRSLSSSATPLSSPARSGPSARGTPRAPAHPSQPKPKGLQALRP 273

Query: 3589 PLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRG--TFHKGSATKPA 3646
            P V   ++ A  A G  +                S S   S   P    T     AT P+
Sbjct: 274  PQVTPPRKDAAPALGPLSSSPLATP---------SPSAPPSPSAPPSLQTLPSPPATPPS 324

Query: 3647 GCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARG------TENGMKPATPKAKP 3700
               +S    +  +T S     P+ P       AP  LA        +     P +P A P
Sbjct: 325  QATTSLGSPTLQATHSFLPSPPLSPLATPPPQAPPALALPPLQAPPSPPASPPLSPLATP 384

Query: 3701 GPSS---------QGSGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPER 3751
             P +         Q   SP P         P PAS  + S +AT P++   PS +  P +
Sbjct: 385  SPQAPNALAVHLLQAPFSPPPSPPVQAPFSP-PASPPV-SPSATPPSQAP-PSLAAPPLQ 441

Query: 3752 LPARAQAKSCTKGPREAGEQGPHGSLGP---------KEKGESSTKRKKGQVPGPARSES 3802
            +P    A            Q P     P         +     +T   +     PA    
Sbjct: 442  VPPSPPASPPMSPSATPPPQAPPPLAAPPLQLAKPPPQAPPALATPPLQALPSPPASFPG 501

Query: 3803 VGSFGRAPSAPDKPPRTPRKQATPS------RVLPTKPKPNSQNKPRPPPSEQRKAEPGH 3856
               F  + S P  P  TP  QA P       +V P+ P   +   PR PP+      P  
Sbjct: 502  QAPFSPSASLPMSPLATPPPQAPPVLAAPLLQVPPSPPASPTLQAPRRPPT----PGPDT 557

Query: 3857 TQRKDRLGKAFPQGRPLLRPPKR 3879
            +    RL  A   G P   PP R
Sbjct: 558  SVSGPRLTLALAPGPP--PPPSR 578



 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 185/808 (22%), Positives = 244/808 (30%), Gaps = 143/808 (17%)

Query: 1288 SKDPPARQPGEFLAPVANPSSTACPKPSVLSSKISSFGCDPAGFNRDPLGVPVAKKGPQ- 1346
            ++ P AR PG  L P   P  +  P P V  + +   G   A   R PL       G   
Sbjct: 14   ARTPAARAPG-LLTP--RPPGSPRPPPPVTPAALRVLGAAGA-VGRKPLAERAGGIGGAT 69

Query: 1347 -PYSSPHSELFLGPKDLAGCFLEELHPKPSARD--APPASSSC---LCQDGEDAGSLEPQ 1400
             P S+P +    GP   +        P  S R   APPA ++    +   G  +G+  P 
Sbjct: 70   IPESAPRA----GPTRTS-------RPPASGRGERAPPAKNTSPGPVSSPGRASGTTRPG 118

Query: 1401 LPRSPPG---TAETEPGRAASPPTLESSSLFPDLPVDRFDPP--------LYGSLSANRD 1449
             P    G   +AE    R  +    + S+L      D   P            S +A  +
Sbjct: 119  -PLGQKGLRISAEETVARGKATEAPKRSALSAGARRDTSGPTPGTPSPAMARRSRAAGTE 177

Query: 1450 SGLPFACADPPQKTVPSDPPYPSFLLLEEVSPMLPSHFPDLSGGKVLSKTCPPERTVVPG 1509
             GLP        +  PS  P P                P     K +S       T    
Sbjct: 178  VGLP--------RPAPSARPRP----------------PTEGPRKSVSSASEHSTTEPSP 213

Query: 1510 AAPSLPGKGSGCSVALMSHLSEDELEIQKLVTELESQLQRSKDTRGAPRELAEAESVGRV 1569
            AA   P  G G        LS          T L S  +     RG PR  A        
Sbjct: 214  AARRRPSAGGGLQRPASRSLSSS-------ATPLSSPARSGPSARGTPRAPAHPSQPKPK 266

Query: 1570 ELGTGTEPPSQRRTCQATVPHEDTFSAADLTRVGESTAHREGAESAVATVEAVQGRPGGT 1629
             L     PP      +   P     S++ L     S      A  ++ T+ +    P  T
Sbjct: 267  GL-QALRPPQVTPPRKDAAPALGPLSSSPLATPSPSAPPSPSAPPSLQTLPS----PPAT 321

Query: 1630 WPCPASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQPVQKAGASKTGLCQAEGDSRPP 1689
             P  A+   G   L   A    +   P SP        P Q   A      QA     PP
Sbjct: 322  PPSQATTSLGSPTLQ--ATHSFLPSPPLSPLAT----PPPQAPPALALPPLQA-----PP 370

Query: 1690 QDVCLP--EPSKQPGPQ---------LDAGSLAKCSPDQELSF------PKNKEAASSQE 1732
                 P   P   P PQ         L A      SP  +  F      P +  A    +
Sbjct: 371  SPPASPPLSPLATPSPQAPNALAVHLLQAPFSPPPSPPVQAPFSPPASPPVSPSATPPSQ 430

Query: 1733 SEDSLRLLPCEQRGGFLPEPGTADQPHRGAPAPEAFGSPAVHLAP-DLAFQGDGAPPLDA 1791
            +  SL   P +     +P    A  P   +  P     P +   P  LA     APP  A
Sbjct: 431  APPSLAAPPLQ-----VPPSPPASPPMSPSATPPPQAPPPLAAPPLQLAKPPPQAPPALA 485

Query: 1792 TWPFGASPSHAAQGHSAGRAGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVP 1851
            T P  A PS  A     G+A     P+A  P       +P       AP    A L+ VP
Sbjct: 486  TPPLQALPSPPAS--FPGQAP--FSPSASLP------MSPLATPPPQAPPVLAAPLLQVP 535

Query: 1852 SPACVSNTHPSRRSQDPALSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNPSG 1911
                 S          P L  P R    P PG   S  G      L P    PP  +PS 
Sbjct: 536  PSPPAS----------PTLQAPRRP---PTPGPDTSVSGPRLTLALAPGPPPPPSRSPSS 582

Query: 1912 LEGGTVEGGKVACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTAN 1971
                         GP          +T   + G+  G E     G              +
Sbjct: 583  ----------TLSGPDLAGHSSSATSTPEELRGYDSGPEG----GAAASPPPDAELAACH 628

Query: 1972 QLQPENGVSPGGTDNHASVNASPKTALTGP--TEGAVLLEKCKGSRAAMSLQEEAEPTPS 2029
                  G +P      A     P    TGP   +G   + + +G  +A       +P PS
Sbjct: 629  PAAWSRGPAPPLAFRGAPGAPLPWPPATGPGSADGLCTIYETEGPESATPAPGALDPGPS 688

Query: 2030 PPSPNRESLALALTAAHSRSGSEGRTPE 2057
            P +   ++ A A   A SRS  + R  E
Sbjct: 689  PGTSGGKAAAGAGAGASSRSPKQARLGE 716


>gi|111118976 collagen, type II, alpha 1 isoform 1 precursor [Homo
            sapiens]
          Length = 1487

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 299/1256 (23%), Positives = 394/1256 (31%), Gaps = 248/1256 (19%)

Query: 1674 ASKTGLCQAEGDSRPPQDVC-LPEPSKQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQE 1732
            A+ +G    +G    P D+  +  P   PGPQ  AG         +    K ++ A    
Sbjct: 94   ATASGQPGPKGQKGEPGDIKDIVGPKGPPGPQGPAGEQGPRGDRGD----KGEKGAPGPR 149

Query: 1733 SEDSLRLLPCEQRGGFLPEPGTADQPHR----GAPAPEAFGSP-AVHLAPDLAFQGDGAP 1787
              D               EPGT   P      G P P   G   A  +A     +  GA 
Sbjct: 150  GRDG--------------EPGTPGNPGPPGPPGPPGPPGLGGNFAAQMAGGFDEKAGGAQ 195

Query: 1788 PLDATWPFGASPSHAAQGHSAGRAGGHLHPTAGRPGFEGNEFAPA--GASSLTAPRGREA 1845
                  P G        G +            G  GF+GN   P   G S    PRG   
Sbjct: 196  LGVMQGPMGPMGPRGPPGPAGA---------PGPQGFQGNPGEPGEPGVSGPMGPRGPPG 246

Query: 1846 WLVPVPSPACVSNTHPSRRSQDPALSPPIRQLQLPG----PGV-----------AKSKDG 1890
               P   P          ++ +     P      PG    PGV           AK + G
Sbjct: 247  ---PPGKPGDDGEAGKPGKAGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAG 303

Query: 1891 ILGL--QELTPAAQ-SPPRVNPSGLEGGTVEGGKVACGPAQGSPGGVQVTTLPAVAGHQL 1947
              G+  +  +P    SP  + P GL G     G      A+G+ G       P   G   
Sbjct: 304  APGVKGESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAG 363

Query: 1948 GLEADGHWGLLGQAEKTQGQGTANQLQPENGVSPGGTDNHASVNASPKTALTGPTEGAVL 2007
            G    G  G  G+A  T  +G      PE    P G         SP  A      G   
Sbjct: 364  GPGFPGAPGAKGEAGPTGARG------PEGAQGPRG---EPGTPGSPGPAGASGNPGTDG 414

Query: 2008 LEKCKGSRAAMSLQ-EEAEPTP-SPPSPNRESLALALTAAHSRSGSEGRTPERA--SSPG 2063
            +   KGS  A  +      P P  PP P   +  L         G  G   E+     PG
Sbjct: 415  IPGAKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPG 474

Query: 2064 LNKPLLATG----DSPAPSVGDLAACAP-SPTSAAHMPCSLGPLPREDPLTSPSRAQGGL 2118
               P  A G    +    + G+     P  P      P + G  P +D L  P  A G  
Sbjct: 475  PAGPQGAPGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRG-FPGQDGLAGPKGAPGER 533

Query: 2119 GGQLPASP-SCRDPPGPQQLLACSPAWAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCD 2177
            G    A P      PG        P    L  A G+            V P         
Sbjct: 534  GPSGLAGPKGANGDPG-------RPGEPGLPGARGLTGRPGDAGPQGKVGP--------- 577

Query: 2178 PKEALAGCLLQGEGSPLEDPSSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESP 2237
                         G+P ED    PPG   A         P       P+ +  E     P
Sbjct: 578  ------------SGAPGEDGRPGPPGPQGA------RGQPGVMGFPGPKGANGE-----P 614

Query: 2238 GRATSPPLAGAVSPSVAVRATGLSSTPTGDEAQAGRGLPGP-----DPQSRGAPPHTNPD 2292
            G+A    L G         A GL   P  D      G PGP     +   +GAP  +   
Sbjct: 615  GKAGEKGLPG---------APGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPGPSGFQ 665

Query: 2293 RMPRGHSSYSPSNTARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSSKEPED- 2351
             +P       P      G + G     VP E       GP       GE G+   +    
Sbjct: 666  GLP------GPPGPPGEGGKPGD--QGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQG 717

Query: 2352 ----PGTPET----GRSGATKMPRVTCPSTGL-------GLGRTTAPSSTASDFQSDSPQ 2396
                PGTP T    G SG    P    P  GL       G      P     D     P+
Sbjct: 718  PRGLPGTPGTDGPKGASGPAGPPGAQGP-PGLQGMPGERGAAGIAGPKGDRGDVGEKGPE 776

Query: 2397 SHRNASHQTPQGDPLGPQDLKQRSRGYKKKPASTENGQWKGQAPHGPVTCEVCAASFRSG 2456
                         P+GP             PA   NG+     P GP      +A  R  
Sbjct: 777  GAPGKDGGRGLTGPIGPPG-----------PAGA-NGEKGEVGPPGPAG----SAGARGA 820

Query: 2457 PGLSRHKARKHRPHPGAPAEPSPAALPAQQPLEPLAQKCQPPRKKSHRVSGKERPNHSRG 2516
            PG      R     PG      P     Q   +   ++ +  +K      G + P+ + G
Sbjct: 821  PG-----ERGETGPPGPAGFAGPPGADGQPGAK--GEQGEAGQKGDAGAPGPQGPSGAPG 873

Query: 2517 --DPSHVTQPPPAQGSKEVLRAPGSPHSQ-QLHPPSPTEH--EVDVKTPASKPRPDQARE 2571
               P+ VT P  A+G++    A G P +  ++ PP    +        P+ K  P  AR 
Sbjct: 874  PQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARG 933

Query: 2572 DELHPKQAEK--REGRRW----RREPTVDSPSHSEGKSNKKRGKLRGRRLREESILPVSA 2625
            D   P +A +   +G       + EP  D PS +EG    +   L G+R     I+ +  
Sbjct: 934  DSGPPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQ--GLAGQR----GIVGLPG 987

Query: 2626 DVISDGRGSRPSPAMASYAASPSHCLSVEGGPEADGEQPPRLATLGPGVMEGAAETDQEA 2685
                  RG R  P +   +  P      +G P A G++ P      PG+   A E  +E 
Sbjct: 988  Q-----RGERGFPGLPGPSGEPGK----QGAPGASGDRGPPGPVGPPGLTGPAGEPGRE- 1037

Query: 2686 LCAGETGAQKPPGDRMLCPGRMDGAALGEQPTGQKGA-SARGFWGP-------RETKALG 2737
               G  GA  PPG         DGAA  +   G+ GA  A G  GP         T   G
Sbjct: 1038 ---GSPGADGPPG--------RDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAGPTGKQG 1086

Query: 2738 VCKESGSE-PAEDSSRAHSRSEEGVWEENTPPLGPLGFPETSSSPADSTTS-----SCLQ 2791
               E+G++ P   S  A +R  +G       P GP G    +  P +         + LQ
Sbjct: 1087 DRGEAGAQGPMGPSGPAGARGIQG-------PQGPRGDKGEAGEPGERGLKGHRGFTGLQ 1139

Query: 2792 GLPDNPDTQG--GVQGPEGPT-----PDASGSSAKDPPSLFDDEVSFSQLFPPGGR 2840
            GLP  P   G  G  GP GP+     P   G S KD  +     +      PPG R
Sbjct: 1140 GLPGPPGPSGDQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIG-----PPGPR 1190



 Score = 92.8 bits (229), Expect = 6e-18
 Identities = 306/1227 (24%), Positives = 381/1227 (31%), Gaps = 267/1227 (21%)

Query: 208  PGPPQSRGTSPLQPGSYPEYQASGADSWP--PAAENSFPGANFGVPPAEPEPIPKGSRPG 265
            PGP   +G    +PG   +         P  PA E   P  + G    +  P P+G R G
Sbjct: 100  PGPKGQKG----EPGDIKDIVGPKGPPGPQGPAGEQG-PRGDRGDKGEKGAPGPRG-RDG 153

Query: 266  --GSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGT--- 320
              G+P         P   G    P P  + G+        FA  Q  G + E+A G    
Sbjct: 154  EPGTPGN-------PGPPGPPGPPGPPGLGGN--------FAA-QMAGGFDEKAGGAQLG 197

Query: 321  ---GPAYPL----PTQPAPSPLPC-YQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSL 372
               GP  P+    P  PA +P P  +QG PG       +SG +   G      +P  D  
Sbjct: 198  VMQGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPG-VSGPMGPRGPPGPPGKPGDDGE 256

Query: 373  HKSLTKILPERPPSAQDGLG--STRGPPSSLPQRHFPGQ-----AYRASGVDTSPGPPDT 425
                 K     PP  Q   G   T G P     R +PG         A GV    G P  
Sbjct: 257  AGKPGKAGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVKGESGSPG- 315

Query: 426  ELAAPGPP-PARLPQLWDPTAA------------PYPTPPGGPLAATRSMFFNGQPSPGQ 472
            E  +PGP  P  LP     T              P P  P GP+       F G P   +
Sbjct: 316  ENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFPGAPG-AK 374

Query: 473  RLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQG--------GSQGALGTA 524
                P  A  P     P   P   G       P PAG     G        GS GA G A
Sbjct: 375  GEAGPTGARGPEGAQGPRGEPGTPGS------PGPAGASGNPGTDGIPGAKGSAGAPGIA 428

Query: 525  GKT--PGPREKL-------PAVRSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQVSPH-- 573
            G    PGPR          P     Q G P +  + G   P  +P   G A PQ +P   
Sbjct: 429  GAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEP---GPAGPQGAPGPA 485

Query: 574  -------------GTPSLPPPRVVGAS-----PSESPLPSPA--------TNTAGSTCSS 607
                         G   + PP   GA      P +  L  P         +  AG   ++
Sbjct: 486  GEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGAN 545

Query: 608  LSP-MSSSPANPSSEE-SQLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTHYQPEP 665
              P     P  P +   +  PG  GP     P   P E G P     PP       QP  
Sbjct: 546  GDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRP----GPPGPQGARGQPG- 600

Query: 666  AKAFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGFP-------RAPPPYPTHHFS 718
               FP P    GA G      E   P      G  GL+G P        A PP P     
Sbjct: 601  VMGFPGPK---GANGEPGKAGEKGLP------GAPGLRGLPGKDGETGAAGPPGP----- 646

Query: 719  LSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPA 778
                                     A     R   G   A    G Q  PGPPG P    
Sbjct: 647  -------------------------AGPAGERGEQG---APGPSGFQGLPGPPGPPGEGG 678

Query: 779  APR---VPADAHA-GLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLPASDLDM 834
             P    VP +A A GL+         G+  + G         LP    T  P  AS    
Sbjct: 679  KPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAG 738

Query: 835  EDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAGVTPE 894
               A+        L GM  +     I         D    G +GP          G+T  
Sbjct: 739  PPGAQGPP----GLQGMPGERGAAGIAGPK----GDRGDVGEKGPEGAPGKDGGRGLTGP 790

Query: 895  SKAPPPLPAATPDPQTPRPGDRGCP-ARGRP----KTRSLGLAPTEADAPSQGRQQRRGK 949
               P P  A     +   PG  G   ARG P    +T   G A       + G+   +G+
Sbjct: 791  IGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGE 850

Query: 950  QLKLFRK-DLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPPRPRRP----RTQAPGS 1004
            Q +  +K D  + G    SG+ G    +G+   +     + PP     P    R   PGS
Sbjct: 851  QGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGS 910

Query: 1005 RADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRLREY 1064
              +P P  P   +  +  + +R    PP         R G  G +       +K      
Sbjct: 911  NGNPGPPGPPGPSGKDGPKGARGDSGPP--------GRAGEPGLQGPAGPPGEKG----- 957

Query: 1065 DFASESEEDEQPPPRGPGFRGRRG-------RGEKRKEVELTQGPREDEPQKPRKAARQE 1117
            +   +     + PP   G  G+RG       RGE+        GP  +    P K     
Sbjct: 958  EPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERG--FPGLPGPSGE----PGKQGAPG 1011

Query: 1118 AGGDGAPANPEEPGG-----SRPGPGRSPQARGP----------SRSLETGAAAREGGP- 1161
            A GD  P  P  P G       PG   SP A GP              ETGA    G P 
Sbjct: 1012 ASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPG 1071

Query: 1162 ------------KCADRPSVAPKDPL--QVPTNTETSEETRPSLDFPQEAKEPETAEESA 1207
                        K  DR     + P+    P      +  +       EA EP   E   
Sbjct: 1072 PPGSPGPAGPTGKQGDRGEAGAQGPMGPSGPAGARGIQGPQGPRGDKGEAGEP--GERGL 1129

Query: 1208 PDSTEFT--EALRSPPAACAGEMGAS--PGLLIPEQPP----PSRHD--------TGTPK 1251
                 FT  + L  PP   +G+ GAS   G   P  PP    PS  D         G P 
Sbjct: 1130 KGHRGFTGLQGLPGPPGP-SGDQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGPPG 1188

Query: 1252 PSGSLANTAPHGSSPTPGVGSLLGGPG 1278
            P G    T P G    PG     G PG
Sbjct: 1189 PRGRSGETGPAGPPGNPGPPGPPGPPG 1215



 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 211/804 (26%), Positives = 258/804 (32%), Gaps = 117/804 (14%)

Query: 2   PGERPRGAPPPTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGG-QAQAME- 59
           PG R R   P T      P      PG P  P L  N  A        +AGG Q   M+ 
Sbjct: 146 PGPRGRDGEPGTPGNPGPP----GPPGPPGPPGLGGNFAAQMAGGFDEKAGGAQLGVMQG 201

Query: 60  ---------------LPEAQPRQARDGELKPPSLRG-QAPSSTPGKRGSPQTP-----PG 98
                           P  Q  Q   GE   P + G   P   PG  G P        PG
Sbjct: 202 PMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMGPRGPPGPPGKPGDDGEAGKPG 261

Query: 99  RSPLQAPSRLAGRAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGT 158
           ++  + P    G A G P    + G+   R  P LD           +  E  +P   G+
Sbjct: 262 KAGERGPPGPQG-ARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVK-GESGSPGENGS 319

Query: 159 GAPLRP-GLPRTEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPR-PPAPG------P 210
             P+ P GLP    +         R     P          P+  P  P APG      P
Sbjct: 320 PGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFPGAPGAKGEAGP 379

Query: 211 PQSRGTSPLQ-----PGSYPEYQASGADSWP-----PAAENSFPGANFGVPPAEPEPI-P 259
             +RG    Q     PG+      +GA   P     P A+ S         P  P P  P
Sbjct: 380 TGARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGP 439

Query: 260 KGSRPGGSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVG 319
            G +    P G   Q   P + G   +  P    G A   G    A  + +     E  G
Sbjct: 440 PGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQGAPGPAGEEGKRGARGEPGG 499

Query: 320 TGPAYPLPTQPAPSPLPCYQGQPG-----GLNRHSDLSGALSSPGAAHSAPRPFSDSLHK 374
            GP  P   + AP     + GQ G     G       SG     GA     RP    L  
Sbjct: 500 VGPIGPPGERGAPGNRG-FPGQDGLAGPKGAPGERGPSGLAGPKGANGDPGRPGEPGLPG 558

Query: 375 SLTKILPERP----------PSAQDGLGSTRGPPSSLPQRHFPGQAY--RASGVDTSPGP 422
           +  + L  RP          PS   G     GPP     R  PG        G +  PG 
Sbjct: 559 A--RGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGK 616

Query: 423 PDTELAAPGPPPAR-LPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAP 481
              E   PG P  R LP     T A  P  P GP          G PS  Q L  P   P
Sbjct: 617 AG-EKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPG-PSGFQGLPGPPGPP 674

Query: 482 ----LPWPQVLPTARPSPHGMEMLSRLPFPA--GGPEWQG--GSQGALGTAGKTPGPREK 533
                P  Q +P    +P  +       FP   G P  QG  G +G  GT G T GP+  
Sbjct: 675 GEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPG-TDGPKGA 733

Query: 534 L-PAVRSSQGGSPALFTYNGMTDPGAQPLFFGVAQP--------QVSPHGTPSLPPPRVV 584
             PA      G P L    GM  PG +    G+A P        +  P G P     R +
Sbjct: 734 SGPAGPPGAQGPPGL---QGM--PGERGAA-GIAGPKGDRGDVGEKGPEGAPGKDGGRGL 787

Query: 585 GASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQET 644
              P   P P+ A    G       P  S+ A  +  E    GP GP+ F  PP    + 
Sbjct: 788 -TGPIGPPGPAGANGEKGEV-GPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQP 845

Query: 645 GSP-------------FPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFP 691
           G+               P P+ P   P    P+       P    GA+G       T FP
Sbjct: 846 GAKGEQGEAGQKGDAGAPGPQGPSGAPG---PQGPTGVTGPKGARGAQGPPGA---TGFP 899

Query: 692 HEGPEVGRGGLQGFPRAP-PPYPT 714
                VG  G  G P  P PP P+
Sbjct: 900 GAAGRVGPPGSNGNPGPPGPPGPS 923



 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 216/837 (25%), Positives = 264/837 (31%), Gaps = 149/837 (17%)

Query: 6    PRGAPPPT-MTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQAMELPEAQ 64
            PRG P P   TG L P+     PG              +  +G +   G A     P   
Sbjct: 436  PRGPPGPQGATGPLGPKGQTGEPG----------IAGFKGEQGPKGEPGPAGPQGAPGPA 485

Query: 65   PRQARDGELKPPSLRGQAPSSTPGKRGSPQTP--PGRSPLQAPSRLAGRAEGSPPQRYIL 122
              + + G    P   G  P   PG+RG+P     PG+  L  P       +G+P +R   
Sbjct: 486  GEEGKRGARGEPG--GVGPIGPPGERGAPGNRGFPGQDGLAGP-------KGAPGERGPS 536

Query: 123  GIASSRTKPTLDETPENPQLEAAQ----LPEVDTPQGP--GTGAPLRPGLPRTEAQPAAE 176
            G+A  +        P  P L  A+     P    PQG    +GAP   G P       A 
Sbjct: 537  GLAGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGAR 596

Query: 177  ELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWP 236
                   F  P  +        P        PG P  RG     PG   E  A+G     
Sbjct: 597  GQPGVMGFPGPKGA-----NGEPGKAGEKGLPGAPGLRGL----PGKDGETGAAGPPGPA 647

Query: 237  -PAAENSFPGA----NFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGA-STKPFPA 290
             PA E    GA     F   P  P P  +G +PG   +GV  +   P L G    + FP 
Sbjct: 648  GPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKPGD--QGVPGEAGAPGLVGPRGERGFPG 705

Query: 291  DVA--GHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPG--GLN 346
            +    G     GP       P    P+ A  +GPA P    P     P  QG PG  G  
Sbjct: 706  ERGSPGAQGLQGPRGLP-GTPGTDGPKGA--SGPAGP----PGAQGPPGLQGMPGERGAA 758

Query: 347  RHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERP-----------PSAQDGLGSTR 395
              +   G     G       P  D        I P  P           P    G    R
Sbjct: 759  GIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGAR 818

Query: 396  GPPSSLPQRHFPGQAYRAS--GVDTSPGPPDTELAAPGPPPARLPQLWDPTAAPYP---- 449
            G P    +   PG A  A   G D  PG    +  A     A  P    P+ AP P    
Sbjct: 819  GAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPT 878

Query: 450  --TPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLP--TARPSPHGMEMLSRLP 505
              T P G   A       G P    R+  P S   P P   P  + +  P G    S  P
Sbjct: 879  GVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPP 938

Query: 506  FPAGGPEWQGGSQGALGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTD-PGAQPLFFG 564
              AG P    G QG  G  G+   P +  P+      G   L    G+   PG       
Sbjct: 939  GRAGEP----GLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPG------- 987

Query: 565  VAQPQVSPHGTPSLPPPR-------VVGASPSESPLPSPA-----TNTAGSTCSSLSPMS 612
                Q    G P LP P          GAS    P P P      T  AG      SP +
Sbjct: 988  ----QRGERGFPGLPGPSGEPGKQGAPGASGDRGP-PGPVGPPGLTGPAGEPGREGSPGA 1042

Query: 613  SSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTHYQPEPAKAF--- 669
              P         + G  G +     P  P   GSP P+       PT  Q +  +A    
Sbjct: 1043 DGPPGRDGAAG-VKGDRGETGAVGAPGAPGPPGSPGPAG------PTGKQGDRGEAGAQG 1095

Query: 670  ------PFPADGL-GAEGAFQCLEETPFPHE-GPEVGRG--GLQGFPRAPPPYPTHHFSL 719
                  P  A G+ G +G      E   P E G +  RG  GLQG P  P P        
Sbjct: 1096 PMGPSGPAGARGIQGPQGPRGDKGEAGEPGERGLKGHRGFTGLQGLPGPPGP-------- 1147

Query: 720  SSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSP 776
                             D+  S  A     R   G +    KDG    PGP G P P
Sbjct: 1148 ---------------SGDQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGPPGP 1189



 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 256/1081 (23%), Positives = 319/1081 (29%), Gaps = 221/1081 (20%)

Query: 425  TELAAPGPP-----PARLPQLWDPTAAPYPTPPGG---PLAATRSMFFNGQPSPGQRLCL 476
            T    PGP      P  +  +  P   P P  P G   P          G P P  R   
Sbjct: 95   TASGQPGPKGQKGEPGDIKDIVGPKGPPGPQGPAGEQGPRGDRGDKGEKGAPGPRGRDGE 154

Query: 477  PQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKLPA 536
            P +   P P   P   P P G+          G  E  GG+Q  LG      GP    P 
Sbjct: 155  PGTPGNPGPPG-PPGPPGPPGLGGNFAAQMAGGFDEKAGGAQ--LGVMQGPMGPMG--PR 209

Query: 537  VRSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSP 596
                  G+P    + G      +P   GV+ P + P G P   PP   G    E+  P  
Sbjct: 210  GPPGPAGAPGPQGFQGNPGEPGEP---GVSGP-MGPRGPPG--PPGKPG-DDGEAGKPGK 262

Query: 597  ATNTAGSTCSSLSPMSSSPANPSSEESQ-LPGPLGPSAFFHPPTHPQETGSP----FPSP 651
            A                +P  P  +  +  PG  G       P    E+GSP     P P
Sbjct: 263  AGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVKGESGSPGENGSPGP 322

Query: 652  EPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGP-EVGRGGLQGFPRAPP 710
              P  LP        +    PA   GA G     +  P P   P  VG  G  GFP AP 
Sbjct: 323  MGPRGLPGE------RGRTGPAGAAGARGN----DGQPGPAGPPGPVGPAGGPGFPGAP- 371

Query: 711  PYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGP 770
                                                   +   G   AR  +G Q   G 
Sbjct: 372  -------------------------------------GAKGEAGPTGARGPEGAQGPRGE 394

Query: 771  PGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATP-FPLPA 829
            PG P  P     PA A             +G+   +G      +   P +A  P FP P 
Sbjct: 395  PGTPGSPG----PAGA-------------SGNPGTDGIPGAKGSAGAPGIAGAPGFPGPR 437

Query: 830  SDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKA 889
                 +         T  L G + Q+  P I     +     EP GP GP        + 
Sbjct: 438  GPPGPQG-------ATGPL-GPKGQTGEPGIAGFKGEQGPKGEP-GPAGPQGAPGPAGEE 488

Query: 890  GVTPESKAPPPLPAATPDPQTPRPGDRGCPA-------RGRPKTRS-LGLAPTEADAPSQ 941
            G       P  +    P  +   PG+RG P        +G P  R   GLA  +      
Sbjct: 489  GKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDP 548

Query: 942  GRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERP-PPRPRRPRTQ 1000
            GR    G            G        G  G    + P    G   RP PP P+  R Q
Sbjct: 549  GRPGEPGLP----------GARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQ 598

Query: 1001 APGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNR 1060
             PG    P P+         E   +  + LP     R    + G  G             
Sbjct: 599  -PGVMGFPGPKGANG-----EPGKAGEKGLPGAPGLRGLPGKDGETGAA---------GP 643

Query: 1061 LREYDFASESEEDEQPPPRG----PGFRGRRGRGEKRKEVELTQ--------GPREDEPQ 1108
                  A E  E   P P G    PG  G  G G K  +  +          GPR +   
Sbjct: 644  PGPAGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGF 703

Query: 1109 KPRKAARQEAGGDGAPANPEEPGGSRP----GPGRSPQARGP----SRSLETGAAAREGG 1160
               + +    G  G    P  PG   P    GP   P A+GP        E GAA    G
Sbjct: 704  PGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGI-AG 762

Query: 1161 PKCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEALRSP 1220
            PK  DR  V  K P   P        T P           E  E   P       A  +P
Sbjct: 763  PK-GDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAP 821

Query: 1221 ----------PAACAGEMGA--------------------SPGLLIPEQPPPSRHDTGTP 1250
                      PA  AG  GA                    +PG   P   P  +  TG  
Sbjct: 822  GERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVT 881

Query: 1251 KPSGSLANTAPHGSSPTPGVGSLLGGPG-----GTQAPVSHNSKDPPARQPGEFLAPVAN 1305
             P G+     P G++  PG    +G PG     G   P   + KD P    G+   P   
Sbjct: 882  GPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGD-SGPPGR 940

Query: 1306 PSSTACPKPSVLSSKISSFGCD-PAGFNRDPLGVPVAKKGPQPYSSPHSELFL----GPK 1360
                    P+    +    G D P+G    P        GPQ  +     + L    G +
Sbjct: 941  AGEPGLQGPAGPPGEKGEPGDDGPSGAEGPP--------GPQGLAGQRGIVGLPGQRGER 992

Query: 1361 DLAGCFLEELHPKPSARDAPPASSSCLCQDGEDAGSLEPQLPRSPPGTA--ETEPGRAAS 1418
               G  L     +P  + AP AS           G   P  P  PPG      EPGR  S
Sbjct: 993  GFPG--LPGPSGEPGKQGAPGAS-----------GDRGPPGPVGPPGLTGPAGEPGREGS 1039

Query: 1419 P 1419
            P
Sbjct: 1040 P 1040



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 261/1086 (24%), Positives = 342/1086 (31%), Gaps = 209/1086 (19%)

Query: 455  PLAATRSMFFNGQPSP-GQR--------LCLPQSAPLPWPQVLPTARPSPHGMEMLSRLP 505
            P+  T     +GQP P GQ+        +  P+  P P     P     P G +   +  
Sbjct: 87   PICPTDLATASGQPGPKGQKGEPGDIKDIVGPKGPPGPQG---PAGEQGPRG-DRGDKGE 142

Query: 506  FPAGGPEWQGGSQGALGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTDP--GAQPLFF 563
              A GP  + G  G  G  G  PGP    P      GG+ A     G  +   GAQ    
Sbjct: 143  KGAPGPRGRDGEPGTPGNPGP-PGPPG--PPGPPGLGGNFAAQMAGGFDEKAGGAQ---L 196

Query: 564  GVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEES 623
            GV Q  + P G P  PP       P+ +P P                   +P  P   E 
Sbjct: 197  GVMQGPMGPMG-PRGPP------GPAGAPGPQG--------------FQGNPGEPG--EP 233

Query: 624  QLPGPLGPSAFFHPPTHPQ---ETGSPFPSPE--PPHSLPTHYQPEPAKAFPFPADGLGA 678
             + GP+GP     PP  P    E G P  + E  PP        P+ A+ FP      G 
Sbjct: 234  GVSGPMGPRGPPGPPGKPGDDGEAGKPGKAGERGPPG-------PQGARGFPGTPGLPGV 286

Query: 679  EG--AFQCLEETPFPHEGPEV-GRGGLQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCRQ 735
            +G   +  L+        P V G  G  G   +P P                        
Sbjct: 287  KGHRGYPGLDGAKGEAGAPGVKGESGSPGENGSPGPMGPR-------------------- 326

Query: 736  CDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAK 795
                   L          G   AR  DG     GPPG   P   P  P    A       
Sbjct: 327  ------GLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFPGAPGAK------ 374

Query: 796  TFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQS 855
                AG   A G +        P    +P P  AS           +  T+ + G +  +
Sbjct: 375  --GEAGPTGARGPEGAQGPRGEPGTPGSPGPAGAS----------GNPGTDGIPGAKGSA 422

Query: 856  DNPEIDSS--FIDVFADEEPSGPRGP-----SSGHP----LKSKAGVTPESKAPPPLPAA 904
              P I  +  F        P G  GP      +G P     K + G  P+ +  P  P  
Sbjct: 423  GAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQG--PKGEPGPAGPQG 480

Query: 905  TPDPQTPRPGDRGCPARGRPKTRSLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAA 964
             P P     G RG  ARG P        P E  AP  G +   G+            G A
Sbjct: 481  APGP-AGEEGKRG--ARGEPGGVGPIGPPGERGAP--GNRGFPGQD-----------GLA 524

Query: 965  EGSGSGGGGRASGLR-PRRNDGLGERPPPRPRRPRTQ-APGSRADPAPRVPRAAALPEET 1022
               G+ G    SGL  P+  +G     P RP  P    A G    P    P+    P   
Sbjct: 525  GPKGAPGERGPSGLAGPKGANG----DPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGA 580

Query: 1023 RSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRGPG 1082
                 R  PP           GA G+  ++     K    E       +  E+  P  PG
Sbjct: 581  PGEDGRPGPPGPQ--------GARGQPGVMGFPGPKGANGE-----PGKAGEKGLPGAPG 627

Query: 1083 FRGRRGRGEKRKEVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPG-GSRPG----P 1137
             RG  G+ +         GP     ++  + A   +G  G P  P  PG G +PG    P
Sbjct: 628  LRGLPGK-DGETGAAGPPGPAGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKPGDQGVP 686

Query: 1138 GR--SPQARGPSRSL----ETGAAAREG--------------GPKCADRPSVAPKDPLQV 1177
            G   +P   GP        E G+   +G              GPK A  P+  P    Q 
Sbjct: 687  GEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPP--GAQG 744

Query: 1178 PTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEALRSPPAACAGEMGASPGLLIP 1237
            P   +     R +        +     E  P+     +  R       G +G  PG   P
Sbjct: 745  PPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGR----GLTGPIG-PPG---P 796

Query: 1238 EQPPPSRHDTGTPKPSGSL-ANTAP--HGSSPTPGVGSLLGGPGGTQAPVSHNSKDPPAR 1294
                  + + G P P+GS  A  AP   G +  PG     G PG    P     +   A 
Sbjct: 797  AGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQP-GAKGEQGEAG 855

Query: 1295 QPGEFLAP-VANPSSTACPK-PSVLSSKISSFGCD-PAGFNRDP-----LGVPVAKKGPQ 1346
            Q G+  AP    PS    P+ P+ ++    + G   P G    P     +G P +   P 
Sbjct: 856  QKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPG 915

Query: 1347 PYSSPHSELFLGPKDLAGCFLEELHPKPSARDAPPASSSCLCQDGE--DAGSLEPQLPRS 1404
            P   P      GPK   G         P  R   P         GE  + G   P     
Sbjct: 916  PPGPPGPSGKDGPKGARG------DSGPPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEG 969

Query: 1405 PPGTAETEPGRA-ASPPTLESSSLFPDLPVDRFDPPLYGSLSANRDSGLPFACADPPQKT 1463
            PPG       R     P       FP LP    +P   G+  A+ D G P     PP  T
Sbjct: 970  PPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPP-GPVGPPGLT 1028

Query: 1464 VPSDPP 1469
             P+  P
Sbjct: 1029 GPAGEP 1034



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 265/1132 (23%), Positives = 348/1132 (30%), Gaps = 234/1132 (20%)

Query: 6    PRGAPPPTMTGDLQPRQVASSPGHPSQP----PLEDNTPATRTTKGAR--EAGGQAQAME 59
            PRG P P   G   P+    +PG P +P    P+    P     K     EAG   +A E
Sbjct: 208  PRGPPGPA--GAPGPQGFQGNPGEPGEPGVSGPMGPRGPPGPPGKPGDDGEAGKPGKAGE 265

Query: 60   LPEAQPRQARD-----------------------GELKPPSLRGQAPSSTPGKRGSP--- 93
                 P+ AR                        GE   P ++G+  S +PG+ GSP   
Sbjct: 266  RGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVKGE--SGSPGENGSPGPM 323

Query: 94   --QTPPGRSPLQAPSRLAGRAEGSPPQRYILGI-----------------ASSRTKPTLD 134
              +  PG      P+  AG A G+  Q    G                  A     PT  
Sbjct: 324  GPRGLPGERGRTGPAGAAG-ARGNDGQPGPAGPPGPVGPAGGPGFPGAPGAKGEAGPTGA 382

Query: 135  ETPENPQLEAAQLPEVDTPQGPG----TGAPLRPGLPRTEAQPAAEELGFHRCF---QEP 187
              PE  Q       E  TP  PG    +G P   G+P  +    A  +     F   + P
Sbjct: 383  RGPEGAQ---GPRGEPGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGP 439

Query: 188  PSSFTSTNYTSPSATPRPPA-------------PGPPQSRGTSPLQPGSYPEYQASGADS 234
            P    +T    P      P              PGP   +G     PG   E    GA  
Sbjct: 440  PGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQGA----PGPAGEEGKRGARG 495

Query: 235  WP-------PAAENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKP 287
             P       P  E   PG N G P  +    PKG+     P G++        +G   +P
Sbjct: 496  EPGGVGPIGPPGERGAPG-NRGFPGQDGLAGPKGAPGERGPSGLAGP---KGANGDPGRP 551

Query: 288  FPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPG---- 343
                + G     G       +P  A P+  VG   A     +P P      +GQPG    
Sbjct: 552  GEPGLPGARGLTG-------RPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGF 604

Query: 344  ----GLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERP-----------PSAQ 388
                G N     +G    PGA      P  D    +     P  P           PS  
Sbjct: 605  PGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPGPSGF 664

Query: 389  DGLGSTRGPPSSLPQ---RHFPGQAYRASGVDTSPGPPDT-----ELAAPGPP----PAR 436
             GL    GPP    +   +  PG+A    G     GP        E  +PG      P  
Sbjct: 665  QGLPGPPGPPGEGGKPGDQGVPGEA----GAPGLVGPRGERGFPGERGSPGAQGLQGPRG 720

Query: 437  LPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQR----LCLPQSAPLPWPQVLPTAR 492
            LP           + P GP  A       G P  G+R    +  P+       +  P   
Sbjct: 721  LPGTPGTDGPKGASGPAGPPGAQGPPGLQGMP--GERGAAGIAGPKGDRGDVGEKGPEGA 778

Query: 493  PSPHGMEMLSRL---PFPAG--GPEWQGGSQGALGTAGKTPGPREKLPAVRSSQGGSPAL 547
            P   G   L+     P PAG  G + + G  G  G+AG    P E+       + G P  
Sbjct: 779  PGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGER------GETGPPGP 832

Query: 548  FTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPS-ESPL----PSPATNTAG 602
              + G      QP   G  Q +    G    P P+    +P  + P     P  A    G
Sbjct: 833  AGFAGPPGADGQPGAKG-EQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQG 891

Query: 603  STCSSLSPMSSSPANP--SSEESQLPGPLGPSAFFHPPTHPQETGSPFPSPEP---PHSL 657
               ++  P ++    P  S+     PGP GPS    P     ++G P  + EP     + 
Sbjct: 892  PPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAG 951

Query: 658  PTHYQPEPAKAFPFPADG----------LGAEGAFQCLEETPFPHEGPEVGRGGLQGFPR 707
            P   + EP    P  A+G           G  G      E  FP      G  G QG P 
Sbjct: 952  PPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPG 1011

Query: 708  AP----PPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDG 763
            A     PP P     L+  +           +  R  S  A     R   G    +   G
Sbjct: 1012 ASGDRGPPGPVGPPGLTGPA----------GEPGREGSPGADGPPGRD--GAAGVKGDRG 1059

Query: 764  HQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAAT 823
               + G PG P PP +P  PA                GD    G   P+     PS  A 
Sbjct: 1060 ETGAVGAPGAPGPPGSPG-PAGPTG----------KQGDRGEAGAQGPMG----PSGPAG 1104

Query: 824  PFPLPASDLDMEDDAKLDSLITEALNGME-----YQSDNPEIDSSFIDVFADEEPSGPRG 878
               +        D  +        L G            P   S          PSGPRG
Sbjct: 1105 ARGIQGPQGPRGDKGEAGEPGERGLKGHRGFTGLQGLPGPPGPSGDQGASGPAGPSGPRG 1164

Query: 879  PSSGHPLKSKAGVT----------PESKAPPPLPAATPDPQTPRPGDRGCPARGRPKTRS 928
            P        K G            P  ++    PA  P    P PG  G P  G   +  
Sbjct: 1165 PPGPVGPSGKDGANGIPGPIGPPGPRGRSGETGPAGPPGNPGP-PGPPGPPGPGIDMSAF 1223

Query: 929  LGLAPTE----------ADAPSQGRQQRRGK---QLKLFRKDLDSGGAAEGS 967
             GL P E          AD  + G +Q   +    LK     ++S  + EGS
Sbjct: 1224 AGLGPREKGPDPLQYMRADQAAGGLRQHDAEVDATLKSLNNQIESIRSPEGS 1275



 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 123/507 (24%), Positives = 162/507 (31%), Gaps = 66/507 (13%)

Query: 3414 RGGRQPFAFRGVRRPGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILS 3473
            +G   P  F+G+  PG PG      EG  P  +    +PG A  PG     PRG      
Sbjct: 656  QGAPGPSGFQGL--PGPPGPPG---EGGKPGDQ---GVPGEAGAPG--LVGPRGERGFPG 705

Query: 3474 EGSLPALLHLCSEVAPSTTKGW--PETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFP 3531
            E   P    L        T G   P+    P  P      G + P   Q  P    +   
Sbjct: 706  ERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPP-----GAQGPPGLQGMPGERGAAGI 760

Query: 3532 AALADGRGDCALDGALERPENEASPGSPGPLLQQALPLGASLPRP-GARGQDAE-GKRAP 3589
            A     RGD    G    P  +   G  GP+           P P GA G+  E G   P
Sbjct: 761  AGPKGDRGDVGEKGPEGAPGKDGGRGLTGPI---------GPPGPAGANGEKGEVGPPGP 811

Query: 3590 LVFSGKRRAPGARGRCA----------PDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHK 3639
               +G R APG RG             P    +     ++ E          GP+G    
Sbjct: 812  AGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGA 871

Query: 3640 GSATKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAK 3699
                 P G  +  K    A  P  A  FP     A G + P   + G      P  P  K
Sbjct: 872  PGPQGPTGV-TGPKGARGAQGPPGATGFP----GAAGRVGPPG-SNGNPGPPGPPGPSGK 925

Query: 3700 PGPSSQGSGSPRPGTKTGGGSQ-PQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQA 3758
             GP      S  PG     G Q P    G+        P+    P   P P+ L   A  
Sbjct: 926  DGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEGP---PGPQGL---AGQ 979

Query: 3759 KSCTKGPREAGEQGPHGSLGPKEK-------GESSTKRKKGQVPGPARSESVGSFGR--A 3809
            +     P + GE+G  G  GP  +       G S  +   G V  P  +   G  GR  +
Sbjct: 980  RGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGS 1039

Query: 3810 PSAPDKPPRTPRKQATPSR----VLPTKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGK 3865
            P A   P R         R     +     P     P P     ++ + G    +  +G 
Sbjct: 1040 PGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMGP 1099

Query: 3866 AFPQGRPLLRPPK--RGTAVHGAEPAE 3890
            + P G   ++ P+  RG      EP E
Sbjct: 1100 SGPAGARGIQGPQGPRGDKGEAGEPGE 1126



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 170/653 (26%), Positives = 209/653 (32%), Gaps = 138/653 (21%)

Query: 2    PGER--PRGAPPPTMTGDLQPRQVASSPGHPSQPPLED-----NTPATRTTKGAREAGGQ 54
            PG++  P  A  P + G    R      G P    L+       TP T   KGA    G 
Sbjct: 680  PGDQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGP 739

Query: 55   AQAMELPEAQPRQARDGELK---PPSLRG----QAPSSTPGKRGS-----PQTPPGRSPL 102
              A   P  Q      G      P   RG    + P   PGK G      P  PPG    
Sbjct: 740  PGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPG---- 795

Query: 103  QAPSRLAG-RAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAP 161
              P+   G + E  PP     G A +R  P              +  E   P   G   P
Sbjct: 796  --PAGANGEKGEVGPPGP--AGSAGARGAP-------------GERGETGPPGPAGFAGP 838

Query: 162  LRPGLPRTEAQPAAE-ELGFHRCFQEPPSSFTSTNYTSPSATPRPPAP----GPPQSRGT 216
                 P  + QP A+ E G     Q+  +         PS  P P  P    GP  +RG 
Sbjct: 839  -----PGADGQPGAKGEQG--EAGQKGDAGAPGPQ--GPSGAPGPQGPTGVTGPKGARGA 889

Query: 217  SPLQPGSYPEYQASGADSWPPAAENSFPGANFGVPPAEPEPI----PKGSRPGGSPRGVS 272
                PG+     A+G     P   N  PG     PP  P P     PKG+R    P G +
Sbjct: 890  QG-PPGATGFPGAAGRVG--PPGSNGNPG-----PPGPPGPSGKDGPKGARGDSGPPGRA 941

Query: 273  FQFPFPALHGASTKPF----PADVAGHAFTNGPLVFAFHQPQGAWPEEAV----GTGPAY 324
             +   P L G +  P     P D  G +   GP       PQG   +  +    G     
Sbjct: 942  GE---PGLQGPAGPPGEKGEPGD-DGPSGAEGP-----PGPQGLAGQRGIVGLPGQRGER 992

Query: 325  PLPTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERP 384
              P  P PS  P  QG PG         G +  PG    A  P  +    +      + P
Sbjct: 993  GFPGLPGPSGEPGKQGAPGASGDRGP-PGPVGPPGLTGPAGEPGREGSPGA------DGP 1045

Query: 385  PSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGPP-PARLPQLWDP 443
            P  +DG    +G          PG          +PGPP     +PGP  P         
Sbjct: 1046 PG-RDGAAGVKGDRGETGAVGAPG----------APGPP----GSPGPAGPTGKQGDRGE 1090

Query: 444  TAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSR 503
              A  P  P GP  A       G   P         A  P  + L   R    G   L  
Sbjct: 1091 AGAQGPMGPSGPAGA------RGIQGPQGPRGDKGEAGEPGERGLKGHR----GFTGLQG 1140

Query: 504  LPFPAGGPEWQGGSQGALGTAGKTPGPR-EKLPAVRSSQGGSPALFTYNGMTDPGAQPLF 562
            LP    GP    G QGA G AG + GPR    P   S + G+      NG+  P   P  
Sbjct: 1141 LP----GPPGPSGDQGASGPAGPS-GPRGPPGPVGPSGKDGA------NGIPGPIGPPGP 1189

Query: 563  FGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSP 615
             G    +  P G P  P P      P     P P  +   S  + L P    P
Sbjct: 1190 RG-RSGETGPAGPPGNPGP------PGPPGPPGPGIDM--SAFAGLGPREKGP 1233



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 117/479 (24%), Positives = 144/479 (30%), Gaps = 72/479 (15%)

Query: 3429 GAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEVA 3488
            G  G +    E   P  R R   PG+   PG   PP     P L       +     E A
Sbjct: 132  GPRGDRGDKGEKGAPGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGNFAAQMAGGFDEKA 191

Query: 3489 PSTTKGWPETLERPVDPVTHP-IRGCELPSNHQECP-----PPSLSPF-PAALADGRGDC 3541
                 G  +    P+ P   P   G   P   Q  P     P    P  P       G  
Sbjct: 192  GGAQLGVMQGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMGPRGPPGPPGKP 251

Query: 3542 ALDGALERPENEASPGSPGPLLQQALPLGASLPR-PGARG----QDAEGKRAPLVFSGKR 3596
              DG   +P      G PGP   +  P    LP   G RG      A+G+       G+ 
Sbjct: 252  GDDGEAGKPGKAGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVKGES 311

Query: 3597 RAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGC-------- 3648
             +PG  G   P                        GPRG   +   T PAG         
Sbjct: 312  GSPGENGSPGP-----------------------MGPRGLPGERGRTGPAGAAGARGNDG 348

Query: 3649 QSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSG 3708
            Q           P+    FP  P  A G   P   ARG E    P      PG       
Sbjct: 349  QPGPAGPPGPVGPAGGPGFPGAP-GAKGEAGPTG-ARGPEGAQGPRGEPGTPGSPGPAGA 406

Query: 3709 SPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPREA 3768
            S  PGT    G++    +  +    A  P  P  P   P P+        K  T  P  A
Sbjct: 407  SGNPGTDGIPGAKGSAGAPGI----AGAPGFPG-PRGPPGPQGATGPLGPKGQTGEPGIA 461

Query: 3769 ---GEQGPHGSLGPK----EKGESSTKRKKGQVPGPARSESVGSFGR--APSAPDKP--- 3816
               GEQGP G  GP       G +  + K+G    P     +G  G   AP     P   
Sbjct: 462  GFKGEQGPKGEPGPAGPQGAPGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQD 521

Query: 3817 ----PRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGR 3871
                P+    +  PS +   K       +P  P        PG      R G A PQG+
Sbjct: 522  GLAGPKGAPGERGPSGLAGPKGANGDPGRPGEP------GLPGARGLTGRPGDAGPQGK 574



 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 116/469 (24%), Positives = 154/469 (32%), Gaps = 56/469 (11%)

Query: 3428 PGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEV 3487
            PG  G         LP +R R    G+A   G D  P     P                V
Sbjct: 314  PGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPP--------------GPV 359

Query: 3488 APSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGDCALDGA- 3546
             P+   G+P       +      RG E     +  P    SP PA  +   G   + GA 
Sbjct: 360  GPAGGPGFPGAPGAKGEAGPTGARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAK 419

Query: 3547 --LERPENEASPGSPGPLLQQALPLGASLPRPGARGQDAEGKRAPLVFS-GKRRAPGARG 3603
                 P    +PG PGP      P GA+ P  G +GQ  E   A      G +  PG  G
Sbjct: 420  GSAGAPGIAGAPGFPGPRGPPG-PQGATGPL-GPKGQTGEPGIAGFKGEQGPKGEPGPAG 477

Query: 3604 -RCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKP-----AGCQSSSKDR-- 3655
             + AP    E+       E      +   G RG    G+   P     AG + +  +R  
Sbjct: 478  PQGAPGPAGEEGKRGARGEPGGVGPIGPPGERGA--PGNRGFPGQDGLAGPKGAPGERGP 535

Query: 3656 SAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTK 3715
            S  + P  A   P  P +      PG  ARG       A P+ K GPS       RPG  
Sbjct: 536  SGLAGPKGANGDPGRPGEPG---LPG--ARGLTGRPGDAGPQGKVGPSGAPGEDGRPGP- 589

Query: 3716 TGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGP---REAGEQG 3772
                  PQ A GQ        P    FP    A    P +A  K     P      G+ G
Sbjct: 590  ----PGPQGARGQ--------PGVMGFPGPKGANGE-PGKAGEKGLPGAPGLRGLPGKDG 636

Query: 3773 PHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKP--PRTPRKQATPSRVL 3830
              G+ GP      + +R +   PGP+  + +      P    KP     P +   P  V 
Sbjct: 637  ETGAAGPPGPAGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVG 696

Query: 3831 PTKPK--PNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPP 3877
            P   +  P  +  P     +  +  PG        G + P G P  + P
Sbjct: 697  PRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGP 745



 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 107/391 (27%), Positives = 128/391 (32%), Gaps = 65/391 (16%)

Query: 3415 GGRQPFAFRGVRRP-GAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILS 3473
            G   P    GV  P GA G +        P    RV  PGS   PG   PP     P   
Sbjct: 870  GAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPP----GPSGK 925

Query: 3474 EGSLPALLHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAA 3533
            +G   A      +  P    G P  L+ P  P        +   +  E PP      P  
Sbjct: 926  DGPKGAR----GDSGPPGRAGEPG-LQGPAGPPGEKGEPGDDGPSGAEGPPG-----PQG 975

Query: 3534 LADGRGDCALDGALERPENEASPGSPGPLLQ---QALPLGASLPR--PGARGQDAEGKRA 3588
            LA  RG   L G  +R E    PG PGP  +   Q  P GAS  R  PG  G    G   
Sbjct: 976  LAGQRGIVGLPG--QRGER-GFPGLPGPSGEPGKQGAP-GASGDRGPPGPVGPP--GLTG 1029

Query: 3589 PLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGC 3648
            P    G+  +PGA G   P       +     E  +       GP G+        PAG 
Sbjct: 1030 PAGEPGREGSPGADG--PPGRDGAAGVKGDRGETGAVGAPGAPGPPGS------PGPAGP 1081

Query: 3649 QSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPG-PSSQGS 3707
                 DR  A         P+ P    G       ARG +    P   K + G P  +G 
Sbjct: 1082 TGKQGDRGEAGAQG-----PMGPSGPAG-------ARGIQGPQGPRGDKGEAGEPGERGL 1129

Query: 3708 GSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERL--------------P 3753
               R  T   G   P   SG    + A+ PA PS P   P P                 P
Sbjct: 1130 KGHRGFTGLQGLPGPPGPSGD---QGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGP 1186

Query: 3754 ARAQAKSCTKGPR-EAGEQGPHGSLGPKEKG 3783
               + +S   GP    G  GP G  GP   G
Sbjct: 1187 PGPRGRSGETGPAGPPGNPGPPGPPGPPGPG 1217



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 95/411 (23%), Positives = 125/411 (30%), Gaps = 59/411 (14%)

Query: 3504 DPVTHPIRGCELPS-NHQECPPPSLSPFPAALADGRGDCALDGALERPENEASPGSPGPL 3562
            D +   ++ C  P     EC P  + P   A A G+           P  +   G PG +
Sbjct: 66   DIICEDVKDCLSPEIPFGECCP--ICPTDLATASGQ-----------PGPKGQKGEPGDI 112

Query: 3563 LQQALPLGASLPRPGARGQDAEGKRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEV 3622
                 P G   P+  A  Q   G R      G++ APG RGR              + E 
Sbjct: 113  KDIVGPKGPPGPQGPAGEQGPRGDRGD---KGEKGAPGPRGR--------------DGEP 155

Query: 3623 SSSHMVSEGGPRG-TFHKGSATKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAP- 3680
             +       GP G     G     A   +   D  A       ++ P+ P    G   P 
Sbjct: 156  GTPGNPGPPGPPGPPGPPGLGGNFAAQMAGGFDEKAGGAQLGVMQGPMGPMGPRGPPGPA 215

Query: 3681 ---------GELARGTENGMK-PATPKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQ 3730
                     G      E G+  P  P+  PGP  +       G K G   +  P   Q  
Sbjct: 216  GAPGPQGFQGNPGEPGEPGVSGPMGPRGPPGPPGKPGDDGEAG-KPGKAGERGPPGPQGA 274

Query: 3731 SETATTPAKPSFPSRSPAPERLPARAQA-----KSCTKGPREAGEQGPHGSLG-PKEKGE 3784
                 TP  P        P    A+ +A     K  +  P E G  GP G  G P E+G 
Sbjct: 275  RGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVKGESGSPGENGSPGPMGPRGLPGERGR 334

Query: 3785 SSTKRKKGQ-----VPGPARSES-VGSFGRA--PSAPD-KPPRTPRKQATPSRVLPTKPK 3835
            +      G       PGPA     VG  G    P AP  K    P     P      + +
Sbjct: 335  TGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFPGAPGAKGEAGPTGARGPEGAQGPRGE 394

Query: 3836 PNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPPKRGTAVHGA 3886
            P +   P P  +       G    K   G     G P    P+      GA
Sbjct: 395  PGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGPQGA 445



 Score = 40.0 bits (92), Expect = 0.046
 Identities = 56/236 (23%), Positives = 68/236 (28%), Gaps = 30/236 (12%)

Query: 3679 APGELAR----GTENGMKPATPKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETA 3734
            APG   R    GT     P  P   PGP   G        +  GG   +    QL     
Sbjct: 145  APGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGNF---AAQMAGGFDEKAGGAQLG--VM 199

Query: 3735 TTPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPK-------EKGESST 3787
              P  P  P   P P   P     +     P E G  GP G  GP        + GE+  
Sbjct: 200  QGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMGPRGPPGPPGKPGDDGEAGK 259

Query: 3788 KRKKGQVPGPARSESVGSFGRAPSAPDKPPRT-------PRKQATPSRVLPTKPKPNSQN 3840
              K G+  GP   +    F   P  P              + +A    V      P    
Sbjct: 260  PGKAGE-RGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVKGESGSPGENG 318

Query: 3841 KPRP------PPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPPKRGTAVHGAEPAE 3890
             P P      P    R    G    +   G+  P G P    P  G    GA  A+
Sbjct: 319  SPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFPGAPGAK 374



 Score = 38.9 bits (89), Expect = 0.10
 Identities = 101/428 (23%), Positives = 128/428 (29%), Gaps = 68/428 (15%)

Query: 3419 PFAFRGVRRPGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILS-EGSL 3477
            P  F G   PGA GQ     E     ++     PG  P      P P+G + +   +G+ 
Sbjct: 832  PAGFAGP--PGADGQPGAKGEQGEAGQKGDAGAPG--PQGPSGAPGPQGPTGVTGPKGAR 887

Query: 3478 PALLHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADG 3537
             A         P    G+P    R   P ++   G   P        P  +   +     
Sbjct: 888  GAQ-------GPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGR 940

Query: 3538 RGDCALDGALERPENEASPGSPGPLLQQALPLGASLPR-------PGARGQDA-EGKRAP 3589
             G+  L G    P  +  PG  GP   +  P    L         PG RG+    G   P
Sbjct: 941  AGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGP 1000

Query: 3590 LVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQ 3649
                GK+ APGA G                          + GP G       T PAG  
Sbjct: 1001 SGEPGKQGAPGASG--------------------------DRGPPGPVGPPGLTGPAGEP 1034

Query: 3650 SSSKDRSAASTPSK----ALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQ 3705
                   A   P +     +K       AVG  APG  A G      PA P  K G   +
Sbjct: 1035 GREGSPGADGPPGRDGAAGVKGDRGETGAVG--APG--APGPPGSPGPAGPTGKQGDRGE 1090

Query: 3706 GS--GSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTK 3763
                G   P    G      P   +     A  P +     R     R     Q      
Sbjct: 1091 AGAQGPMGPSGPAGARGIQGPQGPRGDKGEAGEPGE-----RGLKGHRGFTGLQGLPGPP 1145

Query: 3764 GPR----EAGEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRA-PSAPDKPPR 3818
            GP      +G  GP G  GP      S K     +PGP      G  GR+  + P  PP 
Sbjct: 1146 GPSGDQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGPP--GPRGRSGETGPAGPPG 1203

Query: 3819 TPRKQATP 3826
             P     P
Sbjct: 1204 NPGPPGPP 1211



 Score = 37.7 bits (86), Expect = 0.23
 Identities = 36/111 (32%), Positives = 43/111 (38%), Gaps = 17/111 (15%)

Query: 3187 PGGLEGSSAVAHLLNSITE------PAPKHHRGKRSAGKAAGSPGDPW-----GQEGEAK 3235
            P GL G   +  L     E      P P    GK+ A  A+G  G P      G  G A 
Sbjct: 973  PQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPA- 1031

Query: 3236 KDSPGERAKPRARSTPSNPDGAA--TPDSASATALADAGSPGPPRTTPSPS 3284
               PG    P A   P   DGAA    D     A+   G+PGPP  +P P+
Sbjct: 1032 -GEPGREGSPGADGPPGR-DGAAGVKGDRGETGAVGAPGAPGPP-GSPGPA 1079



 Score = 35.4 bits (80), Expect = 1.1
 Identities = 30/91 (32%), Positives = 37/91 (40%), Gaps = 6/91 (6%)

Query: 3206 PAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPGERAKPRARSTPSNP-DGAATPDSAS 3264
            P  K HRG      A G  G P G +GE+   SPGE   P        P +   T  + +
Sbjct: 284  PGVKGHRGYPGLDGAKGEAGAP-GVKGES--GSPGENGSPGPMGPRGLPGERGRTGPAGA 340

Query: 3265 ATALADAGSPGP--PRTTPSPSPDPWAGGEP 3293
            A A  + G PGP  P     P+  P   G P
Sbjct: 341  AGARGNDGQPGPAGPPGPVGPAGGPGFPGAP 371



 Score = 34.3 bits (77), Expect = 2.5
 Identities = 28/94 (29%), Positives = 35/94 (37%), Gaps = 22/94 (23%)

Query: 3205 EPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSP-------GERAKPRARSTPSNPDGA 3257
            +P PK  +G+    K    P  P G +G A +  P       GE+  P  R     P   
Sbjct: 99   QPGPKGQKGEPGDIKDIVGPKGPPGPQGPAGEQGPRGDRGDKGEKGAPGPRGRDGEP--- 155

Query: 3258 ATPDSASATALADAGSPGPPRTTPSPSPDPWAGG 3291
             TP           G+PGPP   P P   P  GG
Sbjct: 156  GTP-----------GNPGPPG-PPGPPGPPGLGG 177



 Score = 32.7 bits (73), Expect = 7.3
 Identities = 26/81 (32%), Positives = 36/81 (44%), Gaps = 8/81 (9%)

Query: 3205 EPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPGERAKPRARSTPSNPDGAATPDSAS 3264
            +P  K  +G+      AG+PG P G  G     +PG +  P   + P    GA  P  A+
Sbjct: 844  QPGAKGEQGEAGQKGDAGAPG-PQGPSG-----APGPQG-PTGVTGPKGARGAQGPPGAT 896

Query: 3265 ATALADAGSPGPPRTTPSPSP 3285
                A AG  GPP +  +P P
Sbjct: 897  GFPGA-AGRVGPPGSNGNPGP 916


>gi|111118974 collagen, type II, alpha 1 isoform 2 precursor [Homo
            sapiens]
          Length = 1418

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 300/1253 (23%), Positives = 395/1253 (31%), Gaps = 259/1253 (20%)

Query: 1693 CLPEPSKQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRLLPCEQRGGFLPEP 1752
            C  +  +QPGP+   G   +    +++  PK          E               P  
Sbjct: 23   CQGQDVRQPGPK---GQKGEPGDIKDIVGPKGPPGPQGPAGEQG-------------PRG 66

Query: 1753 GTADQPHRGAPAPEAF-GSPAVHLAPDLAFQGDGAPPLDATWPFGASPSHAAQ------- 1804
               D+  +GAP P    G P     P     G   PP     P G   + AAQ       
Sbjct: 67   DRGDKGEKGAPGPRGRDGEPGTPGNP-----GPPGPP-GPPGPPGLGGNFAAQMAGGFDE 120

Query: 1805 ---GHSAGRAGGHLHPT--------AGRPG---FEGNEFAPA--GASSLTAPRGREAWLV 1848
               G   G   G + P         AG PG   F+GN   P   G S    PRG      
Sbjct: 121  KAGGAQLGVMQGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMGPRGPPG--- 177

Query: 1849 PVPSPACVSNTHPSRRSQDPALSPPIRQLQLPG----PGV-----------AKSKDGILG 1893
            P   P          ++ +     P      PG    PGV           AK + G  G
Sbjct: 178  PPGKPGDDGEAGKPGKAGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPG 237

Query: 1894 L--QELTPAAQ-SPPRVNPSGLEGGTVEGGKVACGPAQGSPGGVQVTTLPAVAGHQLGLE 1950
            +  +  +P    SP  + P GL G     G      A+G+ G       P   G   G  
Sbjct: 238  VKGESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPG 297

Query: 1951 ADGHWGLLGQAEKTQGQGTANQLQPENGVSPGGTDNHASVNASPKTALTGPTEGAVLLEK 2010
              G  G  G+A  T  +G      PE    P G         SP  A      G   +  
Sbjct: 298  FPGAPGAKGEAGPTGARG------PEGAQGPRG---EPGTPGSPGPAGASGNPGTDGIPG 348

Query: 2011 CKGSRAAMSLQ-EEAEPTP-SPPSPNRESLALALTAAHSRSGSEGRTPERA--SSPGLNK 2066
             KGS  A  +      P P  PP P   +  L         G  G   E+     PG   
Sbjct: 349  AKGSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAG 408

Query: 2067 PLLATG----DSPAPSVGDLAACAP-SPTSAAHMPCSLGPLPREDPLTSPSRAQGGLGGQ 2121
            P  A G    +    + G+     P  P      P + G  P +D L  P  A G  G  
Sbjct: 409  PQGAPGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRG-FPGQDGLAGPKGAPGERGPS 467

Query: 2122 LPASP-SCRDPPGPQQLLACSPAWAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCDPKE 2180
              A P      PG        P    L  A G+            V P            
Sbjct: 468  GLAGPKGANGDPG-------RPGEPGLPGARGLTGRPGDAGPQGKVGP------------ 508

Query: 2181 ALAGCLLQGEGSPLEDPSSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRA 2240
                      G+P ED    PPG   A         P       P+ +  E     PG+A
Sbjct: 509  ---------SGAPGEDGRPGPPGPQGA------RGQPGVMGFPGPKGANGE-----PGKA 548

Query: 2241 TSPPLAGAVSPSVAVRATGLSSTPTGDEAQAGRGLPGP-----DPQSRGAPPHTNPDRMP 2295
                L G         A GL   P  D      G PGP     +   +GAP  +    +P
Sbjct: 549  GEKGLPG---------APGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPGPSGFQGLP 599

Query: 2296 RGHSSYSPSNTARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSSKEPED---- 2351
                   P      G + G     VP E       GP       GE G+   +       
Sbjct: 600  ------GPPGPPGEGGKPGD--QGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRG 651

Query: 2352 -PGTPET----GRSGATKMPRVTCPSTGL-------GLGRTTAPSSTASDFQSDSPQSHR 2399
             PGTP T    G SG    P    P  GL       G      P     D     P+   
Sbjct: 652  LPGTPGTDGPKGASGPAGPPGAQGP-PGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAP 710

Query: 2400 NASHQTPQGDPLGPQDLKQRSRGYKKKPASTENGQWKGQAPHGPVTCEVCAASFRSGPGL 2459
                      P+GP             PA   NG+     P GP      +A  R  PG 
Sbjct: 711  GKDGGRGLTGPIGPPG-----------PAGA-NGEKGEVGPPGPAG----SAGARGAPG- 753

Query: 2460 SRHKARKHRPHPGAPAEPSPAALPAQQPLEPLAQKCQPPRKKSHRVSGKERPNHSRG--D 2517
                 R     PG      P     Q   +   ++ +  +K      G + P+ + G   
Sbjct: 754  ----ERGETGPPGPAGFAGPPGADGQPGAK--GEQGEAGQKGDAGAPGPQGPSGAPGPQG 807

Query: 2518 PSHVTQPPPAQGSKEVLRAPGSPHSQ-QLHPPSPTEH--EVDVKTPASKPRPDQAREDEL 2574
            P+ VT P  A+G++    A G P +  ++ PP    +        P+ K  P  AR D  
Sbjct: 808  PTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSG 867

Query: 2575 HPKQAEK--REGRRW----RREPTVDSPSHSEGKSNKKRGKLRGRRLREESILPVSADVI 2628
             P +A +   +G       + EP  D PS +EG    +   L G+R     I+ +     
Sbjct: 868  PPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQ--GLAGQR----GIVGLPGQ-- 919

Query: 2629 SDGRGSRPSPAMASYAASPSHCLSVEGGPEADGEQPPRLATLGPGVMEGAAETDQEALCA 2688
               RG R  P +   +  P      +G P A G++ P      PG+   A E  +E    
Sbjct: 920  ---RGERGFPGLPGPSGEPGK----QGAPGASGDRGPPGPVGPPGLTGPAGEPGRE---- 968

Query: 2689 GETGAQKPPGDRMLCPGRMDGAALGEQPTGQKGA-SARGFWGP-------RETKALGVCK 2740
            G  GA  PPG         DGAA  +   G+ GA  A G  GP         T   G   
Sbjct: 969  GSPGADGPPG--------RDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAGPTGKQGDRG 1020

Query: 2741 ESGSE-PAEDSSRAHSRSEEGVWEENTPPLGPLGFPETSSSPADSTTS-----SCLQGLP 2794
            E+G++ P   S  A +R  +G       P GP G    +  P +         + LQGLP
Sbjct: 1021 EAGAQGPMGPSGPAGARGIQG-------PQGPRGDKGEAGEPGERGLKGHRGFTGLQGLP 1073

Query: 2795 DNPDTQG--GVQGPEGPT-----PDASGSSAKDPPSLFDDEVSFSQLFPPGGR 2840
              P   G  G  GP GP+     P   G S KD  +     +      PPG R
Sbjct: 1074 GPPGPSGDQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIG-----PPGPR 1121



 Score = 92.8 bits (229), Expect = 6e-18
 Identities = 306/1227 (24%), Positives = 381/1227 (31%), Gaps = 267/1227 (21%)

Query: 208  PGPPQSRGTSPLQPGSYPEYQASGADSWP--PAAENSFPGANFGVPPAEPEPIPKGSRPG 265
            PGP   +G    +PG   +         P  PA E   P  + G    +  P P+G R G
Sbjct: 31   PGPKGQKG----EPGDIKDIVGPKGPPGPQGPAGEQG-PRGDRGDKGEKGAPGPRG-RDG 84

Query: 266  --GSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGT--- 320
              G+P         P   G    P P  + G+        FA  Q  G + E+A G    
Sbjct: 85   EPGTPGN-------PGPPGPPGPPGPPGLGGN--------FAA-QMAGGFDEKAGGAQLG 128

Query: 321  ---GPAYPL----PTQPAPSPLPC-YQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSL 372
               GP  P+    P  PA +P P  +QG PG       +SG +   G      +P  D  
Sbjct: 129  VMQGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPG-VSGPMGPRGPPGPPGKPGDDGE 187

Query: 373  HKSLTKILPERPPSAQDGLG--STRGPPSSLPQRHFPGQ-----AYRASGVDTSPGPPDT 425
                 K     PP  Q   G   T G P     R +PG         A GV    G P  
Sbjct: 188  AGKPGKAGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVKGESGSPG- 246

Query: 426  ELAAPGPP-PARLPQLWDPTAA------------PYPTPPGGPLAATRSMFFNGQPSPGQ 472
            E  +PGP  P  LP     T              P P  P GP+       F G P   +
Sbjct: 247  ENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFPGAPG-AK 305

Query: 473  RLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQG--------GSQGALGTA 524
                P  A  P     P   P   G       P PAG     G        GS GA G A
Sbjct: 306  GEAGPTGARGPEGAQGPRGEPGTPGS------PGPAGASGNPGTDGIPGAKGSAGAPGIA 359

Query: 525  GKT--PGPREKL-------PAVRSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQVSPH-- 573
            G    PGPR          P     Q G P +  + G   P  +P   G A PQ +P   
Sbjct: 360  GAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEP---GPAGPQGAPGPA 416

Query: 574  -------------GTPSLPPPRVVGAS-----PSESPLPSPA--------TNTAGSTCSS 607
                         G   + PP   GA      P +  L  P         +  AG   ++
Sbjct: 417  GEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGAN 476

Query: 608  LSP-MSSSPANPSSEE-SQLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTHYQPEP 665
              P     P  P +   +  PG  GP     P   P E G P     PP       QP  
Sbjct: 477  GDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRP----GPPGPQGARGQPG- 531

Query: 666  AKAFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGFP-------RAPPPYPTHHFS 718
               FP P    GA G      E   P      G  GL+G P        A PP P     
Sbjct: 532  VMGFPGPK---GANGEPGKAGEKGLP------GAPGLRGLPGKDGETGAAGPPGP----- 577

Query: 719  LSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPA 778
                                     A     R   G   A    G Q  PGPPG P    
Sbjct: 578  -------------------------AGPAGERGEQG---APGPSGFQGLPGPPGPPGEGG 609

Query: 779  APR---VPADAHA-GLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLPASDLDM 834
             P    VP +A A GL+         G+  + G         LP    T  P  AS    
Sbjct: 610  KPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAG 669

Query: 835  EDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAGVTPE 894
               A+        L GM  +     I         D    G +GP          G+T  
Sbjct: 670  PPGAQGPP----GLQGMPGERGAAGIAGPK----GDRGDVGEKGPEGAPGKDGGRGLTGP 721

Query: 895  SKAPPPLPAATPDPQTPRPGDRGCP-ARGRP----KTRSLGLAPTEADAPSQGRQQRRGK 949
               P P  A     +   PG  G   ARG P    +T   G A       + G+   +G+
Sbjct: 722  IGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGE 781

Query: 950  QLKLFRK-DLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPPRPRRP----RTQAPGS 1004
            Q +  +K D  + G    SG+ G    +G+   +     + PP     P    R   PGS
Sbjct: 782  QGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGS 841

Query: 1005 RADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRLREY 1064
              +P P  P   +  +  + +R    PP         R G  G +       +K      
Sbjct: 842  NGNPGPPGPPGPSGKDGPKGARGDSGPP--------GRAGEPGLQGPAGPPGEKG----- 888

Query: 1065 DFASESEEDEQPPPRGPGFRGRRG-------RGEKRKEVELTQGPREDEPQKPRKAARQE 1117
            +   +     + PP   G  G+RG       RGE+        GP  +    P K     
Sbjct: 889  EPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERG--FPGLPGPSGE----PGKQGAPG 942

Query: 1118 AGGDGAPANPEEPGG-----SRPGPGRSPQARGP----------SRSLETGAAAREGGP- 1161
            A GD  P  P  P G       PG   SP A GP              ETGA    G P 
Sbjct: 943  ASGDRGPPGPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPG 1002

Query: 1162 ------------KCADRPSVAPKDPL--QVPTNTETSEETRPSLDFPQEAKEPETAEESA 1207
                        K  DR     + P+    P      +  +       EA EP   E   
Sbjct: 1003 PPGSPGPAGPTGKQGDRGEAGAQGPMGPSGPAGARGIQGPQGPRGDKGEAGEP--GERGL 1060

Query: 1208 PDSTEFT--EALRSPPAACAGEMGAS--PGLLIPEQPP----PSRHD--------TGTPK 1251
                 FT  + L  PP   +G+ GAS   G   P  PP    PS  D         G P 
Sbjct: 1061 KGHRGFTGLQGLPGPPGP-SGDQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGPPG 1119

Query: 1252 PSGSLANTAPHGSSPTPGVGSLLGGPG 1278
            P G    T P G    PG     G PG
Sbjct: 1120 PRGRSGETGPAGPPGNPGPPGPPGPPG 1146



 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 211/804 (26%), Positives = 258/804 (32%), Gaps = 117/804 (14%)

Query: 2   PGERPRGAPPPTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGG-QAQAME- 59
           PG R R   P T      P      PG P  P L  N  A        +AGG Q   M+ 
Sbjct: 77  PGPRGRDGEPGTPGNPGPP----GPPGPPGPPGLGGNFAAQMAGGFDEKAGGAQLGVMQG 132

Query: 60  ---------------LPEAQPRQARDGELKPPSLRG-QAPSSTPGKRGSPQTP-----PG 98
                           P  Q  Q   GE   P + G   P   PG  G P        PG
Sbjct: 133 PMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMGPRGPPGPPGKPGDDGEAGKPG 192

Query: 99  RSPLQAPSRLAGRAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGT 158
           ++  + P    G A G P    + G+   R  P LD           +  E  +P   G+
Sbjct: 193 KAGERGPPGPQG-ARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVK-GESGSPGENGS 250

Query: 159 GAPLRP-GLPRTEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPR-PPAPG------P 210
             P+ P GLP    +         R     P          P+  P  P APG      P
Sbjct: 251 PGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFPGAPGAKGEAGP 310

Query: 211 PQSRGTSPLQ-----PGSYPEYQASGADSWP-----PAAENSFPGANFGVPPAEPEPI-P 259
             +RG    Q     PG+      +GA   P     P A+ S         P  P P  P
Sbjct: 311 TGARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGP 370

Query: 260 KGSRPGGSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVG 319
            G +    P G   Q   P + G   +  P    G A   G    A  + +     E  G
Sbjct: 371 PGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQGAPGPAGEEGKRGARGEPGG 430

Query: 320 TGPAYPLPTQPAPSPLPCYQGQPG-----GLNRHSDLSGALSSPGAAHSAPRPFSDSLHK 374
            GP  P   + AP     + GQ G     G       SG     GA     RP    L  
Sbjct: 431 VGPIGPPGERGAPGNRG-FPGQDGLAGPKGAPGERGPSGLAGPKGANGDPGRPGEPGLPG 489

Query: 375 SLTKILPERP----------PSAQDGLGSTRGPPSSLPQRHFPGQAY--RASGVDTSPGP 422
           +  + L  RP          PS   G     GPP     R  PG        G +  PG 
Sbjct: 490 A--RGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKGANGEPGK 547

Query: 423 PDTELAAPGPPPAR-LPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAP 481
              E   PG P  R LP     T A  P  P GP          G PS  Q L  P   P
Sbjct: 548 AG-EKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPG-PSGFQGLPGPPGPP 605

Query: 482 ----LPWPQVLPTARPSPHGMEMLSRLPFPA--GGPEWQG--GSQGALGTAGKTPGPREK 533
                P  Q +P    +P  +       FP   G P  QG  G +G  GT G T GP+  
Sbjct: 606 GEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPG-TDGPKGA 664

Query: 534 L-PAVRSSQGGSPALFTYNGMTDPGAQPLFFGVAQP--------QVSPHGTPSLPPPRVV 584
             PA      G P L    GM  PG +    G+A P        +  P G P     R +
Sbjct: 665 SGPAGPPGAQGPPGL---QGM--PGERGAA-GIAGPKGDRGDVGEKGPEGAPGKDGGRGL 718

Query: 585 GASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQET 644
              P   P P+ A    G       P  S+ A  +  E    GP GP+ F  PP    + 
Sbjct: 719 -TGPIGPPGPAGANGEKGEV-GPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQP 776

Query: 645 GSP-------------FPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFP 691
           G+               P P+ P   P    P+       P    GA+G       T FP
Sbjct: 777 GAKGEQGEAGQKGDAGAPGPQGPSGAPG---PQGPTGVTGPKGARGAQGPPGA---TGFP 830

Query: 692 HEGPEVGRGGLQGFPRAP-PPYPT 714
                VG  G  G P  P PP P+
Sbjct: 831 GAAGRVGPPGSNGNPGPPGPPGPS 854



 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 216/837 (25%), Positives = 264/837 (31%), Gaps = 149/837 (17%)

Query: 6    PRGAPPPT-MTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQAMELPEAQ 64
            PRG P P   TG L P+     PG              +  +G +   G A     P   
Sbjct: 367  PRGPPGPQGATGPLGPKGQTGEPG----------IAGFKGEQGPKGEPGPAGPQGAPGPA 416

Query: 65   PRQARDGELKPPSLRGQAPSSTPGKRGSPQTP--PGRSPLQAPSRLAGRAEGSPPQRYIL 122
              + + G    P   G  P   PG+RG+P     PG+  L  P       +G+P +R   
Sbjct: 417  GEEGKRGARGEPG--GVGPIGPPGERGAPGNRGFPGQDGLAGP-------KGAPGERGPS 467

Query: 123  GIASSRTKPTLDETPENPQLEAAQ----LPEVDTPQGP--GTGAPLRPGLPRTEAQPAAE 176
            G+A  +        P  P L  A+     P    PQG    +GAP   G P       A 
Sbjct: 468  GLAGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGAR 527

Query: 177  ELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWP 236
                   F  P  +        P        PG P  RG     PG   E  A+G     
Sbjct: 528  GQPGVMGFPGPKGA-----NGEPGKAGEKGLPGAPGLRGL----PGKDGETGAAGPPGPA 578

Query: 237  -PAAENSFPGA----NFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGA-STKPFPA 290
             PA E    GA     F   P  P P  +G +PG   +GV  +   P L G    + FP 
Sbjct: 579  GPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKPGD--QGVPGEAGAPGLVGPRGERGFPG 636

Query: 291  DVA--GHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPG--GLN 346
            +    G     GP       P    P+ A  +GPA P    P     P  QG PG  G  
Sbjct: 637  ERGSPGAQGLQGPRGLP-GTPGTDGPKGA--SGPAGP----PGAQGPPGLQGMPGERGAA 689

Query: 347  RHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERP-----------PSAQDGLGSTR 395
              +   G     G       P  D        I P  P           P    G    R
Sbjct: 690  GIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGAR 749

Query: 396  GPPSSLPQRHFPGQAYRAS--GVDTSPGPPDTELAAPGPPPARLPQLWDPTAAPYP---- 449
            G P    +   PG A  A   G D  PG    +  A     A  P    P+ AP P    
Sbjct: 750  GAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPT 809

Query: 450  --TPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLP--TARPSPHGMEMLSRLP 505
              T P G   A       G P    R+  P S   P P   P  + +  P G    S  P
Sbjct: 810  GVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPP 869

Query: 506  FPAGGPEWQGGSQGALGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTD-PGAQPLFFG 564
              AG P    G QG  G  G+   P +  P+      G   L    G+   PG       
Sbjct: 870  GRAGEP----GLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPG------- 918

Query: 565  VAQPQVSPHGTPSLPPPR-------VVGASPSESPLPSPA-----TNTAGSTCSSLSPMS 612
                Q    G P LP P          GAS    P P P      T  AG      SP +
Sbjct: 919  ----QRGERGFPGLPGPSGEPGKQGAPGASGDRGP-PGPVGPPGLTGPAGEPGREGSPGA 973

Query: 613  SSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTHYQPEPAKAF--- 669
              P         + G  G +     P  P   GSP P+       PT  Q +  +A    
Sbjct: 974  DGPPGRDGAAG-VKGDRGETGAVGAPGAPGPPGSPGPAG------PTGKQGDRGEAGAQG 1026

Query: 670  ------PFPADGL-GAEGAFQCLEETPFPHE-GPEVGRG--GLQGFPRAPPPYPTHHFSL 719
                  P  A G+ G +G      E   P E G +  RG  GLQG P  P P        
Sbjct: 1027 PMGPSGPAGARGIQGPQGPRGDKGEAGEPGERGLKGHRGFTGLQGLPGPPGP-------- 1078

Query: 720  SSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSP 776
                             D+  S  A     R   G +    KDG    PGP G P P
Sbjct: 1079 ---------------SGDQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGPPGP 1120



 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 255/1080 (23%), Positives = 320/1080 (29%), Gaps = 221/1080 (20%)

Query: 426  ELAAPGPP-----PARLPQLWDPTAAPYPTPPGG---PLAATRSMFFNGQPSPGQRLCLP 477
            ++  PGP      P  +  +  P   P P  P G   P          G P P  R   P
Sbjct: 27   DVRQPGPKGQKGEPGDIKDIVGPKGPPGPQGPAGEQGPRGDRGDKGEKGAPGPRGRDGEP 86

Query: 478  QSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKLPAV 537
             +   P P   P   P P G+          G  E  GG+Q  LG      GP    P  
Sbjct: 87   GTPGNPGPPG-PPGPPGPPGLGGNFAAQMAGGFDEKAGGAQ--LGVMQGPMGPMG--PRG 141

Query: 538  RSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPA 597
                 G+P    + G      +P   GV+ P + P G P   PP   G    E+  P  A
Sbjct: 142  PPGPAGAPGPQGFQGNPGEPGEP---GVSGP-MGPRGPPG--PPGKPG-DDGEAGKPGKA 194

Query: 598  TNTAGSTCSSLSPMSSSPANPSSEESQ-LPGPLGPSAFFHPPTHPQETGSP----FPSPE 652
                            +P  P  +  +  PG  G       P    E+GSP     P P 
Sbjct: 195  GERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVKGESGSPGENGSPGPM 254

Query: 653  PPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGP-EVGRGGLQGFPRAPPP 711
             P  LP        +    PA   GA G     +  P P   P  VG  G  GFP AP  
Sbjct: 255  GPRGLPGE------RGRTGPAGAAGARGN----DGQPGPAGPPGPVGPAGGPGFPGAP-- 302

Query: 712  YPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPP 771
                                                  +   G   AR  +G Q   G P
Sbjct: 303  ------------------------------------GAKGEAGPTGARGPEGAQGPRGEP 326

Query: 772  GLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATP-FPLPAS 830
            G P  P     PA A             +G+   +G      +   P +A  P FP P  
Sbjct: 327  GTPGSPG----PAGA-------------SGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRG 369

Query: 831  DLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAG 890
                +         T  L G + Q+  P I     +     EP GP GP        + G
Sbjct: 370  PPGPQG-------ATGPL-GPKGQTGEPGIAGFKGEQGPKGEP-GPAGPQGAPGPAGEEG 420

Query: 891  VTPESKAPPPLPAATPDPQTPRPGDRGCPA-------RGRPKTRS-LGLAPTEADAPSQG 942
                   P  +    P  +   PG+RG P        +G P  R   GLA  +      G
Sbjct: 421  KRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDPG 480

Query: 943  RQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERP-PPRPRRPRTQA 1001
            R    G            G        G  G    + P    G   RP PP P+  R Q 
Sbjct: 481  RPGEPGLP----------GARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQ- 529

Query: 1002 PGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRL 1061
            PG    P P+         E   +  + LP     R    + G  G              
Sbjct: 530  PGVMGFPGPKGANG-----EPGKAGEKGLPGAPGLRGLPGKDGETGAA---------GPP 575

Query: 1062 REYDFASESEEDEQPPPRG----PGFRGRRGRGEKRKEVELTQ--------GPREDEPQK 1109
                 A E  E   P P G    PG  G  G G K  +  +          GPR +    
Sbjct: 576  GPAGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFP 635

Query: 1110 PRKAARQEAGGDGAPANPEEPGGSRP----GPGRSPQARGP----SRSLETGAAAREGGP 1161
              + +    G  G    P  PG   P    GP   P A+GP        E GAA    GP
Sbjct: 636  GERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGI-AGP 694

Query: 1162 KCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEALRSP- 1220
            K  DR  V  K P   P        T P           E  E   P       A  +P 
Sbjct: 695  K-GDRGDVGEKGPEGAPGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPG 753

Query: 1221 ---------PAACAGEMGA--------------------SPGLLIPEQPPPSRHDTGTPK 1251
                     PA  AG  GA                    +PG   P   P  +  TG   
Sbjct: 754  ERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTG 813

Query: 1252 PSGSLANTAPHGSSPTPGVGSLLGGPG-----GTQAPVSHNSKDPPARQPGEFLAPVANP 1306
            P G+     P G++  PG    +G PG     G   P   + KD P    G+   P    
Sbjct: 814  PKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGD-SGPPGRA 872

Query: 1307 SSTACPKPSVLSSKISSFGCD-PAGFNRDPLGVPVAKKGPQPYSSPHSELFL----GPKD 1361
                   P+    +    G D P+G    P        GPQ  +     + L    G + 
Sbjct: 873  GEPGLQGPAGPPGEKGEPGDDGPSGAEGPP--------GPQGLAGQRGIVGLPGQRGERG 924

Query: 1362 LAGCFLEELHPKPSARDAPPASSSCLCQDGEDAGSLEPQLPRSPPGTA--ETEPGRAASP 1419
              G  L     +P  + AP AS           G   P  P  PPG      EPGR  SP
Sbjct: 925  FPG--LPGPSGEPGKQGAPGAS-----------GDRGPPGPVGPPGLTGPAGEPGREGSP 971



 Score = 72.8 bits (177), Expect = 6e-12
 Identities = 255/1066 (23%), Positives = 335/1066 (31%), Gaps = 200/1066 (18%)

Query: 466  GQPSPGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAG 525
            G+P   + +  P+  P P     P     P G +   +    A GP  + G  G  G  G
Sbjct: 38   GEPGDIKDIVGPKGPPGPQG---PAGEQGPRG-DRGDKGEKGAPGPRGRDGEPGTPGNPG 93

Query: 526  KTPGPREKLPAVRSSQGGSPALFTYNGMTDP--GAQPLFFGVAQPQVSPHGTPSLPPPRV 583
              PGP    P      GG+ A     G  +   GAQ    GV Q  + P G P  PP   
Sbjct: 94   P-PGPPG--PPGPPGLGGNFAAQMAGGFDEKAGGAQ---LGVMQGPMGPMG-PRGPP--- 143

Query: 584  VGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQ- 642
                P+ +P P                   +P  P   E  + GP+GP     PP  P  
Sbjct: 144  ---GPAGAPGPQG--------------FQGNPGEPG--EPGVSGPMGPRGPPGPPGKPGD 184

Query: 643  --ETGSPFPSPE--PPHSLPTHYQPEPAKAFPFPADGLGAEG--AFQCLEETPFPHEGPE 696
              E G P  + E  PP        P+ A+ FP      G +G   +  L+        P 
Sbjct: 185  DGEAGKPGKAGERGPPG-------PQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPG 237

Query: 697  V-GRGGLQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGL 755
            V G  G  G   +P P                               L          G 
Sbjct: 238  VKGESGSPGENGSPGPMGPR--------------------------GLPGERGRTGPAGA 271

Query: 756  LLARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTG 815
              AR  DG     GPPG   P   P  P    A           AG   A G +      
Sbjct: 272  AGARGNDGQPGPAGPPGPVGPAGGPGFPGAPGAK--------GEAGPTGARGPEGAQGPR 323

Query: 816  FLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSS--FIDVFADEEP 873
              P    +P P  AS           +  T+ + G +  +  P I  +  F        P
Sbjct: 324  GEPGTPGSPGPAGAS----------GNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGPPGP 373

Query: 874  SGPRGP-----SSGHP----LKSKAGVTPESKAPPPLPAATPDPQTPRPGDRGCPARGRP 924
             G  GP      +G P     K + G  P+ +  P  P   P P     G RG  ARG P
Sbjct: 374  QGATGPLGPKGQTGEPGIAGFKGEQG--PKGEPGPAGPQGAPGP-AGEEGKRG--ARGEP 428

Query: 925  KTRSLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLR-PRRN 983
                    P E  AP  G +   G+            G A   G+ G    SGL  P+  
Sbjct: 429  GGVGPIGPPGERGAP--GNRGFPGQD-----------GLAGPKGAPGERGPSGLAGPKGA 475

Query: 984  DGLGERPPPRPRRPRTQ-APGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKAR 1042
            +G     P RP  P    A G    P    P+    P        R  PP          
Sbjct: 476  NG----DPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQ------- 524

Query: 1043 GGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRGPGFRGRRGRGEKRKEVELTQGP 1102
             GA G+  ++     K    E       +  E+  P  PG RG  G+ +         GP
Sbjct: 525  -GARGQPGVMGFPGPKGANGE-----PGKAGEKGLPGAPGLRGLPGK-DGETGAAGPPGP 577

Query: 1103 REDEPQKPRKAARQEAGGDGAPANPEEPG-GSRPG----PGR--SPQARGPSRSL----E 1151
                 ++  + A   +G  G P  P  PG G +PG    PG   +P   GP        E
Sbjct: 578  AGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGE 637

Query: 1152 TGAAAREG--------------GPKCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEA 1197
             G+   +G              GPK A  P+  P    Q P   +     R +       
Sbjct: 638  RGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPP--GAQGPPGLQGMPGERGAAGIAGPK 695

Query: 1198 KEPETAEESAPDSTEFTEALRSPPAACAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSL- 1256
             +     E  P+     +  R       G +G  PG   P      + + G P P+GS  
Sbjct: 696  GDRGDVGEKGPEGAPGKDGGR----GLTGPIG-PPG---PAGANGEKGEVGPPGPAGSAG 747

Query: 1257 ANTAP--HGSSPTPGVGSLLGGPGGTQAPVSHNSKDPPARQPGEFLAP-VANPSSTACPK 1313
            A  AP   G +  PG     G PG    P     +   A Q G+  AP    PS    P+
Sbjct: 748  ARGAPGERGETGPPGPAGFAGPPGADGQP-GAKGEQGEAGQKGDAGAPGPQGPSGAPGPQ 806

Query: 1314 -PSVLSSKISSFGCD-PAGFNRDP-----LGVPVAKKGPQPYSSPHSELFLGPKDLAGCF 1366
             P+ ++    + G   P G    P     +G P +   P P   P      GPK   G  
Sbjct: 807  GPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARG-- 864

Query: 1367 LEELHPKPSARDAPPASSSCLCQDGE--DAGSLEPQLPRSPPGTAETEPGRA-ASPPTLE 1423
                   P  R   P         GE  + G   P     PPG       R     P   
Sbjct: 865  ----DSGPPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQR 920

Query: 1424 SSSLFPDLPVDRFDPPLYGSLSANRDSGLPFACADPPQKTVPSDPP 1469
                FP LP    +P   G+  A+ D G P     PP  T P+  P
Sbjct: 921  GERGFPGLPGPSGEPGKQGAPGASGDRGPP-GPVGPPGLTGPAGEP 965



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 265/1132 (23%), Positives = 348/1132 (30%), Gaps = 234/1132 (20%)

Query: 6    PRGAPPPTMTGDLQPRQVASSPGHPSQP----PLEDNTPATRTTKGAR--EAGGQAQAME 59
            PRG P P   G   P+    +PG P +P    P+    P     K     EAG   +A E
Sbjct: 139  PRGPPGPA--GAPGPQGFQGNPGEPGEPGVSGPMGPRGPPGPPGKPGDDGEAGKPGKAGE 196

Query: 60   LPEAQPRQARD-----------------------GELKPPSLRGQAPSSTPGKRGSP--- 93
                 P+ AR                        GE   P ++G+  S +PG+ GSP   
Sbjct: 197  RGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVKGE--SGSPGENGSPGPM 254

Query: 94   --QTPPGRSPLQAPSRLAGRAEGSPPQRYILGI-----------------ASSRTKPTLD 134
              +  PG      P+  AG A G+  Q    G                  A     PT  
Sbjct: 255  GPRGLPGERGRTGPAGAAG-ARGNDGQPGPAGPPGPVGPAGGPGFPGAPGAKGEAGPTGA 313

Query: 135  ETPENPQLEAAQLPEVDTPQGPG----TGAPLRPGLPRTEAQPAAEELGFHRCF---QEP 187
              PE  Q       E  TP  PG    +G P   G+P  +    A  +     F   + P
Sbjct: 314  RGPEGAQ---GPRGEPGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRGP 370

Query: 188  PSSFTSTNYTSPSATPRPPA-------------PGPPQSRGTSPLQPGSYPEYQASGADS 234
            P    +T    P      P              PGP   +G     PG   E    GA  
Sbjct: 371  PGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQGA----PGPAGEEGKRGARG 426

Query: 235  WP-------PAAENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKP 287
             P       P  E   PG N G P  +    PKG+     P G++        +G   +P
Sbjct: 427  EPGGVGPIGPPGERGAPG-NRGFPGQDGLAGPKGAPGERGPSGLAGP---KGANGDPGRP 482

Query: 288  FPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPG---- 343
                + G     G       +P  A P+  VG   A     +P P      +GQPG    
Sbjct: 483  GEPGLPGARGLTG-------RPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGF 535

Query: 344  ----GLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERP-----------PSAQ 388
                G N     +G    PGA      P  D    +     P  P           PS  
Sbjct: 536  PGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPGPSGF 595

Query: 389  DGLGSTRGPPSSLPQ---RHFPGQAYRASGVDTSPGPPDT-----ELAAPGPP----PAR 436
             GL    GPP    +   +  PG+A    G     GP        E  +PG      P  
Sbjct: 596  QGLPGPPGPPGEGGKPGDQGVPGEA----GAPGLVGPRGERGFPGERGSPGAQGLQGPRG 651

Query: 437  LPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQR----LCLPQSAPLPWPQVLPTAR 492
            LP           + P GP  A       G P  G+R    +  P+       +  P   
Sbjct: 652  LPGTPGTDGPKGASGPAGPPGAQGPPGLQGMP--GERGAAGIAGPKGDRGDVGEKGPEGA 709

Query: 493  PSPHGMEMLSRL---PFPAG--GPEWQGGSQGALGTAGKTPGPREKLPAVRSSQGGSPAL 547
            P   G   L+     P PAG  G + + G  G  G+AG    P E+       + G P  
Sbjct: 710  PGKDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGER------GETGPPGP 763

Query: 548  FTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPS-ESPL----PSPATNTAG 602
              + G      QP   G  Q +    G    P P+    +P  + P     P  A    G
Sbjct: 764  AGFAGPPGADGQPGAKG-EQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQG 822

Query: 603  STCSSLSPMSSSPANP--SSEESQLPGPLGPSAFFHPPTHPQETGSPFPSPEP---PHSL 657
               ++  P ++    P  S+     PGP GPS    P     ++G P  + EP     + 
Sbjct: 823  PPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAG 882

Query: 658  PTHYQPEPAKAFPFPADG----------LGAEGAFQCLEETPFPHEGPEVGRGGLQGFPR 707
            P   + EP    P  A+G           G  G      E  FP      G  G QG P 
Sbjct: 883  PPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPG 942

Query: 708  AP----PPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDG 763
            A     PP P     L+  +           +  R  S  A     R   G    +   G
Sbjct: 943  ASGDRGPPGPVGPPGLTGPA----------GEPGREGSPGADGPPGRD--GAAGVKGDRG 990

Query: 764  HQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAAT 823
               + G PG P PP +P  PA                GD    G   P+     PS  A 
Sbjct: 991  ETGAVGAPGAPGPPGSPG-PAGPTG----------KQGDRGEAGAQGPMG----PSGPAG 1035

Query: 824  PFPLPASDLDMEDDAKLDSLITEALNGME-----YQSDNPEIDSSFIDVFADEEPSGPRG 878
               +        D  +        L G            P   S          PSGPRG
Sbjct: 1036 ARGIQGPQGPRGDKGEAGEPGERGLKGHRGFTGLQGLPGPPGPSGDQGASGPAGPSGPRG 1095

Query: 879  PSSGHPLKSKAGVT----------PESKAPPPLPAATPDPQTPRPGDRGCPARGRPKTRS 928
            P        K G            P  ++    PA  P    P PG  G P  G   +  
Sbjct: 1096 PPGPVGPSGKDGANGIPGPIGPPGPRGRSGETGPAGPPGNPGP-PGPPGPPGPGIDMSAF 1154

Query: 929  LGLAPTE----------ADAPSQGRQQRRGK---QLKLFRKDLDSGGAAEGS 967
             GL P E          AD  + G +Q   +    LK     ++S  + EGS
Sbjct: 1155 AGLGPREKGPDPLQYMRADQAAGGLRQHDAEVDATLKSLNNQIESIRSPEGS 1206



 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 123/507 (24%), Positives = 162/507 (31%), Gaps = 66/507 (13%)

Query: 3414 RGGRQPFAFRGVRRPGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILS 3473
            +G   P  F+G+  PG PG      EG  P  +    +PG A  PG     PRG      
Sbjct: 587  QGAPGPSGFQGL--PGPPGPPG---EGGKPGDQ---GVPGEAGAPG--LVGPRGERGFPG 636

Query: 3474 EGSLPALLHLCSEVAPSTTKGW--PETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFP 3531
            E   P    L        T G   P+    P  P      G + P   Q  P    +   
Sbjct: 637  ERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPP-----GAQGPPGLQGMPGERGAAGI 691

Query: 3532 AALADGRGDCALDGALERPENEASPGSPGPLLQQALPLGASLPRP-GARGQDAE-GKRAP 3589
            A     RGD    G    P  +   G  GP+           P P GA G+  E G   P
Sbjct: 692  AGPKGDRGDVGEKGPEGAPGKDGGRGLTGPI---------GPPGPAGANGEKGEVGPPGP 742

Query: 3590 LVFSGKRRAPGARGRCA----------PDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHK 3639
               +G R APG RG             P    +     ++ E          GP+G    
Sbjct: 743  AGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEAGQKGDAGAPGPQGPSGA 802

Query: 3640 GSATKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAK 3699
                 P G  +  K    A  P  A  FP     A G + P   + G      P  P  K
Sbjct: 803  PGPQGPTGV-TGPKGARGAQGPPGATGFP----GAAGRVGPPG-SNGNPGPPGPPGPSGK 856

Query: 3700 PGPSSQGSGSPRPGTKTGGGSQ-PQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQA 3758
             GP      S  PG     G Q P    G+        P+    P   P P+ L   A  
Sbjct: 857  DGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEGP---PGPQGL---AGQ 910

Query: 3759 KSCTKGPREAGEQGPHGSLGPKEK-------GESSTKRKKGQVPGPARSESVGSFGR--A 3809
            +     P + GE+G  G  GP  +       G S  +   G V  P  +   G  GR  +
Sbjct: 911  RGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEPGREGS 970

Query: 3810 PSAPDKPPRTPRKQATPSR----VLPTKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGK 3865
            P A   P R         R     +     P     P P     ++ + G    +  +G 
Sbjct: 971  PGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAGPTGKQGDRGEAGAQGPMGP 1030

Query: 3866 AFPQGRPLLRPPK--RGTAVHGAEPAE 3890
            + P G   ++ P+  RG      EP E
Sbjct: 1031 SGPAGARGIQGPQGPRGDKGEAGEPGE 1057



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 170/653 (26%), Positives = 209/653 (32%), Gaps = 138/653 (21%)

Query: 2    PGER--PRGAPPPTMTGDLQPRQVASSPGHPSQPPLED-----NTPATRTTKGAREAGGQ 54
            PG++  P  A  P + G    R      G P    L+       TP T   KGA    G 
Sbjct: 611  PGDQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGP 670

Query: 55   AQAMELPEAQPRQARDGELK---PPSLRG----QAPSSTPGKRGS-----PQTPPGRSPL 102
              A   P  Q      G      P   RG    + P   PGK G      P  PPG    
Sbjct: 671  PGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTGPIGPPG---- 726

Query: 103  QAPSRLAG-RAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAP 161
              P+   G + E  PP     G A +R  P              +  E   P   G   P
Sbjct: 727  --PAGANGEKGEVGPPGP--AGSAGARGAP-------------GERGETGPPGPAGFAGP 769

Query: 162  LRPGLPRTEAQPAAE-ELGFHRCFQEPPSSFTSTNYTSPSATPRPPAP----GPPQSRGT 216
                 P  + QP A+ E G     Q+  +         PS  P P  P    GP  +RG 
Sbjct: 770  -----PGADGQPGAKGEQG--EAGQKGDAGAPGPQ--GPSGAPGPQGPTGVTGPKGARGA 820

Query: 217  SPLQPGSYPEYQASGADSWPPAAENSFPGANFGVPPAEPEPI----PKGSRPGGSPRGVS 272
                PG+     A+G     P   N  PG     PP  P P     PKG+R    P G +
Sbjct: 821  QG-PPGATGFPGAAGRVG--PPGSNGNPG-----PPGPPGPSGKDGPKGARGDSGPPGRA 872

Query: 273  FQFPFPALHGASTKPF----PADVAGHAFTNGPLVFAFHQPQGAWPEEAV----GTGPAY 324
             +   P L G +  P     P D  G +   GP       PQG   +  +    G     
Sbjct: 873  GE---PGLQGPAGPPGEKGEPGD-DGPSGAEGP-----PGPQGLAGQRGIVGLPGQRGER 923

Query: 325  PLPTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERP 384
              P  P PS  P  QG PG         G +  PG    A  P  +    +      + P
Sbjct: 924  GFPGLPGPSGEPGKQGAPGASGDRGP-PGPVGPPGLTGPAGEPGREGSPGA------DGP 976

Query: 385  PSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGPP-PARLPQLWDP 443
            P  +DG    +G          PG          +PGPP     +PGP  P         
Sbjct: 977  PG-RDGAAGVKGDRGETGAVGAPG----------APGPP----GSPGPAGPTGKQGDRGE 1021

Query: 444  TAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSR 503
              A  P  P GP  A       G   P         A  P  + L   R    G   L  
Sbjct: 1022 AGAQGPMGPSGPAGA------RGIQGPQGPRGDKGEAGEPGERGLKGHR----GFTGLQG 1071

Query: 504  LPFPAGGPEWQGGSQGALGTAGKTPGPR-EKLPAVRSSQGGSPALFTYNGMTDPGAQPLF 562
            LP    GP    G QGA G AG + GPR    P   S + G+      NG+  P   P  
Sbjct: 1072 LP----GPPGPSGDQGASGPAGPS-GPRGPPGPVGPSGKDGA------NGIPGPIGPPGP 1120

Query: 563  FGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSP 615
             G    +  P G P  P P      P     P P  +   S  + L P    P
Sbjct: 1121 RG-RSGETGPAGPPGNPGP------PGPPGPPGPGIDM--SAFAGLGPREKGP 1164



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 117/479 (24%), Positives = 144/479 (30%), Gaps = 72/479 (15%)

Query: 3429 GAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEVA 3488
            G  G +    E   P  R R   PG+   PG   PP     P L       +     E A
Sbjct: 63   GPRGDRGDKGEKGAPGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGNFAAQMAGGFDEKA 122

Query: 3489 PSTTKGWPETLERPVDPVTHP-IRGCELPSNHQECP-----PPSLSPF-PAALADGRGDC 3541
                 G  +    P+ P   P   G   P   Q  P     P    P  P       G  
Sbjct: 123  GGAQLGVMQGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMGPRGPPGPPGKP 182

Query: 3542 ALDGALERPENEASPGSPGPLLQQALPLGASLPR-PGARG----QDAEGKRAPLVFSGKR 3596
              DG   +P      G PGP   +  P    LP   G RG      A+G+       G+ 
Sbjct: 183  GDDGEAGKPGKAGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVKGES 242

Query: 3597 RAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGC-------- 3648
             +PG  G   P                        GPRG   +   T PAG         
Sbjct: 243  GSPGENGSPGP-----------------------MGPRGLPGERGRTGPAGAAGARGNDG 279

Query: 3649 QSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSG 3708
            Q           P+    FP  P  A G   P   ARG E    P      PG       
Sbjct: 280  QPGPAGPPGPVGPAGGPGFPGAP-GAKGEAGPTG-ARGPEGAQGPRGEPGTPGSPGPAGA 337

Query: 3709 SPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPREA 3768
            S  PGT    G++    +  +    A  P  P  P   P P+        K  T  P  A
Sbjct: 338  SGNPGTDGIPGAKGSAGAPGI----AGAPGFPG-PRGPPGPQGATGPLGPKGQTGEPGIA 392

Query: 3769 ---GEQGPHGSLGPK----EKGESSTKRKKGQVPGPARSESVGSFGR--APSAPDKP--- 3816
               GEQGP G  GP       G +  + K+G    P     +G  G   AP     P   
Sbjct: 393  GFKGEQGPKGEPGPAGPQGAPGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQD 452

Query: 3817 ----PRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGR 3871
                P+    +  PS +   K       +P  P        PG      R G A PQG+
Sbjct: 453  GLAGPKGAPGERGPSGLAGPKGANGDPGRPGEP------GLPGARGLTGRPGDAGPQGK 505



 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 116/469 (24%), Positives = 154/469 (32%), Gaps = 56/469 (11%)

Query: 3428 PGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEV 3487
            PG  G         LP +R R    G+A   G D  P     P                V
Sbjct: 245  PGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPP--------------GPV 290

Query: 3488 APSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGDCALDGA- 3546
             P+   G+P       +      RG E     +  P    SP PA  +   G   + GA 
Sbjct: 291  GPAGGPGFPGAPGAKGEAGPTGARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAK 350

Query: 3547 --LERPENEASPGSPGPLLQQALPLGASLPRPGARGQDAEGKRAPLVFS-GKRRAPGARG 3603
                 P    +PG PGP      P GA+ P  G +GQ  E   A      G +  PG  G
Sbjct: 351  GSAGAPGIAGAPGFPGPRGPPG-PQGATGPL-GPKGQTGEPGIAGFKGEQGPKGEPGPAG 408

Query: 3604 -RCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKP-----AGCQSSSKDR-- 3655
             + AP    E+       E      +   G RG    G+   P     AG + +  +R  
Sbjct: 409  PQGAPGPAGEEGKRGARGEPGGVGPIGPPGERGA--PGNRGFPGQDGLAGPKGAPGERGP 466

Query: 3656 SAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTK 3715
            S  + P  A   P  P +      PG  ARG       A P+ K GPS       RPG  
Sbjct: 467  SGLAGPKGANGDPGRPGEPG---LPG--ARGLTGRPGDAGPQGKVGPSGAPGEDGRPGP- 520

Query: 3716 TGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGP---REAGEQG 3772
                  PQ A GQ        P    FP    A    P +A  K     P      G+ G
Sbjct: 521  ----PGPQGARGQ--------PGVMGFPGPKGANGE-PGKAGEKGLPGAPGLRGLPGKDG 567

Query: 3773 PHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKP--PRTPRKQATPSRVL 3830
              G+ GP      + +R +   PGP+  + +      P    KP     P +   P  V 
Sbjct: 568  ETGAAGPPGPAGPAGERGEQGAPGPSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVG 627

Query: 3831 PTKPK--PNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPP 3877
            P   +  P  +  P     +  +  PG        G + P G P  + P
Sbjct: 628  PRGERGFPGERGSPGAQGLQGPRGLPGTPGTDGPKGASGPAGPPGAQGP 676



 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 107/391 (27%), Positives = 128/391 (32%), Gaps = 65/391 (16%)

Query: 3415 GGRQPFAFRGVRRP-GAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILS 3473
            G   P    GV  P GA G +        P    RV  PGS   PG   PP     P   
Sbjct: 801  GAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNPGPPGPP----GPSGK 856

Query: 3474 EGSLPALLHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAA 3533
            +G   A      +  P    G P  L+ P  P        +   +  E PP      P  
Sbjct: 857  DGPKGAR----GDSGPPGRAGEPG-LQGPAGPPGEKGEPGDDGPSGAEGPPG-----PQG 906

Query: 3534 LADGRGDCALDGALERPENEASPGSPGPLLQ---QALPLGASLPR--PGARGQDAEGKRA 3588
            LA  RG   L G  +R E    PG PGP  +   Q  P GAS  R  PG  G    G   
Sbjct: 907  LAGQRGIVGLPG--QRGER-GFPGLPGPSGEPGKQGAP-GASGDRGPPGPVGPP--GLTG 960

Query: 3589 PLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGC 3648
            P    G+  +PGA G   P       +     E  +       GP G+        PAG 
Sbjct: 961  PAGEPGREGSPGADG--PPGRDGAAGVKGDRGETGAVGAPGAPGPPGS------PGPAGP 1012

Query: 3649 QSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPG-PSSQGS 3707
                 DR  A         P+ P    G       ARG +    P   K + G P  +G 
Sbjct: 1013 TGKQGDRGEAGAQG-----PMGPSGPAG-------ARGIQGPQGPRGDKGEAGEPGERGL 1060

Query: 3708 GSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERL--------------P 3753
               R  T   G   P   SG    + A+ PA PS P   P P                 P
Sbjct: 1061 KGHRGFTGLQGLPGPPGPSGD---QGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGP 1117

Query: 3754 ARAQAKSCTKGPR-EAGEQGPHGSLGPKEKG 3783
               + +S   GP    G  GP G  GP   G
Sbjct: 1118 PGPRGRSGETGPAGPPGNPGPPGPPGPPGPG 1148



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 85/367 (23%), Positives = 112/367 (30%), Gaps = 45/367 (12%)

Query: 3547 LERPENEASPGSPGPLLQQALPLGASLPRPGARGQDAEGKRAPLVFSGKRRAPGARGRCA 3606
            + +P  +   G PG +     P G   P+  A  Q   G R      G++ APG RGR  
Sbjct: 28   VRQPGPKGQKGEPGDIKDIVGPKGPPGPQGPAGEQGPRGDRGD---KGEKGAPGPRGR-- 82

Query: 3607 PDHFQEDHLLQKEKEVSSSHMVSEGGPRG-TFHKGSATKPAGCQSSSKDRSAASTPSKAL 3665
                        + E  +       GP G     G     A   +   D  A       +
Sbjct: 83   ------------DGEPGTPGNPGPPGPPGPPGPPGLGGNFAAQMAGGFDEKAGGAQLGVM 130

Query: 3666 KFPVHPRKAVGSLAP----------GELARGTENGMK-PATPKAKPGPSSQGSGSPRPGT 3714
            + P+ P    G   P          G      E G+  P  P+  PGP  +       G 
Sbjct: 131  QGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMGPRGPPGPPGKPGDDGEAG- 189

Query: 3715 KTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQA-----KSCTKGPREAG 3769
            K G   +  P   Q       TP  P        P    A+ +A     K  +  P E G
Sbjct: 190  KPGKAGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVKGESGSPGENG 249

Query: 3770 EQGPHGSLG-PKEKGESSTKRKKGQ-----VPGPARSES-VGSFGRA--PSAPD-KPPRT 3819
              GP G  G P E+G +      G       PGPA     VG  G    P AP  K    
Sbjct: 250  SPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFPGAPGAKGEAG 309

Query: 3820 PRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPPKR 3879
            P     P      + +P +   P P  +       G    K   G     G P    P+ 
Sbjct: 310  PTGARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAGAPGFPGPRG 369

Query: 3880 GTAVHGA 3886
                 GA
Sbjct: 370  PPGPQGA 376



 Score = 40.0 bits (92), Expect = 0.046
 Identities = 56/236 (23%), Positives = 68/236 (28%), Gaps = 30/236 (12%)

Query: 3679 APGELAR----GTENGMKPATPKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETA 3734
            APG   R    GT     P  P   PGP   G        +  GG   +    QL     
Sbjct: 76   APGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGNF---AAQMAGGFDEKAGGAQLG--VM 130

Query: 3735 TTPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPK-------EKGESST 3787
              P  P  P   P P   P     +     P E G  GP G  GP        + GE+  
Sbjct: 131  QGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMGPRGPPGPPGKPGDDGEAGK 190

Query: 3788 KRKKGQVPGPARSESVGSFGRAPSAPDKPPRT-------PRKQATPSRVLPTKPKPNSQN 3840
              K G+  GP   +    F   P  P              + +A    V      P    
Sbjct: 191  PGKAGE-RGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVKGESGSPGENG 249

Query: 3841 KPRP------PPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPPKRGTAVHGAEPAE 3890
             P P      P    R    G    +   G+  P G P    P  G    GA  A+
Sbjct: 250  SPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFPGAPGAK 305



 Score = 38.9 bits (89), Expect = 0.10
 Identities = 101/428 (23%), Positives = 128/428 (29%), Gaps = 68/428 (15%)

Query: 3419 PFAFRGVRRPGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILS-EGSL 3477
            P  F G   PGA GQ     E     ++     PG  P      P P+G + +   +G+ 
Sbjct: 763  PAGFAGP--PGADGQPGAKGEQGEAGQKGDAGAPG--PQGPSGAPGPQGPTGVTGPKGAR 818

Query: 3478 PALLHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADG 3537
             A         P    G+P    R   P ++   G   P        P  +   +     
Sbjct: 819  GAQ-------GPPGATGFPGAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGR 871

Query: 3538 RGDCALDGALERPENEASPGSPGPLLQQALPLGASLPR-------PGARGQDA-EGKRAP 3589
             G+  L G    P  +  PG  GP   +  P    L         PG RG+    G   P
Sbjct: 872  AGEPGLQGPAGPPGEKGEPGDDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGP 931

Query: 3590 LVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQ 3649
                GK+ APGA G                          + GP G       T PAG  
Sbjct: 932  SGEPGKQGAPGASG--------------------------DRGPPGPVGPPGLTGPAGEP 965

Query: 3650 SSSKDRSAASTPSK----ALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQ 3705
                   A   P +     +K       AVG  APG  A G      PA P  K G   +
Sbjct: 966  GREGSPGADGPPGRDGAAGVKGDRGETGAVG--APG--APGPPGSPGPAGPTGKQGDRGE 1021

Query: 3706 GS--GSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTK 3763
                G   P    G      P   +     A  P +     R     R     Q      
Sbjct: 1022 AGAQGPMGPSGPAGARGIQGPQGPRGDKGEAGEPGE-----RGLKGHRGFTGLQGLPGPP 1076

Query: 3764 GPR----EAGEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRA-PSAPDKPPR 3818
            GP      +G  GP G  GP      S K     +PGP      G  GR+  + P  PP 
Sbjct: 1077 GPSGDQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGPP--GPRGRSGETGPAGPPG 1134

Query: 3819 TPRKQATP 3826
             P     P
Sbjct: 1135 NPGPPGPP 1142



 Score = 37.7 bits (86), Expect = 0.23
 Identities = 36/111 (32%), Positives = 43/111 (38%), Gaps = 17/111 (15%)

Query: 3187 PGGLEGSSAVAHLLNSITE------PAPKHHRGKRSAGKAAGSPGDPW-----GQEGEAK 3235
            P GL G   +  L     E      P P    GK+ A  A+G  G P      G  G A 
Sbjct: 904  PQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPA- 962

Query: 3236 KDSPGERAKPRARSTPSNPDGAA--TPDSASATALADAGSPGPPRTTPSPS 3284
               PG    P A   P   DGAA    D     A+   G+PGPP  +P P+
Sbjct: 963  -GEPGREGSPGADGPPGR-DGAAGVKGDRGETGAVGAPGAPGPP-GSPGPA 1010



 Score = 35.4 bits (80), Expect = 1.1
 Identities = 30/91 (32%), Positives = 37/91 (40%), Gaps = 6/91 (6%)

Query: 3206 PAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPGERAKPRARSTPSNP-DGAATPDSAS 3264
            P  K HRG      A G  G P G +GE+   SPGE   P        P +   T  + +
Sbjct: 215  PGVKGHRGYPGLDGAKGEAGAP-GVKGES--GSPGENGSPGPMGPRGLPGERGRTGPAGA 271

Query: 3265 ATALADAGSPGP--PRTTPSPSPDPWAGGEP 3293
            A A  + G PGP  P     P+  P   G P
Sbjct: 272  AGARGNDGQPGPAGPPGPVGPAGGPGFPGAP 302



 Score = 35.0 bits (79), Expect = 1.5
 Identities = 28/96 (29%), Positives = 36/96 (37%), Gaps = 22/96 (22%)

Query: 3203 ITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSP-------GERAKPRARSTPSNPD 3255
            + +P PK  +G+    K    P  P G +G A +  P       GE+  P  R     P 
Sbjct: 28   VRQPGPKGQKGEPGDIKDIVGPKGPPGPQGPAGEQGPRGDRGDKGEKGAPGPRGRDGEP- 86

Query: 3256 GAATPDSASATALADAGSPGPPRTTPSPSPDPWAGG 3291
               TP           G+PGPP   P P   P  GG
Sbjct: 87   --GTP-----------GNPGPPG-PPGPPGPPGLGG 108



 Score = 32.7 bits (73), Expect = 7.3
 Identities = 26/81 (32%), Positives = 36/81 (44%), Gaps = 8/81 (9%)

Query: 3205 EPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPGERAKPRARSTPSNPDGAATPDSAS 3264
            +P  K  +G+      AG+PG P G  G     +PG +  P   + P    GA  P  A+
Sbjct: 775  QPGAKGEQGEAGQKGDAGAPG-PQGPSG-----APGPQG-PTGVTGPKGARGAQGPPGAT 827

Query: 3265 ATALADAGSPGPPRTTPSPSP 3285
                A AG  GPP +  +P P
Sbjct: 828  GFPGA-AGRVGPPGSNGNPGP 847


>gi|95147555 microtubule-associated protein 1A [Homo sapiens]
          Length = 2803

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 252/1073 (23%), Positives = 341/1073 (31%), Gaps = 240/1073 (22%)

Query: 4    ERPRGAPPPTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQAMELPEA 63
            E P G PP       +  ++  SP     PP    +P     +    A GQ   +  P+ 
Sbjct: 1775 ESPVGLPPE------EEDKLTRSPFEIISPPA---SPPEMVGQRVPSAPGQESPIPDPKL 1825

Query: 64   QPRQARDGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRYILG 123
             P      E   PS     P   P  R  P  P   SP   P   A   E   P  +  G
Sbjct: 1826 MPHMKN--EPTTPSWLADIPPWVPKDRPLPPAP--LSPAPGPPTPA--PESHTPAPFSWG 1879

Query: 124  IASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAEELGFHRC 183
             A        D      Q  AA+L     P  P  G   R      E +  AE       
Sbjct: 1880 TAE------YDSVVAAVQEGAAELE--GGPYSP-LGKDYRKAEGEREEEGRAEAPDKSSH 1930

Query: 184  FQEPPSSFTSTNYTSPSATP---RPPAPGPPQSR-------------GTSPLQPGSYPEY 227
              + P +  S   T P  T    R P P P +               G  P  P   P  
Sbjct: 1931 SSKVPEASKSHATTEPEQTEPEQREPTPYPDERSFQYADIYEQMMLTGLGPACPTREPPL 1990

Query: 228  QASGADSWPP--AAENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGAST 285
             A+G   WPP  + + +  G N         PI   S    +P      F + AL G + 
Sbjct: 1991 GAAG--DWPPCLSTKEAAAGRNTSAEKELSSPISPKSLQSDTPT-----FSYAALAGPTV 2043

Query: 286  KPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAV-GTGPAYPL--------PTQPAPSPLP 336
             P P          GP +     P    P   +   GP+ PL        P + +PSP  
Sbjct: 2044 PPRPEP--------GPSMEPSLTPPAVPPRAPILSKGPSPPLNGNILSCSPDRRSPSPKE 2095

Query: 337  CYQGQPGGLNRHSDLS-GALSSPGAAHSAPRPFSDSLHKSLTKILPERPPSAQDGLGSTR 395
              +         S+L  GA   P     +P P    +      + PE        L S  
Sbjct: 2096 SGRSHWDDSTSDSELEKGAREQPEKEAQSPSP-PHPIPMGSPTLWPETEAHVSPPLDSHL 2154

Query: 396  GPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGPPPARLPQLWDPTAAPYPT----- 450
            GP  + P   FP  A+  S +               P P +LP   +P +AP  +     
Sbjct: 2155 GP--ARPSLDFPASAFGFSSLQ--------------PAPPQLPSPAEPRSAPCGSLAFSG 2198

Query: 451  ------PPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRL 504
                   PG P       +     +P     LPQ         LP+  PS  G  +LS L
Sbjct: 2199 DRALALAPGPPTRTRHDEYLEVTKAPSLDSSLPQ---------LPS--PSSPGAPLLSNL 2247

Query: 505  PFPAGGPEWQGGSQGALGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTDPGAQPLFFG 564
            P PA     +G S  A      +   R   P++ +++  S       G  DPG +P    
Sbjct: 2248 PRPASPALSEGSSSEATTPVISSVAERFS-PSLEAAEQES-------GELDPGMEP---- 2295

Query: 565  VAQPQVSPHGTPSLPPPRVVGASPSESPLP-SPATNTAGSTCSSLSPMSSSPANPSSEES 623
                  + H    L P  +  A P+   L  +PA +  G     + P     +  ++E+ 
Sbjct: 2296 ------AAHSLWDLTP--LSPAPPASLDLALAPAPSLPGDMGDGILPCHLECSEAATEK- 2346

Query: 624  QLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQ 683
                   PS F  P       G    SP PP   P   + E A A P    G   EGA +
Sbjct: 2347 -------PSPFQVPSEDCAANGPTETSPNPPGPAPAKAENEEAAACPAWERGAWPEGAER 2399

Query: 684  CLE-ETPFPHEGPEVGRGGLQGFPRAPPPY-----------PTHHFSLSSASLDQLDVLL 731
                +T    E P    GG  G P +  P            P  H    S S   L+  L
Sbjct: 2400 SSRPDTLLSPEQPVCPAGGSGGPPSSASPEVEAGPQGCATEPRPHRGELSPSF--LNPPL 2457

Query: 732  TCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLL 791
                 DR+ S+    L  R        R + G    PG  G P P      P  A     
Sbjct: 2458 PPSIDDRDLSTEEVRLVGRG------GRRRVG---GPGTTGGPCPVTDETPPTSASD--- 2505

Query: 792  SHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGM 851
                    +G +Q++  D P  T   PS+ A              +A LDS         
Sbjct: 2506 --------SGSSQSDS-DVPPETEECPSITA--------------EAALDS--------- 2533

Query: 852  EYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAGVTPESKAPPPLPAATPDPQTP 911
                   + D  F+ V      SG   P  GH              PPPLP   P P  P
Sbjct: 2534 -------DEDGDFLPVDKAGGVSGTHHPRPGHD-------------PPPLPQPDPRPSPP 2573

Query: 912  RPGDRGCPARGRPKTRSLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGG 971
            RP               + +A  E  +   GR +R  ++ K+  +           G   
Sbjct: 2574 RP--------------DVCMADPEGLSSESGRVERLREKEKVQGR----------VGRRA 2609

Query: 972  GGRASGLRP-RRNDGLGERPPPRPRRPRTQAPGSRADPAPRVPRAAALPEETR 1023
             G+A    P RR D  G+R P   + P  +A  SRA P PR   +   P E +
Sbjct: 2610 PGKAKPASPARRLDLRGKRSPTPGKGPADRA--SRAPPRPRSTTSQVTPAEEK 2660



 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 215/937 (22%), Positives = 301/937 (32%), Gaps = 160/937 (17%)

Query: 1457 ADPPQ---KTVPSDP------PYPSFLLLEEVSPMLPSHFPDLSGGKVLSKTCPPERTVV 1507
            A PP+   + VPS P      P P  +   +  P  PS   D+       +  PP   + 
Sbjct: 1800 ASPPEMVGQRVPSAPGQESPIPDPKLMPHMKNEPTTPSWLADIPPWVPKDRPLPPA-PLS 1858

Query: 1508 PGAAPSLPGKGSGCSVALMSHLSEDE---LEIQKLVTELE-------------SQLQRSK 1551
            P   P  P   S          +E +     +Q+   ELE             ++ +R +
Sbjct: 1859 PAPGPPTPAPESHTPAPFSWGTAEYDSVVAAVQEGAAELEGGPYSPLGKDYRKAEGEREE 1918

Query: 1552 DTRG-APRELAEAESVGRVELGTGTEPPSQRRTCQ---ATVPHEDTFSAADLTRVGESTA 1607
            + R  AP + + +  V        T  P Q    Q      P E +F  AD+      T 
Sbjct: 1919 EGRAEAPDKSSHSSKVPEASKSHATTEPEQTEPEQREPTPYPDERSFQYADIYEQMMLT- 1977

Query: 1608 HREGAESAVATVEAVQGRPGGTWPCPASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQ 1667
               G   A  T E   G   G WP   S     A     A+++L S  P SP+       
Sbjct: 1978 ---GLGPACPTREPPLGA-AGDWPPCLSTKEAAAGRNTSAEKELSS--PISPKSLQSD-T 2030

Query: 1668 PVQKAGASKTGLCQAEGDSRPPQDVCLPEP---------SKQPGPQLDAGSLAKCSPDQE 1718
            P     A          +  P  +  L  P         SK P P L+ G++  CSPD+ 
Sbjct: 2031 PTFSYAALAGPTVPPRPEPGPSMEPSLTPPAVPPRAPILSKGPSPPLN-GNILSCSPDRR 2089

Query: 1719 LSFPKNKEAASSQESEDSLRLLPCEQRGGFLPEPGTADQPHRGA-----PAPEAFGSPAV 1773
               PK    +   +S     L           E G  +QP + A     P P   GSP +
Sbjct: 2090 SPSPKESGRSHWDDSTSDSEL-----------EKGAREQPEKEAQSPSPPHPIPMGSPTL 2138

Query: 1774 ------HLAPDL-AFQGDGAPPLDATWPFGASPSHAAQGHSAGRAGGHLHPTAGRPGFEG 1826
                  H++P L +  G   P LD    F AS    A G S+ +      P+   P    
Sbjct: 2139 WPETEAHVSPPLDSHLGPARPSLD----FPAS----AFGFSSLQPAPPQLPSPAEP---- 2186

Query: 1827 NEFAPAGASSLTAPRGREAWLVPVPSPACVSNTHPSRRSQDPALSPPIRQL--------- 1877
               AP G  SL     R   L P P P    +      ++ P+L   + QL         
Sbjct: 2187 -RSAPCG--SLAFSGDRALALAPGP-PTRTRHDEYLEVTKAPSLDSSLPQLPSPSSPGAP 2242

Query: 1878 ---QLPGPGVAKSKDGILGLQELTPAAQS-PPRVNPSGLEGGTVEGGKVACGPAQGSPGG 1933
                LP P      +G    +  TP   S   R +PS LE    E G++  G    +   
Sbjct: 2243 LLSNLPRPASPALSEG-SSSEATTPVISSVAERFSPS-LEAAEQESGELDPGMEPAAHSL 2300

Query: 1934 VQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTANQLQPENGVSPGGTDNHASVNA- 1992
              +T L       L L        L  A    G      L      S   T+  +     
Sbjct: 2301 WDLTPLSPAPPASLDL-------ALAPAPSLPGDMGDGILPCHLECSEAATEKPSPFQVP 2353

Query: 1993 SPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPTPS------PPSPNRESLALALTAAH 2046
            S   A  GPTE +       G   A +  EEA   P+      P    R S    L +  
Sbjct: 2354 SEDCAANGPTETS---PNPPGPAPAKAENEEAAACPAWERGAWPEGAERSSRPDTLLSPE 2410

Query: 2047 S----RSGSEGRTPERASSPGLNKPLLATGDSPAPSVGDLAACAPSPTSAAHMPCSLGPL 2102
                   GS G  P  ++SP +          P P  G+L+    +P     +P S+   
Sbjct: 2411 QPVCPAGGSGG--PPSSASPEVEAGPQGCATEPRPHRGELSPSFLNPP----LPPSIDD- 2463

Query: 2103 PREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQLLACSPAWAPLEEADGVQATTDTGAE 2162
               D  T   R  G  G +    P     P P      +    P   +D   + +D+   
Sbjct: 2464 --RDLSTEEVRLVGRGGRRRVGGPGTTGGPCP-----VTDETPPTSASDSGSSQSDSDVP 2516

Query: 2163 DSPVAPPSLTTS------------PCDPKEALAGCLLQGEGS-----PLEDPSSWPPGSV 2205
                  PS+T              P D    ++G      G      P  DP   PP   
Sbjct: 2517 PETEECPSITAEAALDSDEDGDFLPVDKAGGVSGTHHPRPGHDPPPLPQPDPRPSPP--- 2573

Query: 2206 SAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRATGLSSTPT 2265
                C    +     + R+     KEK+    GR  +P  A   SP+  +   G  S PT
Sbjct: 2574 RPDVCMADPEGLSSESGRVERLREKEKVQGRVGR-RAPGKAKPASPARRLDLRGKRS-PT 2631

Query: 2266 GDEAQAGRGLPGPDPQSRGAPPHTNPDRMPRGHSSYS 2302
              +  A R    P P+ R       P     GHS  S
Sbjct: 2632 PGKGPADRASRAP-PRPRSTTSQVTPAEEKDGHSPMS 2667



 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 115/460 (25%), Positives = 170/460 (36%), Gaps = 79/460 (17%)

Query: 3434 KARALEGTLPSKRRRVAMPG-SAPGPGEDRPPPRGSSPILSEGS-----LPALLHLCSEV 3487
            KA +L+ +LP       +P  S+PG       PR +SP LSEGS      P +  +    
Sbjct: 2222 KAPSLDSSLPQ------LPSPSSPGAPLLSNLPRPASPALSEGSSSEATTPVISSVAERF 2275

Query: 3488 APSTTKGWPET--LERPVDPVTHPIRGCELPSNHQECPPPS----LSPFPAALADGRGDC 3541
            +PS      E+  L+  ++P  H +      S     PP S    L+P P+   D  GD 
Sbjct: 2276 SPSLEAAEQESGELDPGMEPAAHSLWDLTPLS---PAPPASLDLALAPAPSLPGD-MGDG 2331

Query: 3542 ALDGALERPENEASPGSPGPLLQQALPLGASLPR------PGARGQDAEGKRAPLVFSGK 3595
             L   LE   +EA+   P P    +    A+ P       PG     AE + A    + +
Sbjct: 2332 ILPCHLEC--SEAATEKPSPFQVPSEDCAANGPTETSPNPPGPAPAKAENEEAAACPAWE 2389

Query: 3596 RRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDR 3655
            R   GA    A    + D LL  E+ V  +     GGP  +        P GC +  +  
Sbjct: 2390 R---GAWPEGAERSSRPDTLLSPEQPVCPAG--GSGGPPSSASPEVEAGPQGCATEPRPH 2444

Query: 3656 SAASTPSKALKFPVHPRKAVGSLAPGEL------------ARGTENGMKPATPKAKPGPS 3703
                +PS  L  P+ P      L+  E+              GT  G  P T +  P  S
Sbjct: 2445 RGELSPS-FLNPPLPPSIDDRDLSTEEVRLVGRGGRRRVGGPGTTGGPCPVTDETPP-TS 2502

Query: 3704 SQGSGSPRPGTKTGGGSQPQP---ASGQLQSE--------------TATTPAKPSF-PSR 3745
            +  SGS +  +     ++  P   A   L S+              + T   +P   P  
Sbjct: 2503 ASDSGSSQSDSDVPPETEECPSITAEAALDSDEDGDFLPVDKAGGVSGTHHPRPGHDPPP 2562

Query: 3746 SPAPERLPARAQAKSCTKGPRE-AGEQGPHGSLGPKEKGESSTKRK---KGQVPGPARSE 3801
             P P+  P+  +   C   P   + E G    L  KEK +    R+   K +   PAR  
Sbjct: 2563 LPQPDPRPSPPRPDVCMADPEGLSSESGRVERLREKEKVQGRVGRRAPGKAKPASPARRL 2622

Query: 3802 SVGSFGRAPSAPDKPP------RTPRKQATPSRVLPTKPK 3835
             +   G+    P K P        PR ++T S+V P + K
Sbjct: 2623 DLR--GKRSPTPGKGPADRASRAPPRPRSTTSQVTPAEEK 2660



 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 178/777 (22%), Positives = 249/777 (32%), Gaps = 146/777 (18%)

Query: 3166 LREHAVRFARRGQARRSLGDLPG-GLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSP 3224
            LREHA R       +      P  GLE    +A   + +  P  +  +  RS  +    P
Sbjct: 1742 LREHATRSPWASDFKDFQESSPQKGLEVERWLAE--SPVGLPPEEEDKLTRSPFEIISPP 1799

Query: 3225 GDPWGQEGEAKKDSPGERAK-------PRARSTPSNPDGAA-----TPDSASATALADAG 3272
              P    G+    +PG+ +        P  ++ P+ P   A      P          + 
Sbjct: 1800 ASPPEMVGQRVPSAPGQESPIPDPKLMPHMKNEPTTPSWLADIPPWVPKDRPLPPAPLSP 1859

Query: 3273 SPGPPRTTP---SPSPDPWAGGE------------PLLQATPVHEACKD----------- 3306
            +PGPP   P   +P+P  W   E              L+  P     KD           
Sbjct: 1860 APGPPTPAPESHTPAPFSWGTAEYDSVVAAVQEGAAELEGGPYSPLGKDYRKAEGEREEE 1919

Query: 3307 -----PSRDCHHCGKRFPKPFKLQRHLAVHSPQRVYLCPRCPRVYPEHGE---------- 3351
                 P +  H    + P+  K     A   P++     R P  YP+             
Sbjct: 1920 GRAEAPDKSSH--SSKVPEASKSH---ATTEPEQTEPEQREPTPYPDERSFQYADIYEQM 1974

Query: 3352 LLAHLGGAHGLLERPELQHTPLYACELCATVMRIIKKSFACSSCNYTFAKKEQFDRHMNK 3411
            +L  LG A    E P         C         +    A +  N T A+KE       K
Sbjct: 1975 MLTGLGPACPTREPPLGAAGDWPPC---------LSTKEAAAGRN-TSAEKELSSPISPK 2024

Query: 3412 HLRGGRQPFAFRGVRRPGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRP--PPRGSS 3469
             L+     F++  +  P  P +                  PG +  P    P  PPR  +
Sbjct: 2025 SLQSDTPTFSYAALAGPTVPPRPE----------------PGPSMEPSLTPPAVPPR--A 2066

Query: 3470 PILSEGSLPALLHLCSEVAPSTTKGWPETLERP-VDPVTHPIR----GCELPSNHQECP- 3523
            PILS+G  P L       +P      P+   R   D  T          E P    + P 
Sbjct: 2067 PILSKGPSPPLNGNILSCSPDRRSPSPKESGRSHWDDSTSDSELEKGAREQPEKEAQSPS 2126

Query: 3524 PPSLSPFPAALADGRGDCALDGALERPENEASPGSPGPLLQQALPLGASLPRPGARGQDA 3583
            PP   P  +       +  +   L+     A P    P    A    +  P P      A
Sbjct: 2127 PPHPIPMGSPTLWPETEAHVSPPLDSHLGPARPSLDFP--ASAFGFSSLQPAPPQLPSPA 2184

Query: 3584 EGKRAP---LVFSGKRR---APGARGRCAPDHFQEDHLLQKEKEVSSS--HMVSEGGPRG 3635
            E + AP   L FSG R    APG   R   D + E   + K   + SS   + S   P G
Sbjct: 2185 EPRSAPCGSLAFSGDRALALAPGPPTRTRHDEYLE---VTKAPSLDSSLPQLPSPSSP-G 2240

Query: 3636 TFHKGSATKPAGCQSSSKDRSAASTP---SKALKFPVHPRKAVGSLAPGELARGTE---- 3688
                 +  +PA    S    S A+TP   S A +F   P         GEL  G E    
Sbjct: 2241 APLLSNLPRPASPALSEGSSSEATTPVISSVAERF--SPSLEAAEQESGELDPGMEPAAH 2298

Query: 3689 -----NGMKPATPKA-----KPGPS---SQGSGSPRPGTKTGGGSQPQPASGQLQSE--T 3733
                   + PA P +      P PS     G G      +    +  +P+  Q+ SE   
Sbjct: 2299 SLWDLTPLSPAPPASLDLALAPAPSLPGDMGDGILPCHLECSEAATEKPSPFQVPSEDCA 2358

Query: 3734 ATTPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPKEKGESSTKRKKGQ 3793
            A  P + S     PAP +     +A +C    R A  +G   S  P       T     Q
Sbjct: 2359 ANGPTETSPNPPGPAPAK-AENEEAAACPAWERGAWPEGAERSSRP------DTLLSPEQ 2411

Query: 3794 VPGPARSESVGSFGRAPSAPDKPPRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQR 3850
               PA     GS G   SA  +    P+  AT  R    +  P+  N P PP  + R
Sbjct: 2412 PVCPAG----GSGGPPSSASPEVEAGPQGCATEPRPHRGELSPSFLNPPLPPSIDDR 2464



 Score = 43.1 bits (100), Expect = 0.005
 Identities = 178/789 (22%), Positives = 246/789 (31%), Gaps = 176/789 (22%)

Query: 2026 PTPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAPSVGDLAAC 2085
            PT  PP          L+   + +G      +  SSP   K L +  D+P  S   LA  
Sbjct: 1984 PTREPPLGAAGDWPPCLSTKEAAAGRNTSAEKELSSPISPKSLQS--DTPTFSYAALAG- 2040

Query: 2086 APSPTSAAHMPCSLGPLPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQLLACSPAWA 2145
               PT        + P P   P   PS     +  + P       PP    +L+CSP   
Sbjct: 2041 ---PT--------VPPRPEPGPSMEPSLTPPAVPPRAPILSKGPSPPLNGNILSCSPDRR 2089

Query: 2146 PLEEADGVQATTDTGAEDSPV------APPSLTTSPCDPKEALAGCLLQGEGSPLEDPSS 2199
                 +  ++  D    DS +       P     SP  P              P+  P+ 
Sbjct: 2090 SPSPKESGRSHWDDSTSDSELEKGAREQPEKEAQSPSPPHPI-----------PMGSPTL 2138

Query: 2200 WP--PGSVSAVTCTHSGDTPKDSTLRIPEDS-RKEKLWESPGRATSP------------- 2243
            WP     VS    +H G  P   +L  P  +     L  +P +  SP             
Sbjct: 2139 WPETEAHVSPPLDSHLG--PARPSLDFPASAFGFSSLQPAPPQLPSPAEPRSAPCGSLAF 2196

Query: 2244 --PLAGAVSPSVAVRATGLSSTPTGDEAQAGRGLPG-PDPQSRGAPPHTNPDRMPRGHSS 2300
                A A++P    R                  LP  P P S GAP  +N   +PR    
Sbjct: 2197 SGDRALALAPGPPTRTRHDEYLEVTKAPSLDSSLPQLPSPSSPGAPLLSN---LPR---- 2249

Query: 2301 YSPSNTARLGHREGQAVTAVPTE-----PPTLQGAGPDSPACLEGEMGTSSKEPEDPGTP 2355
              P++ A       +A T V +       P+L+ A  +S     GE+        DPG  
Sbjct: 2250 --PASPALSEGSSSEATTPVISSVAERFSPSLEAAEQES-----GEL--------DPGME 2294

Query: 2356 ETGRSGATKMPRVTCPSTGLGLGRTTAPS---------------------STASDFQSDS 2394
                S     P    P   L L    APS                        S FQ  S
Sbjct: 2295 PAAHSLWDLTPLSPAPPASLDLALAPAPSLPGDMGDGILPCHLECSEAATEKPSPFQVPS 2354

Query: 2395 PQSHRNASHQTPQGDPLGPQDLKQRSRGYKKKPASTENGQW-----KGQAPHGPVTCE-- 2447
                 N   +T    P GP   K  +      PA  E G W     +   P   ++ E  
Sbjct: 2355 EDCAANGPTETSPNPP-GPAPAKAENEEAAACPA-WERGAWPEGAERSSRPDTLLSPEQP 2412

Query: 2448 VCAASFRSGPGLSRHK---------ARKHRPHPGAPAEPSPAALPAQQPLEPLAQKCQPP 2498
            VC A    GP  S            A + RPH G   E SP+ L    PL P        
Sbjct: 2413 VCPAGGSGGPPSSASPEVEAGPQGCATEPRPHRG---ELSPSFL--NPPLPPSIDDRDLS 2467

Query: 2499 RKKSHRV--SGKERPN--HSRGDPSHVTQPPPAQGSKEVLRAPGSPHSQQLHPPSPTEHE 2554
             ++   V   G+ R     + G P  VT   P   + +     GS  S    PP  TE  
Sbjct: 2468 TEEVRLVGRGGRRRVGGPGTTGGPCPVTDETPPTSASD----SGSSQSDSDVPPE-TEEC 2522

Query: 2555 VDVKTPASKPRPDQAREDELHPKQAEKREGRRWRREPTVDSP------------------ 2596
              +   A+    D   + +  P              P  D P                  
Sbjct: 2523 PSITAEAAL---DSDEDGDFLPVDKAGGVSGTHHPRPGHDPPPLPQPDPRPSPPRPDVCM 2579

Query: 2597 SHSEGKSNKKRGKLRGRRLREESILPVSADVISDGRGSRPSPAMASYAASPSHCLSVEGG 2656
            +  EG S++     R  RLRE+  +         GR  R +P  A   ASP+  L + G 
Sbjct: 2580 ADPEGLSSESG---RVERLREKEKV--------QGRVGRRAPGKAK-PASPARRLDLRG- 2626

Query: 2657 PEADGEQPPRLATLGPGVMEGA--AETDQEALCAGETGAQKPPGDRMLCPGRMDGAALGE 2714
                     R  T G G  + A  A     +  +  T A++  G   +  G ++G   G 
Sbjct: 2627 --------KRSPTPGKGPADRASRAPPRPRSTTSQVTPAEEKDGHSPMSKGLVNGLKAGP 2678

Query: 2715 QPTGQKGAS 2723
                 KG+S
Sbjct: 2679 MALSSKGSS 2687



 Score = 41.6 bits (96), Expect = 0.016
 Identities = 108/439 (24%), Positives = 144/439 (32%), Gaps = 59/439 (13%)

Query: 1089 RGEKRKEVELTQGPREDEPQKP--RKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGP 1146
            R E    +E +  P    P+ P   K       G+    +P+    S    GRS      
Sbjct: 2046 RPEPGPSMEPSLTPPAVPPRAPILSKGPSPPLNGNILSCSPDRRSPSPKESGRSHWDDST 2105

Query: 1147 SRSLETGAAAREGGPKCADRPSVAPKDPLQVPTNTETSEE------------TRPSLDFP 1194
            S S E    ARE   K A  PS     P+  PT    +E              RPSLDFP
Sbjct: 2106 SDS-ELEKGAREQPEKEAQSPSPPHPIPMGSPTLWPETEAHVSPPLDSHLGPARPSLDFP 2164

Query: 1195 QEAKEPETAEESAPDSTEFTEALRSPPAACAGEMGASPGLLIPEQPPPSRHDTGTP-KPS 1253
              A    + + + P      E  RS P       G     L P  P  +RHD       +
Sbjct: 2165 ASAFGFSSLQPAPPQLPSPAEP-RSAPCGSLAFSGDRALALAPGPPTRTRHDEYLEVTKA 2223

Query: 1254 GSLANTAPHGSSPTPGVGSLLGGPGGTQAPVSHNSKDPPARQPGEFLAPVANPSSTACPK 1313
             SL ++ P   SP+     LL       +P         A  P   ++ VA   S +   
Sbjct: 2224 PSLDSSLPQLPSPSSPGAPLLSNLPRPASPALSEGSSSEATTP--VISSVAERFSPSLEA 2281

Query: 1314 PSVLSSKISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSELFLGPKDLAGCFL------ 1367
                S ++   G +PA  +   L  P++   P       +     P D+    L      
Sbjct: 2282 AEQESGELDP-GMEPAAHSLWDL-TPLSPAPPASLDLALAPAPSLPGDMGDGILPCHLEC 2339

Query: 1368 -EELHPKPSARDAPPASSSCLCQDGEDAGSLEPQLPRSPPGTAETEPG-------RAASP 1419
             E    KPS    P  S  C      +     P  P   P  AE E         R A P
Sbjct: 2340 SEAATEKPSPFQVP--SEDCAANGPTET---SPNPPGPAPAKAENEEAAACPAWERGAWP 2394

Query: 1420 PTLESSS-----LFPDLPV----DRFDPPLYGSLSANRDSGLPFACADPPQKTVPSDPPY 1470
               E SS     L P+ PV        PP   S S   ++G P  CA  P+       P+
Sbjct: 2395 EGAERSSRPDTLLSPEQPVCPAGGSGGPP--SSASPEVEAG-PQGCATEPR-------PH 2444

Query: 1471 PSFLLLEEVSPMLPSHFPD 1489
               L    ++P LP    D
Sbjct: 2445 RGELSPSFLNPPLPPSIDD 2463



 Score = 40.8 bits (94), Expect = 0.027
 Identities = 207/951 (21%), Positives = 297/951 (31%), Gaps = 252/951 (26%)

Query: 1101 GPREDEPQK--PRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGAAARE 1158
            GP    P+   P   +   A  D   A  +E      G   SP  +   ++   G    E
Sbjct: 1862 GPPTPAPESHTPAPFSWGTAEYDSVVAAVQEGAAELEGGPYSPLGKDYRKA--EGEREEE 1919

Query: 1159 GGPKCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEAL- 1217
            G  +  D+ S + K    VP  +++   T P    P++ +     +E +    +  E + 
Sbjct: 1920 GRAEAPDKSSHSSK----VPEASKSHATTEPEQTEPEQREPTPYPDERSFQYADIYEQMM 1975

Query: 1218 ----------RSPPAACAGEM---------------GASPGLLIPEQPPPSRHDTGTPKP 1252
                      R PP   AG+                 A   L  P  P   + DT T   
Sbjct: 1976 LTGLGPACPTREPPLGAAGDWPPCLSTKEAAAGRNTSAEKELSSPISPKSLQSDTPTFSY 2035

Query: 1253 SGSLANTAPHGSSPTPGVGSLLGGPG-GTQAPVSHNSKDPPARQPGEFLAPVANPSSTAC 1311
            +     T P    P P +   L  P    +AP+      PP    G  L+   +  S   
Sbjct: 2036 AALAGPTVPPRPEPGPSMEPSLTPPAVPPRAPILSKGPSPPLN--GNILSCSPDRRS--- 2090

Query: 1312 PKPSVLSSKISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSELFLGPKDLAGCFLEELH 1371
              PS   S  S +    +    +       +K  Q  S PH      P          L 
Sbjct: 2091 --PSPKESGRSHWDDSTSDSELEKGAREQPEKEAQSPSPPHPIPMGSP---------TLW 2139

Query: 1372 PKPSARDAPPASSSCLCQDGEDAGSLEPQL--PRSPPGTAETEPGRAASPPTLESSSLFP 1429
            P+  A  +PP  S          G   P L  P S  G +  +P    +PP L S     
Sbjct: 2140 PETEAHVSPPLDS--------HLGPARPSLDFPASAFGFSSLQP----APPQLPS----- 2182

Query: 1430 DLPVDRFDPPLYGSLSANRDSGLPFACADPPQKTVPSDPPYPSFLLLEEVSPMLPSHFPD 1489
              P +    P  GSL+ + D  L  A   P +              L+   P LPS  P 
Sbjct: 2183 --PAEPRSAPC-GSLAFSGDRALALAPGPPTRTRHDEYLEVTKAPSLDSSLPQLPS--PS 2237

Query: 1490 LSGGKVLSKTCPPERTVVPGAAPSL-PGKGSGCSVALMSHLSEDELEIQKLVTELESQLQ 1548
              G  +LS    P       A+P+L  G  S  +  ++S ++E                 
Sbjct: 2238 SPGAPLLSNLPRP-------ASPALSEGSSSEATTPVISSVAE----------------- 2273

Query: 1549 RSKDTRGAPR-ELAEAESVGRVELGTGTEPPSQRRTCQATVPHEDTFSAADLTRVGESTA 1607
                 R +P  E AE ES    EL  G EP +               S  DLT +  S A
Sbjct: 2274 -----RFSPSLEAAEQES---GELDPGMEPAAH--------------SLWDLTPL--SPA 2309

Query: 1608 HREGAESAVATVEAVQGRPG-GTWPCPASFHPGHAALLPCAQEDLVSGAPFSPRGANFHF 1666
                 + A+A   ++ G  G G  PC           L C++      +PF     +   
Sbjct: 2310 PPASLDLALAPAPSLPGDMGDGILPCH----------LECSEAATEKPSPFQVPSED--- 2356

Query: 1667 QPVQKAGASKTGLCQAEGDSRPPQDVCLPEPSKQPGPQLDAGSLAKCSPDQELSFPKNKE 1726
                         C A G +    +   P P+K    +      A C   +  ++P+  E
Sbjct: 2357 -------------CAANGPTETSPNPPGPAPAKAENEE-----AAACPAWERGAWPEGAE 2398

Query: 1727 AASSQESEDSLRLLPCEQRGGFLP--------EPG-----TADQPHRGAPAPEAFGSPAV 1773
             +S  ++  S     C   G   P        E G     T  +PHRG  +P     P  
Sbjct: 2399 RSSRPDTLLSPEQPVCPAGGSGGPPSSASPEVEAGPQGCATEPRPHRGELSPSFLNPPLP 2458

Query: 1774 HLAPDLAFQ---------------------GDGAPPLDATWPFGASPSHAAQGHSAGRAG 1812
                D                         G   P  D T P  AS S ++Q  S     
Sbjct: 2459 PSIDDRDLSTEEVRLVGRGGRRRVGGPGTTGGPCPVTDETPPTSASDSGSSQSDS----- 2513

Query: 1813 GHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPACVSNTHPSRRSQDPALSP 1872
              + P          E  P+  +        +   +PV     VS TH  R   DP   P
Sbjct: 2514 -DVPPE--------TEECPSITAEAALDSDEDGDFLPVDKAGGVSGTHHPRPGHDP---P 2561

Query: 1873 PIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPR-----VNPSGL--EGGTV----EGGK 1921
            P+ Q   P P                    SPPR      +P GL  E G V    E  K
Sbjct: 2562 PLPQ---PDP------------------RPSPPRPDVCMADPEGLSSESGRVERLREKEK 2600

Query: 1922 VACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTANQ 1972
            V     + +PG  +    PA    +L L         G+   T G+G A++
Sbjct: 2601 VQGRVGRRAPGKAK----PASPARRLDLR--------GKRSPTPGKGPADR 2639



 Score = 38.5 bits (88), Expect = 0.13
 Identities = 60/276 (21%), Positives = 93/276 (33%), Gaps = 38/276 (13%)

Query: 2    PGERPRG-APPPTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTT-------KGAREAGG 53
            PGE   G A    ++ D    ++AS P  PS PP   +TP  ++        +  +EA  
Sbjct: 972  PGEPALGEAEERCLSPDDSTVKMASPP--PSGPPSATHTPFHQSPVEEKSEPQDFQEADS 1029

Query: 54   QAQAMELPEAQPRQARDGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAE 113
                   P      A +  +KP    G             + PP RSP         +A+
Sbjct: 1030 WGDTKRTPGVGKEDAAEETVKPGPEEGTLEKEE-------KVPPPRSP---------QAQ 1073

Query: 114  GSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPG----LPRT 169
             +P     + I    T  T+   P   +    ++ E   P GP  GA   PG    LP+ 
Sbjct: 1074 EAP-----VNIDEGLTGCTIQLLPAQDKAIVFEIMEAGEPTGPILGAEALPGGLRTLPQE 1128

Query: 170  EAQPAAEEL---GFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPE 226
              +P  +E+          E   S +  +  SP    + P P  P       L    +PE
Sbjct: 1129 PGKPQKDEVLRYPDRSLSPEDAESLSVLSVPSPDTANQEPTPKSPCGLTEQYLHKDRWPE 1188

Query: 227  YQASGADSWPPAAENSFPGANFGVPPAEPEPIPKGS 262
                   S   + E+     +  V   +  P   G+
Sbjct: 1189 VSPEDTQSLSLSEESPSKETSLDVSSKQLSPESLGT 1224



 Score = 37.7 bits (86), Expect = 0.23
 Identities = 184/849 (21%), Positives = 276/849 (32%), Gaps = 155/849 (18%)

Query: 1502 PERTVVPGAAPSLPGKGSGCSVALMSHLSEDELEIQKLVTELESQLQRSKD---TRGAPR 1558
            P  T + G  PS+PG G            E  ++ ++LV E+  + Q SKD     GA  
Sbjct: 568  PPSTAIQGTPPSVPGLGQ----------EEHVMKEKELVPEVPEE-QGSKDRGLDSGAET 616

Query: 1559 ELAEAESVGRVELGTGTEPPSQRRTCQATVPH--EDTFSAADLTRVGE---STAHREGAE 1613
            E  E ++    +       P +    + + P   ED    A+L  + E   S    E A 
Sbjct: 617  E-EEKDTWEEKKQREAERLPDRTEAREESEPEVKEDVIEKAELEEMEEVHPSDEEEEDAT 675

Query: 1614 SAVATVEAVQGRPGGTWPCPASFHPGHAALL----PCAQEDLVSGAPFSPRGANFHFQPV 1669
             A    +     P    P       G    L    P  +  L   +  +P GA  H   +
Sbjct: 676  KAEGFYQKHMQEPLKVTPRSREAFGGRELGLQGKAPEKETSLFLSSLTTPAGATEHVSYI 735

Query: 1670 QK---AGASKTGLC--------QAEGDSRPPQ------DVCLPE-----PSKQPGPQLDA 1707
            Q     G S+T           + E    PP+      D+  PE      + QP      
Sbjct: 736  QDETIPGYSETEQTISDEEIHDEPEERPAPPRFHTSTYDLPGPEGAGPFEASQPADSAVP 795

Query: 1708 GSLAKC--SPDQELSFPKNKEAASSQESE---DSLRLLPCEQRGGFLPEPGTADQPHRGA 1762
             +  K   +P+ EL++P N  AA   E E    +  +  C++   F             A
Sbjct: 796  ATSGKVYGTPETELTYPTNIVAAPLAEEEHVSSATSITECDKLSSF-------------A 842

Query: 1763 PAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPSHAAQGHSAGRAGGHLHPTAGRP 1822
             +     S A   AP     G  +  LD      +S + A QG     + G + PT+   
Sbjct: 843  TSVAEDQSVASLTAPQTEETGKSSLLLDTVTSIPSSRTEATQGLDYVPSAGTISPTSSLE 902

Query: 1823 GFEGNEFAPAGASSLTAP---------RGREAWLVPVPSPACVSNTHPSRR--SQ--DPA 1869
              +G +  P    S+T           +G              +N   S +  SQ   P 
Sbjct: 903  EDKGFKSPPCEDFSVTGESEKRGEIIGKGLSGERAVEEEEEETANVEMSEKLCSQYGTPV 962

Query: 1870 LSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNPSGLEGGTVEGGKVACGPAQG 1929
             S P   L    P + ++++  L   + T    SPP   PSG    T         P   
Sbjct: 963  FSAPGHALHPGEPALGEAEERCLSPDDSTVKMASPP---PSGPPSATHT-------PFHQ 1012

Query: 1930 SPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTAN-------------QLQPE 1976
            SP  V+  + P     Q   EAD  W   G  ++T G G  +              L+ E
Sbjct: 1013 SP--VEEKSEP-----QDFQEADS-W---GDTKRTPGVGKEDAAEETVKPGPEEGTLEKE 1061

Query: 1977 NGVSPGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPTPSPPSPNRE 2036
              V P  +        +    LTG T   + L   +       + E  EPT   P    E
Sbjct: 1062 EKVPPPRSPQAQEAPVNIDEGLTGCT---IQLLPAQDKAIVFEIMEAGEPT--GPILGAE 1116

Query: 2037 SLALALTAAHSRSGSEG-----RTPERASSPGLNKPLLATGDSPAPSVGDLAACAPSPTS 2091
            +L   L       G        R P+R+ SP             A S+  L+   PSP +
Sbjct: 1117 ALPGGLRTLPQEPGKPQKDEVLRYPDRSLSP-----------EDAESLSVLS--VPSPDT 1163

Query: 2092 AAHMPCSLGPLPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQLLACSPAWAPLEEAD 2151
            A   P    P    +      R                  P   Q L+ S      EE+ 
Sbjct: 1164 ANQEPTPKSPCGLTEQYLHKDRWP-------------EVSPEDTQSLSLS------EESP 1204

Query: 2152 GVQATTDTGAED-SPVAPPSLTTSPCDPKEALAGCLLQGEG-SPLEDPSSWPPGSVSAVT 2209
              + + D  ++  SP +  +L     +  +   G L+Q E  S    P S P    +  +
Sbjct: 1205 SKETSLDVSSKQLSPESLGTLQFGELNLGKEEMGHLMQAEDTSHHTAPMSVPEPHAATAS 1264

Query: 2210 CTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRATGLSSTPTGDEA 2269
                G T   +   I +DS   K   S    ++P   G   P           TP    +
Sbjct: 1265 PPTDGTTRYSAQTDITDDSLDRKSPASSFSHSTPSGNGKYLPGAITSPDEHILTPDSSFS 1324

Query: 2270 QAGRGLPGP 2278
            ++   LPGP
Sbjct: 1325 KSPESLPGP 1333



 Score = 35.4 bits (80), Expect = 1.1
 Identities = 57/238 (23%), Positives = 84/238 (35%), Gaps = 36/238 (15%)

Query: 36   EDNTPATRTTKGAREAGGQAQAMELPEAQPR---QARDGELKPPSLRGQAPSSTPGKRGS 92
            ED + A+ T     E G  +  ++   + P    +A  G    PS    +P+S+  +   
Sbjct: 847  EDQSVASLTAPQTEETGKSSLLLDTVTSIPSSRTEATQGLDYVPSAGTISPTSSLEEDKG 906

Query: 93   PQTPPGRS-PLQAPSRLAGRAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVD 151
             ++PP     +   S   G   G        G++  R     +E   N ++      +  
Sbjct: 907  FKSPPCEDFSVTGESEKRGEIIGK-------GLSGERAVEEEEEETANVEMSEKLCSQYG 959

Query: 152  TPQGPGTGAPLRPGLPRTEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPP 211
            TP     G  L PG P   A   AEE    RC     S+    +         PP  GPP
Sbjct: 960  TPVFSAPGHALHPGEP---ALGEAEE----RCLSPDDSTVKMAS---------PPPSGPP 1003

Query: 212  QSRGT----SPLQPGSYPEYQASGADSWPPAAENSFPGANFGVPPAEPEPIPKGSRPG 265
             +  T    SP++  S P+     ADSW        PG   G   A  E +  G   G
Sbjct: 1004 SATHTPFHQSPVEEKSEPQ-DFQEADSWGDTKRT--PGV--GKEDAAEETVKPGPEEG 1056


>gi|148762969 myeloid/lymphoid or mixed-lineage leukemia 2 [Homo
            sapiens]
          Length = 5537

 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 222/1002 (22%), Positives = 317/1002 (31%), Gaps = 198/1002 (19%)

Query: 2    PGERPRGAPPPTMTGDLQPRQVASSP------------GHPSQPPLEDN----------- 38
            P E P   PP        P ++ +SP              P  PP E++           
Sbjct: 453  PEESPTSPPPEASRLSPPPEELPASPLPEALHLSRPLEESPLSPPPEESPLSPPPESSPF 512

Query: 39   TPATRTTKGAREAGGQAQAMELPEAQPRQA-------RDGELKPPSLRGQAPSSTPGKRG 91
            +P   +     E    + A+E P + P +A        +  L PP    + P+S P +  
Sbjct: 513  SPLEESPLSPPEESPPSPALETPLSPPPEASPLSPPFEESPLSPPP--EELPTSPPPEAS 570

Query: 92   SPQTPPGRSPLQAPSRLAGRAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQL--PE 149
                PP  SP+  P   +  +      R       S   P  +E+P +P  EA++L  P 
Sbjct: 571  RLSPPPEESPMSPPPEESPMSPPPEASRLFPPFEESPLSPPPEESPLSPPPEASRLSPPP 630

Query: 150  VDTPQGPGTG-APLRPG--------LPR-TEAQPAAEELGFHRCFQEPPSSFT-STNYTS 198
             D+P  P    +P+ P         LP  +   P  EE       +E P+S     +  S
Sbjct: 631  EDSPMSPPPEESPMSPPPEVSRLSPLPVVSRLSPPPEESPLSPPPEESPTSPPPEASRLS 690

Query: 199  PSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPAAENSF----PGANFGVPPAE 254
            P     P +P PP+    SP    S        +   P   E        G +    P E
Sbjct: 691  PPPEDSPTSP-PPEDSPASPPPEDSLMSLPLEESPLLPLPEEPQLCPRSEGPHLSPRPEE 749

Query: 255  PEPIPKGSRPGGSPRG----VSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQ 310
            P   P+   P  SP+     +S Q   P L     +P  +  A      GP +    QP+
Sbjct: 750  PHLSPRPEEPHLSPQAEEPHLSPQPEEPCLCAVPEEPHLSPQA-----EGPHLSP--QPE 802

Query: 311  GAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSD 370
                          P+P +P  SP P    +   L+  S+       P  +H +P     
Sbjct: 803  ELHLSPQTEEPHLSPVPEEPCLSPQP----EESHLSPQSEEPCLSPRPEESHLSPE---- 854

Query: 371  SLHKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAP 430
             L K      PE+PP                     PGQ          P P +  L  P
Sbjct: 855  -LEKPPLSPRPEKPPEE-------------------PGQC---------PAPEELPLFPP 885

Query: 431  GPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPT 490
               P+  P L +P  +    PP  PL     +  +G+PS   +L  P   P P   ++  
Sbjct: 886  PGEPSLSPLLGEPALSEPGEPPLSPLPEELPLSPSGEPSLSPQLMPPDPLPPPLSPIITA 945

Query: 491  ARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTP----------GPREKLPAVRSS 540
            A  +P  +  L  L +P G                +TP           P    P +   
Sbjct: 946  A--APPALSPLGELEYPFGAKGDSDPESPLAAPILETPISPPPEANCTDPEPVPPMILPP 1003

Query: 541  QGGSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNT 600
              GSP            A P+      PQ SP    SL P     +  S   LP      
Sbjct: 1004 SPGSPV---------GPASPILMEPLPPQCSPLLQHSLVPQNSPPSQCSPPALPL----- 1049

Query: 601  AGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTH 660
              S  S LSP+          E         S    P   P  T SP PSP    S P  
Sbjct: 1050 --SVPSPLSPIGKVVGVSDEAELHEMETEKVSEPECPALEPSAT-SPLPSPMGDLSCPA- 1105

Query: 661  YQPEPAKAF---------PFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGFPRAPPP 711
              P PA A            P DG+ A G+       P P + P      L+G P    P
Sbjct: 1106 --PSPAPALDDFSGLGEDTAPLDGIDAPGS------QPEPGQTPGSLASELKGSPVLLDP 1157

Query: 712  YPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPP 771
                      A +  ++V   C+Q     S                       Q  P  P
Sbjct: 1158 E-------ELAPVTPMEVYPECKQTAGQGSPCE-------------------EQEEPRAP 1191

Query: 772  GLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLPASD 831
              P+PP    + +D     + +  + L  GDA A              L  +P P     
Sbjct: 1192 VAPTPPTL--IKSD-----IVNEISNLSQGDASASFPGS-------EPLLGSPDPEGGGS 1237

Query: 832  LDMEDDAKLDSLITEALNGMEYQSDN-PEIDSSFI----DVFADEEPSGPRGPSSGHPLK 886
            L ME     D         +   +D+ PE D S +       +  +  G +G     P +
Sbjct: 1238 LSMELGVSTDVSPARDEGSLRLCTDSLPETDDSLLCDAGTAISGGKAEGEKGRRRSSPAR 1297

Query: 887  SKAGVTPESKAPPPLPAATPDPQTPRPGDRGCPARGRPKTRS 928
            S+      S        + P  + PR G  G   RGR + +S
Sbjct: 1298 SRIKQGRSS--------SFPGRRRPRGGAHGGRGRGRARLKS 1331



 Score = 82.4 bits (202), Expect = 8e-15
 Identities = 238/1027 (23%), Positives = 338/1027 (32%), Gaps = 135/1027 (13%)

Query: 77   SLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRYI--------------- 121
            ++R  A   TP         PG +P   P  L    +G P   ++               
Sbjct: 357  TIRSVAEQHTPVCSRFSPPEPGDTPTDEPDALYVACQGQPKGGHVTSMQPKEPGPLQCEA 416

Query: 122  --LGIASSRTKPTL-----DETPENPQLEAAQL---PEVDTPQGPGTGAPLRPGLPRTEA 171
              LG A  + +P L     +E P  P  E + L   PE      P   + L P      A
Sbjct: 417  KPLGKAGVQLEPQLEAPLNEEMPLLPPPEESPLSPPPEESPTSPPPEASRLSPPPEELPA 476

Query: 172  QPAAEELGFHRCFQEPPSS---FTSTNYTSPSATP---------RPPAPGPPQSRGTSPL 219
             P  E L   R  +E P S     S     P ++P          PP   PP     +PL
Sbjct: 477  SPLPEALHLSRPLEESPLSPPPEESPLSPPPESSPFSPLEESPLSPPEESPPSPALETPL 536

Query: 220  QPGS-----YPEYQASGADSWPPAAE---NSFPGANFGVPPAEPEPI--PKGSRPGGSPR 269
             P        P ++ S     PP  E   +  P A+   PP E  P+  P    P   P 
Sbjct: 537  SPPPEASPLSPPFEESPLS--PPPEELPTSPPPEASRLSPPPEESPMSPPPEESPMSPPP 594

Query: 270  GVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQ 329
              S    FP    +   P P +      +  P       P    PE++  + P    P  
Sbjct: 595  EASRL--FPPFEESPLSPPPEE---SPLSPPPEASRLSPP----PEDSPMSPPPEESPMS 645

Query: 330  PAP-----SPLPCYQ-----GQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKI 379
            P P     SPLP         +   L+   + S     P A+  +P P  DS      + 
Sbjct: 646  PPPEVSRLSPLPVVSRLSPPPEESPLSPPPEESPTSPPPEASRLSPPP-EDSPTSPPPED 704

Query: 380  LPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGPPPARLPQ 439
             P  PP     +         LP    P    R+ G   SP P +  L+     P   PQ
Sbjct: 705  SPASPPPEDSLMSLPLEESPLLPLPEEPQLCPRSEGPHLSPRPEEPHLSPRPEEPHLSPQ 764

Query: 440  LWDPTAAPYP------TPPGGPLAATRSMFFNGQPSPGQRLCLPQS-----APLPWPQVL 488
              +P  +P P        P  P  + ++   +  P P +    PQ+     +P+P     
Sbjct: 765  AEEPHLSPQPEEPCLCAVPEEPHLSPQAEGPHLSPQPEELHLSPQTEEPHLSPVPEE--- 821

Query: 489  PTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTP--GPREKLPAVRSSQGGSP- 545
            P   P P    +  +   P   P      +  L    + P   PR + P     Q  +P 
Sbjct: 822  PCLSPQPEESHLSPQSEEPCLSPR---PEESHLSPELEKPPLSPRPEKPPEEPGQCPAPE 878

Query: 546  --ALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPP-PRVVGASPSESPLPSPATNTAG 602
               LF   G  +P   PL   + +P +S  G P L P P  +  SPS  P  SP      
Sbjct: 879  ELPLFPPPG--EPSLSPL---LGEPALSEPGEPPLSPLPEELPLSPSGEPSLSPQLMPPD 933

Query: 603  STCSSLSPMSSSPANPS-SEESQLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTHY 661
                 LSP+ ++ A P+ S   +L  P G      P +         P   PP +  T  
Sbjct: 934  PLPPPLSPIITAAAPPALSPLGELEYPFGAKGDSDPESPLAAPILETPISPPPEANCTDP 993

Query: 662  QPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLSS 721
            +P P    P P+ G     A   L E P P +   + +  L   P+  PP      +L  
Sbjct: 994  EPVPPMILP-PSPGSPVGPASPILME-PLPPQCSPLLQHSL--VPQNSPPSQCSPPALPL 1049

Query: 722  ASLDQLDVL--LTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAA 779
            +    L  +  +     +     +         C  L   A        G    P+P  A
Sbjct: 1050 SVPSPLSPIGKVVGVSDEAELHEMETEKVSEPECPALEPSATSPLPSPMGDLSCPAPSPA 1109

Query: 780  PRVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLPASDLDMEDDAK 839
            P +  D  +GL            A  +G D P   G  P    TP  L AS+L       
Sbjct: 1110 PAL--DDFSGLGEDT--------APLDGIDAP---GSQPEPGQTPGSL-ASEL-KGSPVL 1154

Query: 840  LDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKS----KAGVTPES 895
            LD      +  ME   +  +           EEP  P  P+    +KS    +     + 
Sbjct: 1155 LDPEELAPVTPMEVYPECKQTAGQGSPCEEQEEPRAPVAPTPPTLIKSDIVNEISNLSQG 1214

Query: 896  KAPPPLPAATPDPQTPRPGDRGCPARGRPKTRSLGLAPTEADAPSQGRQQRRGKQLKLFR 955
             A    P + P   +P       P  G   +  LG++   + A  +G  +     L    
Sbjct: 1215 DASASFPGSEPLLGSPD------PEGGGSLSMELGVSTDVSPARDEGSLRLCTDSLPETD 1268

Query: 956  KDL--DSGGAAEG---SGSGGGGRASGLRPRRNDGLGERPPPRPRRPRTQAPGSRADPAP 1010
              L  D+G A  G    G  G  R+S  R R   G     P R RRPR  A G R     
Sbjct: 1269 DSLLCDAGTAISGGKAEGEKGRRRSSPARSRIKQGRSSSFPGR-RRPRGGAHGGRGRGRA 1327

Query: 1011 RVPRAAA 1017
            R+   A+
Sbjct: 1328 RLKSTAS 1334



 Score = 72.8 bits (177), Expect = 6e-12
 Identities = 198/795 (24%), Positives = 259/795 (32%), Gaps = 152/795 (19%)

Query: 1    MPGERPRGAPPPTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQAMEL 60
            +P + P G  P      L+PR   + P +P  P      PA     GA    G  Q  E 
Sbjct: 2171 VPSQDPFGLAPAY---PLEPRFPTAPPTYPPYPS-PTGAPAQPPMLGASSRPGAGQPGEF 2226

Query: 61   PEAQPRQAR------DGELKP--PSLRGQAPSSTPGKRGSPQTPPGRSP---------LQ 103
                P   R      D  LKP  PSL   A   +PG  G   + P  SP         L+
Sbjct: 2227 HTTPPGTPRHQPSTPDPFLKPRCPSLDNLAVPESPGVGGGKASEPLLSPPPFGESRKALE 2286

Query: 104  APSRLAGRAEGS--PPQRYILGIASSRTK--------PTLDETPENPQLEAAQLPEVDTP 153
                  G +  S  PP    +   SS T         P + + P  P+    +      P
Sbjct: 2287 VKKEELGASSPSYGPPNLGFVDSPSSGTHLGGLELKTPDVFKAPLTPRASQVE------P 2340

Query: 154  QGPGTGAPLRPGLPRTEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGP--- 210
            Q PG G  LRP  P      A         F+  P S+T   Y  P  TPRP  P P   
Sbjct: 2341 QSPGLG--LRPQEPPPAQALAPSPPSHPDIFR--PGSYTDP-YAQPPLTPRPQPPPPESC 2395

Query: 211  ----PQSRGTSPLQ--PGSYPEYQASGADSWPP---AAENSFPGA---------NFGVPP 252
                P+S  + P    P S P+ Q+S      P   +AE   P            +  PP
Sbjct: 2396 CALPPRSLPSDPFSRVPAS-PQSQSSSQSPLTPRPLSAEAFCPSPVTPRFQSPDPYSRPP 2454

Query: 253  AEPE------PIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPADV-AGHA--------- 296
            + P+      P+ K  RP   P  V+F+    A        FPA + AG A         
Sbjct: 2455 SRPQSRDPFAPLHKPPRP--QPPEVAFKAGSLAHTSLGAGGFPAALPAGPAGELHAKVPS 2512

Query: 297  -----FTNGPLVFAF---HQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPGGLNRH 348
                 F   P   AF     P      +AVG     P   QP   P       P G+N H
Sbjct: 2513 GQPPNFVRSPGTGAFVGTPSPMRFTFPQAVGEPSLKPPVPQPGLPP-------PHGINSH 2565

Query: 349  SDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERPPSAQD-GLGSTRGPPSSLPQRHFP 407
                  L  P + +      + + H S + + P    + +  GL   R PPS LP     
Sbjct: 2566 FGPGPTLGKPQSTNYTVA--TGNFHPSGSPLGPSSGSTGESYGLSPLR-PPSVLPPPAPD 2622

Query: 408  GQA-YRASGVDTSPG--PPDTELAAPGP------PPARLPQLWDPTAAPYPTPP---GGP 455
            G   Y + G     G   P  +   PG         A LP   DP  +            
Sbjct: 2623 GSLPYLSHGASQRSGITSPVEKREDPGTGMGSSLATAELPGTQDPGMSGLSQTELEKQRQ 2682

Query: 456  LAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPT----ARPSPHGMEMLSRLPFPAGGP 511
                R +    Q          ++A      V P     A PS    E LSR   P  G 
Sbjct: 2683 RQRLRELLIRQQIQRNTLRQEKETAAAAAGAVGPPGSWGAEPSSPAFEQLSRGQTPFAGT 2742

Query: 512  EWQGGSQGALGT--AGKTPGP----------REKLPAVRSSQ--------GGSPALFTYN 551
            + +    G   +  +G   GP          R   PA  SS         GGS A   Y 
Sbjct: 2743 QDKSSLVGLPPSKLSGPILGPGSFPSDDRLSRPPPPATPSSMDVNSRQLVGGSQAF--YQ 2800

Query: 552  GMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPM 611
                PG+ PL     Q       T +      + A    +P P       GS  + +S  
Sbjct: 2801 RAPYPGSLPLQQQQQQLWQQQQATAATSMRFAMSARFPSTPGPELGRQALGSPLAGISTR 2860

Query: 612  SSSPANPSSEESQLPGPLGPSAFFHPPTHPQE----TGSPFPSPEPPHSLPTHY--QPEP 665
               P  P      +PGP GP+ F     + Q+     G+PFP   PP   P  Y    +P
Sbjct: 2861 LPGPGEP------VPGPAGPAQFIELRHNVQKGLGPGGTPFPGQGPPQR-PRFYPVSEDP 2913

Query: 666  AKAFPFPADGLGAEG 680
             +  P    GL   G
Sbjct: 2914 HRLAPEGLRGLAVSG 2928



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 206/922 (22%), Positives = 296/922 (32%), Gaps = 183/922 (19%)

Query: 420  PGPPDTELAAPGPPPARL-PQLWDPTAAPYPT---PPGGPLAATRSMFFNGQPSPGQRLC 475
            PGP   E    G    +L PQL  P     P    P   PL+          P    RL 
Sbjct: 409  PGPLQCEAKPLGKAGVQLEPQLEAPLNEEMPLLPPPEESPLSPPPEESPTSPPPEASRLS 468

Query: 476  LP--QSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTP-GPRE 532
             P  +    P P+ L  +RP    +E     P P   P              ++P  P E
Sbjct: 469  PPPEELPASPLPEALHLSRP----LEESPLSPPPEESPLSPPPESSPFSPLEESPLSPPE 524

Query: 533  KLPAVRSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQVSP--HGTPSLPPPRVVGASP-- 588
            + P        SPAL T      P A PL     +  +SP     P+ PPP     SP  
Sbjct: 525  ESPP-------SPALETPLS-PPPEASPLSPPFEESPLSPPPEELPTSPPPEASRLSPPP 576

Query: 589  SESPLPSPATNTAGSTCSSLS----PMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQET 644
             ESP+  P   +  S     S    P   SP +P  EES L  P   S    PP      
Sbjct: 577  EESPMSPPPEESPMSPPPEASRLFPPFEESPLSPPPEESPLSPPPEASRLSPPPEDS--- 633

Query: 645  GSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPF---PHEGP-----E 696
                P   PP   P    PE ++  P P     +       EE+P    P E P     E
Sbjct: 634  ----PMSPPPEESPMSPPPEVSRLSPLPVVSRLSPPP----EESPLSPPPEESPTSPPPE 685

Query: 697  VGRGGL--QGFPRAPPPY-----PTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAH 749
              R     +  P +PPP      P    SL S  L++  +L    +      S    L+ 
Sbjct: 686  ASRLSPPPEDSPTSPPPEDSPASPPPEDSLMSLPLEESPLLPLPEEPQLCPRSEGPHLSP 745

Query: 750  RQFCGLLLARAKDGH----QRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQA 805
            R     L  R ++ H       P     P  P    VP + H                QA
Sbjct: 746  RPEEPHLSPRPEEPHLSPQAEEPHLSPQPEEPCLCAVPEEPHLS-------------PQA 792

Query: 806  EGKDDPLRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFI 865
            EG          P L+  P  L  S     ++  L  +  E          +P+ + S +
Sbjct: 793  EG----------PHLSPQPEELHLSP--QTEEPHLSPVPEEPCL-------SPQPEESHL 833

Query: 866  DVFADEEPSGPRGPSSGH--PLKSKAGVTPESKAPPPLPAATPDPQT----PRPGDRGC- 918
               ++E    PR P   H  P   K  ++P  + PP  P   P P+     P PG+    
Sbjct: 834  SPQSEEPCLSPR-PEESHLSPELEKPPLSPRPEKPPEEPGQCPAPEELPLFPPPGEPSLS 892

Query: 919  PARGRPKTRSLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGL 978
            P  G P     G  P                 L    ++L    + E S S        L
Sbjct: 893  PLLGEPALSEPGEPP-----------------LSPLPEELPLSPSGEPSLSPQLMPPDPL 935

Query: 979  RPRRNDGLGERPPPR--PRRPRTQAPGSRADPAPRVPRAAAL-------PEETRSSRRRR 1029
             P  +  +    PP   P        G++ D  P  P AA +       P E   +    
Sbjct: 936  PPPLSPIITAAAPPALSPLGELEYPFGAKGDSDPESPLAAPILETPISPPPEANCTDPEP 995

Query: 1030 LPPRKDPRKRKARGGAWGKELILKIVQQKNRLREYDFASESEEDEQ----------PPPR 1079
            +PP   P    +  G     L+  +  Q + L ++    ++    Q          P P 
Sbjct: 996  VPPMILPPSPGSPVGPASPILMEPLPPQCSPLLQHSLVPQNSPPSQCSPPALPLSVPSPL 1055

Query: 1080 GPGFRGRRGRGEKRKEVELTQGPREDEPQKPRKAARQEA--------------------- 1118
             P   G+        E+   +  +  EP+ P       +                     
Sbjct: 1056 SP--IGKVVGVSDEAELHEMETEKVSEPECPALEPSATSPLPSPMGDLSCPAPSPAPALD 1113

Query: 1119 -----GGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGAAAREGGPKCADRPSVAPKD 1173
                 G D AP +  +  GS+P PG++P +          A+  +G P   D   +AP  
Sbjct: 1114 DFSGLGEDTAPLDGIDAPGSQPEPGQTPGSL---------ASELKGSPVLLDPEELAPVT 1164

Query: 1174 PLQV-PTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEALRSPPAACAGEMGASP 1232
            P++V P   +T+ +  P     +E +EP       P +   ++ +        G+  AS 
Sbjct: 1165 PMEVYPECKQTAGQGSPC----EEQEEPRAPVAPTPPTLIKSDIVNEISNLSQGDASAS- 1219

Query: 1233 GLLIPEQPPPSRHDTGTPKPSG 1254
                    P S    G+P P G
Sbjct: 1220 -------FPGSEPLLGSPDPEG 1234



 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 130/552 (23%), Positives = 189/552 (34%), Gaps = 80/552 (14%)

Query: 205  PPAPG-----PPQSRGTSPLQPGSYPEYQASGADSWPPAAENSFPGAN------FGVPPA 253
            PP PG     PP +  T  +   + P   ++ AD +      S PG +        +PP 
Sbjct: 2107 PPQPGALGSPPPAAAPTIFIGSPTTPAGLSTSADGFLKPPAGSVPGPDSPGELFLKLPPQ 2166

Query: 254  EPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAW 313
             P  +P    P G       +  FP     +  P+P+     A    P++ A  +P    
Sbjct: 2167 VPAQVPSQD-PFGLAPAYPLEPRFPTAP-PTYPPYPSPTGAPA--QPPMLGASSRPGAGQ 2222

Query: 314  PEEAVGTGPAYPL--PTQPAPSPLP-CYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSD 370
            P E   T P  P   P+ P P   P C       +     + G  +S      +P PF +
Sbjct: 2223 PGEFHTTPPGTPRHQPSTPDPFLKPRCPSLDNLAVPESPGVGGGKASEPLL--SPPPFGE 2280

Query: 371  S---LHKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTEL 427
            S   L     ++    P      LG    P S     H  G   +   V  +P  P    
Sbjct: 2281 SRKALEVKKEELGASSPSYGPPNLGFVDSPSSGT---HLGGLELKTPDVFKAPLTPRASQ 2337

Query: 428  AAPGPPPARL-PQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQ 486
              P  P   L PQ   P  A  P+PP  P       + +    P      P+  P P P+
Sbjct: 2338 VEPQSPGLGLRPQEPPPAQALAPSPPSHPDIFRPGSYTDPYAQPP---LTPRPQPPP-PE 2393

Query: 487  VLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKLPAVRSSQGGSPA 546
                  P     +  SR+P     P+ Q  SQ  L     TP P        S++   P+
Sbjct: 2394 SCCALPPRSLPSDPFSRVP---ASPQSQSSSQSPL-----TPRPL-------SAEAFCPS 2438

Query: 547  LFTYNGMT-DPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNTAGSTC 605
              T    + DP ++P     ++PQ      P   PPR     P    +   A + A ++ 
Sbjct: 2439 PVTPRFQSPDPYSRP----PSRPQSRDPFAPLHKPPR-----PQPPEVAFKAGSLAHTSL 2489

Query: 606  SSLSPMSSSPANPSSE-ESQLPGPLGPS--------AFFHPP-----THPQETGSPFPSP 651
             +    ++ PA P+ E  +++P    P+        AF   P     T PQ  G P   P
Sbjct: 2490 GAGGFPAALPAGPAGELHAKVPSGQPPNFVRSPGTGAFVGTPSPMRFTFPQAVGEPSLKP 2549

Query: 652  E-------PPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHE---GPEVGRGG 701
                    PPH + +H+ P P    P   +   A G F        P     G   G   
Sbjct: 2550 PVPQPGLPPPHGINSHFGPGPTLGKPQSTNYTVATGNFHPSGSPLGPSSGSTGESYGLSP 2609

Query: 702  LQGFPRAPPPYP 713
            L+     PPP P
Sbjct: 2610 LRPPSVLPPPAP 2621



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 157/627 (25%), Positives = 224/627 (35%), Gaps = 104/627 (16%)

Query: 1686 SRPPQDVCL-PEPSKQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRLLPCEQ 1744
            S PP++  L P P + P       S     P+   + P  +++ +S   EDSL  LP E+
Sbjct: 663  SPPPEESPLSPPPEESPTSPPPEASRLSPPPEDSPTSPPPEDSPASPPPEDSLMSLPLEE 722

Query: 1745 RGGFLPEP------GTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGAS 1798
                LP P        ++ PH      E   SP     P L+ Q +  P L        S
Sbjct: 723  -SPLLPLPEEPQLCPRSEGPHLSPRPEEPHLSPRPE-EPHLSPQAE-EPHL--------S 771

Query: 1799 PSHAAQGHSAGRAGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPACVS- 1857
            P        A     HL P A     EG   +P       +P+  E  L PVP   C+S 
Sbjct: 772  PQPEEPCLCAVPEEPHLSPQA-----EGPHLSPQPEELHLSPQTEEPHLSPVPEEPCLSP 826

Query: 1858 ---NTHPSRRSQDPALSPPIRQLQL----------PGPGVAKSKDGILGLQELTPAAQSP 1904
                +H S +S++P LSP   +  L          P P     + G     E  P    P
Sbjct: 827  QPEESHLSPQSEEPCLSPRPEESHLSPELEKPPLSPRPEKPPEEPGQCPAPEELPLFPPP 886

Query: 1905 --PRVNPSGLEGGTVEGGKVACGPAQG----SPGG--------VQVTTLPAVAGHQLGLE 1950
              P ++P   E    E G+    P       SP G        +    LP      +   
Sbjct: 887  GEPSLSPLLGEPALSEPGEPPLSPLPEELPLSPSGEPSLSPQLMPPDPLPPPLSPIITAA 946

Query: 1951 ADGHWGLLGQAEKTQG-QGTANQLQP------ENGVSPGGTDNHASVNASPKTALTGPTE 2003
            A      LG+ E   G +G ++   P      E  +SP    N       P   L  P+ 
Sbjct: 947  APPALSPLGELEYPFGAKGDSDPESPLAAPILETPISPPPEANCTDPEPVPPMILP-PSP 1005

Query: 2004 GA-------VLLEKCKGSRAAMSLQEEAEPTPSPPSP-NRESLALALTAAHSRSGS---- 2051
            G+       +L+E     + +  LQ    P  SPPS  +  +L L++ +  S  G     
Sbjct: 1006 GSPVGPASPILMEPLP-PQCSPLLQHSLVPQNSPPSQCSPPALPLSVPSPLSPIGKVVGV 1064

Query: 2052 ------EGRTPERASSPGLNKPLLATGDSPAPS-VGDLAACAPSPTSAAHMPCSLG---- 2100
                       E+ S P     L  +  SP PS +GDL+  APSP  A      LG    
Sbjct: 1065 SDEAELHEMETEKVSEPEC-PALEPSATSPLPSPMGDLSCPAPSPAPALDDFSGLGEDTA 1123

Query: 2101 PLPREDPLTS---PSRAQGGLGGQLPASPSCRDPPGPQQLLACSP--AWAPLEEADGVQA 2155
            PL   D   S   P +  G L  +L  SP   D   P++L   +P   +   ++  G  +
Sbjct: 1124 PLDGIDAPGSQPEPGQTPGSLASELKGSPVLLD---PEELAPVTPMEVYPECKQTAGQGS 1180

Query: 2156 TTDTGAED-SPVAPPSLTTSPCDPKEALAGCLLQGEGS-------PL---EDPSSWPPGS 2204
              +   E  +PVAP   T    D    ++  L QG+ S       PL    DP      S
Sbjct: 1181 PCEEQEEPRAPVAPTPPTLIKSDIVNEISN-LSQGDASASFPGSEPLLGSPDPEGGGSLS 1239

Query: 2205 VSAVTCTHSGDTPKDSTLRIPEDSRKE 2231
            +     T       + +LR+  DS  E
Sbjct: 1240 MELGVSTDVSPARDEGSLRLCTDSLPE 1266



 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 148/654 (22%), Positives = 207/654 (31%), Gaps = 111/654 (16%)

Query: 895  SKAPPPLPAATPDPQTPRPGDRGCPARGRPKTRSLGLAPTEADAPSQGRQQRRGKQLKLF 954
            S+  PP P  TP   T  P       +G+PK   +     +   P Q   +  GK     
Sbjct: 370  SRFSPPEPGDTP---TDEPDALYVACQGQPKGGHVTSMQPKEPGPLQCEAKPLGKAGVQL 426

Query: 955  RKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPPRPRRPRTQAPGSRADPAPRVPR 1014
               L++    E            L P     L   P   P  P  +A  SR  P P    
Sbjct: 427  EPQLEAPLNEE---------MPLLPPPEESPLSPPPEESPTSPPPEA--SRLSPPPEELP 475

Query: 1015 AAALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRLREYDFASESEEDE 1074
            A+ LPE    SR     P   P           +E  L    + +     + +  S  +E
Sbjct: 476  ASPLPEALHLSRPLEESPLSPP----------PEESPLSPPPESSPFSPLEESPLSPPEE 525

Query: 1075 QPPPRGPGFRGRRGRGEKRKEVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSR 1134
             PP                 E  L+  P       P + +      +  P +P  P  SR
Sbjct: 526  SPP-------------SPALETPLSPPPEASPLSPPFEESPLSPPPEELPTSP-PPEASR 571

Query: 1135 --PGPGRSPQARGPSRS-LETGAAAREGGPKCADRPSVAPKDPLQVPTNTETSEETRPSL 1191
              P P  SP +  P  S +     A    P   + P   P +   +    E S  + P  
Sbjct: 572  LSPPPEESPMSPPPEESPMSPPPEASRLFPPFEESPLSPPPEESPLSPPPEASRLSPPPE 631

Query: 1192 DFPQEAKEPETAEESAPDSTEFTEALRSPPAACAGEMGASPGLLIPEQPPPSRHDTGTPK 1251
            D P  +  PE +  S P      E  R  P      +   P    P  PPP    T +P 
Sbjct: 632  DSPM-SPPPEESPMSPP-----PEVSRLSPLPVVSRLSPPPE-ESPLSPPPEESPT-SPP 683

Query: 1252 PSGSLANTAPHGSSPTPGVGSLLGGPGGTQAPVSHNSKDPP-----------ARQPGEFL 1300
            P  S  +  P  S  +P        P    + +S   ++ P            R  G  L
Sbjct: 684  PEASRLSPPPEDSPTSPPPEDSPASPPPEDSLMSLPLEESPLLPLPEEPQLCPRSEGPHL 743

Query: 1301 AP-VANPSSTACPKPSVLSSKISSFGCDPAGFNRDPLGVP----VAKKGPQPYSSPH-SE 1354
            +P    P  +  P+   LS +       P         VP    ++ +   P+ SP   E
Sbjct: 744  SPRPEEPHLSPRPEEPHLSPQAEEPHLSPQPEEPCLCAVPEEPHLSPQAEGPHLSPQPEE 803

Query: 1355 LFLGPKDLAGCFLEELH-----------PKPSARDAPPASSSCLCQDGEDAGSLEPQLPR 1403
            L L P+       EE H           P+P      P S         +   L P+L +
Sbjct: 804  LHLSPQ------TEEPHLSPVPEEPCLSPQPEESHLSPQSEEPCLSPRPEESHLSPELEK 857

Query: 1404 SP----PGTAETEPGRAASPPTLESSSLFPDLPVDRFDPPLYGSLSANRDSGLPFACADP 1459
             P    P     EPG+  +P   E   LFP        PP   SLS              
Sbjct: 858  PPLSPRPEKPPEEPGQCPAP---EELPLFP--------PPGEPSLS---------PLLGE 897

Query: 1460 PQKTVPSDPPYPSFLLLEEVSPMLPSHFPDLSGGKVLSKTCPPERT-VVPGAAP 1512
            P  + P +PP      L E  P+ PS  P LS   +     PP  + ++  AAP
Sbjct: 898  PALSEPGEPPLSP---LPEELPLSPSGEPSLSPQLMPPDPLPPPLSPIITAAAP 948



 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 240/1033 (23%), Positives = 324/1033 (31%), Gaps = 224/1033 (21%)

Query: 1372 PKPSARDAPPASSSCLCQDGEDAGSLEPQLPRSPPGTAETEPGRAASPPTLESSSLFPDL 1431
            P+P A  +PP +++     G          P +P G + +  G    P     S   PD 
Sbjct: 2108 PQPGALGSPPPAAAPTIFIGS---------PTTPAGLSTSADGFLKPPA---GSVPGPDS 2155

Query: 1432 PVDRFD--PPLYGSLSANRDSGLPFACA-----DPPQKTVPSD-PPYPSFLLLEEVSPML 1483
            P + F   PP   +   ++D   PF  A     +P   T P   PPYPS        PML
Sbjct: 2156 PGELFLKLPPQVPAQVPSQD---PFGLAPAYPLEPRFPTAPPTYPPYPSPTGAPAQPPML 2212

Query: 1484 ----------PSHFPDLSGGKVLSKTCPPERTVVPG-------AAPSLPGKGSGCSVALM 1526
                      P  F     G    +   P+  + P        A P  PG G G      
Sbjct: 2213 GASSRPGAGQPGEFHTTPPGTPRHQPSTPDPFLKPRCPSLDNLAVPESPGVGGG------ 2266

Query: 1527 SHLSEDELEIQKLVTELESQLQRSKDTRGAPRELAEAESVGRVELGTGTEPPSQRRTCQA 1586
               + + L       E    L+  K+  GA      + S G   LG    P S       
Sbjct: 2267 --KASEPLLSPPPFGESRKALEVKKEELGA-----SSPSYGPPNLGFVDSPSSGTHLGGL 2319

Query: 1587 TVPHEDTFSAADLTRVGESTAHREGAESAVATVEAVQGRPGGTWPCPASFHPGHAALLPC 1646
             +   D F A    R  +      G           Q         P  F PG       
Sbjct: 2320 ELKTPDVFKAPLTPRASQVEPQSPGLGLRPQEPPPAQALAPSPPSHPDIFRPG------- 2372

Query: 1647 AQEDLVSGAPFSPRGANFHFQPVQKAGASKTGLCQAEGDSRPPQDVCLPEPSKQPGPQLD 1706
            +  D  +  P +PR      QP                   PP+  C   P   P     
Sbjct: 2373 SYTDPYAQPPLTPRP-----QPP------------------PPESCCALPPRSLPS---- 2405

Query: 1707 AGSLAKCSPDQELSFPKNKEAASSQESEDSLRLLPCEQRGGFLPEPGTADQPHRGAPAPE 1766
                     D     P + ++ SS +S  + R L  E    F P P T   P   +P P 
Sbjct: 2406 ---------DPFSRVPASPQSQSSSQSPLTPRPLSAE---AFCPSPVT---PRFQSPDP- 2449

Query: 1767 AFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPSHAAQGHSAGRAGGHLHPTAGRPGFEG 1826
             +  P     P      D   PL         P        A +AG   H + G  GF  
Sbjct: 2450 -YSRP-----PSRPQSRDPFAPLH-------KPPRPQPPEVAFKAGSLAHTSLGAGGFPA 2496

Query: 1827 NEFA-PAGASSLTAPRGREAWLVPVPSP-ACVSNTHPSRRS-----QDPALSPPIRQLQL 1879
               A PAG      P G+    V  P   A V    P R +      +P+L PP+ Q  L
Sbjct: 2497 ALPAGPAGELHAKVPSGQPPNFVRSPGTGAFVGTPSPMRFTFPQAVGEPSLKPPVPQPGL 2556

Query: 1880 PGPGVAKSKDG---ILGLQELTPAAQSPPRVNPSGLEGGTVEGGK-VACGPAQGSPGGVQ 1935
            P P    S  G    LG  + T    +    +PSG   G   G    + G +   P  V 
Sbjct: 2557 PPPHGINSHFGPGPTLGKPQSTNYTVATGNFHPSGSPLGPSSGSTGESYGLSPLRPPSVL 2616

Query: 1936 VTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTANQLQPENGVSPGGTDNHASVNASPK 1995
                P  +   L   A    G+    EK +  GT           PG  D        P 
Sbjct: 2617 PPPAPDGSLPYLSHGASQRSGITSPVEKREDPGTGMGSSLATAELPGTQD--------PG 2668

Query: 1996 TALTGPTEGAVLLEKCKGSRAAMSLQEEAEPTPSPPSPNRESLALALTAAHSRSGSEGRT 2055
             +    TE    LEK +  +    L    +   +     +E+ A A   A    GS G  
Sbjct: 2669 MSGLSQTE----LEKQRQRQRLRELLIRQQIQRNTLRQEKET-AAAAAGAVGPPGSWGAE 2723

Query: 2056 PERASSPGLNKPLLATGDSPAPSVGDLAACAPSPTSAAHMPCSLGP--LPREDPLTSPSR 2113
            P   SSP   +  L+ G +P     D ++    P S    P  LGP   P +D L+ P  
Sbjct: 2724 P---SSPAFEQ--LSRGQTPFAGTQDKSSLVGLPPSKLSGPI-LGPGSFPSDDRLSRPPP 2777

Query: 2114 AQGGLGGQLPASPSCRDPPGPQQLLACS---------PAWAPLEEA-----DGVQATTDT 2159
                     PA+PS  D    +QL+  S         P   PL++         QAT  T
Sbjct: 2778 ---------PATPSSMD-VNSRQLVGGSQAFYQRAPYPGSLPLQQQQQQLWQQQQATAAT 2827

Query: 2160 GAEDSPVAPPSLTTSPCDPKEALAGCL------LQGEGSPLEDPSSWPPGSVSAVTCTHS 2213
                +  A    T  P   ++AL   L      L G G P+  P+    G    +   H+
Sbjct: 2828 SMRFAMSARFPSTPGPELGRQALGSPLAGISTRLPGPGEPVPGPA----GPAQFIELRHN 2883

Query: 2214 -------GDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRATGLSSTPTG 2266
                   G TP       P+  R   + E P R                        P G
Sbjct: 2884 VQKGLGPGGTPFPGQ-GPPQRPRFYPVSEDPHRL----------------------APEG 2920

Query: 2267 DEAQAGRGLPGPDPQSRGAP---------PHTNPDRMPRGHSSYS-PSNTARLGHREGQA 2316
                A  GLP   P +  AP         PHT    +P G    + P ++  LG     A
Sbjct: 2921 LRGLAVSGLPPQKPSAPPAPELNNSLHPTPHTKGPTLPTGLELVNRPPSSTELGRPNPLA 2980

Query: 2317 VTA--VPTEPPTL 2327
            + A  +P E P L
Sbjct: 2981 LEAGKLPCEDPEL 2993



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 201/909 (22%), Positives = 288/909 (31%), Gaps = 150/909 (16%)

Query: 602  GSTCSSLSPMSSSP----ANPSSE-----ESQLPGPLGPSAFFHPPTHPQETGSPFPSPE 652
            G   +S+ P    P    A P  +     E QL  PL       PP  P+E+    P   
Sbjct: 398  GGHVTSMQPKEPGPLQCEAKPLGKAGVQLEPQLEAPLNEEMPLLPP--PEES----PLSP 451

Query: 653  PPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCL------EETPFPHEGPEVGRGGLQGFP 706
            PP   PT   PE ++  P P + L A    + L      EE+P      E         P
Sbjct: 452  PPEESPTSPPPEASRLSP-PPEELPASPLPEALHLSRPLEESPLSPPPEES--------P 502

Query: 707  RAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQR 766
             +PPP  +    L  + L   +        +   S               L+   +    
Sbjct: 503  LSPPPESSPFSPLEESPLSPPEESPPSPALETPLSPPPEASP--------LSPPFEESPL 554

Query: 767  SPGPPGLPS--PPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATP 824
            SP P  LP+  PP A R+        +S           ++     P  +   P    +P
Sbjct: 555  SPPPEELPTSPPPEASRLSPPPEESPMSPPPE-------ESPMSPPPEASRLFPPFEESP 607

Query: 825  FPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEP-SGPRGPSSGH 883
               P  +  +    +   L             +P  + S +    +E P S P   S   
Sbjct: 608  LSPPPEESPLSPPPEASRL-------------SPPPEDSPMSPPPEESPMSPPPEVSRLS 654

Query: 884  PLKSKAGVTPESKAPPPLPAATPDPQTPRPGDRGCPARGRPKTRSLGLAPTEADAPSQGR 943
            PL   + ++P  +  P  P     P +P P      +R  P       +P   D+P+   
Sbjct: 655  PLPVVSRLSPPPEESPLSPPPEESPTSPPPE----ASRLSPPPEDSPTSPPPEDSPASPP 710

Query: 944  QQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPPRPRRPRT--QA 1001
             +     L L    L      E            L PR  +       PRP  P    QA
Sbjct: 711  PEDSLMSLPLEESPLLP--LPEEPQLCPRSEGPHLSPRPEE---PHLSPRPEEPHLSPQA 765

Query: 1002 PGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRL 1061
                  P P  P   A+PEE   S +    P   P+  +       +E  L  V ++  L
Sbjct: 766  EEPHLSPQPEEPCLCAVPEEPHLSPQAE-GPHLSPQPEELHLSPQTEEPHLSPVPEEPCL 824

Query: 1062 REYDFASESEEDEQPPPRGPGFRGRRGRGEKRKEVELTQGPREDEPQKPRKAARQEAGGD 1121
                  S      + P   P         E     EL + P    P+KP +   Q     
Sbjct: 825  SPQPEESHLSPQSEEPCLSPRPE------ESHLSPELEKPPLSPRPEKPPEEPGQ----- 873

Query: 1122 GAPANPEEPGGSRPG-PGRSPQARGPSRSL----------ETGAAAREGGPKCADRPSVA 1170
              PA  E P    PG P  SP    P+ S           E    +  G P  +  P + 
Sbjct: 874  -CPAPEELPLFPPPGEPSLSPLLGEPALSEPGEPPLSPLPEELPLSPSGEPSLS--PQLM 930

Query: 1171 PKDPLQVPTNTETSEETRPSLDFPQEAKEPETAE-ESAPDSTEFTEALRSPPAACAGEMG 1229
            P DPL  P +   +    P+L    E + P  A+ +S P+S                   
Sbjct: 931  PPDPLPPPLSPIITAAAPPALSPLGELEYPFGAKGDSDPESPL----------------- 973

Query: 1230 ASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSLLGGPGGTQAPVSHNSK 1289
            A+P L  P  PPP  + T  P+P        P    P+P      G P G  +P+     
Sbjct: 974  AAPILETPISPPPEANCT-DPEP------VPPMILPPSP------GSPVGPASPILMEPL 1020

Query: 1290 DPPARQP--GEFLAPVANPSSTACPK--PSVLSSKISSFG-----CDPAGFNRDPLGVPV 1340
             PP   P     L P  +P S   P   P  + S +S  G      D A  +        
Sbjct: 1021 -PPQCSPLLQHSLVPQNSPPSQCSPPALPLSVPSPLSPIGKVVGVSDEAELHEMETEKVS 1079

Query: 1341 AKKGPQPYSSPHSELFLGPKDLAGCFLEELHPKPSARDAPPASSSCLCQDGEDAGSLEPQ 1400
              + P    S  S L   P  +         P P+  D           DG DA   +P+
Sbjct: 1080 EPECPALEPSATSPL---PSPMGDLSCPAPSPAPALDDFSGLGEDTAPLDGIDAPGSQPE 1136

Query: 1401 LPRSPPGTAETEPGRAASPPTLESSSLFPDLPVDRFDPPLYGSLSANRDSGLPFACADPP 1460
             P   PG+  +E     SP  L+   L P  P++     +Y         G P    + P
Sbjct: 1137 -PGQTPGSLASE--LKGSPVLLDPEELAPVTPME-----VYPECKQTAGQGSPCEEQEEP 1188

Query: 1461 QKTVPSDPP 1469
            +  V   PP
Sbjct: 1189 RAPVAPTPP 1197



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 118/509 (23%), Positives = 167/509 (32%), Gaps = 68/509 (13%)

Query: 2026 PTPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAPSVGDLAAC 2085
            P  SP SP  E+  L      S    E        +  L++PL  +  SP P    L+  
Sbjct: 453  PEESPTSPPPEASRL------SPPPEELPASPLPEALHLSRPLEESPLSPPPEESPLS-- 504

Query: 2086 APSPTSAAHMPCSLGPLPREDPLTSPSRAQGGLGGQLPASP----SCRDPPGPQQLLACS 2141
             P P S+   P        E PL+ P  +      + P SP    S   PP  +  L+  
Sbjct: 505  -PPPESSPFSPLE------ESPLSPPEESPPSPALETPLSPPPEASPLSPPFEESPLSPP 557

Query: 2142 PAWAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCDPKEALAGCLLQGEGSPLEDPSSWP 2201
            P   P          +    E+SP++PP    SP  P    +      E SPL  P    
Sbjct: 558  PEELPTSPPPEASRLSPP-PEESPMSPPP-EESPMSPPPEASRLFPPFEESPLSPPPEES 615

Query: 2202 PGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVSP--SVAVRATG 2259
            P S      +     P+DS +  P +           R +  P+   +SP    +  +  
Sbjct: 616  PLSPPP-EASRLSPPPEDSPMSPPPEESPMSPPPEVSRLSPLPVVSRLSPPPEESPLSPP 674

Query: 2260 LSSTPTGDEAQAGRGLPGPDPQSRGAPPHTNPDRMPRGHSSYS-----------PSNTAR 2308
               +PT    +A R  P P+      PP  +P   P   S  S           P     
Sbjct: 675  PEESPTSPPPEASRLSPPPEDSPTSPPPEDSPASPPPEDSLMSLPLEESPLLPLPEEPQL 734

Query: 2309 LGHREGQAVTAVPTEPPTLQGAGPDSP-ACLEGEMGTSSKEPEDP---GTPETGR-SGAT 2363
                EG  ++  P EP       P+ P    + E    S +PE+P     PE    S   
Sbjct: 735  CPRSEGPHLSPRPEEPHL--SPRPEEPHLSPQAEEPHLSPQPEEPCLCAVPEEPHLSPQA 792

Query: 2364 KMPRVTCPSTGLGLGRTT-------APSSTASDFQSD----SPQSHRNASHQTPQGDPLG 2412
            + P ++     L L   T        P       Q +    SPQS        P+   L 
Sbjct: 793  EGPHLSPQPEELHLSPQTEEPHLSPVPEEPCLSPQPEESHLSPQSEEPCLSPRPEESHLS 852

Query: 2413 PQDLKQRSRGYKKKPASTENGQWKG--QAPHGPVTCEVCAASFRSGPGLSRHKARKHRPH 2470
            P+  K       +KP   E GQ     + P  P   E   +     P LS          
Sbjct: 853  PELEKPPLSPRPEKPPE-EPGQCPAPEELPLFPPPGEPSLSPLLGEPALSE--------- 902

Query: 2471 PGAPAEPSPAALPAQQPLEPLAQKCQPPR 2499
               P EP  + LP + PL P  +    P+
Sbjct: 903  ---PGEPPLSPLPEELPLSPSGEPSLSPQ 928



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 137/577 (23%), Positives = 181/577 (31%), Gaps = 119/577 (20%)

Query: 1107 PQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQAR---GPSRSLETGAAAREGGPKC 1163
            PQ P +   Q+  G  APA P EP      P   P       P++    GA++R G  + 
Sbjct: 2165 PQVPAQVPSQDPFGL-APAYPLEPRFPTAPPTYPPYPSPTGAPAQPPMLGASSRPGAGQP 2223

Query: 1164 ADRPSVAPKDPLQVPTNTETSEETR-PSLDFPQEAKEPETAEESAPDSTEFTEALRSPPA 1222
             +  +  P  P   P+  +   + R PSLD     + P      A      +E L SPP 
Sbjct: 2224 GEFHTTPPGTPRHQPSTPDPFLKPRCPSLDNLAVPESPGVGGGKA------SEPLLSPPP 2277

Query: 1223 ACAG---------EMGAS------PGLLIPEQPPPSRHDTGTP--KPSGSLANTAPHGSS 1265
                         E+GAS      P L   + P    H  G     P    A   P  S 
Sbjct: 2278 FGESRKALEVKKEELGASSPSYGPPNLGFVDSPSSGTHLGGLELKTPDVFKAPLTPRASQ 2337

Query: 1266 ---PTPGVGSLLGGPGGTQAPVSHNSKDPPARQPGEFLAPVANPSSTACPKPSVLSSKIS 1322
                +PG+G     P   QA        P   +PG +  P A P  T  P+P       S
Sbjct: 2338 VEPQSPGLGLRPQEPPPAQALAPSPPSHPDIFRPGSYTDPYAQPPLTPRPQP---PPPES 2394

Query: 1323 SFGCDPAGFNRDPLG-VPVAKKGPQPYSSPHSELFLGPKDLAGCFLEELHP--------- 1372
                 P     DP   VP +   PQ  SS  S L   P          + P         
Sbjct: 2395 CCALPPRSLPSDPFSRVPAS---PQSQSSSQSPLTPRPLSAEAFCPSPVTPRFQSPDPYS 2451

Query: 1373 ----KPSARD------APPA--------SSSCLCQDGEDAGSLEPQLPRSP--------- 1405
                +P +RD       PP          +  L      AG     LP  P         
Sbjct: 2452 RPPSRPQSRDPFAPLHKPPRPQPPEVAFKAGSLAHTSLGAGGFPAALPAGPAGELHAKVP 2511

Query: 1406 ----------PGT----AETEPGRAASPPTLESSSLFPDLPVDRFDPPLYGSLSANRDSG 1451
                      PGT        P R   P  +   SL P +P     PP    ++++   G
Sbjct: 2512 SGQPPNFVRSPGTGAFVGTPSPMRFTFPQAVGEPSLKPPVPQPGLPPP--HGINSHFGPG 2569

Query: 1452 LPFACADPPQKTVPSDPPYPSFLLLEE----------VSPM-----LPSHFPDLSGGKVL 1496
                       TV +   +PS   L            +SP+     LP   PD S   + 
Sbjct: 2570 PTLGKPQSTNYTVATGNFHPSGSPLGPSSGSTGESYGLSPLRPPSVLPPPAPDGSLPYLS 2629

Query: 1497 SKTCPPERTVVPGAAPSLPGKGSGCSVAL----------MSHLSEDELEIQKLVTELESQ 1546
                       P      PG G G S+A           MS LS+ ELE Q+    L   
Sbjct: 2630 HGASQRSGITSPVEKREDPGTGMGSSLATAELPGTQDPGMSGLSQTELEKQRQRQRLREL 2689

Query: 1547 LQRSKDTRGAPRELAEAESVGRVELGT----GTEPPS 1579
            L R +  R   R+  E  +     +G     G EP S
Sbjct: 2690 LIRQQIQRNTLRQEKETAAAAAGAVGPPGSWGAEPSS 2726



 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 143/595 (24%), Positives = 191/595 (32%), Gaps = 154/595 (25%)

Query: 768  PGPPGLPSPPAAPRV---PADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATP 824
            PG  G P P AAP +        AGL + A  FL        G D P    FL      P
Sbjct: 2110 PGALGSPPPAAAPTIFIGSPTTPAGLSTSADGFLKPPAGSVPGPDSPGEL-FLKLPPQVP 2168

Query: 825  FPLPASD-LDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGH 883
              +P+ D   +     L                               EP  P  P +  
Sbjct: 2169 AQVPSQDPFGLAPAYPL-------------------------------EPRFPTAPPTYP 2197

Query: 884  PLKSKAGVTPESKAPPPLPAATPDPQTPRPGDRGCPARG-------------RPKTRSL- 929
            P  S  G    + A PP+  A+  P   +PG+      G             +P+  SL 
Sbjct: 2198 PYPSPTG----APAQPPMLGASSRPGAGQPGEFHTTPPGTPRHQPSTPDPFLKPRCPSLD 2253

Query: 930  GLAPTEADAPSQGRQQR----------RGKQLKLFRKDLDSGGAAEG-----------SG 968
             LA  E+     G+               K L++ +++L +   + G           SG
Sbjct: 2254 NLAVPESPGVGGGKASEPLLSPPPFGESRKALEVKKEELGASSPSYGPPNLGFVDSPSSG 2313

Query: 969  SGGGG---------------RASGLRPRRNDGLGERP----------PPRPRRPRTQAPG 1003
            +  GG               RAS + P+ + GLG RP          P  P  P    PG
Sbjct: 2314 THLGGLELKTPDVFKAPLTPRASQVEPQ-SPGLGLRPQEPPPAQALAPSPPSHPDIFRPG 2372

Query: 1004 SRADP---APRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNR 1060
            S  DP    P  PR    P E+  +    LPPR  P    +R  A  +        Q + 
Sbjct: 2373 SYTDPYAQPPLTPRPQPPPPESCCA----LPPRSLPSDPFSRVPASPQ-------SQSSS 2421

Query: 1061 LREYDFASESEEDEQPPPRGPGFRG--RRGRGEKRKE-----VELTQGPREDEPQKPRKA 1113
                     S E   P P  P F+      R   R +       L + PR   P+   KA
Sbjct: 2422 QSPLTPRPLSAEAFCPSPVTPRFQSPDPYSRPPSRPQSRDPFAPLHKPPRPQPPEVAFKA 2481

Query: 1114 ---ARQEAGGDGAPA----------NPEEPGGSRPGPGRSPQARGPSRSLETGAAAREGG 1160
               A    G  G PA          + + P G  P   RSP   G    + T +  R   
Sbjct: 2482 GSLAHTSLGAGGFPAALPAGPAGELHAKVPSGQPPNFVRSP---GTGAFVGTPSPMRFTF 2538

Query: 1161 PKCADRPSVAPKDP---LQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEAL 1217
            P+    PS+ P  P   L  P    +     P+L  PQ            P         
Sbjct: 2539 PQAVGEPSLKPPVPQPGLPPPHGINSHFGPGPTLGKPQSTNYTVATGNFHPSG------- 2591

Query: 1218 RSPPAACAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGS 1272
             SP    +G  G S G L P +PP        P P GSL   + HG+S   G+ S
Sbjct: 2592 -SPLGPSSGSTGESYG-LSPLRPPSV---LPPPAPDGSLPYLS-HGASQRSGITS 2640



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 170/678 (25%), Positives = 228/678 (33%), Gaps = 154/678 (22%)

Query: 21   RQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQAMELPEAQPRQARDGELKP----P 76
            R+V ++   P     +DN  A R  K  ++A  Q           +Q + G++      P
Sbjct: 2050 RKVPAADKAPYLQKAKDNRAAHRINKVQKQAESQIN---------KQTKVGDIARKTDRP 2100

Query: 77   SLRGQAPSSTPGKRGSPQTPPGRSPL------QAPSRLAGRAEG--SPPQRYILGIASSR 128
            +L  + P   PG  GSP  PP  +P         P+ L+  A+G   PP   + G   S 
Sbjct: 2101 ALHLRIPPQ-PGALGSP--PPAAAPTIFIGSPTTPAGLSTSADGFLKPPAGSVPG-PDSP 2156

Query: 129  TKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAEELGFHRCFQEPP 188
             +  L   P+ P    AQ+P  D P G     PL P  P                   PP
Sbjct: 2157 GELFLKLPPQVP----AQVPSQD-PFGLAPAYPLEPRFPTA-----------------PP 2194

Query: 189  SSFTSTNYTSPSATP-RPPAPGPPQSRGTSPLQPGSY-------PEYQASGADSWP---- 236
               T   Y SP+  P +PP  G     G    QPG +       P +Q S  D +     
Sbjct: 2195 ---TYPPYPSPTGAPAQPPMLGASSRPGAG--QPGEFHTTPPGTPRHQPSTPDPFLKPRC 2249

Query: 237  PAAEN----SFPGANFGV---PPAEPEPIPKG-------------SRPGGSPRGVSF-QF 275
            P+ +N      PG   G    P   P P  +              S P   P  + F   
Sbjct: 2250 PSLDNLAVPESPGVGGGKASEPLLSPPPFGESRKALEVKKEELGASSPSYGPPNLGFVDS 2309

Query: 276  PFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQP-APSP 334
            P    H    +    DV        PL     Q +   P   +G  P  P P Q  APSP
Sbjct: 2310 PSSGTHLGGLELKTPDVF-----KAPLTPRASQVEPQSP--GLGLRPQEPPPAQALAPSP 2362

Query: 335  LPCYQGQPGGLNRHSDL--SGALSSPGAAHS-APRPFSDSLHKSLTKILPERPPSAQDGL 391
                         H D+   G+ + P A     PRP      +S   + P   PS  D  
Sbjct: 2363 -----------PSHPDIFRPGSYTDPYAQPPLTPRP-QPPPPESCCALPPRSLPS--DPF 2408

Query: 392  GSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGP---PPARLPQLWDPTAA-- 446
                  P S      P      S     P P      +P P   PP+R PQ  DP A   
Sbjct: 2409 SRVPASPQSQSSSQSPLTPRPLSAEAFCPSPVTPRFQSPDPYSRPPSR-PQSRDPFAPLH 2467

Query: 447  --PYPTPP-----GGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPTARP-----S 494
              P P PP      G LA T S+   G P+      LP          +P+ +P     S
Sbjct: 2468 KPPRPQPPEVAFKAGSLAHT-SLGAGGFPA-----ALPAGPAGELHAKVPSGQPPNFVRS 2521

Query: 495  PHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKLP---AVRSSQGGSPALFTYN 551
            P G       P P      Q   + +L    K P P+  LP    + S  G  P L    
Sbjct: 2522 P-GTGAFVGTPSPMRFTFPQAVGEPSL----KPPVPQPGLPPPHGINSHFGPGPTLGK-- 2574

Query: 552  GMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPM 611
                   Q   + VA     P G+P  P     G S   SPL  P+     +   SL  +
Sbjct: 2575 ------PQSTNYTVATGNFHPSGSPLGPSSGSTGESYGLSPLRPPSVLPPPAPDGSLPYL 2628

Query: 612  SSSPANPSSEESQLPGPL 629
            S    + +S+ S +  P+
Sbjct: 2629 S----HGASQRSGITSPV 2642



 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 225/941 (23%), Positives = 290/941 (30%), Gaps = 209/941 (22%)

Query: 1688 PPQDVCLPEPSKQPGPQLDAGSLA-----KCSPDQELSFPKNKEAASSQESEDSLRLLPC 1742
            PPQ   L  P     P +  GS         S D  L  P           E  L+L P 
Sbjct: 2107 PPQPGALGSPPPAAAPTIFIGSPTTPAGLSTSADGFLKPPAGSVPGPDSPGELFLKLPP- 2165

Query: 1743 EQRGGFLPEPGTADQPHRGAPAPEAFG-SPAVHLAPDLAFQGDGAPPLDATWPFGASPSH 1801
                          Q     P+ + FG +PA  L P        APP   T+P   SP+ 
Sbjct: 2166 --------------QVPAQVPSQDPFGLAPAYPLEPRFPT----APP---TYPPYPSPTG 2204

Query: 1802 AAQGHSAGRAGGHLHPTAGRPGFEGNEF--APAGASSLTAPRGREAWLVPVPSPACVSNT 1859
            A         G    P AG+PG    EF   P G      PR + +   P   P C S  
Sbjct: 2205 APA--QPPMLGASSRPGAGQPG----EFHTTPPGT-----PRHQPSTPDPFLKPRCPSLD 2253

Query: 1860 HPSRRSQDPALSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNPS--GLEGGTV 1917
            +         L+ P    + PG G  K+ + +L          SPP    S   LE    
Sbjct: 2254 N---------LAVP----ESPGVGGGKASEPLL----------SPPPFGESRKALEVKKE 2290

Query: 1918 EGGKVACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTANQLQPEN 1977
            E G  A  P+ G P  +     P+   H  GLE            K      A+Q++P+ 
Sbjct: 2291 ELG--ASSPSYGPPN-LGFVDSPSSGTHLGGLELK-----TPDVFKAPLTPRASQVEPQ- 2341

Query: 1978 GVSPGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPTPSPPSPNRES 2037
              SPG          +   A + P+   +      GS      Q    P P PP P    
Sbjct: 2342 --SPGLGLRPQEPPPAQALAPSPPSHPDIFRP---GSYTDPYAQPPLTPRPQPPPPES-- 2394

Query: 2038 LALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAPSVGDLAACAPSPTSAAHMPC 2097
               AL      S    R P    S   ++  L    +P P   +  A  PSP +    P 
Sbjct: 2395 -CCALPPRSLPSDPFSRVPASPQSQSSSQSPL----TPRPLSAE--AFCPSPVT----PR 2443

Query: 2098 SLGPLPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQLLACSPAWAPLEEA--DGVQA 2155
               P    DP + P           P+ P  RDP  P   L   P   P E A   G  A
Sbjct: 2444 FQSP----DPYSRP-----------PSRPQSRDPFAP---LHKPPRPQPPEVAFKAGSLA 2485

Query: 2156 TTDTGAEDSPVAPPSLTTSPCDPKEALAGCLLQGEGSPLEDPSSWPPGSVSAVTCTHSGD 2215
             T  GA   P A P+        K                 PS  PP  V +        
Sbjct: 2486 HTSLGAGGFPAALPAGPAGELHAKV----------------PSGQPPNFVRSPGTGAFVG 2529

Query: 2216 TPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRATGLSSTPTGDEAQAGRGL 2275
            TP                  SP R T P   G  S    V   GL   P G  +  G G 
Sbjct: 2530 TP------------------SPMRFTFPQAVGEPSLKPPVPQPGLPP-PHGINSHFGPGP 2570

Query: 2276 PGPDPQSRG---APPHTNPDRMPRGHSSYSPSNTARLGHREGQAVTAVPTEPPTL----- 2327
                PQS     A  + +P   P G SS S   +  L      +V   P    +L     
Sbjct: 2571 TLGKPQSTNYTVATGNFHPSGSPLGPSSGSTGESYGLSPLRPPSVLPPPAPDGSLPYLSH 2630

Query: 2328 ---QGAGPDSPACLEGE----MGTSSKEPEDPGTPETGRSGATKMPRVTCPSTGLGLGRT 2380
               Q +G  SP     +    MG+S    E PGT + G SG ++                
Sbjct: 2631 GASQRSGITSPVEKREDPGTGMGSSLATAELPGTQDPGMSGLSQTELEKQRQRQRLRELL 2690

Query: 2381 TAPSSTASDFQSDSPQSHRNASHQTPQG----DPLGPQDLKQRSRGYKKKPASTENGQWK 2436
                   +  + +   +   A    P G    +P  P   +Q SRG      + +     
Sbjct: 2691 IRQQIQRNTLRQEKETAAAAAGAVGPPGSWGAEPSSPA-FEQLSRGQTPFAGTQDKSSLV 2749

Query: 2437 GQAPH---GPVTCEVCAASFRSGPGLSRHKARKHRPHPGAPAEPS--------------- 2478
            G  P    GP+           GPG      R  RP P  PA PS               
Sbjct: 2750 GLPPSKLSGPIL----------GPGSFPSDDRLSRPPP--PATPSSMDVNSRQLVGGSQA 2797

Query: 2479 -------PAALPAQQPLEPLAQKCQPPRKKSHRVSGKER-PNHSRGDPSHVTQPPPAQGS 2530
                   P +LP QQ  + L Q+ Q     S R +   R P+    +        P  G 
Sbjct: 2798 FYQRAPYPGSLPLQQQQQQLWQQQQATAATSMRFAMSARFPSTPGPELGRQALGSPLAGI 2857

Query: 2531 KEVLRAPGSPHSQQLHPPSPTEHEVDVKT---PASKPRPDQ 2568
               L  PG P      P    E   +V+    P   P P Q
Sbjct: 2858 STRLPGPGEPVPGPAGPAQFIELRHNVQKGLGPGGTPFPGQ 2898



 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 116/500 (23%), Positives = 176/500 (35%), Gaps = 100/500 (20%)

Query: 845  TEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAGVTPESKAPPP---L 901
            T  L G E  + +P + S      A E PS       G PL    G TPES A  P    
Sbjct: 4018 TLLLTGKEQNTVDPAVSSE-----ATEGPS----THQGGPLA--IGTTPESMATEPGEVK 4066

Query: 902  PAATPDPQT----PRPGDRGCPARGRPKTRSLGLAPTEADAPSQGRQQRRGKQLKLFRKD 957
            P+ + D Q     P+P         +P+  SL L P        G+QQ++   L      
Sbjct: 4067 PSLSGDSQLLLVQPQP---------QPQPSSLQLQPP---LRLPGQQQQQVSLLHT---- 4110

Query: 958  LDSGGAAEGS-GSGGGGRASG---LRPRRNDGLGERPPPR------PRRPRTQAPGSRAD 1007
              +GG + G  GSG    AS    L  + +  LG++P         P++P  + P  + +
Sbjct: 4111 --AGGGSHGQLGSGSSSEASSVPHLLAQPSVSLGDQPGSMTQNLLGPQQPMLERP-MQNN 4167

Query: 1008 PAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGG-AWGKELILKIVQQKNRLREYDF 1066
              P+ P+   + +  +      + P     + + +G  A   +L     QQ+ +L+    
Sbjct: 4168 TGPQPPKPGPVLQSGQGLPGVGIMPTVGQLRAQLQGVLAKNPQLRHLSPQQQQQLQALLM 4227

Query: 1067 ASESEEDEQ----PPPRGPGFRGRRGRGEKRKEVELTQGPREDEPQKPRKAARQEAGGDG 1122
              + ++ +     PP + PG            +    QG    +PQ          G  G
Sbjct: 4228 QRQLQQSQAVRQTPPYQEPG-----------TQTSPLQGLLGCQPQL--------GGFPG 4268

Query: 1123 APANPEEPGGSRPGPGRSPQARGPSRSLETGAAAREGGPKCADRPSVAPKDPLQVPTNTE 1182
                P +  G+ P P   P+   P  +L TG       P         PK P Q+P+   
Sbjct: 4269 PQTGPLQELGAGPRPQGPPRLPAPPGALSTGPVLGPVHPTPPPSSPQEPKRPSQLPS--- 4325

Query: 1183 TSEETRPSLDFPQEAKEPET---AEESAPDSTEFTEALRSPPAACAGEMGASPGLLIPEQ 1239
                  PS   P EA+ P T     +    + E      SP AA   +   S GL     
Sbjct: 4326 ------PSSQLPTEAQLPPTHPGTPKPQGPTLEPPPGRVSPAAAQLADTLFSKGL----- 4374

Query: 1240 PPPSRHDTGTPKPSGSLANT-APHGSSPTPGVGSLLGG---PGGTQAPVSHNSKDPPARQ 1295
                    G   P  +LA T  P  SS  PG    + G   P  +Q  +    ++ P   
Sbjct: 4375 --------GPWDPPDNLAETQKPEQSSLVPGHLDQVNGQVVPEASQLSIKQEPREEPCAL 4426

Query: 1296 PGEFLAPVANPSSTACPKPS 1315
              + +   AN      P  S
Sbjct: 4427 GAQSVKREANGEPIGAPGTS 4446



 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 104/412 (25%), Positives = 148/412 (35%), Gaps = 52/412 (12%)

Query: 327  PTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERPPS 386
            P Q     +    G P    +H    GAL   G          +++  +++    E P +
Sbjct: 3987 PQQQQQQQVALGPGMPAKPLQHFSSPGAL---GPTLLLTGKEQNTVDPAVSSEATEGPST 4043

Query: 387  AQDG---LGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGPPPARLPQLWDP 443
             Q G   +G+T    ++ P    P  +  +  +   P P     +    PP RLP     
Sbjct: 4044 HQGGPLAIGTTPESMATEPGEVKPSLSGDSQLLLVQPQPQPQPSSLQLQPPLRLPGQQQQ 4103

Query: 444  TAAPYPTPPGGP-----------------LAATRSMFFNGQP-SPGQRLCLPQSAPLPWP 485
              +   T  GG                  L A  S+    QP S  Q L  PQ   L  P
Sbjct: 4104 QVSLLHTAGGGSHGQLGSGSSSEASSVPHLLAQPSVSLGDQPGSMTQNLLGPQQPMLERP 4163

Query: 486  QVLPTA-RPSPHGMEMLSRLPFPAGG-----PEWQGGSQGALGTAGK----TPGPREKLP 535
                T  +P   G  + S    P  G      + +   QG L    +    +P  +++L 
Sbjct: 4164 MQNNTGPQPPKPGPVLQSGQGLPGVGIMPTVGQLRAQLQGVLAKNPQLRHLSPQQQQQLQ 4223

Query: 536  AVRSSQG--GSPALFTYNGMTDPGAQ--PL--FFGVAQPQVSPHGTPSLPPPRVVGASPS 589
            A+   +    S A+       +PG Q  PL    G  QPQ+     P   P + +GA P 
Sbjct: 4224 ALLMQRQLQQSQAVRQTPPYQEPGTQTSPLQGLLG-CQPQLGGFPGPQTGPLQELGAGPR 4282

Query: 590  -ESPLPSPATNTAGSTCSSLSPMSSSPANPSSEE----SQLPGPLG--PSAFFHPPTHPQ 642
             + P   PA   A ST   L P+  +P   S +E    SQLP P    P+    PPTHP 
Sbjct: 4283 PQGPPRLPAPPGALSTGPVLGPVHPTPPPSSPQEPKRPSQLPSPSSQLPTEAQLPPTHPG 4342

Query: 643  ETGSPFPSPEPPHSLPTHYQPEPAK-AFPFPADGLGAEGAFQCLEETPFPHE 693
                  P+ EPP   P    P  A+ A    + GLG       L ET  P +
Sbjct: 4343 TPKPQGPTLEPP---PGRVSPAAAQLADTLFSKGLGPWDPPDNLAETQKPEQ 4391



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 107/448 (23%), Positives = 141/448 (31%), Gaps = 60/448 (13%)

Query: 2471 PGAPAEPSPAALPAQQPLEP-LAQKCQPPRKKSHRVSGKERPNHSRGDPSHVTQPPPAQG 2529
            P +P E SP + P + P  P L     PP + S      E    S       T PPP   
Sbjct: 511  PFSPLEESPLSPPEESPPSPALETPLSPPPEASPLSPPFEESPLSPPPEELPTSPPP--- 567

Query: 2530 SKEVLRAPGSPHSQQLHPPSPTEHEVDVKTPASKPRPDQAREDELHPKQAEKR-----EG 2584
              E  R    P    + PP P E  +     AS+  P    E  L P   E       E 
Sbjct: 568  --EASRLSPPPEESPMSPP-PEESPMSPPPEASRLFPP-FEESPLSPPPEESPLSPPPEA 623

Query: 2585 RRWRREPTVDSPSHSEGKSNKKRGKLRGRRLREESILPVSADVISDGRGSRPSPAMASYA 2644
             R    P  DSP     + +         RL   S LPV + +      S  SP      
Sbjct: 624  SRLSPPPE-DSPMSPPPEESPMSPPPEVSRL---SPLPVVSRLSPPPEESPLSPPPEESP 679

Query: 2645 ASPSHCLSVEGGPEADG--EQPPRLATLGPGVMEGAAETDQEALCAGETGAQKPPGDRML 2702
             SP    S    P  D     PP  +   P       E    +L   E+     P +  L
Sbjct: 680  TSPPPEASRLSPPPEDSPTSPPPEDSPASP-----PPEDSLMSLPLEESPLLPLPEEPQL 734

Query: 2703 CPGRMDGAALGEQPT-------------GQKGASARGFWGPRETKALGVCKESGSEPAED 2749
            CP R +G  L  +P                +         P E     V +E    P  +
Sbjct: 735  CP-RSEGPHLSPRPEEPHLSPRPEEPHLSPQAEEPHLSPQPEEPCLCAVPEEPHLSPQAE 793

Query: 2750 SSRAHSRSEEGVWEENT--PPLGPLGF-PETSSSPADSTTSS-----CLQGLPD----NP 2797
                  + EE      T  P L P+   P  S  P +S  S      CL   P+    +P
Sbjct: 794  GPHLSPQPEELHLSPQTEEPHLSPVPEEPCLSPQPEESHLSPQSEEPCLSPRPEESHLSP 853

Query: 2798 DTQGGVQGPEGPTPDASGSSAKDPPSLFDDEVSFSQLFPPGGR--LTRKRNPHVYGKRCE 2855
            + +     P    P         P  L         LFPP G   L+         +  E
Sbjct: 854  ELEKPPLSPRPEKPPEEPGQCPAPEEL--------PLFPPPGEPSLSPLLGEPALSEPGE 905

Query: 2856 KPVLPLPTQPSFEEGGDPTLGPARLPTD 2883
             P+ PLP +      G+P+L P  +P D
Sbjct: 906  PPLSPLPEELPLSPSGEPSLSPQLMPPD 933



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 74/305 (24%), Positives = 110/305 (36%), Gaps = 39/305 (12%)

Query: 3636 TFHKGSATKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSL---APGELARGTENGMK 3692
            T   GS T PAG  +S+        P+ ++  P  P +    L    P ++      G+ 
Sbjct: 2123 TIFIGSPTTPAGLSTSAD--GFLKPPAGSVPGPDSPGELFLKLPPQVPAQVPSQDPFGLA 2180

Query: 3693 PATPKAKPGPSSQGSGSPRPGTKTGGGSQP-------QPASGQLQSETATTPAKPSFPSR 3745
            PA P     P++  +  P P + TG  +QP       +P +GQ      T P  P     
Sbjct: 2181 PAYPLEPRFPTAPPTYPPYP-SPTGAPAQPPMLGASSRPGAGQPGEFHTTPPGTPRHQPS 2239

Query: 3746 SPAPERLPARAQAKSCT--KGPREAGEQGPHGSLGPKEKGES----STKRKKGQVPGPAR 3799
            +P P   P      +    + P   G +     L P   GES      K+++     P+ 
Sbjct: 2240 TPDPFLKPRCPSLDNLAVPESPGVGGGKASEPLLSPPPFGESRKALEVKKEELGASSPSY 2299

Query: 3800 SESVGSFGRAPSA-----------PD--KPPRTPR----KQATPSRVLPTKPKPNSQNKP 3842
                  F  +PS+           PD  K P TPR    +  +P   L  +  P +Q   
Sbjct: 2300 GPPNLGFVDSPSSGTHLGGLELKTPDVFKAPLTPRASQVEPQSPGLGLRPQEPPPAQALA 2359

Query: 3843 RPPPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPPKRGTAVHGAE-PAEPHTHRTAEAQS 3901
              PPS      PG     D   +     RP   PP+   A+     P++P +   A  QS
Sbjct: 2360 PSPPSHPDIFRPG--SYTDPYAQPPLTPRPQPPPPESCCALPPRSLPSDPFSRVPASPQS 2417

Query: 3902 DLLSQ 3906
               SQ
Sbjct: 2418 QSSSQ 2422



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 66/253 (26%), Positives = 94/253 (37%), Gaps = 31/253 (12%)

Query: 3547 LERPENEAS---PGSPGPLLQ--QALPLGASLPRPGARGQDAEGKRAPLVFSGKRRAPGA 3601
            LERP    +   P  PGP+LQ  Q LP    +P  G      +G  A        + P  
Sbjct: 4160 LERPMQNNTGPQPPKPGPVLQSGQGLPGVGIMPTVGQLRAQLQGVLA--------KNPQL 4211

Query: 3602 RGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPA----GCQSSSKDRSA 3657
            R   +P   Q+   L  ++++  S  V +  P      G+ T P     GCQ        
Sbjct: 4212 R-HLSPQQQQQLQALLMQRQLQQSQAVRQTPPYQ--EPGTQTSPLQGLLGCQPQLGGFPG 4268

Query: 3658 AST-PSKALKFPVHPRKAVGSLAP-GELARGTENG-MKPATPKAKPGPSSQGSGSPRPGT 3714
              T P + L     P+      AP G L+ G   G + P  P + P    + S  P P +
Sbjct: 4269 PQTGPLQELGAGPRPQGPPRLPAPPGALSTGPVLGPVHPTPPPSSPQEPKRPSQLPSPSS 4328

Query: 3715 KTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQGPH 3774
            +        P   QL      TP KP  P+  P P R+   A   + T   +  G   P 
Sbjct: 4329 QL-------PTEAQLPPTHPGTP-KPQGPTLEPPPGRVSPAAAQLADTLFSKGLGPWDPP 4380

Query: 3775 GSLGPKEKGESST 3787
             +L   +K E S+
Sbjct: 4381 DNLAETQKPEQSS 4393



 Score = 42.7 bits (99), Expect = 0.007
 Identities = 71/265 (26%), Positives = 93/265 (35%), Gaps = 31/265 (11%)

Query: 1217 LRSPPAACAGEMGASPGLLIPEQPPPSRHDTGTP------KPSGSLANTAPHGSSPTPGV 1270
            L+ PP   A      P  L P  P   R  T  P       P+G+ A     G+S  PG 
Sbjct: 2161 LKLPPQVPAQVPSQDPFGLAPAYPLEPRFPTAPPTYPPYPSPTGAPAQPPMLGASSRPGA 2220

Query: 1271 GSLLGGPGGTQAPVSHNSKDPPARQPGEFLAP-VANPSSTACPK-PSVLSSKISSFGCDP 1328
            G     PG          +  P+  P  FL P   +  + A P+ P V   K S     P
Sbjct: 2221 GQ----PGEFHTTPPGTPRHQPST-PDPFLKPRCPSLDNLAVPESPGVGGGKASEPLLSP 2275

Query: 1329 AGFNRDPLGVPVAKKGPQPYSSPHSELFLGPKDL--AGCFLEELHPK-PSARDAPPASSS 1385
              F      + V K+     S  +    LG  D   +G  L  L  K P    AP    +
Sbjct: 2276 PPFGESRKALEVKKEELGASSPSYGPPNLGFVDSPSSGTHLGGLELKTPDVFKAPLTPRA 2335

Query: 1386 CLCQDGEDAGSLEPQLPRSPPGTAETEPGRAASPPTLESSSLFPDL--PVDRFDPPLYGS 1443
               +       L PQ P  PP  A      A SPP+       PD+  P    DP     
Sbjct: 2336 SQVEPQSPGLGLRPQEP--PPAQA-----LAPSPPS------HPDIFRPGSYTDPYAQPP 2382

Query: 1444 LSANRDSGLPFACADPPQKTVPSDP 1468
            L+       P +C   P +++PSDP
Sbjct: 2383 LTPRPQPPPPESCCALPPRSLPSDP 2407



 Score = 42.4 bits (98), Expect = 0.009
 Identities = 116/486 (23%), Positives = 148/486 (30%), Gaps = 78/486 (16%)

Query: 3455 APGPGED--RPPPRGS--SPILSE---GSLPALLHLCSEVAPSTTKGWPETLERPVDPVT 3507
            +P P E    PPP  S  SP   E     LP  LHL   +  S     PE       P +
Sbjct: 450  SPPPEESPTSPPPEASRLSPPPEELPASPLPEALHLSRPLEESPLSPPPEESPLSPPPES 509

Query: 3508 HPIRGCELPSNHQECPPPSLSPFPAALADGRGDCALDGALERPENEASPGSP----GPLL 3563
             P      P       PP  SP   AL               P  EASP SP     PL 
Sbjct: 510  SPFS----PLEESPLSPPEESPPSPALETPLS----------PPPEASPLSPPFEESPLS 555

Query: 3564 QQALPLGASLPRPGAR--GQDAEGKRAPLVFSGKRRAPGARGRCAPDHFQEDHL------ 3615
                 L  S P   +R      E   +P         P    R  P  F+E  L      
Sbjct: 556  PPPEELPTSPPPEASRLSPPPEESPMSPPPEESPMSPPPEASRLFPP-FEESPLSPPPEE 614

Query: 3616 --LQKEKEVSSSHMVSEGGPRGTFHKGSATKP------------AGCQSSSKDRSAASTP 3661
              L    E S      E  P     + S   P                S   + S  S P
Sbjct: 615  SPLSPPPEASRLSPPPEDSPMSPPPEESPMSPPPEVSRLSPLPVVSRLSPPPEESPLSPP 674

Query: 3662 SKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTKTGGGSQ 3721
             +  + P  P      L+P      +     P    A P P       P   +       
Sbjct: 675  PE--ESPTSPPPEASRLSPPP--EDSPTSPPPEDSPASPPPEDSLMSLPLEESPL----L 726

Query: 3722 PQPASGQL--QSETATTPAKPSFPSRSPAPER--LPARAQAKSCTKGPRE----AGEQGP 3773
            P P   QL  +SE      +P  P  SP PE   L  +A+    +  P E    A  + P
Sbjct: 727  PLPEEPQLCPRSEGPHLSPRPEEPHLSPRPEEPHLSPQAEEPHLSPQPEEPCLCAVPEEP 786

Query: 3774 HGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQATPSRVLPT- 3832
            H  L P+ +G   + + +     P   E        P  P   P+      +P    P  
Sbjct: 787  H--LSPQAEGPHLSPQPEELHLSPQTEEP--HLSPVPEEPCLSPQPEESHLSPQSEEPCL 842

Query: 3833 KPKPNS-------QNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPPKRGTAVHG 3885
             P+P         +  P  P  E+   EPG     + L    P G P L P     A+  
Sbjct: 843  SPRPEESHLSPELEKPPLSPRPEKPPEEPGQCPAPEELPLFPPPGEPSLSPLLGEPAL-- 900

Query: 3886 AEPAEP 3891
            +EP EP
Sbjct: 901  SEPGEP 906



 Score = 42.4 bits (98), Expect = 0.009
 Identities = 60/214 (28%), Positives = 78/214 (36%), Gaps = 28/214 (13%)

Query: 3693 PATPKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSET--ATTPAKPSFPSRSP-AP 3749
            PA+P+++   SSQ   +PRP   +     P P + + QS    +  P++P   SR P AP
Sbjct: 2412 PASPQSQS--SSQSPLTPRP--LSAEAFCPSPVTPRFQSPDPYSRPPSRPQ--SRDPFAP 2465

Query: 3750 ERLPARAQA-----KSCTKGPREAGEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVG 3804
               P R Q      K+ +      G  G   +L     GE   K   GQ P   RS   G
Sbjct: 2466 LHKPPRPQPPEVAFKAGSLAHTSLGAGGFPAALPAGPAGELHAKVPSGQPPNFVRSPGTG 2525

Query: 3805 SFGRAPSA-----PDKPPRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHTQR 3859
            +F   PS      P        K   P   LP     NS   P P        +P  T  
Sbjct: 2526 AFVGTPSPMRFTFPQAVGEPSLKPPVPQPGLPPPHGINSHFGPGP-----TLGKPQSTNY 2580

Query: 3860 KDRLGKAFPQGRPLLRPPKRGTA--VHGAEPAEP 3891
                G   P G PL   P  G+    +G  P  P
Sbjct: 2581 TVATGNFHPSGSPL--GPSSGSTGESYGLSPLRP 2612



 Score = 40.8 bits (94), Expect = 0.027
 Identities = 163/808 (20%), Positives = 279/808 (34%), Gaps = 185/808 (22%)

Query: 1055 VQQKNRLREYDFASESEEDEQPPPRGPGFRGRRGRGEKRKEVELTQGPREDEPQK----- 1109
            +QQ+ +L++     + ++ +    +    + ++ + +++++ +  Q  ++ + Q+     
Sbjct: 3920 LQQQQQLQQQQLQQQQQQQQLQQQQQQQLQQQQQQLQQQQQQQQQQFQQQQQQQQMGLLN 3979

Query: 1110 -------PRKAARQEAG-GDGAPANP----EEPGGSRPG---PGRSPQARGPSRSLET-- 1152
                   P++  +Q+   G G PA P      PG   P     G+      P+ S E   
Sbjct: 3980 QSRTLLSPQQQQQQQVALGPGMPAKPLQHFSSPGALGPTLLLTGKEQNTVDPAVSSEATE 4039

Query: 1153 GAAAREGGPKCAD-------------RPSVAPKDPLQV----PTNTETSEETRPSLDFPQ 1195
            G +  +GGP                 +PS++    L +    P    +S + +P L  P 
Sbjct: 4040 GPSTHQGGPLAIGTTPESMATEPGEVKPSLSGDSQLLLVQPQPQPQPSSLQLQPPLRLPG 4099

Query: 1196 EAKEP-------------ETAEESAPDSTEFTEALRSPPAACAGEMGA-SPGLLIPEQPP 1241
            + ++              +    S+ +++     L  P  +   + G+ +  LL P+QP 
Sbjct: 4100 QQQQQVSLLHTAGGGSHGQLGSGSSSEASSVPHLLAQPSVSLGDQPGSMTQNLLGPQQPM 4159

Query: 1242 ---PSRHDTGT--PKPSGSL-ANTAPHGSSPTPGVGSLLGGPGGTQA--PVSHNSKDPPA 1293
               P +++TG   PKP   L +     G    P VG L     G  A  P   +      
Sbjct: 4160 LERPMQNNTGPQPPKPGPVLQSGQGLPGVGIMPTVGQLRAQLQGVLAKNPQLRHLSPQQQ 4219

Query: 1294 RQPGEFLAPVANPSSTAC------PKPSVLSSKISSF-GCDP--AGFNR------DPLGV 1338
            +Q    L       S A        +P   +S +    GC P   GF          LG 
Sbjct: 4220 QQLQALLMQRQLQQSQAVRQTPPYQEPGTQTSPLQGLLGCQPQLGGFPGPQTGPLQELGA 4279

Query: 1339 PVAKKGPQPYSSPHSELFLGPKDLAGCFLEELHPKP--SARDAP------PASSSCLCQD 1390
                +GP    +P   L  GP       L  +HP P  S+   P      P+ SS L  +
Sbjct: 4280 GPRPQGPPRLPAPPGALSTGP------VLGPVHPTPPPSSPQEPKRPSQLPSPSSQLPTE 4333

Query: 1391 GE----DAGSLEPQLPRSPPGTAETEPGRAASPPTLESSSLFPDLPVDRFDPPLYGSLSA 1446
             +      G+ +PQ P   P      P  A    TL S  L P                 
Sbjct: 4334 AQLPPTHPGTPKPQGPTLEPPPGRVSPAAAQLADTLFSKGLGP----------------- 4376

Query: 1447 NRDSGLPFACADPPQKTVPSDPPYPSFLLLEEVSPMLPSHFPDLSG------GKVLSKTC 1500
                       DPP     +  P        E S ++P H   ++G       ++  K  
Sbjct: 4377 ----------WDPPDNLAETQKP--------EQSSLVPGHLDQVNGQVVPEASQLSIKQE 4418

Query: 1501 PPERTVVPGA--------APSLPGKGSGCSVALMSHLSE-DELEIQKLVTELESQLQRSK 1551
            P E     GA           +   G+   + L    SE   L +QKL+     QL   +
Sbjct: 4419 PREEPCALGAQSVKREANGEPIGAPGTSNHLLLAGPRSEAGHLLLQKLLRAKNVQLSTGR 4478

Query: 1552 DTRGAPREL---AEAESVGRVELGTGTEPPSQRRTCQATVP----HEDTFSAAD-LTRVG 1603
             + G   E+    +++  G  +   GT  PS +    A  P     +    A+D L    
Sbjct: 4479 GSEGLRAEINGHIDSKLAGLEQKLQGT--PSNKEDAAARKPLTPKPKRVQKASDRLVSSR 4536

Query: 1604 ESTAHREGAESAVATVEAVQGRPGGTWPCPASFHPGHAALLPCAQEDLVSG----APFS- 1658
            +     +G  ++ A ++ ++                  +LLP  +  + +     APF  
Sbjct: 4537 KKLRKEDGVRASEALLKQLK---------------QELSLLPLTEPAITANFSLFAPFGS 4581

Query: 1659 --PRGANFHFQPVQKAGASKTG------LCQAEGDSRPPQDVCLPEPSKQPGPQLDAGSL 1710
              P       +    +GA  TG      L      S PP       P+  P P +    +
Sbjct: 4582 GCPVNGQSQLRGAFGSGALPTGPDYYSQLLTKNNLSNPPTPPSSLPPT--PPPSVQQKMV 4639

Query: 1711 AKCSPDQELSFPKNKEAASSQESEDSLR 1738
               +P +EL     K+AAS+++SE +LR
Sbjct: 4640 NGVTPSEELG-EHPKDAASARDSERALR 4666



 Score = 40.4 bits (93), Expect = 0.035
 Identities = 86/374 (22%), Positives = 121/374 (32%), Gaps = 60/374 (16%)

Query: 3537 GRGDCALDGALERPENEASPGSPGPLLQQALPLGASLPRPGARGQDAEGKRAPLVFSGKR 3596
            G+    L+  LE P NE  P  P P   +  PL    P P       E   +P   + + 
Sbjct: 420  GKAGVQLEPQLEAPLNEEMPLLPPP---EESPLS---PPP------EESPTSPPPEASRL 467

Query: 3597 RAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRS 3656
              P      +P    E   L +  E S      E  P     + S   P   + S     
Sbjct: 468  SPPPEELPASP--LPEALHLSRPLEESPLSPPPEESPLSPPPESSPFSPL--EESPLSPP 523

Query: 3657 AASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTKT 3716
              S PS AL+ P+ P      L+P       E+ + P   +    P  + S    P  ++
Sbjct: 524  EESPPSPALETPLSPPPEASPLSPPF----EESPLSPPPEELPTSPPPEASRLSPPPEES 579

Query: 3717 GGGSQPQPASGQLQSETATTPAKPSFPSR--SPAPERLPARAQAKSCTKGPREAGEQGPH 3774
                 P P    +      +   P F     SP PE  P           P EA    P 
Sbjct: 580  P--MSPPPEESPMSPPPEASRLFPPFEESPLSPPPEESPLSP--------PPEASRLSPP 629

Query: 3775 GSLGPKEKGESSTKRKKGQVPGP--ARSESVGSFGRAPSAPDKPPRTPRKQATPSRVLPT 3832
                P++   S    +    P P  +R   +    R    P++ P +P     P    PT
Sbjct: 630  ----PEDSPMSPPPEESPMSPPPEVSRLSPLPVVSRLSPPPEESPLSP-----PPEESPT 680

Query: 3833 KPKPNS-------QNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPPK------R 3879
             P P +       ++ P  PP E   A P     +D L     +  PLL  P+      R
Sbjct: 681  SPPPEASRLSPPPEDSPTSPPPEDSPASP---PPEDSLMSLPLEESPLLPLPEEPQLCPR 737

Query: 3880 GTAVH-GAEPAEPH 3892
                H    P EPH
Sbjct: 738  SEGPHLSPRPEEPH 751



 Score = 40.4 bits (93), Expect = 0.035
 Identities = 29/83 (34%), Positives = 34/83 (40%), Gaps = 3/83 (3%)

Query: 590  ESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHP--QETGSP 647
            ESP P P T  + +   S   +    A P  E S  P PL PS    PPT P  +    P
Sbjct: 4882 ESPAPEPPTQHSYTYNVSNLDVRQLSAPPPEEPSPPPSPLAPSP-ASPPTEPLVELPTEP 4940

Query: 648  FPSPEPPHSLPTHYQPEPAKAFP 670
               P  P  LP    PE A+  P
Sbjct: 4941 LAEPPVPSPLPLASSPESARPKP 4963



 Score = 39.7 bits (91), Expect = 0.060
 Identities = 73/330 (22%), Positives = 113/330 (34%), Gaps = 74/330 (22%)

Query: 3619 EKEVSSSHM-----VSEGGPRGTFHKGSATKPAGCQSSSKDRSAASTPSKALKFP-VHPR 3672
            +K++ + H+      +E   R    +G    P G +      + AS P  A   P V P+
Sbjct: 3062 KKDIFNEHLRLVESANEKAEREALLRGVEPGPLGPEERPPPAADASEPRLASVLPEVKPK 3121

Query: 3673 KAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSG-SPRPGTKTGGGSQPQPASGQLQS 3731
               G   P             ATPK +P P++   G   +PG    G    +  +G   S
Sbjct: 3122 VEEGGRHPSPCQ------FTIATPKVEPAPAANSLGLGLKPGQSMMGSRDTRMGTGPFSS 3175

Query: 3732 ETAT-----------------TPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQ--G 3772
               T                 TP+  S P  S   E+    + A +   GP  +G++   
Sbjct: 3176 SGHTAEKASFGATGGPPAHLLTPSPLSGPGGSSLLEKFELESGALTLPGGPAASGDELDK 3235

Query: 3773 PHGSLGPKE---------KGESSTKRKKGQV----------------------PGPARSE 3801
               SL   E         + E    +KK Q+                      PGPA++ 
Sbjct: 3236 MESSLVASELPLLIEDLLEHEKKELQKKQQLSAQLQPAQQQQQQQQQHSLLSAPGPAQAM 3295

Query: 3802 SVGSFGRAPSAPDKPPRT------PRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPG 3855
            S+   G +PS      +        R+   P  ++PT+P P    + R  PS    +  G
Sbjct: 3296 SLPHEGSSPSLAGSQQQLSLGLAGARQPGLPQPLMPTQP-PAHALQQRLAPSMAMVSNQG 3354

Query: 3856 HTQRKDRLGKA--FPQ--GRPLLRPPKRGT 3881
            H       G+A   PQ   +P+L     GT
Sbjct: 3355 HMLSGQHGGQAGLVPQQSSQPVLSQKPMGT 3384



 Score = 36.2 bits (82), Expect = 0.66
 Identities = 92/426 (21%), Positives = 125/426 (29%), Gaps = 53/426 (12%)

Query: 3458 PGEDRPPPRGSSPILSEGSLPALLHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPS 3517
            P E+ PP       LS     + L    E +P +    P   E P  P     R    P 
Sbjct: 522  PPEESPPSPALETPLSPPPEASPLSPPFEESPLS----PPPEELPTSPPPEASRLSPPPE 577

Query: 3518 NHQECPPPSLSPFPAALADGRGDCALDGALERPENEASPGSPGPLLQQALPLGASLPRPG 3577
                 PPP  SP        R     + +   P  E SP SP P   +  P     P   
Sbjct: 578  ESPMSPPPEESPMSPPPEASRLFPPFEESPLSPPPEESPLSPPPEASRLSPPPEDSPMSP 637

Query: 3578 ARGQDAEG------KRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEG 3631
               +          + +PL    +   P      +P    E+       E S      E 
Sbjct: 638  PPEESPMSPPPEVSRLSPLPVVSRLSPPPEESPLSPP--PEESPTSPPPEASRLSPPPED 695

Query: 3632 GPRGTFHKGSATKPAGCQSSSKDRSAASTP---SKALKFPVHPRKAVGSLAPGELARGTE 3688
             P     + S   P        + S  S P   S  L  P  P+    S  P    R  E
Sbjct: 696  SPTSPPPEDSPASPP------PEDSLMSLPLEESPLLPLPEEPQLCPRSEGPHLSPRPEE 749

Query: 3689 NGMKPATPKAKPGPSSQGSG-SPRPGTKT---------------GGGSQPQPASGQL--Q 3730
              + P   +    P ++    SP+P                   G    PQP    L  Q
Sbjct: 750  PHLSPRPEEPHLSPQAEEPHLSPQPEEPCLCAVPEEPHLSPQAEGPHLSPQPEELHLSPQ 809

Query: 3731 SETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPR----------EAGEQGPHGSLGPK 3780
            +E       P  P  SP PE      Q++     PR          E     P     P+
Sbjct: 810  TEEPHLSPVPEEPCLSPQPEESHLSPQSEEPCLSPRPEESHLSPELEKPPLSPRPEKPPE 869

Query: 3781 EKGESSTKRKKGQVPGPARSESVGSFGR-APSAPDKPPRTPRKQATPSRVLPTKPKPNSQ 3839
            E G+     +    P P         G  A S P +PP +P  +  P   L    +P+  
Sbjct: 870  EPGQCPAPEELPLFPPPGEPSLSPLLGEPALSEPGEPPLSPLPEELP---LSPSGEPSLS 926

Query: 3840 NKPRPP 3845
             +  PP
Sbjct: 927  PQLMPP 932



 Score = 36.2 bits (82), Expect = 0.66
 Identities = 73/305 (23%), Positives = 107/305 (35%), Gaps = 68/305 (22%)

Query: 3617 QKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQS--SSKDRSAASTPSKALKFPVHPRKA 3674
            Q++++VS  H    GG  G    GS+++ +      +    S    P    +  + P++ 
Sbjct: 4100 QQQQQVSLLHTAG-GGSHGQLGSGSSSEASSVPHLLAQPSVSLGDQPGSMTQNLLGPQQP 4158

Query: 3675 VGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETA 3734
            +       L R  +N   P  PK  PGP  Q SG   PG          P  GQL+++  
Sbjct: 4159 M-------LERPMQNNTGPQPPK--PGPVLQ-SGQGLPGVGI------MPTVGQLRAQLQ 4202

Query: 3735 TTPAK-PSFPSRSPAPE---------RLPARAQAKSCTKGPREAGEQG------------ 3772
               AK P     SP  +         R   ++QA   T   +E G Q             
Sbjct: 4203 GVLAKNPQLRHLSPQQQQQLQALLMQRQLQQSQAVRQTPPYQEPGTQTSPLQGLLGCQPQ 4262

Query: 3773 ----PHGSLGP-KEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQATPS 3827
                P    GP +E G     +   ++P P  + S G     P  P  PP +P++   PS
Sbjct: 4263 LGGFPGPQTGPLQELGAGPRPQGPPRLPAPPGALSTGPV-LGPVHPTPPPSSPQEPKRPS 4321

Query: 3828 RV-------------LPTKPKPNSQNKP--RPPPSEQRKAEPGHTQRKDRLGKAFPQGRP 3872
            ++              PT P       P   PPP    +  P   Q  D L   F +G  
Sbjct: 4322 QLPSPSSQLPTEAQLPPTHPGTPKPQGPTLEPPPG---RVSPAAAQLADTL---FSKGLG 4375

Query: 3873 LLRPP 3877
               PP
Sbjct: 4376 PWDPP 4380



 Score = 35.8 bits (81), Expect = 0.86
 Identities = 74/355 (20%), Positives = 117/355 (32%), Gaps = 33/355 (9%)

Query: 2235 ESPGRATSPPLAGAVSPSVAVRATGLSSTPTGDEAQAGRGLPGPDPQSRGA---PPHTNP 2291
            E P      PLA   +P       G        ++Q     P P PQ       PP   P
Sbjct: 4039 EGPSTHQGGPLAIGTTPESMATEPGEVKPSLSGDSQLLLVQPQPQPQPSSLQLQPPLRLP 4098

Query: 2292 DRMPRGHS---SYSPSNTARLGHREGQAVTAVP---TEPPTLQGAGPDSPACLEGEMGTS 2345
             +  +  S   +    +  +LG       ++VP    +P    G  P S    +  +G  
Sbjct: 4099 GQQQQQVSLLHTAGGGSHGQLGSGSSSEASSVPHLLAQPSVSLGDQPGSMT--QNLLGPQ 4156

Query: 2346 SKEPEDPGTPETGRSGATKMPRVTCPSTGLGLGRTTAPSSTASDFQ---SDSPQSHRNAS 2402
                E P    TG       P +       G+G         +  Q   + +PQ    + 
Sbjct: 4157 QPMLERPMQNNTGPQPPKPGPVLQSGQGLPGVGIMPTVGQLRAQLQGVLAKNPQLRHLSP 4216

Query: 2403 HQTPQGDPLGPQDLKQRSRGYKKKPASTENGQWKGQAPHGPVTCEVCAASFRSGPGLSRH 2462
             Q  Q   L  Q   Q+S+  ++ P   E G        G + C+     F  GP     
Sbjct: 4217 QQQQQLQALLMQRQLQQSQAVRQTPPYQEPGTQTSPL-QGLLGCQPQLGGF-PGPQTGPL 4274

Query: 2463 KARKHRPHP-GAPAEPSPAAL----PAQQPLEPLAQKCQP--PRKKSHRVS-GKERPNHS 2514
            +     P P G P  P+P       P   P+ P      P  P++ S   S   + P  +
Sbjct: 4275 QELGAGPRPQGPPRLPAPPGALSTGPVLGPVHPTPPPSSPQEPKRPSQLPSPSSQLPTEA 4334

Query: 2515 RGDPSH---------VTQPPPAQGSKEVLRAPGSPHSQQLHPPSPTEHEVDVKTP 2560
            +  P+H           +PPP + S    +   +  S+ L P  P ++  + + P
Sbjct: 4335 QLPPTHPGTPKPQGPTLEPPPGRVSPAAAQLADTLFSKGLGPWDPPDNLAETQKP 4389



 Score = 35.4 bits (80), Expect = 1.1
 Identities = 94/387 (24%), Positives = 132/387 (34%), Gaps = 86/387 (22%)

Query: 3223 SPGDPWGQEGEAKKDSPGERAKPRARSTPSNP---DGAATP---DSASATALADAGS--- 3273
            SP  P  +E          R  P    +P++P   D  A+P   DS  +  L ++     
Sbjct: 669  SPLSPPPEESPTSPPPEASRLSPPPEDSPTSPPPEDSPASPPPEDSLMSLPLEESPLLPL 728

Query: 3274 PGPPRTTP-------SPSPDPWAGGEPLLQATPVHEACKDPSRDCHHCGKRFPKPFKLQR 3326
            P  P+  P       SP P+     EP L   P  E    P  +  H     P+P   + 
Sbjct: 729  PEEPQLCPRSEGPHLSPRPE-----EPHLSPRP-EEPHLSPQAEEPHLS---PQP---EE 776

Query: 3327 HLAVHSPQRVYLCPRC--PRVYPEHGELLAHLGGAHGLLERPELQHTPLYACELCATVMR 3384
                  P+  +L P+   P + P+  EL  HL       E P L   P   C     +  
Sbjct: 777  PCLCAVPEEPHLSPQAEGPHLSPQPEEL--HLSPQ---TEEPHLSPVPEEPC-----LSP 826

Query: 3385 IIKKSFACSSCNYTFAKKEQFDRHMNKHLRGGRQPFAFRGVRRPGAPGQKARALEGTLPS 3444
              ++S                + H++  L   + P + R  + P  PGQ     E  L  
Sbjct: 827  QPEESHLSPQSEEPCLSPRPEESHLSPELE--KPPLSPRPEKPPEEPGQCPAPEELPL-- 882

Query: 3445 KRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEVAPSTTKGWPETLER--P 3502
                       P PGE    P    P LSE   P L  L  E+ P +  G P    +  P
Sbjct: 883  ----------FPPPGEPSLSPLLGEPALSEPGEPPLSPLPEEL-PLSPSGEPSLSPQLMP 931

Query: 3503 VDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGDCALDGALERP---ENEASPGSP 3559
             DP+  P     L        PP+LSP               G LE P   + ++ P SP
Sbjct: 932  PDPLPPP-----LSPIITAAAPPALSPL--------------GELEYPFGAKGDSDPESP 972

Query: 3560 --GPLLQQALPLGASLPRPGARGQDAE 3584
               P+L+  +      P P A   D E
Sbjct: 973  LAAPILETPIS-----PPPEANCTDPE 994



 Score = 34.7 bits (78), Expect = 1.9
 Identities = 106/467 (22%), Positives = 149/467 (31%), Gaps = 113/467 (24%)

Query: 1098 LTQGPREDEPQKPRKAARQEAGGDG---APANPEEPGGSRPGPGRSPQARGPSRSLETGA 1154
            LT    + EPQ P    R +        AP+ P  P   RPG    P A+ P   L    
Sbjct: 2331 LTPRASQVEPQSPGLGLRPQEPPPAQALAPSPPSHPDIFRPGSYTDPYAQPP---LTPRP 2387

Query: 1155 AAREGGPKCADRPSVAPKDPL-QVPTNTETSEETR--------------PSLDFPQ-EAK 1198
                    CA  P   P DP  +VP + ++   ++              PS   P+ ++ 
Sbjct: 2388 QPPPPESCCALPPRSLPSDPFSRVPASPQSQSSSQSPLTPRPLSAEAFCPSPVTPRFQSP 2447

Query: 1199 EPETAEESAPDSTEFTEALRSPPAACAGEMGASPGLL----------------------- 1235
            +P +   S P S +    L  PP     E+    G L                       
Sbjct: 2448 DPYSRPPSRPQSRDPFAPLHKPPRPQPPEVAFKAGSLAHTSLGAGGFPAALPAGPAGELH 2507

Query: 1236 --IPEQPPPSRHDT-------GTPKPSGSLANTA-----------------PHGSSPTPG 1269
              +P   PP+   +       GTP P       A                 PHG +   G
Sbjct: 2508 AKVPSGQPPNFVRSPGTGAFVGTPSPMRFTFPQAVGEPSLKPPVPQPGLPPPHGINSHFG 2567

Query: 1270 VGSLLGGPGGTQAPVS----HNSKDPPARQPGEF-----LAPVANPSSTACPKPSVLSSK 1320
             G  LG P  T   V+    H S  P     G       L+P+  PS    P P      
Sbjct: 2568 PGPTLGKPQSTNYTVATGNFHPSGSPLGPSSGSTGESYGLSPLRPPSVLPPPAPDGSLPY 2627

Query: 1321 ISSFGCDPAGFNRDPLGVPVAKK---GPQPYSSPHSELFLGPKD-----LAGCFLEELHP 1372
            +S      +G        PV K+   G    SS  +    G +D     L+   LE+   
Sbjct: 2628 LSHGASQRSGITS-----PVEKREDPGTGMGSSLATAELPGTQDPGMSGLSQTELEKQRQ 2682

Query: 1373 KPSARD---APPASSSCLCQDGEDAGSLEPQLPRSPPGTAETEP----------GRAASP 1419
            +   R+         + L Q+ E A +    +   PPG+   EP          G+    
Sbjct: 2683 RQRLRELLIRQQIQRNTLRQEKETAAAAAGAV--GPPGSWGAEPSSPAFEQLSRGQTPFA 2740

Query: 1420 PTLESSSLFPDLPVDRFDPPLYGSLSANRDSGLPFACADPPQKTVPS 1466
             T + SSL   LP  +   P+ G  S   D  L    + PP    PS
Sbjct: 2741 GTQDKSSLV-GLPPSKLSGPILGPGSFPSDDRL----SRPPPPATPS 2782



 Score = 33.9 bits (76), Expect = 3.3
 Identities = 38/135 (28%), Positives = 51/135 (37%), Gaps = 14/135 (10%)

Query: 424 DTELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLP 483
           D+E AA GP  +  P     T +  P P  G +    S+  +G P   +        P+ 
Sbjct: 12  DSEPAADGPAASEDPSA---TESDLPNPHVGEV----SVLSSGSPRLQETPQDCSGGPVR 64

Query: 484 WPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREK-LPAVRSSQG 542
              +     PS HG   L R   P   P     S G       +PGP E  LP+   SQ 
Sbjct: 65  RCALCNCGEPSLHGQRELRRFELPFDWPRCPVVSPGG------SPGPNEAVLPSEDLSQI 118

Query: 543 GSPALFTYNGMTDPG 557
           G P   T   + +PG
Sbjct: 119 GFPEGLTPAHLGEPG 133



 Score = 33.1 bits (74), Expect = 5.6
 Identities = 28/84 (33%), Positives = 35/84 (41%), Gaps = 24/84 (28%)

Query: 582  RVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHP 641
            R + A P E P P P            SP++ SPA+P +E      PL        PT P
Sbjct: 4904 RQLSAPPPEEPSPPP------------SPLAPSPASPPTE------PL-----VELPTEP 4940

Query: 642  QETGSPFPSPEPPHSLPTHYQPEP 665
                 P PSP P  S P   +P+P
Sbjct: 4941 L-AEPPVPSPLPLASSPESARPKP 4963


>gi|163914392 glioma tumor suppressor candidate region gene 1 [Homo
            sapiens]
          Length = 1560

 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 269/1192 (22%), Positives = 370/1192 (31%), Gaps = 240/1192 (20%)

Query: 5    RPRGAPPPTMTGDLQPRQVASS------PGHPSQPPLEDNTPATRTTKGAREAGGQAQAM 58
            +P G  PP +   L P+  A +       G P   P +   P   T   A +AG      
Sbjct: 354  KPAGVLPPKLY-QLTPKPFAPAGATLTIQGEPGALPQQPKAPQNLTFMAAGKAGQNVVLS 412

Query: 59   ELPEAQPRQARDGELKPPSLRGQAPSSTPGKRGSPQTP---------------------- 96
              P A   QA   +  P +  G AP   PG    P +                       
Sbjct: 413  GFP-APALQANVFKQPPATTTGAAPPQPPGALSKPMSVHLLNQGSSIVIPAQHMLPGQNQ 471

Query: 97   ---PGRSPLQAPSRLAGRAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTP 153
               PG   +Q P +L+        Q  IL  A+  T   L   P       A    +   
Sbjct: 472  FLLPGAPAVQLPQQLSALPANVGGQ--ILAAAAPHTGGQLIANPILTNQNLAGPLSLGPV 529

Query: 154  QGPGTGA---------PLRPGLPR--------------TEAQPAAEELGFHRCFQ----- 185
              P +GA         P++ G P               T++QPA          Q     
Sbjct: 530  LAPHSGAHSAHILSAAPIQVGQPALFQMPVSLAAGSLPTQSQPAPAGPAATTVLQGVTLP 589

Query: 186  --------------EPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPL--------QPGS 223
                          +P +   +T   +P  T +P    PP      PL        QP  
Sbjct: 590  PSAVAMLNTPDGLVQPATPAAATGEAAPVLTVQPAPQAPPAVSTPLPLGLQQPQAQQPPQ 649

Query: 224  YPEYQASGADSWPPAAENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGA 283
             P  QA+     PP A    P        + PE I  G  P  +P  +  Q         
Sbjct: 650  APTPQAAA----PPQATTPQPSPGLA---SSPEKIVLGQPPSATPTAILTQDSLQMFLPQ 702

Query: 284  STKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAV------GTGPAYP-LPTQPAPSP-L 335
                 P    G   +    V     P    P  A       G GP  P     PAP+P +
Sbjct: 703  ERSQQPLSAEGPHLSVPASVIVSAPPPAQDPAPATPVAKGAGLGPQAPDSQASPAPAPQI 762

Query: 336  PCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERPPSAQDGLGSTR 395
            P      G         G  SSP   H AP    DS H  L    P RPPS       + 
Sbjct: 763  PAAAPLKG--------PGPSSSPSLPHQAP--LGDSPH--LPSPHPTRPPSRPPSRPQSV 810

Query: 396  GPPSSLPQRH----------FPGQAYRASGVDTSPGPPDTELAAPGPPPARLPQLWDPTA 445
              P S P  H           PG     + +   P   +    APGPP   L     P  
Sbjct: 811  SRPPSEPPLHPCPPPQAPPTLPGIFVIQNQLGVPPPASNPAPTAPGPPQPPLRPQSQPPE 870

Query: 446  APYPTPPGGPLAATRSMFFNGQ------PSPGQRLCLPQSAPLPWPQVLPTARPSPHGME 499
             P P  P  P ++T S   +        P+P       Q  P   P   PT  P+ H   
Sbjct: 871  GPLPPAPHLPPSSTSSAVASSSETSSRLPAPTPSDFQLQFPPSQGPHKSPTPPPTLH--- 927

Query: 500  MLSRLPFPAGGPEWQGGSQGALGTAGKT-PGPREKLPA---------VRSSQGGSPAL-- 547
                +P PA  P     +   + T     P P+  L           +++  GG+PA   
Sbjct: 928  ---LVPEPAAPPPPPPRTFQMVTTPFPALPQPKALLERFHQVPSGIILQNKAGGAPAAPQ 984

Query: 548  --FTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPS--PATNTAGS 603
               +   +T P A  L  G A     P GTP+ P      A  + + LP   PA N A +
Sbjct: 985  TSTSLGPLTSPAASVLVSGQA-----PSGTPTAPSHAPAPAPMAATGLPPLLPAENKAFA 1039

Query: 604  ----TCSSLSPMSSSPANPSS--EESQLPG-----PLGPS--AFFHPPTHPQETG----- 645
                T +     SS P  PS    ES+L G      L PS  A F    H  +       
Sbjct: 1040 SNLPTLNVAKAASSGPGKPSGLQYESKLSGLKKPPTLQPSKEACFLEHLHKHQGSVLHPD 1099

Query: 646  --SPFPSPEPP--HSLPTH-YQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVGRG 700
              + FPS E      LP H YQ     A P P+D    +  F+ +           + + 
Sbjct: 1100 YKTAFPSFEDALHRLLPYHVYQG----ALPSPSDYHKVDEEFETVSTQLLKRTQAMLNKY 1155

Query: 701  GLQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARA 760
             L     +    P+    +      Q +                 +++  +  GL +A +
Sbjct: 1156 RLLLLEESRRVSPSAEMVMIDRMFIQEEKTTLALDKQLAKEKPDEYVSSSRSLGLPIAAS 1215

Query: 761  KDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSL 820
             +GH+     P   S P A   P         H  T L+     A G           SL
Sbjct: 1216 SEGHRLPGHGPLSSSAPGASTQPPP-------HLPTKLVIRHGGAGGSPSVTWARASSSL 1268

Query: 821  AATPFPLPA-SDLDMEDDAKLDSLITEALNGMEYQS---------DNPEIDSSFIDVFAD 870
            +++     A S LD ++D  + S     +   E +S             +     +   D
Sbjct: 1269 SSSSSSSSAASSLDADEDGPMPSRNRPPIKTYEARSRIGLKLKIKQEAGLSKVVHNTALD 1328

Query: 871  EEPSGPRGPSSGHPLKSKAGVTPESKAPPPLPAATPDPQTPRPGDRGCPARGRPKTRSLG 930
                 P  P+           T +   PPP P   P P     G    P    P+ + LG
Sbjct: 1329 PVHQPPPPPA-----------TLKVAEPPPRPPPPPPPTGQMNGTVDHPPPAAPERKPLG 1377

Query: 931  LAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSG---GGGRA----------SG 977
             AP     P +          K +R+++   GA EG+ +G   GG  A          SG
Sbjct: 1378 TAPHCPRLPLR----------KTYRENVGGPGAPEGTPAGRARGGSPAPLPAKVDEATSG 1427

Query: 978  L---RPRRNDGLGER----PPPRPRRPRTQAPGSRADPAPRVPRAAALPEET 1022
            L        D L +R    PPP P     Q  G     AP +P A     E+
Sbjct: 1428 LIRELAAVEDELYQRMLKGPPPEPAASAAQGTGDPDWEAPGLPPAKRRKSES 1479



 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 120/477 (25%), Positives = 159/477 (33%), Gaps = 104/477 (21%)

Query: 1107 PQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGAAARE---GGPKC 1163
            PQ P   +     G   P   + P    P     PQA  P  S    ++  +   G P  
Sbjct: 625  PQAPPAVSTPLPLGLQQPQAQQPPQAPTPQAAAPPQATTPQPSPGLASSPEKIVLGQPPS 684

Query: 1164 ADRPSVAPKDPLQVPTNTETSEETR----PSLDFPQEA--KEPETAEESAPDSTEFTEAL 1217
            A   ++  +D LQ+    E S++      P L  P       P  A++ AP +T   +  
Sbjct: 685  ATPTAILTQDSLQMFLPQERSQQPLSAEGPHLSVPASVIVSAPPPAQDPAP-ATPVAKGA 743

Query: 1218 RSPPAACAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSLLGGP 1277
               P A   +   +P   IP   P        P  S SL + AP G SP       L  P
Sbjct: 744  GLGPQAPDSQASPAPAPQIPAAAPLKGPG---PSSSPSLPHQAPLGDSPH------LPSP 794

Query: 1278 GGTQAPVSHNSKDPPARQPGEFLAPVANPSSTACPKPSVLSSKISSF------GCDPAGF 1331
              T+ P       PP+R P     P + P    CP P    +    F      G  P   
Sbjct: 795  HPTRPP-----SRPPSR-PQSVSRPPSEPPLHPCPPPQAPPTLPGIFVIQNQLGVPPPAS 848

Query: 1332 NRDPLGVPVAKKGPQPYSSPHSELFLGPKDLAGCFLEELHPKPSARDAPPASSSCLCQDG 1391
            N      P A   PQP   P S+   GP              P A   PP+S+S      
Sbjct: 849  NP----APTAPGPPQPPLRPQSQPPEGPL-------------PPAPHLPPSSTSSAVASS 891

Query: 1392 EDAGSLEP---------QLPRS--------PPGTAETEPGRAASPP----TLES-SSLFP 1429
             +  S  P         Q P S        PP T    P  AA PP    T +  ++ FP
Sbjct: 892  SETSSRLPAPTPSDFQLQFPPSQGPHKSPTPPPTLHLVPEPAAPPPPPPRTFQMVTTPFP 951

Query: 1430 DLP-----VDRFDPPLYGSLSANRDSGLPFAC---------------------ADPPQKT 1463
             LP     ++RF     G +  N+  G P A                      A     T
Sbjct: 952  ALPQPKALLERFHQVPSGIILQNKAGGAPAAPQTSTSLGPLTSPAASVLVSGQAPSGTPT 1011

Query: 1464 VPSDPPYPSFLLLEEVSPMLPSHFPDLSGGKVLSKTCPPERTVVPGAAPSLPGKGSG 1520
             PS  P P+ +    + P+LP+        K  +   P     V  AA S PGK SG
Sbjct: 1012 APSHAPAPAPMAATGLPPLLPAE------NKAFASNLPTLN--VAKAASSGPGKPSG 1060



 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 300/1364 (21%), Positives = 432/1364 (31%), Gaps = 283/1364 (20%)

Query: 1119 GGDGAPANPE-----EPGGSRPGPGRSPQARGPSRSLETGAAAREGGPKCADRPSVAPKD 1173
            GG GA + P      +P    PG G SP    P+  L       +  P     P +    
Sbjct: 308  GGAGAASAPTGTPSGQPLAVAPGLGSSPLVPAPNVILHRTPTPIQPKPAGVLPPKLYQLT 367

Query: 1174 PLQ-VPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEALRSPPAACAGEMGASP 1232
            P    P     + +  P    PQ+ K P+     A         L   PA         P
Sbjct: 368  PKPFAPAGATLTIQGEPGA-LPQQPKAPQNLTFMAAGKAGQNVVLSGFPA---------P 417

Query: 1233 GLL--IPEQPPPSRHDTGTPKPSGSLANTAP-----HGSSPTPGVGSLLGG------PGG 1279
             L   + +QPP +      P+P G+L+          GSS       +L G      PG 
Sbjct: 418  ALQANVFKQPPATTTGAAPPQPPGALSKPMSVHLLNQGSSIVIPAQHMLPGQNQFLLPGA 477

Query: 1280 TQAPVSHNSKDPPARQPGEFLAPVANPSSTACPKPSVLSSKISSFGCDPAGFNRDPLGVP 1339
                +       PA   G+ LA  A  +        +L+++      + AG    PL + 
Sbjct: 478  PAVQLPQQLSALPANVGGQILAAAAPHTGGQLIANPILTNQ------NLAG----PLSL- 526

Query: 1340 VAKKGP--QPYSSPHSELFLGPKDLAGCFLEELHPKPSARDAPPASSSCLCQDGEDAGSL 1397
                GP   P+S  HS   L    +          +P+    P + +         AGSL
Sbjct: 527  ----GPVLAPHSGAHSAHILSAAPIQV-------GQPALFQMPVSLA---------AGSL 566

Query: 1398 EPQLPRSPPGTAETEPGRAAS-PPTLESSSLFPDLPVDRFDPPLYGSLSANRDSGLPFAC 1456
              Q   +P G A T   +  + PP+  +    PD  V    P      +A      P   
Sbjct: 567  PTQSQPAPAGPAATTVLQGVTLPPSAVAMLNTPDGLVQPATP------AAATGEAAPVLT 620

Query: 1457 ADPPQKTVPS-DPPYPSFLLLEEVSPMLPSHFPDLSGGKVLSKTCPPERTVVPGAAPSLP 1515
              P  +  P+   P P  L L++     P   P          T P      PG A S P
Sbjct: 621  VQPAPQAPPAVSTPLP--LGLQQPQAQQPPQAPTPQAAAPPQATTPQPS---PGLASS-P 674

Query: 1516 GK---GSGCSVALMSHLSEDELEI--------QKLVTELESQLQRSKDTRGAPRELAEAE 1564
             K   G   S    + L++D L++        Q L  E       +     AP    +  
Sbjct: 675  EKIVLGQPPSATPTAILTQDSLQMFLPQERSQQPLSAEGPHLSVPASVIVSAPPPAQDPA 734

Query: 1565 SVGRVELGTGTEPPSQRRTCQAT-VPHEDTFSAADLTRVGESTAHREGAESAVATVEAVQ 1623
                V  G G  P  Q    QA+  P     +AA L   G S++     ++         
Sbjct: 735  PATPVAKGAGLGP--QAPDSQASPAPAPQIPAAAPLKGPGPSSSPSLPHQA--------- 783

Query: 1624 GRPGGTWPCPASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQPVQKAGASKTGLCQAE 1683
              P G  P   S HP      P ++   VS  P  P     H  P  +A  +  G+   +
Sbjct: 784  --PLGDSPHLPSPHPTRPPSRPPSRPQSVSRPPSEPP---LHPCPPPQAPPTLPGIFVIQ 838

Query: 1684 GDSRPPQDVCLPEPSKQPGPQLDAGSLAKCSPDQELSF-----PKNKEAASSQESEDSLR 1738
                 P     P P+  PGP           P+  L       P +  +A +  SE S R
Sbjct: 839  NQLGVPPPASNPAPTA-PGPPQPPLRPQSQPPEGPLPPAPHLPPSSTSSAVASSSETSSR 897

Query: 1739 LLPCEQRGGFLPEPGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLD-------A 1791
            L P      F  +   +  PH+    P     P +HL P+ A     APP          
Sbjct: 898  L-PAPTPSDFQLQFPPSQGPHKSPTPP-----PTLHLVPEPA-----APPPPPPRTFQMV 946

Query: 1792 TWPFGASPSHAA--QGHSAGRAGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLVP 1849
            T PF A P   A  +      +G  L   AG         APA   + T+       L P
Sbjct: 947  TTPFPALPQPKALLERFHQVPSGIILQNKAGG--------APAAPQTSTS-------LGP 991

Query: 1850 VPSPAC---VSNTHPSRRSQDPALSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPR 1906
            + SPA    VS   PS     P+ +P       P P  A     +L  +    A+  P  
Sbjct: 992  LTSPAASVLVSGQAPSGTPTAPSHAPA------PAPMAATGLPPLLPAENKAFASNLP-- 1043

Query: 1907 VNPSGLEGGTVEGGKVAC-GPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQ 1965
                     T+   K A  GP  G P G+Q  +  +       L+       L    K Q
Sbjct: 1044 ---------TLNVAKAASSGP--GKPSGLQYESKLSGLKKPPTLQPSKEACFLEHLHKHQ 1092

Query: 1966 G--------------QGTANQLQPEN---GVSPGGTDNH--------ASVNASPKTALTG 2000
            G              +   ++L P +   G  P  +D H         S     +T    
Sbjct: 1093 GSVLHPDYKTAFPSFEDALHRLLPYHVYQGALPSPSDYHKVDEEFETVSTQLLKRTQAML 1152

Query: 2001 PTEGAVLLEKCKGSRAA--------MSLQEE----------AEPTPSPPSPNRESLALAL 2042
                 +LLE+ +    +        M +QEE          A+  P     +  SL L +
Sbjct: 1153 NKYRLLLLEESRRVSPSAEMVMIDRMFIQEEKTTLALDKQLAKEKPDEYVSSSRSLGLPI 1212

Query: 2043 TAAHSRSGSEGRTPERASSPGLNK---PLLAT---------GDSPAPSVGDLAACAPSPT 2090
             A+       G  P  +S+PG +    P L T         G SP+ +    ++   S +
Sbjct: 1213 AASSEGHRLPGHGPLSSSAPGASTQPPPHLPTKLVIRHGGAGGSPSVTWARASSSLSSSS 1272

Query: 2091 SAAHMPCSL-----GPLP-REDPLTSPSRAQGGLGGQLPAS---------------PSCR 2129
            S++    SL     GP+P R  P      A+  +G +L                  P  +
Sbjct: 1273 SSSSAASSLDADEDGPMPSRNRPPIKTYEARSRIGLKLKIKQEAGLSKVVHNTALDPVHQ 1332

Query: 2130 DPPGPQQLLACSPAWAPLEEADGVQATTDTGAEDSPVAPPS--LTTSPCDPKEALAGCLL 2187
             PP P  L    P   P            T     P AP    L T+P  P+  L     
Sbjct: 1333 PPPPPATLKVAEPPPRPPPPPPPTGQMNGTVDHPPPAAPERKPLGTAPHCPRLPLRKTYR 1392

Query: 2188 QGEGSPLEDPSSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAG 2247
            +  G P   P   P G          G +P     ++ E             ATS  +  
Sbjct: 1393 ENVGGP-GAPEGTPAGRAR-------GGSPAPLPAKVDE-------------ATSGLIRE 1431

Query: 2248 AVSPSVAVRATGLSSTPTGDEAQAGRGLPGPDPQSRGAPP-----HTNPDRMPRGHSSYS 2302
              +    +    L   P    A A +G   PD ++ G PP       +PD      SS S
Sbjct: 1432 LAAVEDELYQRMLKGPPPEPAASAAQGTGDPDWEAPGLPPAKRRKSESPDVDQASFSSDS 1491

Query: 2303 PSNTARLGH-----------REGQAVTAVPTEPPTLQGAGPDSP 2335
            P +     H           ++    T  P+ P       P SP
Sbjct: 1492 PQDDTLTEHLQSAIDSILNLQQAPGRTPAPSYPHAASAGTPASP 1535



 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 124/531 (23%), Positives = 175/531 (32%), Gaps = 105/531 (19%)

Query: 3411 KHLRGGRQPFAFRGVRRPGAPGQKARALEGTLPSKRRRVAMPGSAPGPG----------- 3459
            +H+  G+  F       PGAP  +       LP+      +  +AP  G           
Sbjct: 463  QHMLPGQNQFLL-----PGAPAVQLPQQLSALPANVGGQILAAAAPHTGGQLIANPILTN 517

Query: 3460 EDRPPPRGSSPILSEGSLPALLHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNH 3519
            ++   P    P+L+  S     H+ S  A     G P   + PV      +    LP+  
Sbjct: 518  QNLAGPLSLGPVLAPHSGAHSAHILS--AAPIQVGQPALFQMPVS-----LAAGSLPTQS 570

Query: 3520 QECPPPSLSPFPAALADGRGDCALDGALERPENEASPGSPGPLLQQALPLGASLPRPGAR 3579
            Q  P       PAA         L G    P   A   +P  L+Q A P  A+       
Sbjct: 571  QPAPAG-----PAATT------VLQGVTLPPSAVAMLNTPDGLVQPATPAAAT------- 612

Query: 3580 GQDAEGKRAP-LVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFH 3638
                 G+ AP L      +AP A     P   Q+    Q  +  +     +   P+ T  
Sbjct: 613  -----GEAAPVLTVQPAPQAPPAVSTPLPLGLQQPQAQQPPQAPTPQ---AAAPPQAT-- 662

Query: 3639 KGSATKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGEL------ARGTENGMK 3692
                 +P+   +SS ++     P  A    +  + ++    P E       A G    + 
Sbjct: 663  ---TPQPSPGLASSPEKIVLGQPPSATPTAILTQDSLQMFLPQERSQQPLSAEGPHLSVP 719

Query: 3693 ---------------PATPKAK------PGPSSQGSGSPRPGTKTGGGSQ-PQPASGQLQ 3730
                           PATP AK        P SQ S +P P        + P P+S    
Sbjct: 720  ASVIVSAPPPAQDPAPATPVAKGAGLGPQAPDSQASPAPAPQIPAAAPLKGPGPSSSPSL 779

Query: 3731 SETATTPAKPSFPSRSPA--PERLPARAQAKSCTKGPREAG-EQGPHGSLGPKEKGESST 3787
               A     P  PS  P   P R P+R Q  S ++ P E      P     P   G    
Sbjct: 780  PHQAPLGDSPHLPSPHPTRPPSRPPSRPQ--SVSRPPSEPPLHPCPPPQAPPTLPGIFVI 837

Query: 3788 KRKKGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQATPSRVLPTKPKPNSQNKPRPPPS 3847
            + + G VP PA +        AP+AP  P    R Q+ P    P  P P +   P  PPS
Sbjct: 838  QNQLG-VPPPASNP-------APTAPGPPQPPLRPQSQP----PEGPLPPA---PHLPPS 882

Query: 3848 EQRKAEPGHTQRKDRLGKAFPQGRPLLRPPKRGTAVHGAEPAEPHTHRTAE 3898
                A    ++   RL    P    L  PP +G   H +    P  H   E
Sbjct: 883  STSSAVASSSETSSRLPAPTPSDFQLQFPPSQGP--HKSPTPPPTLHLVPE 931



 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 237/1085 (21%), Positives = 345/1085 (31%), Gaps = 228/1085 (21%)

Query: 1095 EVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGA 1154
            E EL  GP +    +P        G  GA A    P    PG               T  
Sbjct: 121  EAELDLGPFQLPTLQPADGGAGPTGAGGAAAVAAGPQALFPG--------------STDL 166

Query: 1155 AAREGGPKCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFT 1214
               +G P      ++ P  P  V     + +     +       +P    +  P+     
Sbjct: 167  LGLQGPPTVLTHQALVP--PQDVVNKALSVQPFLQPVGLGNVTLQPIPGLQGLPNG---- 220

Query: 1215 EALRSPPAACAGEMGASP---------------GLLIPEQPPPSRHDTGTPKPSGSL--- 1256
                SP  A A  +G +P                 L+ +Q P S +      PS  +   
Sbjct: 221  ----SPGGATAATLGLAPIQVVGQPVMALNTPTSQLLAKQVPVSGYLASAAGPSEPVTLA 276

Query: 1257 -ANTAPHGS------------SPTPGVGSLLGGPGGTQAPVSHNSKDPPARQPGEFLAPV 1303
             A  +P G+            + T    S+ GG G   AP    S  P A  PG   +P+
Sbjct: 277  SAGVSPQGAGLVIQKNLSAAVATTLNGNSVFGGAGAASAPTGTPSGQPLAVAPGLGSSPL 336

Query: 1304 ANPSSTACPKPSVLSSKISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSELFLGPKDLA 1363
                    P P+V+  +       P      P GV                  L PK   
Sbjct: 337  V-------PAPNVILHR------TPTPIQPKPAGV------------------LPPK--- 362

Query: 1364 GCFLEELHPKPSARDAPPASSSCLCQDGEDAGSLEPQLPRSPPGTAETEPGRAASPPTLE 1423
               L +L PKP A    PA ++   Q   + G+L PQ P++P        G+A     L 
Sbjct: 363  ---LYQLTPKPFA----PAGATLTIQG--EPGAL-PQQPKAPQNLTFMAAGKAGQNVVL- 411

Query: 1424 SSSLFPDLPVDRFDPPLYGSLSANRDSGLPFACADPPQKTVPSDPPYPSFLLLEEVSPML 1483
            S    P L  + F  P   +             A PPQ       P    LL +  S ++
Sbjct: 412  SGFPAPALQANVFKQPPATTTG-----------AAPPQPPGALSKPMSVHLLNQGSSIVI 460

Query: 1484 PSHFPDLSGGKVLSKTCPPERTVVPGAAPSLPGKGSGCSVALMSHLSEDELEIQKLVTEL 1543
            P+        + L    P  +  +P    +LP    G  +A  +  +  +L    ++T  
Sbjct: 461  PAQHMLPGQNQFLLPGAPAVQ--LPQQLSALPANVGGQILAAAAPHTGGQLIANPILTN- 517

Query: 1544 ESQLQRSKDTRGAPRELAEAESVGRVELGTGTEPPSQRRTCQATVPHEDTFSAADLT--- 1600
                          + LA   S+G V                   PH    SA  L+   
Sbjct: 518  --------------QNLAGPLSLGPV-----------------LAPHSGAHSAHILSAAP 546

Query: 1601 -RVGESTAHREGAESAVATVEAVQGRPGGTWPCPASFHPGHAALLPCAQEDLVSG----A 1655
             +VG+    +     A  ++   Q +P    P   +   G   L P A   L +      
Sbjct: 547  IQVGQPALFQMPVSLAAGSL-PTQSQPAPAGPAATTVLQG-VTLPPSAVAMLNTPDGLVQ 604

Query: 1656 PFSPRGANFHFQPVQKAGASKTGLCQAEGDSRPPQDVCLPEPSKQPGPQLDAGSLAKCSP 1715
            P +P  A     PV     +     QA      P  + L +P  Q  PQ      A  +P
Sbjct: 605  PATPAAATGEAAPVLTVQPAP----QAPPAVSTPLPLGLQQPQAQQPPQAPTPQAA--AP 658

Query: 1716 DQELSFPKNKEAASSQE----------------SEDSLRLLPCEQRGGFLPEPGTADQPH 1759
             Q  +   +   ASS E                ++DSL++   ++R     +P +A+ PH
Sbjct: 659  PQATTPQPSPGLASSPEKIVLGQPPSATPTAILTQDSLQMFLPQERS---QQPLSAEGPH 715

Query: 1760 RGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFG-ASPSHAAQGHSAGRAGGHLHPT 1818
               PA     +P     P  A        L    P   ASP+ A Q  +A    G     
Sbjct: 716  LSVPASVIVSAPPPAQDPAPATPVAKGAGLGPQAPDSQASPAPAPQIPAAAPLKG----- 770

Query: 1819 AGRPGFEGNEFAPAGASSL--TAPRGREAWLVPVPSPACVSNTHPSRRS--QDPALSPPI 1874
               PG       P+ + SL   AP G    L P P P    +  PSR      P   PP+
Sbjct: 771  ---PG-------PSSSPSLPHQAPLGDSPHL-PSPHPTRPPSRPPSRPQSVSRPPSEPPL 819

Query: 1875 RQLQLPGPGVAKSKDGILGLQE---LTPAAQSPPRVNPSGLEGGTVEGGKVACGPAQGSP 1931
                 P P    +  GI  +Q    + P A +P    P   +       +   GP   +P
Sbjct: 820  H--PCPPPQAPPTLPGIFVIQNQLGVPPPASNPAPTAPGPPQPPLRPQSQPPEGPLPPAP 877

Query: 1932 GGVQVTTLPAVAGH---QLGLEADGHWGLLGQAEKTQGQGTAN------QLQPENGVSPG 1982
                 +T  AVA        L A        Q   +QG   +        L PE    P 
Sbjct: 878  HLPPSSTSSAVASSSETSSRLPAPTPSDFQLQFPPSQGPHKSPTPPPTLHLVPEPAAPPP 937

Query: 1983 GTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPTPSPP------SPNRE 2036
                   +  +P  AL  P     LLE+     + + LQ +A   P+ P       P   
Sbjct: 938  PPPRTFQMVTTPFPALPQP---KALLERFHQVPSGIILQNKAGGAPAAPQTSTSLGPLTS 994

Query: 2037 SLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAPSVGDLAACAPSPTSAAHMP 2096
              A  L +  + SG+    P  A +P    P+ ATG  P     + A  +  PT      
Sbjct: 995  PAASVLVSGQAPSGTP-TAPSHAPAPA---PMAATGLPPLLPAENKAFASNLPTLNVAKA 1050

Query: 2097 CSLGP 2101
             S GP
Sbjct: 1051 ASSGP 1055



 Score = 49.3 bits (116), Expect = 8e-05
 Identities = 92/359 (25%), Positives = 124/359 (34%), Gaps = 54/359 (15%)

Query: 78   LRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLA---GRAEGSPPQRYILGIASSRTKPTLD 134
            L G  P S+     S Q PP       P++L    G A GSP   +    ASS    +  
Sbjct: 1221 LPGHGPLSSSAPGASTQPPP-----HLPTKLVIRHGGAGGSPSVTWAR--ASSSLSSSSS 1273

Query: 135  ETPENPQLEAAQ---LPEVDTPQGPGTGAPLRPGLPRTEAQPAAEELGFHRC----FQEP 187
             +     L+A +   +P  + P      A  R GL     Q A      H        +P
Sbjct: 1274 SSSAASSLDADEDGPMPSRNRPPIKTYEARSRIGLKLKIKQEAGLSKVVHNTALDPVHQP 1333

Query: 188  PSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASG-ADSWPPAAENSFPGA 246
            P    +     P   P PP P   Q  GT    P + PE +  G A   P          
Sbjct: 1334 PPPPATLKVAEPPPRPPPPPPPTGQMNGTVDHPPPAAPERKPLGTAPHCPRLPLRKTYRE 1393

Query: 247  NFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAF 306
            N G P A PE  P G   GGSP       P PA    +T     ++A        +    
Sbjct: 1394 NVGGPGA-PEGTPAGRARGGSPA------PLPAKVDEATSGLIRELAA-------VEDEL 1439

Query: 307  HQP--QGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGAAHSA 364
            +Q   +G  PE A         P   AP       G P    R S+   +     A+ S+
Sbjct: 1440 YQRMLKGPPPEPAASAAQGTGDPDWEAP-------GLPPAKRRKSE---SPDVDQASFSS 1489

Query: 365  PRPFSDSLHKSLTKIL---------PERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRAS 414
              P  D+L + L   +         P R P+      ++ G P+S P  H P +AY  S
Sbjct: 1490 DSPQDDTLTEHLQSAIDSILNLQQAPGRTPAPSYPHAASAGTPASPPPLHRP-EAYPPS 1547



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 203/930 (21%), Positives = 289/930 (31%), Gaps = 181/930 (19%)

Query: 522  GTAGKTPGPREKLPAVRSSQGGSP---ALFTYNGMTDPGAQPL----FFGVAQPQVSPHG 574
            G      GP E  P   +S G SP    L     ++   A  L     FG A    +P G
Sbjct: 261  GYLASAAGPSE--PVTLASAGVSPQGAGLVIQKNLSAAVATTLNGNSVFGGAGAASAPTG 318

Query: 575  TPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAF 634
            TPS  P  V     S   +P+P      +     +P+   PA          G L P  +
Sbjct: 319  TPSGQPLAVAPGLGSSPLVPAPNVILHRTP----TPIQPKPA----------GVLPPKLY 364

Query: 635  FHPPTHPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEG 694
               P      G+       P +LP   QP+  +   F A G   +     L   P P   
Sbjct: 365  QLTPKPFAPAGATLTIQGEPGALPQ--QPKAPQNLTFMAAGKAGQNVV--LSGFPAPALQ 420

Query: 695  PEVGRGGLQGFPRAPPPYPT-----------------------------HHFSLSSASLD 725
              V +        A PP P                              + F L  A   
Sbjct: 421  ANVFKQPPATTTGAAPPQPPGALSKPMSVHLLNQGSSIVIPAQHMLPGQNQFLLPGAPAV 480

Query: 726  QLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPAD 785
            QL   L+    +     LAA   H    G L+A     +Q   GP  L  P  AP     
Sbjct: 481  QLPQQLSALPANVGGQILAAAAPHTG--GQLIANPILTNQNLAGPLSL-GPVLAP----- 532

Query: 786  AHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLPASDLDMEDD-AKLDSLI 844
             H+G  +H+   L A          P++ G  P+L   P  L A  L  +   A      
Sbjct: 533  -HSG--AHSAHILSAA---------PIQVG-QPALFQMPVSLAAGSLPTQSQPAPAGPAA 579

Query: 845  TEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAGVTPESKAPP----P 900
            T  L G+        + ++   +     P+   G ++  P+ +   V P  +APP    P
Sbjct: 580  TTVLQGVTLPPSAVAMLNTPDGLVQPATPAAATGEAA--PVLT---VQPAPQAPPAVSTP 634

Query: 901  LPAATPDPQTPRPGDRGCP-ARGRPKTRSLGLAPTEADAPSQ---GRQQRRGKQLKLFRK 956
            LP     PQ  +P     P A   P+  +   +P  A +P +   G+         L + 
Sbjct: 635  LPLGLQQPQAQQPPQAPTPQAAAPPQATTPQPSPGLASSPEKIVLGQPPSATPTAILTQD 694

Query: 957  DLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPPRPRRPRT----------QAPGSRA 1006
             L      E S          L    +  +   PP +   P T          QAP S+A
Sbjct: 695  SLQMFLPQERSQQPLSAEGPHLSVPASVIVSAPPPAQDPAPATPVAKGAGLGPQAPDSQA 754

Query: 1007 D--PAPRVPRAA-----------ALPEETRSSRRRRLP---PRKDPRKRKARGGAWGKEL 1050
               PAP++P AA           +LP +        LP   P + P +  +R  +  +  
Sbjct: 755  SPAPAPQIPAAAPLKGPGPSSSPSLPHQAPLGDSPHLPSPHPTRPPSRPPSRPQSVSRP- 813

Query: 1051 ILKIVQQKNRLREYDFASESEEDEQPPPRGPGFRGRRGRGEKRKEVELTQGPREDEPQKP 1110
                             SE      PPP+ P                         P  P
Sbjct: 814  ----------------PSEPPLHPCPPPQAP-------------------------PTLP 832

Query: 1111 RKAARQEAGGDGAPA-NPEEPGGSRPGPGRSPQARGPSRSLETGAAAREGGPKCADRPSV 1169
                 Q   G   PA NP       P P   PQ++ P   L             A   S 
Sbjct: 833  GIFVIQNQLGVPPPASNPAPTAPGPPQPPLRPQSQPPEGPLPPAPHLPPSSTSSAVASSS 892

Query: 1170 APKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEALRSPPAACAGEMG 1229
                 L  PT ++   +  PS   P ++  P       P+      A   PP     +M 
Sbjct: 893  ETSSRLPAPTPSDFQLQFPPS-QGPHKSPTPPPTLHLVPE-----PAAPPPPPPRTFQMV 946

Query: 1230 ASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSLLGGPGGTQAPVSHNSK 1289
             +P   +P+  P +  +     PSG +      G+   P   + LG      A V  + +
Sbjct: 947  TTPFPALPQ--PKALLERFHQVPSGIILQNKAGGAPAAPQTSTSLGPLTSPAASVLVSGQ 1004

Query: 1290 DPPARQPGEFLAPVANPSSTACPKPSVLSSKISSFGCDPAGFNRDPLGVPVAKKGP---- 1345
             P         AP   P + A   P +L ++  +F  +    N        A  GP    
Sbjct: 1005 APSGTPTAPSHAPAPAPMA-ATGLPPLLPAENKAFASNLPTLN----VAKAASSGPGKPS 1059

Query: 1346 -QPYSSPHSELFLGP---KDLAGCFLEELH 1371
               Y S  S L   P        CFLE LH
Sbjct: 1060 GLQYESKLSGLKKPPTLQPSKEACFLEHLH 1089



 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 186/843 (22%), Positives = 266/843 (31%), Gaps = 149/843 (17%)

Query: 1757 QPHRGAPAPE-AFGSPAVHLAPDLAFQGDG------APPLDATWPFGASPSHAAQG---- 1805
            QP  G   P  A G+ AV   P   F G         PP   T      P          
Sbjct: 135  QPADGGAGPTGAGGAAAVAAGPQALFPGSTDLLGLQGPPTVLTHQALVPPQDVVNKALSV 194

Query: 1806 ----HSAGRAGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPACVSNTHP 1861
                   G     L P  G  G      +P GA++ T      A +  V  P    NT  
Sbjct: 195  QPFLQPVGLGNVTLQPIPGLQGLPNG--SPGGATAATLGL---APIQVVGQPVMALNTPT 249

Query: 1862 SR--RSQDP------ALSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNPSGLE 1913
            S+    Q P      + + P   + L   GV+    G++  + L+ A  +        L 
Sbjct: 250  SQLLAKQVPVSGYLASAAGPSEPVTLASAGVSPQGAGLVIQKNLSAAVATT-------LN 302

Query: 1914 GGTVEGGKVACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTANQL 1973
            G +V GG  A     G+P G  +   P +    L             A       T   +
Sbjct: 303  GNSVFGGAGAASAPTGTPSGQPLAVAPGLGSSPLV-----------PAPNVILHRTPTPI 351

Query: 1974 QPENGVSPGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPTPSPPSP 2033
            QP+    P G         +PK                  + A  +L  + EP   P  P
Sbjct: 352  QPK----PAGVLPPKLYQLTPKPF----------------APAGATLTIQGEPGALPQQP 391

Query: 2034 NRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAPSVGDLAACAPSPTSAA 2093
                    + A        G+  +     G   P L       P      A  P P  A 
Sbjct: 392  KAPQNLTFMAA--------GKAGQNVVLSGFPAPALQANVFKQPPATTTGAAPPQPPGAL 443

Query: 2094 HMPCSLGPLPREDPLTSPSRAQGGLGGQ----LPASPSCRDPPGPQQLLACSPAWAPLEE 2149
              P S+  L +   +  P  AQ  L GQ    LP +P+ + P   QQL A      P   
Sbjct: 444  SKPMSVHLLNQGSSIVIP--AQHMLPGQNQFLLPGAPAVQLP---QQLSAL-----PANV 493

Query: 2150 ADGVQATTDTGAEDSPVAPPSLTTSPCDPKEALAGCLLQGEGSPLEDPSSWPPGSVSA-V 2208
               + A          +A P LT       + LAG L  G   P+  P S   G+ SA +
Sbjct: 494  GGQILAAAAPHTGGQLIANPILTN------QNLAGPLSLG---PVLAPHS---GAHSAHI 541

Query: 2209 TCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAV--RATGLSSTPTG 2266
                     + +  ++P       L      A + P A  V   V +   A  + +TP G
Sbjct: 542  LSAAPIQVGQPALFQMPVSLAAGSLPTQSQPAPAGPAATTVLQGVTLPPSAVAMLNTPDG 601

Query: 2267 ------DEAQAGRGLP----GPDPQSRGAPPHTNPDRMPRGHSSYSPSNTARLGHREGQA 2316
                    A  G   P     P PQ   APP              + S    LG ++ QA
Sbjct: 602  LVQPATPAAATGEAAPVLTVQPAPQ---APP--------------AVSTPLPLGLQQPQA 644

Query: 2317 VTAVPTEPPTLQGAGPDSPACLEGEMG-TSSKEPEDPGTPETGRSGATKMPRVTCPSTGL 2375
                P + PT Q A P      +   G  SS E    G P +    AT    +T  S  +
Sbjct: 645  QQ--PPQAPTPQAAAPPQATTPQPSPGLASSPEKIVLGQPPS----ATPTAILTQDSLQM 698

Query: 2376 GLGRTTAPSSTASDFQSDSPQSHRNASHQTPQGDPLGPQDLKQRSRGYKKKPASTENGQW 2435
             L +  +    +++    S  +    S   P  DP     +   ++G    P + ++   
Sbjct: 699  FLPQERSQQPLSAEGPHLSVPASVIVSAPPPAQDPAPATPV---AKGAGLGPQAPDSQAS 755

Query: 2436 KGQAPHGPVTCEVCAASFRSGPGLSRHKARKHRPHPGAPAEPSPAALP-------AQQPL 2488
               AP  P    +      S P L         PH  +P    P + P       ++ P 
Sbjct: 756  PAPAPQIPAAAPLKGPGPSSSPSLPHQAPLGDSPHLPSPHPTRPPSRPPSRPQSVSRPPS 815

Query: 2489 EPLAQKCQPPRKKSHRVSGKERPNHSRGDPSHVTQP-PPAQGSKEVLRAPGSPHSQQLHP 2547
            EP    C PP+     + G     +  G P   + P P A G  +    P S   +   P
Sbjct: 816  EPPLHPCPPPQAPP-TLPGIFVIQNQLGVPPPASNPAPTAPGPPQPPLRPQSQPPEGPLP 874

Query: 2548 PSP 2550
            P+P
Sbjct: 875  PAP 877



 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 98/414 (23%), Positives = 135/414 (32%), Gaps = 47/414 (11%)

Query: 2025 EPTPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAPSVGDLAA 2084
            +P P  P      L L L    ++   +  TP+ A+ P    P  + G + +P    L  
Sbjct: 622  QPAPQAPPAVSTPLPLGLQQPQAQQPPQAPTPQAAAPPQATTPQPSPGLASSPEKIVLGQ 681

Query: 2085 CAPSPTSAAHMPCSLGPLPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQLLACSPAW 2144
               +  +A     SL     ++    P  A+G     +PAS     PP  Q     +P  
Sbjct: 682  PPSATPTAILTQDSLQMFLPQERSQQPLSAEGP-HLSVPASVIVSAPPPAQDPAPATP-- 738

Query: 2145 APLEEADGVQATTDTGAEDSPVAPPSLTTSPCDPKEALAGCLLQGEGSPLEDPS---SWP 2201
                           GA   P AP S   SP    +  A   L+G G P   PS     P
Sbjct: 739  ------------VAKGAGLGPQAPDS-QASPAPAPQIPAAAPLKGPG-PSSSPSLPHQAP 784

Query: 2202 PGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRATGLS 2261
             G    +   H    P     R    SR     E P     PP A    P + V    L 
Sbjct: 785  LGDSPHLPSPHPTRPPSRPPSRPQSVSRPPS--EPPLHPCPPPQAPPTLPGIFVIQNQLG 842

Query: 2262 -STPTGDEAQAGRGLPGPDPQSRGAP--------PHTNPDRMPRGHSSYSPSNTA----- 2307
               P  + A    G P P  + +  P        PH  P       +S S +++      
Sbjct: 843  VPPPASNPAPTAPGPPQPPLRPQSQPPEGPLPPAPHLPPSSTSSAVASSSETSSRLPAPT 902

Query: 2308 ----RLGHREGQAVTAVPTEPPTL----QGAGPDSPACLEGEMGTSSKEPEDPGTPETGR 2359
                +L     Q     PT PPTL    + A P  P     +M T +  P  P  P+   
Sbjct: 903  PSDFQLQFPPSQGPHKSPTPPPTLHLVPEPAAPPPPPPRTFQMVT-TPFPALP-QPKALL 960

Query: 2360 SGATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRNASHQTPQGDPLGP 2413
                ++P         G G   AP ++ S     SP +    S Q P G P  P
Sbjct: 961  ERFHQVPSGIILQNKAG-GAPAAPQTSTSLGPLTSPAASVLVSGQAPSGTPTAP 1013



 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 103/422 (24%), Positives = 143/422 (33%), Gaps = 112/422 (26%)

Query: 3424 GVRRPGA--PGQKARALEGTLPSKRRRVAMPGSAPGPGE---DRPPPRGSSPILSEGSLP 3478
            G+++P A  P Q         P        PG A  P +    +PP    + IL++ SL 
Sbjct: 638  GLQQPQAQQPPQAPTPQAAAPPQATTPQPSPGLASSPEKIVLGQPPSATPTAILTQDSLQ 697

Query: 3479 ALLHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAA-LADG 3537
              L       P + +G    L  P   +                PPP+  P PA  +A G
Sbjct: 698  MFLPQERSQQPLSAEG--PHLSVPASVIV-------------SAPPPAQDPAPATPVAKG 742

Query: 3538 RGDCALDGALERPENEASPGSPGPLLQQALPLGASLPRPGARGQDAEGKRAPLVFSGKRR 3597
             G        + P+++ASP +P P     +P  A L  PG     +   +APL  S    
Sbjct: 743  AGL-----GPQAPDSQASP-APAP----QIPAAAPLKGPGPSSSPSLPHQAPLGDS---- 788

Query: 3598 APGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSA 3657
                       H    H                            T+P   +  S+ +S 
Sbjct: 789  ----------PHLPSPH---------------------------PTRPPS-RPPSRPQSV 810

Query: 3658 ASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSP--RPGTK 3715
            +  PS+    P  P +A  +L PG      + G+ P  P + P P++ G   P  RP   
Sbjct: 811  SRPPSEPPLHPCPPPQAPPTL-PGIFVIQNQLGVPP--PASNPAPTAPGPPQPPLRP--- 864

Query: 3716 TGGGSQPQPASGQLQSETATTPAKPS--FPSRSPAPERLPARAQAKSCTKGPREAGEQGP 3773
                 Q QP  G L       P+  S    S S    RLPA   +    + P     QGP
Sbjct: 865  -----QSQPPEGPLPPAPHLPPSSTSSAVASSSETSSRLPAPTPSDFQLQFPPS---QGP 916

Query: 3774 HGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQATPSRVLPTK 3833
            H S  P              VP PA            + P  PPRT +   TP   LP +
Sbjct: 917  HKSPTPPPTLHL--------VPEPA------------APPPPPPRTFQMVTTPFPALP-Q 955

Query: 3834 PK 3835
            PK
Sbjct: 956  PK 957



 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 81/363 (22%), Positives = 124/363 (34%), Gaps = 50/363 (13%)

Query: 1091 EKRKEVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSL 1150
            E+ ++    +GP    P     +A   A  D APA P   G    GP        P+ + 
Sbjct: 703  ERSQQPLSAEGPHLSVPASVIVSAPPPAQ-DPAPATPVAKGAGL-GPQAPDSQASPAPAP 760

Query: 1151 ETGAAAREGGPKCADRPSVAPKDPL----QVPTNTETSEETRPSLDFPQEAKEPETAEES 1206
            +  AAA   GP  +  PS+  + PL     +P+   T   +RP    PQ    P +    
Sbjct: 761  QIPAAAPLKGPGPSSSPSLPHQAPLGDSPHLPSPHPTRPPSRPP-SRPQSVSRPPSEPPL 819

Query: 1207 APDSTEFTEALRSPPAACAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSP 1266
             P         ++PP          PG+ +       ++  G P P+ + A TAP    P
Sbjct: 820  HP-----CPPPQAPPTL--------PGIFV------IQNQLGVPPPASNPAPTAP--GPP 858

Query: 1267 TPGVGSLLGGPGGTQAPVSHNSKDPPARQPGEFLAPVANPSSTACPKPSVLSSKISSFGC 1326
             P +      P G   P  H         P    + VA+ S T+   P+   S       
Sbjct: 859  QPPLRPQSQPPEGPLPPAPH-------LPPSSTSSAVASSSETSSRLPAPTPSDFQLQFP 911

Query: 1327 DPAGFNRDPLGVPVAKKGPQPYSSPHS-----ELFLGP---KDLAGCFLEELHPKPS--- 1375
               G ++ P   P     P+P + P       ++   P          LE  H  PS   
Sbjct: 912  PSQGPHKSPTPPPTLHLVPEPAAPPPPPPRTFQMVTTPFPALPQPKALLERFHQVPSGII 971

Query: 1376 ----ARDAPPASSSCLCQDGEDAGSLEPQLPRSPPGTAETEPGRAASPPTLESSSLFPDL 1431
                A  AP A  +        + +    +    P    T P  A +P  + ++ L P L
Sbjct: 972  LQNKAGGAPAAPQTSTSLGPLTSPAASVLVSGQAPSGTPTAPSHAPAPAPMAATGLPPLL 1031

Query: 1432 PVD 1434
            P +
Sbjct: 1032 PAE 1034



 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 90/419 (21%), Positives = 137/419 (32%), Gaps = 68/419 (16%)

Query: 3453 GSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEVAPSTTKGWPETLERPVDPVTHPIRG 3512
            GS P   +  P    ++ +L   +LP      S VA   T   P+ L +P  P       
Sbjct: 564  GSLPTQSQPAPAGPAATTVLQGVTLPP-----SAVAMLNT---PDGLVQPATPAAATGEA 615

Query: 3513 CELPSNHQECPPPSLSPFPAALADGRGDCALDGALERPENEASPGSPGPLLQQALPLGAS 3572
                        P L+  PA  A       L   L++P+ +  P +P P  Q A P  A+
Sbjct: 616  A-----------PVLTVQPAPQAPPAVSTPLPLGLQQPQAQQPPQAPTP--QAAAPPQAT 662

Query: 3573 LPRPG----------ARGQDAEGKRAPLVFSGKRRA--PGARGRCAPDHFQEDHL-LQKE 3619
             P+P             GQ        ++     +   P  R +  P   +  HL +   
Sbjct: 663  TPQPSPGLASSPEKIVLGQPPSATPTAILTQDSLQMFLPQERSQ-QPLSAEGPHLSVPAS 721

Query: 3620 KEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLA 3679
              VS+     +  P     KG+   P    S +    A   P+ A      P K  G  +
Sbjct: 722  VIVSAPPPAQDPAPATPVAKGAGLGPQAPDSQASPAPAPQIPAAA------PLKGPGPSS 775

Query: 3680 PGELARGTENGMKPATPKAKPG-----PSSQGSGSPRPGTKTGGGSQPQPASGQ------ 3728
               L      G  P  P   P      P S+     RP ++      P P +        
Sbjct: 776  SPSLPHQAPLGDSPHLPSPHPTRPPSRPPSRPQSVSRPPSEPPLHPCPPPQAPPTLPGIF 835

Query: 3729 -LQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPKEKGESST 3787
             +Q++    P   +    +P P + P R Q++     P       PH          +S+
Sbjct: 836  VIQNQLGVPPPASNPAPTAPGPPQPPLRPQSQP----PEGPLPPAPHLPPSSTSSAVASS 891

Query: 3788 KRKKGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQATPSRVLPTKPKPNSQNKPRPPP 3846
                 ++P P  S+    F         P + P K  TP   L   P+P +   P PPP
Sbjct: 892  SETSSRLPAPTPSDFQLQF--------PPSQGPHKSPTPPPTLHLVPEPAA---PPPPP 939



 Score = 42.4 bits (98), Expect = 0.009
 Identities = 150/659 (22%), Positives = 204/659 (30%), Gaps = 150/659 (22%)

Query: 331 APSPLPCYQGQPGGLNRHSDLSGALSSPGAA-HSAPRPFSDSLHKSLTKILPERPPSAQD 389
           A +P     GQP  +      S  + +P    H  P P        L   L +  P    
Sbjct: 313 ASAPTGTPSGQPLAVAPGLGSSPLVPAPNVILHRTPTPIQPKPAGVLPPKLYQLTPKPFA 372

Query: 390 GLGST---RGPPSSLPQRHFPGQ--AYRASG-----VDTSPGP-PDTELAAPGPPPARLP 438
             G+T   +G P +LPQ+    Q   + A+G     V  S  P P  +      PPA   
Sbjct: 373 PAGATLTIQGEPGALPQQPKAPQNLTFMAAGKAGQNVVLSGFPAPALQANVFKQPPATT- 431

Query: 439 QLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWP-QVLPTARPSPHG 497
                T A  P PPG  L+   S+    Q   G  + +P    LP   Q L    P+   
Sbjct: 432 -----TGAAPPQPPGA-LSKPMSVHLLNQ---GSSIVIPAQHMLPGQNQFLLPGAPAVQL 482

Query: 498 MEMLSRLPFPAGGPEWQGGSQGALGTAGKTP--------GPREKLPAVRSSQG------- 542
            + LS LP   GG      +    G     P        GP    P +    G       
Sbjct: 483 PQQLSALPANVGGQILAAAAPHTGGQLIANPILTNQNLAGPLSLGPVLAPHSGAHSAHIL 542

Query: 543 -------GSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLP-------PPRVVGASP 588
                  G PALF        G+ P      Q Q +P G  +         PP  V    
Sbjct: 543 SAAPIQVGQPALFQMPVSLAAGSLP-----TQSQPAPAGPAATTVLQGVTLPPSAVAMLN 597

Query: 589 SESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSPF 648
           +   L  PAT  A +T  +   ++  PA  +      P PLG       P   Q   +P 
Sbjct: 598 TPDGLVQPAT-PAAATGEAAPVLTVQPAPQAPPAVSTPLPLG----LQQPQAQQPPQAPT 652

Query: 649 PSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGFPRA 708
           P    P          P    P P+ GL +      L + P       + +  LQ F   
Sbjct: 653 PQAAAP----------PQATTPQPSPGLASSPEKIVLGQPPSATPTAILTQDSLQMF--- 699

Query: 709 PPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSP 768
                          L Q          +R+   L+A   H      ++  A        
Sbjct: 700 ---------------LPQ----------ERSQQPLSAEGPHLSVPASVIVSA-------- 726

Query: 769 GPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLP 828
            PP  P+   AP  P    AGL   A       D+QA     P     +P+ A    P P
Sbjct: 727 -PP--PAQDPAPATPVAKGAGLGPQAP------DSQASPAPAPQ----IPAAAPLKGPGP 773

Query: 829 ASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSK 888
           +S   +   A L               D+P + S          PS P+  S   P +  
Sbjct: 774 SSSPSLPHQAPL--------------GDSPHLPSPHPTRPPSRPPSRPQSVSRP-PSEPP 818

Query: 889 AGVTPESKAPP--------------PLPAATPDPQTPRPGDRGCPARGRPKTRSLGLAP 933
               P  +APP              P PA+ P P  P P       + +P    L  AP
Sbjct: 819 LHPCPPPQAPPTLPGIFVIQNQLGVPPPASNPAPTAPGPPQPPLRPQSQPPEGPLPPAP 877



 Score = 38.9 bits (89), Expect = 0.10
 Identities = 88/381 (23%), Positives = 123/381 (32%), Gaps = 71/381 (18%)

Query: 958  LDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPPR-PRRPRTQAPGSRADPAPRVPRAA 1016
            L    ++EG    G G  S   P    G   +PPP  P +   +  G+   P+    RA+
Sbjct: 1210 LPIAASSEGHRLPGHGPLSSSAP----GASTQPPPHLPTKLVIRHGGAGGSPSVTWARAS 1265

Query: 1017 ALPEETRSSRR---------------RRLPPRKDPRKRKARGGAWGKELILKIVQQKNRL 1061
            +    + SS                 R  PP K    R   G      L LKI Q+    
Sbjct: 1266 SSLSSSSSSSSAASSLDADEDGPMPSRNRPPIKTYEARSRIG------LKLKIKQEAGLS 1319

Query: 1062 REYDFASESEEDEQPPPRGPGFRGRRGRGEKRKEVELTQGPREDEPQKPRKAARQEAGGD 1121
            +     +     + PPP                 +++ + P    P  P           
Sbjct: 1320 KVVHNTALDPVHQPPPPPAT--------------LKVAEPPPRPPPPPPPTGQMNGTVDH 1365

Query: 1122 GAPANPE-EPGGSRPGPGRSPQARGPSRSLETGAAAREGGPKCADRPSVAPKDPLQVPTN 1180
              PA PE +P G+ P   R P  R   R    G  A EG P  A R       PL    +
Sbjct: 1366 PPPAAPERKPLGTAPHCPRLP-LRKTYRENVGGPGAPEGTP--AGRARGGSPAPLPAKVD 1422

Query: 1181 TETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEALRSPP---AACAGEMGASPGLLIP 1237
              TS   R               E +A +   +   L+ PP   AA A +    P    P
Sbjct: 1423 EATSGLIR---------------ELAAVEDELYQRMLKGPPPEPAASAAQGTGDPDWEAP 1467

Query: 1238 EQPPPSRHDTGTPK-PSGSLANTAP-------HGSSPTPGVGSLLGGPGGTQAP-VSHNS 1288
              PP  R  + +P     S ++ +P       H  S    + +L   PG T AP   H +
Sbjct: 1468 GLPPAKRRKSESPDVDQASFSSDSPQDDTLTEHLQSAIDSILNLQQAPGRTPAPSYPHAA 1527

Query: 1289 KDPPARQPGEFLAPVANPSST 1309
                   P     P A P S+
Sbjct: 1528 SAGTPASPPPLHRPEAYPPSS 1548



 Score = 38.1 bits (87), Expect = 0.17
 Identities = 44/146 (30%), Positives = 53/146 (36%), Gaps = 14/146 (9%)

Query: 3693 PATPKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSP----- 3747
            PAT K    P       P  G   G    P PA+ + +    T P  P  P R       
Sbjct: 1337 PATLKVAEPPPRPPPPPPPTGQMNGTVDHPPPAAPE-RKPLGTAPHCPRLPLRKTYRENV 1395

Query: 3748 ----APERLPA-RAQAKSCTKGPREAGE--QGPHGSLGPKEKGESSTKRKKGQVPGPARS 3800
                APE  PA RA+  S    P +  E   G    L   E  E   +  KG  P PA S
Sbjct: 1396 GGPGAPEGTPAGRARGGSPAPLPAKVDEATSGLIRELAAVED-ELYQRMLKGPPPEPAAS 1454

Query: 3801 ESVGSFGRAPSAPDKPPRTPRKQATP 3826
             + G+      AP  PP   RK  +P
Sbjct: 1455 AAQGTGDPDWEAPGLPPAKRRKSESP 1480



 Score = 37.4 bits (85), Expect = 0.30
 Identities = 51/213 (23%), Positives = 71/213 (33%), Gaps = 37/213 (17%)

Query: 1070 SEEDEQPPPRGPGFRGRRGRGEKRKEVELTQGPREDEPQKPR----KAARQEAGGDGAP- 1124
            +E   +PPP  P      G  +        + P    P  PR    K  R+  GG GAP 
Sbjct: 1343 AEPPPRPPPPPPPTGQMNGTVDHPPPAAPERKPLGTAPHCPRLPLRKTYRENVGGPGAPE 1402

Query: 1125 ---ANPEEPGGSRPGPGRSPQA--------------------RGPSRSLETGAAAREGGP 1161
               A     G   P P +  +A                    +GP       AA   G P
Sbjct: 1403 GTPAGRARGGSPAPLPAKVDEATSGLIRELAAVEDELYQRMLKGPPPEPAASAAQGTGDP 1462

Query: 1162 KCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEF------TE 1215
               + P + P    +  + +   ++   S D PQ+    E  + +             T 
Sbjct: 1463 DW-EAPGLPPAKRRK--SESPDVDQASFSSDSPQDDTLTEHLQSAIDSILNLQQAPGRTP 1519

Query: 1216 ALRSPPAACAGEMGASPGLLIPEQPPPSRHDTG 1248
            A   P AA AG   + P L  PE  PPS H+ G
Sbjct: 1520 APSYPHAASAGTPASPPPLHRPEAYPPSSHNGG 1552



 Score = 33.9 bits (76), Expect = 3.3
 Identities = 81/342 (23%), Positives = 109/342 (31%), Gaps = 62/342 (18%)

Query: 333  SPLPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERPPSAQDGLG 392
            SP   +      L+  S  S A SS  A    P P  +            RPP       
Sbjct: 1256 SPSVTWARASSSLSSSSSSSSAASSLDADEDGPMPSRN------------RPPIKTYEAR 1303

Query: 393  STRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGPPPARLPQLWDPTAAPYPTPP 452
            S  G    + Q     +    + +D    PP        PPPA L     P   P P PP
Sbjct: 1304 SRIGLKLKIKQEAGLSKVVHNTALDPVHQPP--------PPPATLKVAEPPPRPPPPPPP 1355

Query: 453  GGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGPE 512
             G +  T        P P      P+  PL           +PH      RLP      E
Sbjct: 1356 TGQMNGTVD-----HPPPAA----PERKPLG---------TAPH----CPRLPLRKTYRE 1393

Query: 513  WQGGSQGALGT-AGKTPGPREKLPAVRSSQGGSPALFTYNGMTDPGAQPLFFGVA-QPQV 570
              GG     GT AG+  G        +  +  S  +     + D   Q +  G   +P  
Sbjct: 1394 NVGGPGAPEGTPAGRARGGSPAPLPAKVDEATSGLIRELAAVEDELYQRMLKGPPPEPAA 1453

Query: 571  SP-HGT-------PSLPPPRVVGASPSESPLPSPATNTAGSTCS-SLSPMSSSPANPSSE 621
            S   GT       P LPP +      SESP    A+ ++ S    +L+    S  +    
Sbjct: 1454 SAAQGTGDPDWEAPGLPPAK---RRKSESPDVDQASFSSDSPQDDTLTEHLQSAIDSILN 1510

Query: 622  ESQLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTHYQP 663
              Q PG          P++P    +  P+  PP   P  Y P
Sbjct: 1511 LQQAPGRTPA------PSYPHAASAGTPASPPPLHRPEAYPP 1546



 Score = 32.3 bits (72), Expect = 9.5
 Identities = 41/156 (26%), Positives = 51/156 (32%), Gaps = 49/156 (31%)

Query: 2746 PAEDSSRAHSRSEEGVWEENTPPLGP-------------------LGFPETSSSPADSTT 2786
            P    SR  SR +      + PPL P                   LG P  +S+PA +  
Sbjct: 796  PTRPPSRPPSRPQSVSRPPSEPPLHPCPPPQAPPTLPGIFVIQNQLGVPPPASNPAPTAP 855

Query: 2787 SSCLQGLPDNPDTQGGVQGPEGPTPDASGSSAKDPPSLFDDEVSFSQLFPPGGRLTRKRN 2846
                   P  P  +   Q PEGP P A       PPS     V+ S         T  R 
Sbjct: 856  G------PPQPPLRPQSQPPEGPLPPAPHL----PPSSTSSAVASSSE-------TSSR- 897

Query: 2847 PHVYGKRCEKPVLPLPTQPSFEEGGDPTLGPARLPT 2882
                        LP PT   F+    P+ GP + PT
Sbjct: 898  ------------LPAPTPSDFQLQFPPSQGPHKSPT 921


>gi|89142737 alpha 3 type IV collagen isoform 5 precursor [Homo
            sapiens]
          Length = 1424

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 257/1053 (24%), Positives = 331/1053 (31%), Gaps = 188/1053 (17%)

Query: 1    MPG-ERPRGAPPPTMTGDLQPRQVASSPGHPSQPPLED--NTPATRTTKGAREAGGQAQA 57
            +PG + P+G P    T   Q   +   PG P  P L      P  +   G + + G    
Sbjct: 462  IPGVDGPKGEPGLLCT---QCPYIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGSPGN 518

Query: 58   MELPEAQPRQARDGELKPPSLRGQA-----PSSTPGKRGSP--QTPPGRSPLQAPSRLAG 110
              LP         G+   P L+G+      P    G  G P  +  PGR  L       G
Sbjct: 519  TGLPGFPGFPGAQGD---PGLKGEKGETLQPEGQVGVPGDPGLRGQPGRKGLDGIPGTPG 575

Query: 111  RAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGP-GTGAPLRPGLPRT 169
              +G P  +  L ++  +        P +P       P    P GP G G    PGL  T
Sbjct: 576  -VKGLPGPKGELALSGEKGDQGPPGDPGSPGS-----PGPAGPAGPPGYGPQGEPGLQGT 629

Query: 170  EAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQ--PGSYPEY 227
            +  P A           PP         S S TP P  PGPP   G    Q  PG     
Sbjct: 630  QGVPGAPG---------PPGEAGPRGELSVS-TPVPGPPGPPGPPGHPGPQGPPGIPGSL 679

Query: 228  QASGADSWP-PAAENSFPGANFGVPPAEPEPIPKGSR--PGGSPR-GVSFQFPFPALHGA 283
               G    P P  E   PG  F  PP      PKG +  PG     G   +   P L G 
Sbjct: 680  GKCGDPGLPGPDGEPGIPGIGFPGPPG-----PKGDQGFPGTKGSLGCPGKMGEPGLPGK 734

Query: 284  STKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYP-LPTQPAPSPLPCYQGQP 342
               P        A   GP    F   +G   E      P  P LP  P    L   +G P
Sbjct: 735  PGLPGAKGEPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLDGPRGDP 794

Query: 343  GGLNRHSDLSGALSSPGAAHSAPR-----PFSDSLH-------KSLTKILPERPPSAQDG 390
            G         G    PG     PR     P  + L        K+  K  P  P   + G
Sbjct: 795  G----QPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKTGPKGDPGIPGLDRSG 850

Query: 391  LGSTRGPPS---------SLPQRHFPGQA--------------YRASGVDTSPGPPDT-- 425
                 G P           L QR +PG                    G    PGPP    
Sbjct: 851  FPGETGSPGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPPGNPG 910

Query: 426  ---ELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPL 482
               +  +PG P  +  Q   P A       G P  +  S     +  PG    L   A  
Sbjct: 911  TPGQRGSPGIPGVK-GQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPG----LKGFAGN 965

Query: 483  PWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREK--------- 533
            P  +      P   G++ L  LP PAG P    G +G LG+ G    P  +         
Sbjct: 966  PGEKG-NRGVPGMPGLKGLKGLPGPAGPP----GPRGDLGSTGNPGEPGLRGIPGSMGNM 1020

Query: 534  -LPAVRSSQG--------GSPALFTYNGMTDPGAQPLFFGVAQP-QVSPHGTPSLPPPRV 583
             +P  +  +G        G P L   +G+     +P +    +P    P G P LP    
Sbjct: 1021 GMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGDPGLPGDMG 1080

Query: 584  VGASPSESPLPSPATNTAGSTCSSLSPMSSS-PANPSSEESQ----LPGPLGPSAFFHPP 638
                  + P P      AG   +  SP S   P  P          + G LGP     PP
Sbjct: 1081 KKGEMGQ-PGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGPPGIRGPP 1139

Query: 639  THPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVG 698
              P   GSP P              +     P PA   G +G    L   P P   P  G
Sbjct: 1140 GLPGFPGSPGPMGIRGD--------QGRDGIPGPA---GEKGETGLLRAPPGPRGNP--G 1186

Query: 699  RGGLQGFPRAP--PPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLL 756
              G +G   AP  P  P    ++  A               R  + +  F       G +
Sbjct: 1187 AQGAKGDRGAPGFPGLPGRKGAMGDAG-------------PRGPTGIEGFPGPPGLPGAI 1233

Query: 757  LA-----RAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDP 811
            +      R   G + SPG PG P PP +  +      G + H       G A   G    
Sbjct: 1234 IPGQTGNRGPPGSRGSPGAPGPPGPPGSHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGR 1293

Query: 812  LRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADE 871
            L     P L     P P  D              +   G++ +  NP     F+      
Sbjct: 1294 LGAPGTPGL-----PGPRGDPGF-----------QGFPGVKGEKGNP----GFLGSIGPP 1333

Query: 872  EPSGPRGPSS--GHPLKSKAGVTPESKAPPPLPA-----ATPDPQTPRPGDRG-CPARGR 923
             P GP+GP    G P   K    P S  PP  P        P P  P PG+ G C  RG+
Sbjct: 1334 GPIGPKGPPGVRGDPGTLKIISLPGSPGPPGTPGEPGMQGEPGPPGP-PGNLGPCGPRGK 1392

Query: 924  PKTRSLGLAPTEADAPSQGRQQRRGKQLKLFRK 956
            P     G   T   A  +G +  +G+   LF +
Sbjct: 1393 PGKD--GKPGTPGPAGEKGNKGSKGEPESLFHQ 1423



 Score = 86.7 bits (213), Expect = 4e-16
 Identities = 353/1494 (23%), Positives = 441/1494 (29%), Gaps = 412/1494 (27%)

Query: 184  FQEPPSSFTSTNYTSPSATPRPPAP----------GPPQSRGTS-----------PLQPG 222
            F  PP S     +T P   P P  P          G    RG S           P  PG
Sbjct: 53   FPGPPGSPGQKGFTGPEGLPGPQGPKGFPGLPGLTGSKGVRGISGLPGFSGSPGLPGTPG 112

Query: 223  SYPEYQASGADSWPPA-AENSFPG--ANFGVP--------------PAEPEPIPKGSR-- 263
            +   Y   G      +  E  FPG     G P              PA+ E I   ++  
Sbjct: 113  NTGPYGLVGVPGCSGSKGEQGFPGLPGTLGYPGIPGAAGLKGQKGAPAKEEDIELDAKGD 172

Query: 264  PG--GSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVG-- 319
            PG  G+P       P P   G    P P    G     GP       P+G   E  +G  
Sbjct: 173  PGLPGAPGPQGLPGP-PGFPGPVGPPGPPGFFGFPGAMGP-----RGPKGHMGERVIGHK 226

Query: 320  --------TGPAYP----LPTQPAPSPLPCYQGQPG--GLNRHSDLSGALSSPGAAHSAP 365
                    TGP  P    + T   P      +G+ G  G        G    PG ++ + 
Sbjct: 227  GERGVKGLTGPPGPPGTVIVTLTGPDNRTDLKGEKGDKGAMGEPGPPGPSGLPGESYGSE 286

Query: 366  R--PFSDSLHKSLTKI-LPERPPSAQDGLGSTRGPPSSLPQRHFPGQ------------- 409
            +  P    L     K  +P  P S  +G+   RG P  + +    GQ             
Sbjct: 287  KGAPGDPGLQGKPGKDGVPGFPGS--EGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPT 344

Query: 410  ----AYRASGVDTSPGPPDTELAAPGPPPARLPQLWDPTAAP-YPTPPGGPLAATR---- 460
                 Y+  G + +PGP       PGP  AR PQ   P+  P  P  PG      R    
Sbjct: 345  EYYDTYQEKGDEGTPGP-------PGPRGARGPQ--GPSGPPGVPGSPGSSRPGLRGAPG 395

Query: 461  ------SMFFNGQP------SPGQRLC-----LPQSAPLPWPQ---VLPTARPSPHGME- 499
                  S    G+P      +PG   C     LP S   P P    V     P  HG+  
Sbjct: 396  WPGLKGSKGERGRPGKDAMGTPGSPGCAGSPGLPGSPGPPGPPGDIVFRKGPPGDHGLPG 455

Query: 500  -------------------MLSRLPFPAGGPEWQG-----------GSQGALGTAGKTPG 529
                               + ++ P+  G P   G           G QGA G  G    
Sbjct: 456  YLGSPGIPGVDGPKGEPGLLCTQCPYIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGS 515

Query: 530  P-REKLPAVRSSQG--GSPALFTYNGMT-----------DPG--AQPLFFGVAQPQVSPH 573
            P    LP      G  G P L    G T           DPG   QP   G+     +P 
Sbjct: 516  PGNTGLPGFPGFPGAQGDPGLKGEKGETLQPEGQVGVPGDPGLRGQPGRKGLDGIPGTP- 574

Query: 574  GTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQ-LPGPLGPS 632
            G   LP P+   A   E     P     G   S  SP  + PA P     Q  PG  G  
Sbjct: 575  GVKGLPGPKGELALSGEKGDQGP----PGDPGSPGSPGPAGPAGPPGYGPQGEPGLQGTQ 630

Query: 633  AFFHPPTHPQETG--------SPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQC 684
                 P  P E G        +P P P  P   P H  P+     P      G  G    
Sbjct: 631  GVPGAPGPPGEAGPRGELSVSTPVPGPPGPPGPPGHPGPQGPPGIPGSLGKCGDPG---- 686

Query: 685  LEETPFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLA 744
                  P    E G  G+ GFP  P P     F  +  SL                    
Sbjct: 687  -----LPGPDGEPGIPGI-GFPGPPGPKGDQGFPGTKGSLG------------------- 721

Query: 745  AFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQ 804
                            K G    PG PGLP     P V      G      T    G+  
Sbjct: 722  -------------CPGKMGEPGLPGKPGLPGAKGEPAVAMPGGPG------TPGFPGERG 762

Query: 805  AEGKDDPLRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSF 864
              G+   +    LP L  TP                     E L+G       P      
Sbjct: 763  NSGEHGEIGLPGLPGLPGTPG-------------------NEGLDGPRGDPGQP------ 797

Query: 865  IDVFADEEPSGPRGPSSGHPLKSKAGVTPESKAPPPLPAATPDPQTPRPGDRGCPARGRP 924
                    P G +GP  G  ++   G    ++  P L       Q  R G  G   +G P
Sbjct: 798  -------GPPGEQGP-PGRCIEGPRG----AQGLPGLNGL--KGQQGRRGKTG--PKGDP 841

Query: 925  KTRSLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRND 984
                L  +    +  S G    +G+   L ++             G  G    L P   D
Sbjct: 842  GIPGLDRSGFPGETGSPGIPGHQGEMGPLGQR-------------GYPGNPGILGPPGED 888

Query: 985  GL--------GERPPPRPRRPRTQAPGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDP 1036
            G+           PP  P  P T  PG R  P   +P             +R  P  K  
Sbjct: 889  GVIGMMGFPGAIGPPGPPGNPGT--PGQRGSPG--IPGVKG---------QRGTPGAKGE 935

Query: 1037 RKRKARGGAWGKELILKIVQQKNRLREYDFA-SESEEDEQPPPRGPGFRGRRGRGEKRKE 1095
            +  K   G  G   I  ++  K       FA +  E+  +  P  PG +G +G       
Sbjct: 936  QGDK---GNPGPSEISHVIGDKGEPGLKGFAGNPGEKGNRGVPGMPGLKGLKGL------ 986

Query: 1096 VELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGAA 1155
                  P    P  PR       G  G+  NP EP G R  PG       P    + G  
Sbjct: 987  ------PGPAGPPGPR-------GDLGSTGNPGEP-GLRGIPGSMGNMGMPGSKGKRGTL 1032

Query: 1156 AREGGPKCADRPSVAPKDPLQVPTNTE-TSEETRPSLDFPQEAKEPETAEESAPDSTEFT 1214
               G P  A RP +     LQ        SE TRP    P       T +   P      
Sbjct: 1033 ---GFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGP-------TGDPGLPGD---- 1078

Query: 1215 EALRSPPAACAGEMG--ASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGS 1272
                       GEMG    PG L P  P  +    G+P   G      PHG     G+  
Sbjct: 1079 -------MGKKGEMGQPGPPGHLGPAGPEGA---PGSPGSPGLPGKPGPHGDLGFKGIKG 1128

Query: 1273 LLGGPG-----------------GTQAPVSHNSKDPPARQPGEFLAPVANPSSTACPKPS 1315
            LLG PG                 G +     +    PA + GE     A P     P   
Sbjct: 1129 LLGPPGIRGPPGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNP--- 1185

Query: 1316 VLSSKISSFGCDPAGFNRDPLGVP--VAKKGPQPYSSPHS----ELFLGPKDLAGCFLEE 1369
                     G   A  +R   G P    +KG    + P      E F GP  L G  +  
Sbjct: 1186 ---------GAQGAKGDRGAPGFPGLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPG 1236

Query: 1370 L---HPKPSARDAP-------PASSSCLCQDGEDAGSLEPQLPRSPPGTAET--EPGRAA 1417
                   P +R +P       P  S  +   G D GS+    P+ PPGTA     PGR  
Sbjct: 1237 QTGNRGPPGSRGSPGAPGPPGPPGSHVIGIKG-DKGSMGHPGPKGPPGTAGDMGPPGRLG 1295

Query: 1418 SPPTLESSSLFPDLPVDRFDPPLYGSLSANRDSGLP--FACADPPQKTVPSDPP 1469
            +P T       P LP  R DP   G      + G P       PP    P  PP
Sbjct: 1296 APGT-------PGLPGPRGDPGFQGFPGVKGEKGNPGFLGSIGPPGPIGPKGPP 1342



 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 289/1237 (23%), Positives = 378/1237 (30%), Gaps = 221/1237 (17%)

Query: 208  PGPPQSRGTSPLQPGSYPEYQASGADSWP-----PAAENSFPGANFGVPPAEPEPIPKGS 262
            PGPP +   +   P +  + +    D        P   +  PG ++G     P       
Sbjct: 238  PGPPGTVIVTLTGPDNRTDLKGEKGDKGAMGEPGPPGPSGLPGESYGSEKGAPGDPGLQG 297

Query: 263  RPG-----GSP--RGVSFQFPFPALHGAS-TKPFPADVAGHAFTNGPLVFAFHQPQGAWP 314
            +PG     G P   GV     FP L G    K    D+    F      +  +Q +G   
Sbjct: 298  KPGKDGVPGFPGSEGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPTEYYDTYQEKG--- 354

Query: 315  EEAVGTGPAYPLPTQ--PAPSPLPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSL 372
             +    GP  P   +    PS  P   G PG  +    L GA   PG   S         
Sbjct: 355  -DEGTPGPPGPRGARGPQGPSGPPGVPGSPG--SSRPGLRGAPGWPGLKGSKG------- 404

Query: 373  HKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGP 432
                     ER    +D +G T G P        PG           PGPP   +   GP
Sbjct: 405  ---------ERGRPGKDAMG-TPGSPGCAGSPGLPGSP-------GPPGPPGDIVFRKGP 447

Query: 433  PPAR-LP-QLWDPTAAPYPTPPGGP-LAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLP 489
            P    LP  L  P       P G P L  T+  +  G P       L     +P  Q   
Sbjct: 448  PGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQCPYIPGPPGLPGLPGLHGVKGIPGRQGAA 507

Query: 490  TARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKL-----PAVRSSQG-- 542
              + SP G    + LP   G P  QG   G  G  G+T  P  ++     P +R   G  
Sbjct: 508  GLKGSP-GSPGNTGLPGFPGFPGAQG-DPGLKGEKGETLQPEGQVGVPGDPGLRGQPGRK 565

Query: 543  ---GSPALFTYNGMTDPGAQPLFFGVAQPQVSPH--GTPSLPPPRVVGASPSESPLPSPA 597
               G P      G+  P  +    G    Q  P   G+P  P P      P   P   P 
Sbjct: 566  GLDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGSPGPAGPAGPPGYGPQGEPG 625

Query: 598  TN-TAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSP--------- 647
               T G   +   P  + P    S  + +PGP GP     PP HP   G P         
Sbjct: 626  LQGTQGVPGAPGPPGEAGPRGELSVSTPVPGPPGPPG---PPGHPGPQGPPGIPGSLGKC 682

Query: 648  ----FPSPEPPHSLPTHYQPEPA-----KAFPFPADGLGAEG------------------ 680
                 P P+    +P    P P      + FP     LG  G                  
Sbjct: 683  GDPGLPGPDGEPGIPGIGFPGPPGPKGDQGFPGTKGSLGCPGKMGEPGLPGKPGLPGAKG 742

Query: 681  ----AFQCLEETP-FPHEGPEVGRGGLQGFPRAPP-PYPTHHFSLSSASLD--------Q 726
                A      TP FP E    G  G  G P  P  P    +  L     D        +
Sbjct: 743  EPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLDGPRGDPGQPGPPGE 802

Query: 727  LDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGL-----PSPPAAPR 781
                  C +  R    L      +   G    R K G +  PG PGL     P    +P 
Sbjct: 803  QGPPGRCIEGPRGAQGLPGLNGLKGQQG---RRGKTGPKGDPGIPGLDRSGFPGETGSPG 859

Query: 782  VPA-DAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFP-----LPASDLDME 835
            +P      G L         G     G+D  +     P     P P      P       
Sbjct: 860  IPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPPGNPGTPGQRGSPG 919

Query: 836  DDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAGVT--P 893
                     T    G +    NP   S    V  D+   G +G +     K   GV   P
Sbjct: 920  IPGVKGQRGTPGAKGEQGDKGNPG-PSEISHVIGDKGEPGLKGFAGNPGEKGNRGVPGMP 978

Query: 894  ESKAPP--PLPAATPDPQ-----TPRPGDRGCPARGRPKTR-SLGLAPTEADAPSQGRQQ 945
              K     P PA  P P+     T  PG+ G   RG P +  ++G+  ++    + G   
Sbjct: 979  GLKGLKGLPGPAGPPGPRGDLGSTGNPGEPGL--RGIPGSMGNMGMPGSKGKRGTLGFPG 1036

Query: 946  RRGKQ----LKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPPRPRRPRTQA 1001
            R G+     +   + D    G +EG+  G  G      P  + GL   P    ++     
Sbjct: 1037 RAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPG------PTGDPGL---PGDMGKKGEMGQ 1087

Query: 1002 PGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRL 1061
            PG      P  P  A       S     LP +  P       G  G + I      K  L
Sbjct: 1088 PGPPGHLGPAGPEGAP-----GSPGSPGLPGKPGPH------GDLGFKGI------KGLL 1130

Query: 1062 REYDFASESEEDEQPPPRGP-GFRGRRGR-------GEKRKE--VELTQGPREDEPQKPR 1111
                          P   GP G RG +GR       GEK +   +    GPR +   +  
Sbjct: 1131 GPPGIRGPPGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNPGAQGA 1190

Query: 1112 KAARQEAGGDGAP--------ANPEEPGGSR--PGPGRSPQARGPSRSLETGAAAREGGP 1161
            K  R   G  G P        A P  P G    PGP   P A  P ++   G     G P
Sbjct: 1191 KGDRGAPGFPGLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPGQTGNRGPPGSRGSP 1250

Query: 1162 KCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDS------TEFTE 1215
                    AP  P    ++    +  + S+  P     P TA +  P        T    
Sbjct: 1251 G-------APGPPGPPGSHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGRLGAPGTPGLP 1303

Query: 1216 ALRSPPA-----ACAGEMG--------ASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPH 1262
              R  P         GE G          PG + P+ PP  R D GT K      +  P 
Sbjct: 1304 GPRGDPGFQGFPGVKGEKGNPGFLGSIGPPGPIGPKGPPGVRGDPGTLKIISLPGSPGPP 1363

Query: 1263 GSSPTPGVGSLLG--GPGGTQAPVSHNSKDPPARQPG 1297
            G+   PG+    G  GP G   P     K     +PG
Sbjct: 1364 GTPGEPGMQGEPGPPGPPGNLGPCGPRGKPGKDGKPG 1400



 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 200/845 (23%), Positives = 263/845 (31%), Gaps = 154/845 (18%)

Query: 477  PQSAPLPWPQVLPTARPSPH-GMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPR---- 531
            PQ   LP   VL  A P+   G     +      G + + G +G  G  G +PG +    
Sbjct: 9    PQVLLLPLLLVLLAAAPAASKGCVCKDKGQCFCDGAKGEKGEKGFPGPPG-SPGQKGFTG 67

Query: 532  -EKLPAVRSSQG--GSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASP 588
             E LP  +  +G  G P L    G+      P F G      +P  T       V G S 
Sbjct: 68   PEGLPGPQGPKGFPGLPGLTGSKGVRGISGLPGFSGSPGLPGTPGNTGPYGLVGVPGCSG 127

Query: 589  SESP-----LPSPATNTAGSTCSSLSPMSSSPANPSSEESQ------LPGPLGPSAFFHP 637
            S+       LP           + L     +PA     E        LPG  GP     P
Sbjct: 128  SKGEQGFPGLPGTLGYPGIPGAAGLKGQKGAPAKEEDIELDAKGDPGLPGAPGPQGLPGP 187

Query: 638  PTHPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEV 697
            P  P   G                 P P   F FP   +G  G    + E    H+G E 
Sbjct: 188  PGFPGPVG----------------PPGPPGFFGFPG-AMGPRGPKGHMGERVIGHKG-ER 229

Query: 698  GRGGLQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLL 757
            G  GL G P  PP                  V++T    D N + L              
Sbjct: 230  GVKGLTG-PPGPPG----------------TVIVTLTGPD-NRTDL-------------- 257

Query: 758  ARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFL 817
             + + G + + G PG P P   P     +  G           GD   +GK         
Sbjct: 258  -KGEKGDKGAMGEPGPPGPSGLPGESYGSEKG---------APGDPGLQGK--------- 298

Query: 818  PSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPR 877
            P     P   P S+  ++ +     L+ E  +G++ Q               D  P G R
Sbjct: 299  PGKDGVP-GFPGSE-GVKGNRGFPGLMGE--DGIKGQK-------------GDIGPPGFR 341

Query: 878  GPSSGHPLKSKAGVTPESKAPPPLPAATPDPQTPR--PGDRGCPARGRPKTRSLGLAPTE 935
            GP+  +    + G   E    PP P     PQ P   PG  G P   RP  R  G     
Sbjct: 342  GPTEYYDTYQEKG--DEGTPGPPGPRGARGPQGPSGPPGVPGSPGSSRPGLR--GAPGWP 397

Query: 936  ADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPP--- 992
                S+G + R GK        + + G+   +GS G   + G      D +  + PP   
Sbjct: 398  GLKGSKGERGRPGKDA------MGTPGSPGCAGSPGLPGSPGPPGPPGDIVFRKGPPGDH 451

Query: 993  -------RPRRPRTQA----PGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKA 1041
                    P  P        PG      P +P    LP        + +P R+     K 
Sbjct: 452  GLPGYLGSPGIPGVDGPKGEPGLLCTQCPYIPGPPGLPGLPGLHGVKGIPGRQGAAGLKG 511

Query: 1042 RGGAWGKELILKIVQQKNRLREYDFASESEEDEQPP-----PRGPGFRGRRGRGEKRKEV 1096
              G+ G   +           +     E  E  QP      P  PG RG+ GR +    +
Sbjct: 512  SPGSPGNTGLPGFPGFPGAQGDPGLKGEKGETLQPEGQVGVPGDPGLRGQPGR-KGLDGI 570

Query: 1097 ELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGAAA 1156
              T G +     K   A   E G  G P +P  PG   P     P   GP    E G   
Sbjct: 571  PGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGSPGPAGPAGPPGYGPQG--EPGLQG 628

Query: 1157 REGGPKCADRPSVA-PKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTE 1215
             +G P     P  A P+  L V T         P    P     P       P     + 
Sbjct: 629  TQGVPGAPGPPGEAGPRGELSVST---------PVPGPPGPPGPPGHPGPQGPPGIPGSL 679

Query: 1216 ALRSPPAACA--GEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSL 1273
                 P      GE G  PG+  P  PP  + D G P   GSL      G    PG   L
Sbjct: 680  GKCGDPGLPGPDGEPGI-PGIGFP-GPPGPKGDQGFPGTKGSLGCPGKMGEPGLPGKPGL 737

Query: 1274 LGGPG 1278
             G  G
Sbjct: 738  PGAKG 742



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 285/1227 (23%), Positives = 374/1227 (30%), Gaps = 204/1227 (16%)

Query: 1682 AEGDSRPPQDVCLPEPS--KQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRL 1739
            A G+  PP    LP  S   + G   D G   K   D    FP         E     R 
Sbjct: 266  AMGEPGPPGPSGLPGESYGSEKGAPGDPGLQGKPGKDGVPGFP-------GSEGVKGNRG 318

Query: 1740 LPCEQRGGFLPEPGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASP 1799
             P     G + E G   Q  +G   P  F  P  +         +G P      P G   
Sbjct: 319  FP-----GLMGEDGIKGQ--KGDIGPPGFRGPTEYYDTYQEKGDEGTPG-----PPGPRG 366

Query: 1800 SHAAQGHSAGRAGGHLHPTAGRPGFEGNEFAPA--GASSLTAPRGREAWLVPVPSPACVS 1857
            +   QG S G  G    P + RPG  G    P   G+       G++A   P  SP C  
Sbjct: 367  ARGPQGPS-GPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTP-GSPGCAG 424

Query: 1858 NTHPSRRSQDPALSPP------------------IRQLQLPGPGVAKSKDGILGLQELTP 1899
            +  P          PP                  +    +PG    K + G+L  Q   P
Sbjct: 425  S--PGLPGSPGPPGPPGDIVFRKGPPGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQ--CP 480

Query: 1900 AAQSPPRV-NPSGLEGGTVEGGKVACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLL 1958
                PP +    GL G     G+      +GSPG    T LP   G      A G  GL 
Sbjct: 481  YIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFP---GAQGDPGLK 537

Query: 1959 GQAEKTQGQGTANQLQPENGVS-PGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAA 2017
            G+  +T        LQPE  V  PG               + G T G   L   KG  A 
Sbjct: 538  GEKGET--------LQPEGQVGVPGDPGLRGQPGRKGLDGIPG-TPGVKGLPGPKGELAL 588

Query: 2018 MSLQEEAEPTPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAP 2077
               + +  P   P SP     A         +G  G  P+    PGL       G    P
Sbjct: 589  SGEKGDQGPPGDPGSPGSPGPA-------GPAGPPGYGPQ--GEPGLQGTQGVPGAPGPP 639

Query: 2078 SV----GDLAACAPSPTSAAHMPCSLGPLPREDPLTSPSRAQGGLGGQLPASPSCRDPPG 2133
                  G+L+   P P      P   GP     P   P    G LG      P    P G
Sbjct: 640  GEAGPRGELSVSTPVPGP----PGPPGPPGHPGP-QGPPGIPGSLG--KCGDPGLPGPDG 692

Query: 2134 PQQLLACSPAWAPLEEAD-GVQATTDT----GAEDSPVAP--PSLTTSPCDPKEALAGCL 2186
               +        P  + D G   T  +    G    P  P  P L  +  +P  A+ G  
Sbjct: 693  EPGIPGIGFPGPPGPKGDQGFPGTKGSLGCPGKMGEPGLPGKPGLPGAKGEPAVAMPG-- 750

Query: 2187 LQGEGS---PLEDPSSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSP 2243
              G G+   P E  +S   G +          TP +  L  P   R +     P     P
Sbjct: 751  --GPGTPGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLDGP---RGDPGQPGPPGEQGP 805

Query: 2244 PLAGAVSPSVAVRATGLSSTPTGDEAQAG-RGLPGPDPQSRGAPPHTNPDRMPRGHSSYS 2302
            P      P  A    GL+    G + Q G RG  GP    +G P     DR      + S
Sbjct: 806  PGRCIEGPRGAQGLPGLN----GLKGQQGRRGKTGP----KGDPGIPGLDRSGFPGETGS 857

Query: 2303 PSNTARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSSK--EPEDPGTPETGRS 2360
            P      G          P  P  L   G D    + G  G       P +PGTP  G+ 
Sbjct: 858  PGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPPGNPGTP--GQR 915

Query: 2361 GATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRNASHQTPQGDPLGPQDLKQRS 2420
            G+  +P V         G+   P +        +P     +     +G+P          
Sbjct: 916  GSPGIPGVK--------GQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEP--------GL 959

Query: 2421 RGYKKKPASTENGQWKGQAPHGPVTCEVCAASFRSGPGLSRHKARKHRPHPGAPAEPSPA 2480
            +G+   P    N                     R  PG+   K  K  P P  P  P   
Sbjct: 960  KGFAGNPGEKGN---------------------RGVPGMPGLKGLKGLPGPAGPPGPRGD 998

Query: 2481 ALPAQQPLEPLAQKCQPPRKKSHRVSGKERPNHSRGDPSHVTQP--PPAQGSKEVLRAPG 2538
                  P EP   +  P    +  + G +    + G P    +P  P   G +     PG
Sbjct: 999  LGSTGNPGEP-GLRGIPGSMGNMGMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPG 1057

Query: 2539 SPHSQQLHPPSPT-----EHEVDVKTPASKPRPDQAREDELHPKQAEKREGRRWRREPTV 2593
                 +  PP PT       ++  K    +P P       L P   E   G         
Sbjct: 1058 YSEGTRPGPPGPTGDPGLPGDMGKKGEMGQPGP----PGHLGPAGPEGAPGSPGSPGLPG 1113

Query: 2594 DSPSHSEGKSNKKRGKLRGRRLREESILP----------VSADVISDGRGSRPSPA---- 2639
                H +      +G L    +R    LP          +  D    GR   P PA    
Sbjct: 1114 KPGPHGDLGFKGIKGLLGPPGIRGPPGLPGFPGSPGPMGIRGD---QGRDGIPGPAGEKG 1170

Query: 2640 -MASYAASPSHCLSVEGGPEADGEQPPRLATLGPGVMEGAAETDQEALCAGETGAQKPPG 2698
                  A P       G P A G +  R A   PG + G      +A   G TG +  PG
Sbjct: 1171 ETGLLRAPP----GPRGNPGAQGAKGDRGAPGFPG-LPGRKGAMGDAGPRGPTGIEGFPG 1225

Query: 2699 DRMLCPGRMDGAALGEQPTGQKGA-SARGFWGPRETKALGVCKESGSEPAEDSSRAHSRS 2757
               L    + G      P G +G+  A G  GP  +  +G+  + GS           + 
Sbjct: 1226 PPGLPGAIIPGQTGNRGPPGSRGSPGAPGPPGPPGSHVIGIKGDKGS-----MGHPGPKG 1280

Query: 2758 EEGVWEENTPPLGPLGFPETSSSPADSTTSSCLQGLP------DNPDTQGGVQGPEGPTP 2811
              G   +  PP G LG P T   P         QG P       NP   G + GP GP  
Sbjct: 1281 PPGTAGDMGPP-GRLGAPGTPGLPGPRGDPG-FQGFPGVKGEKGNPGFLGSI-GPPGPI- 1336

Query: 2812 DASGSSAKDPPSLFDDEVSFSQLFPPG 2838
                   K PP +  D  +   +  PG
Sbjct: 1337 -----GPKGPPGVRGDPGTLKIISLPG 1358



 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 282/1189 (23%), Positives = 366/1189 (30%), Gaps = 225/1189 (18%)

Query: 65   PRQAR--DGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRYIL 122
            PR AR   G   PP + G   SS PG RG+P  P  +       R    A G+P      
Sbjct: 364  PRGARGPQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSP--- 420

Query: 123  GIASSRTKPTLDETPENP-----------------QLEAAQLPEVDTPQG-PG---TGAP 161
            G A S   P     P  P                  L +  +P VD P+G PG   T  P
Sbjct: 421  GCAGSPGLPGSPGPPGPPGDIVFRKGPPGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQCP 480

Query: 162  LRPGLPRTEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQP 221
              PG P     P     G         ++    +  SP  T  P  PG P ++G   L+ 
Sbjct: 481  YIPGPPGLPGLPGLH--GVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFPGAQGDPGLKG 538

Query: 222  GSYPEYQASGADSWP--PAAENSFPGANF-----GVPPAEPEPIPKGSRPGGSPRGVSFQ 274
                  Q  G    P  P      PG        G P  +  P PKG       +G   Q
Sbjct: 539  EKGETLQPEGQVGVPGDPGLRGQ-PGRKGLDGIPGTPGVKGLPGPKGELALSGEKG--DQ 595

Query: 275  FPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSP 334
             P P   G+   P PA  AG              P G  P+   G      +P  P P  
Sbjct: 596  GP-PGDPGSPGSPGPAGPAG--------------PPGYGPQGEPGLQGTQGVPGAPGP-- 638

Query: 335  LPCYQGQPGGLNRHSDLSGALSSPG-AAHSAPR---PFSDSLHKSLTKILPERPPSAQDG 390
             P   G  G L+  + + G    PG   H  P+       SL K     LP   P  + G
Sbjct: 639  -PGEAGPRGELSVSTPVPGPPGPPGPPGHPGPQGPPGIPGSLGKCGDPGLP--GPDGEPG 695

Query: 391  LGST--RGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGPPPARLPQLWDPTAAPY 448
            +      GPP     + FPG      G    PG    ++  PG P    P L      P 
Sbjct: 696  IPGIGFPGPPGPKGDQGFPG----TKGSLGCPG----KMGEPGLPGK--PGLPGAKGEPA 745

Query: 449  PTPPGGPLAATRSMFFNGQPS-PGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFP 507
               PGGP          G P  PG+R                      HG   L  LP  
Sbjct: 746  VAMPGGP----------GTPGFPGER-----------------GNSGEHGEIGLPGLPGL 778

Query: 508  AGGPEWQGGSQGALGTAGKTPGPREKLPAVRSSQG--GSPALFTYNGMTDPGAQPLFFGV 565
             G P    G  G  G  G+   P E+ P  R  +G  G+  L   NG+     +      
Sbjct: 779  PGTP-GNEGLDGPRGDPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGR------ 831

Query: 566  AQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSS--PANPS---- 619
             + +  P G P +P     G   S  P  + +    G     + P+     P NP     
Sbjct: 832  -RGKTGPKGDPGIP-----GLDRSGFPGETGSPGIPGHQ-GEMGPLGQRGYPGNPGILGP 884

Query: 620  -SEESQL-----PGPLGPSAFFHPPTHPQETGSP-FPSPEPPHSLPTHYQPEPAKAFPFP 672
              E+  +     PG +GP      P  P + GSP  P  +     P     +  K  P P
Sbjct: 885  PGEDGVIGMMGFPGAIGPPGPPGNPGTPGQRGSPGIPGVKGQRGTPGAKGEQGDKGNPGP 944

Query: 673  AD-----GLGAEGAFQCLEETPFPHEGPEV----GRGGLQGFP-RAPPPYPTHHFSLSS- 721
            ++     G   E   +     P       V    G  GL+G P  A PP P      +  
Sbjct: 945  SEISHVIGDKGEPGLKGFAGNPGEKGNRGVPGMPGLKGLKGLPGPAGPPGPRGDLGSTGN 1004

Query: 722  ----------ASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPG-- 769
                       S+  + +        +       F       GL       G +  PG  
Sbjct: 1005 PGEPGLRGIPGSMGNMGM-----PGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYS 1059

Query: 770  ---PPGLPSPPAAPRVPAD-AHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPF 825
                PG P P   P +P D    G +         G A  EG      +  LP       
Sbjct: 1060 EGTRPGPPGPTGDPGLPGDMGKKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGK----- 1114

Query: 826  PLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPL 885
            P P  DL  +    L  L    + G       P              P G RG      +
Sbjct: 1115 PGPHGDLGFKGIKGL--LGPPGIRGPPGLPGFP----------GSPGPMGIRGDQGRDGI 1162

Query: 886  KSKAGVTPES--KAPPPLPAATPDPQTPRPGDRGCPA-RGRP-KTRSLGLAPTEADAPSQ 941
               AG   E+     PP P   P  Q  + GDRG P   G P +  ++G A        +
Sbjct: 1163 PGPAGEKGETGLLRAPPGPRGNPGAQGAK-GDRGAPGFPGLPGRKGAMGDAGPRGPTGIE 1221

Query: 942  GRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGL----GERPPPRPRRP 997
            G     G    +      + G     GS G     G       G+    G    P P+ P
Sbjct: 1222 GFPGPPGLPGAIIPGQTGNRGPPGSRGSPGAPGPPGPPGSHVIGIKGDKGSMGHPGPKGP 1281

Query: 998  RTQAPGSRADPAPRVPRAAALPEETRSSRRRRLP-PRKDPRKRKARG--GAWGKELILKI 1054
                PG+  D  P        P    +     LP PR DP  +   G  G  G    L  
Sbjct: 1282 ----PGTAGDMGP--------PGRLGAPGTPGLPGPRGDPGFQGFPGVKGEKGNPGFLGS 1329

Query: 1055 VQQKNRLREYDFASESEEDEQPPPRGP-GFRGRRGRGEKRKEVELTQGPREDEPQKPRKA 1113
            +                    P P GP G  G RG     K + L   P    P  P + 
Sbjct: 1330 I------------------GPPGPIGPKGPPGVRGDPGTLKIISLPGSP--GPPGTPGEP 1369

Query: 1114 ARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGAAAREGGPK 1162
              Q   G   P     P G R  PG+  +   P  + E G    +G P+
Sbjct: 1370 GMQGEPGPPGPPGNLGPCGPRGKPGKDGKPGTPGPAGEKGNKGSKGEPE 1418



 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 116/476 (24%), Positives = 150/476 (31%), Gaps = 78/476 (16%)

Query: 3429 GAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEVA 3488
            G PG+K       +P  +    +PG A  PG     PRG          P L  +   + 
Sbjct: 964  GNPGEKGNRGVPGMPGLKGLKGLPGPAGPPG-----PRGDLGSTGNPGEPGLRGIPGSMG 1018

Query: 3489 ----PST-----TKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRG 3539
                P +     T G+P    RP  P  H ++G +    + E   P   P P       G
Sbjct: 1019 NMGMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPG-PPGPTGDPGLPG 1077

Query: 3540 DCALDGALERPENEASPGSPGPLLQQALPLGASLP-RPGARG----QDAEGKRAPLVFSG 3594
            D    G + +P      G  GP      P    LP +PG  G    +  +G   P    G
Sbjct: 1078 DMGKKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGPPGIRG 1137

Query: 3595 KRRAPGARGRCAPDHFQEDHLLQ-----KEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQ 3649
                PG  G   P   + D           ++  +  + +  GPRG           G Q
Sbjct: 1138 PPGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGN---------PGAQ 1188

Query: 3650 SSSKDRSAASTPS----KALKFPVHPRKAVGSLA-------PGELARGTENGMKPATPKA 3698
             +  DR A   P     K       PR   G          PG +  G      P   + 
Sbjct: 1189 GAKGDRGAPGFPGLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPGQTGNRGPPGSRG 1248

Query: 3699 KPG-PSSQGS-GSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARA 3756
             PG P   G  GS   G K   GS   P               P  P  +      P R 
Sbjct: 1249 SPGAPGPPGPPGSHVIGIKGDKGSMGHPG--------------PKGPPGTAGDMGPPGRL 1294

Query: 3757 QAKSCTKGPREAGEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKP 3816
             A      P   G  GP G   P  +G    K +KG  PG      +GS G  P  P  P
Sbjct: 1295 GA------PGTPGLPGPRGD--PGFQGFPGVKGEKGN-PG-----FLGSIG--PPGPIGP 1338

Query: 3817 PRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRP 3872
               P  +  P   L     P S   P  P     + EPG       LG   P+G+P
Sbjct: 1339 KGPPGVRGDPG-TLKIISLPGSPGPPGTPGEPGMQGEPGPPGPPGNLGPCGPRGKP 1393



 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 119/452 (26%), Positives = 148/452 (32%), Gaps = 83/452 (18%)

Query: 3428 PGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEV 3487
            PG+PGQK       LP  +     PG         P   GS  +     LP         
Sbjct: 57   PGSPGQKGFTGPEGLPGPQGPKGFPG--------LPGLTGSKGVRGISGLPGF------- 101

Query: 3488 APSTTKGWPETLERPVDPVTHPIRGCELPSNHQECP--PPSLS----PFPAALADGRGDC 3541
              S + G P T           + GC      Q  P  P +L     P  A L   +G  
Sbjct: 102  --SGSPGLPGTPGNTGPYGLVGVPGCSGSKGEQGFPGLPGTLGYPGIPGAAGLKGQKGAP 159

Query: 3542 AL--DGALERPENEASPGSPGPLLQQALPLGASLPRPGARGQDAEGKRAPLVFSGKRRAP 3599
            A   D  L+   +   PG+PGP   Q LP     P P        G   P  F G    P
Sbjct: 160  AKEEDIELDAKGDPGLPGAPGP---QGLPGPPGFPGP-------VGPPGPPGFFG---FP 206

Query: 3600 GARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKP---AGCQSSSKDRS 3656
            GA G   P     + ++  + E     +    GP GT    + T P      +    D+ 
Sbjct: 207  GAMGPRGPKGHMGERVIGHKGERGVKGLTGPPGPPGTVIV-TLTGPDNRTDLKGEKGDKG 265

Query: 3657 AASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATP--KAKPG-------PSSQGS 3707
            A   P      P  P     S  PGE + G+E G  P  P  + KPG       P S+G 
Sbjct: 266  AMGEPG-----PPGP-----SGLPGE-SYGSEKG-APGDPGLQGKPGKDGVPGFPGSEGV 313

Query: 3708 GSPR--PGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGP 3765
               R  PG     G + Q   G +       P +     +    E  P          GP
Sbjct: 314  KGNRGFPGLMGEDGIKGQ--KGDIGPPGFRGPTEYYDTYQEKGDEGTPG-------PPGP 364

Query: 3766 REA-GEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQA 3824
            R A G QGP G  G      SS    +G    P    S G  GR        P +P    
Sbjct: 365  RGARGPQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSPGCAG 424

Query: 3825 TPSRVLPTKPKPNSQNKPRPPPS-EQRKAEPG 3855
            +P   LP  P P     P PP     RK  PG
Sbjct: 425  SPG--LPGSPGP-----PGPPGDIVFRKGPPG 449



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 113/440 (25%), Positives = 133/440 (30%), Gaps = 88/440 (20%)

Query: 3414 RGGRQPFAFRG-VRRPGAPGQKARALEGTLP--SKRRRVAMPGSAPGPGEDRPPPRGSSP 3470
            +G R    F G   RPG PG      +   P  S+  R   PG    PG   P   G   
Sbjct: 1026 KGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGDPG--LPGDMGKKG 1083

Query: 3471 ILSEGSLPALLHLCSEVAPSTTKGWPETLERPVDPVTHP------IRGCELPSNHQECPP 3524
             + +   P  L       P    G P +   P  P  H       I+G   P   +   P
Sbjct: 1084 EMGQPGPPGHL---GPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGPPGIRG--P 1138

Query: 3525 PSLSPFPAALADG--RGDCALDG----ALERPEN---------EASPGSPGPLLQQALPL 3569
            P L  FP +      RGD   DG    A E+ E            +PG+ G    +  P 
Sbjct: 1139 PGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNPGAQGAKGDRGAPG 1198

Query: 3570 GASLP-RPGARGQDAEGKRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMV 3628
               LP R GA G    G R P    G    PG  G   P                     
Sbjct: 1199 FPGLPGRKGAMGD--AGPRGPTGIEGFPGPPGLPGAIIPGQ------------------T 1238

Query: 3629 SEGGPRGTFHKGSATKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAP-GELARGT 3687
               GP G+     A  P G   S          S     P  P    G + P G L    
Sbjct: 1239 GNRGPPGSRGSPGAPGPPGPPGSHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGRLGA-- 1296

Query: 3688 ENGMKPATPKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSR-- 3745
                 P TP   PGP         PG K   G +  P  G L S     P  P  P    
Sbjct: 1297 -----PGTP-GLPGPRGDPGFQGFPGVK---GEKGNP--GFLGSIGPPGPIGPKGPPGVR 1345

Query: 3746 -------------SPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPKEKGESSTKRKKG 3792
                         SP P   P     +       E G  GP G+LGP        K  K 
Sbjct: 1346 GDPGTLKIISLPGSPGPPGTPGEPGMQG------EPGPPGPPGNLGPCGPRGKPGKDGKP 1399

Query: 3793 QVPGPARSE-SVGSFGRAPS 3811
              PGPA  + + GS G   S
Sbjct: 1400 GTPGPAGEKGNKGSKGEPES 1419



 Score = 40.8 bits (94), Expect = 0.027
 Identities = 117/495 (23%), Positives = 146/495 (29%), Gaps = 74/495 (14%)

Query: 3428 PGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEV 3487
            PG PG K       LP  +  +A+ G     G    P    SP  +  + P       E 
Sbjct: 571  PGTPGVKG------LPGPKGELALSGEKGDQGPPGDPGSPGSPGPAGPAGPPGYGPQGEP 624

Query: 3488 APSTTKGWPETLERPVDP-------VTHPIRGCELPSNHQECPPPSLSP-FPAALADGRG 3539
                T+G P     P +        V+ P+ G   P      P P   P  P +L    G
Sbjct: 625  GLQGTQGVPGAPGPPGEAGPRGELSVSTPVPGPPGPPGPPGHPGPQGPPGIPGSL----G 680

Query: 3540 DCALDGALERPENEAS------PGSPGPLLQQALP-LGASLPRPGARGQDAEGKRAPLVF 3592
             C  D  L  P+ E        PG PGP   Q  P    SL  PG  G+           
Sbjct: 681  KCG-DPGLPGPDGEPGIPGIGFPGPPGPKGDQGFPGTKGSLGCPGKMGEPG--------L 731

Query: 3593 SGKRRAPGARGR--CAPDHFQEDHLLQKEKEVSSSH----MVSEGGPRGTFHKGSATKPA 3646
             GK   PGA+G    A            E+  S  H    +    G  GT        P 
Sbjct: 732  PGKPGLPGAKGEPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLDGPR 791

Query: 3647 GCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPAT-PKAKPG---- 3701
            G             P + ++    PR A G   PG      + G +  T PK  PG    
Sbjct: 792  GDPGQPGPPGEQGPPGRCIE---GPRGAQG--LPGLNGLKGQQGRRGKTGPKGDPGIPGL 846

Query: 3702 --------------PSSQGSGSP--RPGTKTGGGSQPQPAS----GQLQSETATTPAKPS 3741
                          P  QG   P  + G     G    P      G +    A  P  P 
Sbjct: 847  DRSGFPGETGSPGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPP 906

Query: 3742 FPSRSPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPKE----KGESSTKRKKGQVPGP 3797
                +P     P     K     P   GEQG  G+ GP E     G+      KG    P
Sbjct: 907  GNPGTPGQRGSPGIPGVKGQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPGLKGFAGNP 966

Query: 3798 ARSESVGSFGRAPSAPDKPPRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHT 3857
                + G  G       K    P     P   L +   P        P S      PG  
Sbjct: 967  GEKGNRGVPGMPGLKGLKGLPGPAGPPGPRGDLGSTGNPGEPGLRGIPGSMGNMGMPGSK 1026

Query: 3858 QRKDRLGKAFPQGRP 3872
             ++  LG     GRP
Sbjct: 1027 GKRGTLGFPGRAGRP 1041



 Score = 37.7 bits (86), Expect = 0.23
 Identities = 34/115 (29%), Positives = 43/115 (37%), Gaps = 9/115 (7%)

Query: 3176 RGQARRSLGDLPGGLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAK 3235
            RGQ  R   D   G+ G+  V  L     E A    +G +      GSPG P G  G A 
Sbjct: 559  RGQPGRKGLD---GIPGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGSP-GPAGPAG 614

Query: 3236 KDSPGERAKPRARSTPS-----NPDGAATPDSASATALADAGSPGPPRTTPSPSP 3285
                G + +P  + T        P G A P    + +    G PGPP     P P
Sbjct: 615  PPGYGPQGEPGLQGTQGVPGAPGPPGEAGPRGELSVSTPVPGPPGPPGPPGHPGP 669



 Score = 35.0 bits (79), Expect = 1.5
 Identities = 43/143 (30%), Positives = 51/143 (35%), Gaps = 28/143 (19%)

Query: 3183 LGDLPG-----GLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKD 3237
            L  LPG     G+ G    A L  S   P      G      A G PG   G++GE  + 
Sbjct: 488  LPGLPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFPGAQGDPGLK-GEKGETLQP 546

Query: 3238 S--------PGERAKPRARST---PSNPDGAATPDSASATALA----DAGSPGPPRTTPS 3282
                     PG R +P  +     P  P     P      AL+    D G PG P +  S
Sbjct: 547  EGQVGVPGDPGLRGQPGRKGLDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGS 606

Query: 3283 PSPDPWAG-------GEPLLQAT 3298
            P P   AG       GEP LQ T
Sbjct: 607  PGPAGPAGPPGYGPQGEPGLQGT 629



 Score = 35.0 bits (79), Expect = 1.5
 Identities = 51/199 (25%), Positives = 65/199 (32%), Gaps = 21/199 (10%)

Query: 1752 PGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPSHAAQGHSAGRA 1811
            PG+   P  GAP P   G P  H+   +  +GD    +    P G  P  A      GR 
Sbjct: 1244 PGSRGSP--GAPGPP--GPPGSHV---IGIKGDKGS-MGHPGPKGP-PGTAGDMGPPGRL 1294

Query: 1812 GGHLHPTAGRPGFEGNEFAPA--GASSLTAPRGREAWLVPVPSPACVSNTHPSRRSQDPA 1869
            G       G PG  G    P   G   +   +G   +L  +  P  +    P     DP 
Sbjct: 1295 GA-----PGTPGLPGPRGDPGFQGFPGVKGEKGNPGFLGSIGPPGPIGPKGPPGVRGDPG 1349

Query: 1870 LSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPP-RVNPSGLEGGTVEGGKVACGPAQ 1928
                I     PGP     + G+ G     P    PP  + P G  G   + GK       
Sbjct: 1350 TLKIISLPGSPGPPGTPGEPGMQG----EPGPPGPPGNLGPCGPRGKPGKDGKPGTPGPA 1405

Query: 1929 GSPGGVQVTTLPAVAGHQL 1947
            G  G       P    HQL
Sbjct: 1406 GEKGNKGSKGEPESLFHQL 1424



 Score = 32.3 bits (72), Expect = 9.5
 Identities = 35/116 (30%), Positives = 39/116 (33%), Gaps = 28/116 (24%)

Query: 3205 EPAPKHHRGK--RSAGKAAGSPGDPWGQEGEAKKDS----PGERAKPRARSTPS------ 3252
            EP P    G    S G   G+PGDP G +G+  KD     PG       R  P       
Sbjct: 269  EPGPPGPSGLPGESYGSEKGAPGDP-GLQGKPGKDGVPGFPGSEGVKGNRGFPGLMGEDG 327

Query: 3253 --------NPDGAATPDSASAT--ALADAGSPGPP-----RTTPSPSPDPWAGGEP 3293
                     P G   P     T     D G+PGPP     R    PS  P   G P
Sbjct: 328  IKGQKGDIGPPGFRGPTEYYDTYQEKGDEGTPGPPGPRGARGPQGPSGPPGVPGSP 383


>gi|89363017 alpha 2 type V collagen preproprotein [Homo sapiens]
          Length = 1499

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 324/1383 (23%), Positives = 417/1383 (30%), Gaps = 352/1383 (25%)

Query: 31   SQPPLEDNTPATRTTKGAREAGGQAQAMELPEAQPRQARDGELKPPSLRGQAPSSTPGKR 90
            SQ P   NT   R  KG +   G      +P     + R G   PP  +G      P  R
Sbjct: 97   SQTPGGGNTNFGRGRKGQKGEPGL-----VPVVTGIRGRPGPAGPPGSQGPRGERGPKGR 151

Query: 91   GSPQTPPGRSPLQAPSRLAGRAEGSPPQRYILGIASSRTKPTLDETPENPQLE------A 144
              P+ P G              +G P      G+      P     P +P  +      +
Sbjct: 152  PGPRGPQG-------------IDGEP------GVPGQPGAPGPPGHPSHPGPDGLSRPFS 192

Query: 145  AQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPR 204
            AQ+  +D   G G+   L PG          + L   +    P         T P   P 
Sbjct: 193  AQMAGLDEKSGLGSQVGLMPGSVGPVGPRGPQGLQGQQGGAGP---------TGPPGEPG 243

Query: 205  PPAP-GPPQSRGTS--PLQPGSYPEYQASGADSWPPAAENSFPGANFGVPPAEPEPIPKG 261
             P P GP  SRG    P +PG   E   +G       A +  PGA  G P A   P  KG
Sbjct: 244  DPGPMGPIGSRGPEGPPGKPGEDGEPGRNGNPGEVGFAGS--PGAR-GFPGAPGLPGLKG 300

Query: 262  SRPGGSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTG 321
             R      G   +   P   G +    P    G     GP      + +   P+ A G  
Sbjct: 301  HRGHKGLEGPKGEVGAPGSKGEAGPTGPMGAMGPL---GPRGMPGERGR-LGPQGAPGQR 356

Query: 322  PAYPLPTQPAP-SPLPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKIL 380
             A+ +P +P P  PL    G PG        SG   +PG    A    +           
Sbjct: 357  GAHGMPGKPGPMGPL----GIPGS-------SGFPGNPGMKGEAGPTGA----------- 394

Query: 381  PERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGPPPARLPQL 440
              R P    G     GPP  +     PG    A G D +PG       A GP  +  P  
Sbjct: 395  --RGPEGPQGQRGETGPPGPVGSPGLPG----AIGTDGTPG-------AKGPTGS--PGT 439

Query: 441  WDPTAAPYPTPPGGPLAATRSMFFNGQP-SPGQRLCLPQSAPLPWPQVLPTARPSPHGME 499
              P  +  P    GP  +T      GQP  PG         P    +  P   P PHG++
Sbjct: 440  SGPPGSAGPPGSPGPQGSTGPQGIRGQPGDPG--------VPGFKGEAGPKGEPGPHGIQ 491

Query: 500  MLSRLPFPAG--GPEWQGGSQGALGTAGK--TPGPR-----EKLPAVRSSQG-------- 542
                 P   G  GP    G+ G  G  G+   PG R     + LP  + +QG        
Sbjct: 492  GPIGPPGEEGKRGPRGDPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSS 551

Query: 543  ------------GSPALFTYNGMT-DPGAQPLFFGVAQPQVSPHGTPSLP----PPRVVG 585
                        G P L    G+T +PG Q       + ++ P G P       PP  +G
Sbjct: 552  GPKGSQGDPGRPGEPGLPGARGLTGNPGVQG-----PEGKLGPLGAPGEDGRPGPPGSIG 606

Query: 586  --ASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQ--LPGPLGPSAFFHPPTHP 641
                P    LP P     GS+     P  +  A    +       G +GPS    PP   
Sbjct: 607  IRGQPGSMGLPGP----KGSSGDPGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPGLA 662

Query: 642  QETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGG 701
             E G   P        PT +Q  P    P                    P EG + G  G
Sbjct: 663  GERGEQGPPG------PTGFQGLPGPPGP--------------------PGEGGKPGDQG 696

Query: 702  LQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAK 761
            + G P A  P        +                +R    +      +   G       
Sbjct: 697  VPGDPGAVGPLGPRGERGNPG--------------ERGEPGITGLPGEKGMAG---GHGP 739

Query: 762  DGHQRSPGPPGLP---SPPAAPRVPAD-AHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFL 817
            DG + SPGP G P    PP    +P +   AG           G+  AEG         L
Sbjct: 740  DGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGL 799

Query: 818  PSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPR 877
            P     P P   +                                       ++   GPR
Sbjct: 800  PGPLGPPGPAGPT--------------------------------------GEKGEPGPR 821

Query: 878  GPSSGHPLKSKAGVTPESKAPPPLPAATPDPQTPRPGDRGCPARGRPKTRSLGLAPTEAD 937
            G       +   G   E+     +  A P     +PG +G P  G P  +         D
Sbjct: 822  GLVGPPGSRGNPGSRGENGPTGAVGFAGPQGPDGQPGVKGEP--GEPGQK--------GD 871

Query: 938  APSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPPRPRRP 997
            A S G Q                 G A   G  G     GL+     G G + PP     
Sbjct: 872  AGSPGPQ-----------------GLAGSPGPHGPNGVPGLK----GGRGTQGPP----G 906

Query: 998  RTQAPGSRADPAPRVPRAAALPEETRSSRRRRLPP--RKDPRKRKARG--------GAWG 1047
             T  PGS     P  P  A  P        +  PP  R DP      G        G  G
Sbjct: 907  ATGFPGSAGRVGPPGPAGAPGPAGPLGEPGKEGPPGLRGDPGSHGRVGDRGPAGPPGGPG 966

Query: 1048 KELILKIVQQKNRLREYDFASESEEDEQPPPRGP----GFRGRRG-------RGEKRKEV 1096
             +                   +  ED QP P GP    G  G+RG       RGE  + +
Sbjct: 967  DK------------------GDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGE--RGM 1006

Query: 1097 ELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLET---- 1152
                GP       P K     A GD  P  P  P GS  GP   P   GP+ +  T    
Sbjct: 1007 PGLPGP----AGTPGKVGPTGATGDKGPPGPVGPPGSN-GPVGEPGPEGPAGNDGTPGRD 1061

Query: 1153 GAAAREG-----GPKCADRPSVAPKDPLQVPTNTETSEETRP---------------SLD 1192
            GA    G     GP        AP  P  V    +  +   P                L 
Sbjct: 1062 GAVGERGDRGDPGPAGLPGSQGAPGTPGPVGAPGDAGQRGDPGSRGPIGPPGRAGKRGLP 1121

Query: 1193 FPQ-----EAKEPETAEESAPDSTEFT--EALRSPPAACAGEMGAS--PGLLIPEQPPPS 1243
             PQ     +    +  +        FT  + L  PP    GE G++  PG   P  PP  
Sbjct: 1122 GPQGPRGDKGDHGDRGDRGQKGHRGFTGLQGLPGPPGP-NGEQGSAGIPGPFGPRGPP-- 1178

Query: 1244 RHDTGTPKPSGSLANTAPHGSSPTPGV-GSLLGGPGGTQAPVSHNSKDPPARQPGEFLAP 1302
                G   PSG   N  P G    PGV GS+  G  G + P        P   PG   A 
Sbjct: 1179 ----GPVGPSGKEGNPGPLGPIGPPGVRGSV--GEAGPEGPPGEPGPPGPPGPPGHLTAA 1232

Query: 1303 VAN 1305
            + +
Sbjct: 1233 LGD 1235



 Score = 79.0 bits (193), Expect = 9e-14
 Identities = 284/1159 (24%), Positives = 349/1159 (30%), Gaps = 223/1159 (19%)

Query: 1751 EPGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPSHAAQGHSAGR 1810
            EPG   QP  GAP P   G P+ H  PD             + PF A  +   +    G 
Sbjct: 163  EPGVPGQP--GAPGPP--GHPS-HPGPD-----------GLSRPFSAQMAGLDEKSGLGS 206

Query: 1811 AGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPACVSNTHPSRRSQDPAL 1870
              G +  + G  G       P G   L   +G                T P     DP  
Sbjct: 207  QVGLMPGSVGPVG-------PRGPQGLQGQQGG------------AGPTGPPGEPGDPGP 247

Query: 1871 SPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNPSGLEGGTVEGGKVACGPAQGS 1930
              PI      GP     +DG                    G  G   E G      A+G 
Sbjct: 248  MGPIGSRGPEGPPGKPGEDG------------------EPGRNGNPGEVGFAGSPGARGF 289

Query: 1931 PGGVQVTTLPAVAGHQLGLEAD----GHWGLLGQAEKTQGQGTANQLQP-----ENG-VS 1980
            PG   +  L    GH+ GLE      G  G  G+A  T   G    L P     E G + 
Sbjct: 290  PGAPGLPGLKGHRGHK-GLEGPKGEVGAPGSKGEAGPTGPMGAMGPLGPRGMPGERGRLG 348

Query: 1981 PGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPTPS----------- 2029
            P G       +  P     GP  G + +    G      ++ EA PT +           
Sbjct: 349  PQGAPGQRGAHGMP--GKPGPM-GPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRG 405

Query: 2030 ---PPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGD--SPAP--SVGDL 2082
               PP P                G++G T     SPG + P  + G   SP P  S G  
Sbjct: 406  ETGPPGPVGSPGLPGAIGTDGTPGAKGPT----GSPGTSGPPGSAGPPGSPGPQGSTGPQ 461

Query: 2083 AACA-PSPTSAAHMPCSLGPLPREDP--LTSPSRAQGGLGGQLP-ASPSCRDPPGPQQLL 2138
                 P            GP     P  +  P    G  G + P   P    PPGP    
Sbjct: 462  GIRGQPGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPVGER 521

Query: 2139 ACSPAWAPLEEADGVQATTDTGAEDSPVAPPSLTTSPCDP----KEALAGCL-------L 2187
              +P       +DG+        E  PV       S  DP    +  L G         +
Sbjct: 522  G-APGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGV 580

Query: 2188 QGE-------GSPLEDPSSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKE--KLWES-- 2236
            QG        G+P ED    PPGS+           P    L  P+ S  +  K  E+  
Sbjct: 581  QGPEGKLGPLGAPGEDGRPGPPGSIGI------RGQPGSMGLPGPKGSSGDPGKPGEAGN 634

Query: 2237 ---PGRATSPPLAGAVSPSVAVRATGLSSTPTGDEAQAG----RGLPGPD--PQSRGAPP 2287
               PG+  +P   G V PS  V   GL+    G++   G    +GLPGP   P   G P 
Sbjct: 635  AGVPGQRGAPGKDGEVGPSGPVGPPGLAGE-RGEQGPPGPTGFQGLPGPPGPPGEGGKPG 693

Query: 2288 HTNPDRMPRGHSSYSP-SNTARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSS 2346
                   P       P       G R    +T +P E     G GPD P    G  GT  
Sbjct: 694  DQGVPGDPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGSPGPSGT-- 751

Query: 2347 KEPEDPGTPE-TGRSGATKMPRVTCPSTGL-GLGRTTAPSSTASDFQSDSPQSHRNASHQ 2404
              P D G P   G  G   +     P     G+G   A  +  +D     P         
Sbjct: 752  --PGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLP------GPL 803

Query: 2405 TPQGDPLGPQDLKQR--SRGYKKKPASTENGQWKGQAPHGPVTCEVCAASFRSGPGLSRH 2462
             P G P GP   K     RG    P S  N   +G+  +GP      A  F    G    
Sbjct: 804  GPPG-PAGPTGEKGEPGPRGLVGPPGSRGNPGSRGE--NGPTG----AVGFAGPQGPDGQ 856

Query: 2463 KARKHRPHPGAPAEPSPAALPAQQPLE----PLAQKCQPPRKKSHRVSGKERPNHSRGDP 2518
               K    PG P +   A  P  Q L     P      P  K      G        G  
Sbjct: 857  PGVK--GEPGEPGQKGDAGSPGPQGLAGSPGPHGPNGVPGLKGGRGTQGPPGATGFPGSA 914

Query: 2519 SHVTQPPP--AQGSKEVLRAPGSPHSQQLHPPSPTEHEVDVKTPASKPRPDQAREDELHP 2576
              V  P P  A G    L  PG      L     +   V  + PA  P     + D    
Sbjct: 915  GRVGPPGPAGAPGPAGPLGEPGKEGPPGLRGDPGSHGRVGDRGPAGPPGGPGDKGDPGED 974

Query: 2577 KQAEKREGRRWRREPTVDSPSHSEGKSNKKR--GKLRGRRLREESILPVSADVISDGRGS 2634
             Q            P  D P    G + ++   G    R  R    LP  A     G   
Sbjct: 975  GQ------------PGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPA-----GTPG 1017

Query: 2635 RPSPAMASYAASPSHCLSVEGGPEADGEQPPRLATLGPGVMEGAAETDQEALCAGETGAQ 2694
            +  P  A+    P   +   G     GE  P     GP   +G    D      GE G +
Sbjct: 1018 KVGPTGATGDKGPPGPVGPPGSNGPVGEPGPE----GPAGNDGTPGRDG---AVGERGDR 1070

Query: 2695 KPPGDRMLCPGRMDGAALGEQPTGQKG-ASARGFWGPRETKALGVCKESGSEPAEDSSRA 2753
              PG   L PG   GA     P G  G A  RG  G R              P     RA
Sbjct: 1071 GDPGPAGL-PG-SQGAPGTPGPVGAPGDAGQRGDPGSR-------------GPIGPPGRA 1115

Query: 2754 HSRSEEGVWEENTPPLGPLGFPETSSSPADSTTS-----SCLQGLPDNPDTQG-----GV 2803
              R   G       P GP G         D         + LQGLP  P   G     G+
Sbjct: 1116 GKRGLPG-------PQGPRGDKGDHGDRGDRGQKGHRGFTGLQGLPGPPGPNGEQGSAGI 1168

Query: 2804 QGPEGP--TPDASGSSAKD 2820
             GP GP   P   G S K+
Sbjct: 1169 PGPFGPRGPPGPVGPSGKE 1187



 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 230/869 (26%), Positives = 273/869 (31%), Gaps = 162/869 (18%)

Query: 1    MPGER-PRGAPPPT----MTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQA 55
            M GE  P GA  P       G+  P     SPG P      D TP  +   G+    G  
Sbjct: 385  MKGEAGPTGARGPEGPQGQRGETGPPGPVGSPGLPGAIGT-DGTPGAKGPTGSPGTSGPP 443

Query: 56   QAMELPEA---------QPRQARDGELKPPSLRGQA-PSSTPGKRG--SPQTPPGRSPLQ 103
             +   P +         Q  + + G+   P  +G+A P   PG  G   P  PPG    +
Sbjct: 444  GSAGPPGSPGPQGSTGPQGIRGQPGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKR 503

Query: 104  APSRLAGRAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLR 163
             P    G   G P      G   +R  P  D  P     +  + P   +      G P R
Sbjct: 504  GPRGDPGTV-GPPGPVGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQGDPGR 562

Query: 164  PGLPRTEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGS 223
            PG P     P A  L  +   Q P          +P    RP  PG    RG    QPGS
Sbjct: 563  PGEP---GLPGARGLTGNPGVQGPEGKLGPLG--APGEDGRPGPPGSIGIRG----QPGS 613

Query: 224  Y--PEYQASGADSWPP--AAENSFPGANFGVPPAEPEPIPKG--SRPG--------GSPR 269
               P  + S  D   P  A     PG   G P  + E  P G    PG        G P 
Sbjct: 614  MGLPGPKGSSGDPGKPGEAGNAGVPGQR-GAPGKDGEVGPSGPVGPPGLAGERGEQGPPG 672

Query: 270  GVSFQ-FPFP-ALHGASTKPFPADVAGHAFTNGPLVFAFHQPQG--------------AW 313
               FQ  P P    G   KP    V G     GPL      P+G                
Sbjct: 673  PTGFQGLPGPPGPPGEGGKPGDQGVPGDPGAVGPL-----GPRGERGNPGERGEPGITGL 727

Query: 314  PEE---AVGTGPAYPLPTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSD 370
            P E   A G GP  P  + P PS  P   G PG       L G     G A   P P  D
Sbjct: 728  PGEKGMAGGHGPDGPKGS-PGPSGTPGDTGPPG-------LQGMPGERGIA-GTPGPKGD 778

Query: 371  SLHKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAP 430
                     + E+      G    RG P  L     PG A   +G    PGP        
Sbjct: 779  RGG------IGEKGAEGTAGNDGARGLPGPLGP---PGPA-GPTGEKGEPGPR----GLV 824

Query: 431  GPPPARLPQLWDPTAAPYPTPPG-----GPLAATRSMFFNGQPS-PGQRLCLPQSAPLPW 484
            GPP +R     +P +     P G     GP          G+P  PGQ+      A  P 
Sbjct: 825  GPPGSR----GNPGSRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQK----GDAGSPG 876

Query: 485  PQVLPTARPSPHGMEMLSRLPFPAGGPEWQG--------GSQGALGTAGKTPGPREKLPA 536
            PQ L    P PHG    + +P   GG   QG        GS G +G  G    P    P 
Sbjct: 877  PQGL-AGSPGPHGP---NGVPGLKGGRGTQGPPGATGFPGSAGRVGPPGPAGAPGPAGPL 932

Query: 537  VRSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSP 596
                + G P L       DPG+     G   P   P G      P   G    + P P P
Sbjct: 933  GEPGKEGPPGL-----RGDPGSHGRV-GDRGPAGPPGGPGDKGDPGEDGQPGPDGP-PGP 985

Query: 597  ATNTAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHS 656
            A  T       +         P      LPGP G      P     + G P P   P  +
Sbjct: 986  AGTTGQRGIVGMPGQRGERGMPG-----LPGPAGTPGKVGPTGATGDKGPPGPVGPPGSN 1040

Query: 657  LPTHYQPEPAKAFPFPADGL-GAEGAF-----------------QCLEETPFPHEGPEVG 698
             P     EP    P   DG  G +GA                  Q    TP P   P  G
Sbjct: 1041 GPVG---EPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPGSQGAPGTPGPVGAP--G 1095

Query: 699  RGGLQGFP--RAP--PPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCG 754
              G +G P  R P  PP       L      + D      + DR          HR F G
Sbjct: 1096 DAGQRGDPGSRGPIGPPGRAGKRGLPGPQGPRGDKGDHGDRGDRGQKG------HRGFTG 1149

Query: 755  LLLARAKDGHQRSPGPPGLPSPPAAPRVP 783
            L       G     G  G+P  P  PR P
Sbjct: 1150 LQGLPGPPGPNGEQGSAGIPG-PFGPRGP 1177



 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 256/1071 (23%), Positives = 312/1071 (29%), Gaps = 257/1071 (23%)

Query: 505  PFPAGGPEWQGGSQGALGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTDPGAQPLFFG 564
            P PAG P    GSQG  G  G    P  + P     + G P          PGA      
Sbjct: 131  PGPAGPP----GSQGPRGERGPKGRPGPRGPQGIDGEPGVPG--------QPGAP----- 173

Query: 565  VAQPQVSPHGTPSLPPP----RVVGASPSESPLPSPATNTAGSTCSSLSPMS-------- 612
                   P G PS P P    R   A  +     S   +  G    S+ P+         
Sbjct: 174  ------GPPGHPSHPGPDGLSRPFSAQMAGLDEKSGLGSQVGLMPGSVGPVGPRGPQGLQ 227

Query: 613  -----SSPANPSSEESQLPGPLGPSAFFHP---PTHPQETGSPFPSPEPPH--------- 655
                 + P  P  E    PGP+GP     P   P  P E G P  +  P           
Sbjct: 228  GQQGGAGPTGPPGEPGD-PGPMGPIGSRGPEGPPGKPGEDGEPGRNGNPGEVGFAGSPGA 286

Query: 656  -------SLPTHYQPEPAKAFPFPADGLGAEGAFQCLEET-PFPHEGP--------EVGR 699
                    LP        K    P   +GA G+      T P    GP        E GR
Sbjct: 287  RGFPGAPGLPGLKGHRGHKGLEGPKGEVGAPGSKGEAGPTGPMGAMGPLGPRGMPGERGR 346

Query: 700  GGLQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLAR 759
             G QG   AP     H        +  L +           S        +   G   AR
Sbjct: 347  LGPQG---APGQRGAHGMPGKPGPMGPLGI--------PGSSGFPGNPGMKGEAGPTGAR 395

Query: 760  AKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPS 819
              +G Q   G  G P P  +P +P     G +    T    G   + G   P      P 
Sbjct: 396  GPEGPQGQRGETGPPGPVGSPGLP-----GAIGTDGTPGAKGPTGSPGTSGP------PG 444

Query: 820  LAATP-FPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRG 878
             A  P  P P      +              G+  Q  +P +       F  E  +GP+G
Sbjct: 445  SAGPPGSPGPQGSTGPQ--------------GIRGQPGDPGVPG-----FKGE--AGPKG 483

Query: 879  PSSGHPLKSKAGVT-PESKAPPPLPAATPDPQTPRPGDRGCPA-RGRPKTRSLGLAPTEA 936
                H ++   G    E K  P     T  P  P  G+RG P  RG P +  L       
Sbjct: 484  EPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGP-VGERGAPGNRGFPGSDGL------- 535

Query: 937  DAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPP---PR 993
                +G Q  RG         + S G     G  G     GL   R  GL   P    P 
Sbjct: 536  -PGPKGAQGERGP--------VGSSGPKGSQGDPGRPGEPGLPGAR--GLTGNPGVQGPE 584

Query: 994  PRRPRTQAPGSRADPAPR-------VPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAW 1046
             +     APG    P P         P +  LP    SS     P          + GA 
Sbjct: 585  GKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAP 644

Query: 1047 GKELILKIVQQKNRLREYDFASESEEDEQPPPRG----PGFRGRRGRGEKRKEVELTQGP 1102
            GK+     V     +     A E  E   P P G    PG  G  G G K  +  +   P
Sbjct: 645  GKD---GEVGPSGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQGVPGDP 701

Query: 1103 REDEPQKPR-----KAARQEAGGDGAPAN--------PEEPGGSRPGPGRSPQARGP--- 1146
                P  PR        R E G  G P          P+ P GS PGP  +P   GP   
Sbjct: 702  GAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGS-PGPSGTPGDTGPPGL 760

Query: 1147 -----SRSL--------------ETGAAAREGGPKCADRPS-VAPKDPLQVPTNTETSEE 1186
                  R +              E GA    G       P  + P  P   PT  +    
Sbjct: 761  QGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAG-PTGEKGEPG 819

Query: 1187 TRPSLDFPQEAKEPETAEESAPDSTEFTEALRSPPAACAGEMG--ASPGLLIPEQPPPSR 1244
             R  +  P     P +  E+ P                AG  G    PG+      P  +
Sbjct: 820  PRGLVGPPGSRGNPGSRGENGPTGA----------VGFAGPQGPDGQPGVKGEPGEPGQK 869

Query: 1245 HDTGTPKPSGSLANTAPHGSSPTPGV---GSLLGGPGGTQAPVSHNSKDPPARQPGEFLA 1301
             D G+P P G   +  PHG +  PG+       G PG T  P S     PP         
Sbjct: 870  GDAGSPGPQGLAGSPGPHGPNGVPGLKGGRGTQGPPGATGFPGSAGRVGPP--------G 921

Query: 1302 PVANPSSTACPKPSVLSSKISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSELFLGPKD 1361
            P   P                     PAG    PLG P  +  P     P S   +G + 
Sbjct: 922  PAGAPG--------------------PAG----PLGEPGKEGPPGLRGDPGSHGRVGDRG 957

Query: 1362 LAGCFLEELHPKPSARDAPPASSSCLCQDGEDAGSLEPQLPRSPPGTAETEPGRA-ASPP 1420
             AG               PP         GED    +P  P  PPG A T   R     P
Sbjct: 958  PAG---------------PPGGPGDKGDPGEDG---QPG-PDGPPGPAGTTGQRGIVGMP 998

Query: 1421 TLESSSLFPDLPVDRFDPPLYGSLSANRDSGLPFACADPPQKTVPSDPPYP 1471
                    P LP     P   G   A  D G P     PP    P   P P
Sbjct: 999  GQRGERGMPGLPGPAGTPGKVGPTGATGDKGPP-GPVGPPGSNGPVGEPGP 1048



 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 212/840 (25%), Positives = 275/840 (32%), Gaps = 190/840 (22%)

Query: 3   GER-PRGAPPPTMTGDLQ-----PRQVASS--PGHPSQP-PLEDNTPATRTTKGAREAGG 53
           GER P+G P P     +      P Q  +   PGHPS P P   + P +    G  E  G
Sbjct: 144 GERGPKGRPGPRGPQGIDGEPGVPGQPGAPGPPGHPSHPGPDGLSRPFSAQMAGLDEKSG 203

Query: 54  QAQAMEL------------PEA-QPRQARDGELKPPSLRGQ-APSSTPGKRGSPQTPPGR 99
               + L            P+  Q +Q   G   PP   G   P    G RG P+ PPG+
Sbjct: 204 LGSQVGLMPGSVGPVGPRGPQGLQGQQGGAGPTGPPGEPGDPGPMGPIGSRG-PEGPPGK 262

Query: 100 SPLQA-PSRLAGRAE----GSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQ 154
                 P R     E    GSP  R   G   +   P L     +  LE  +  EV  P 
Sbjct: 263 PGEDGEPGRNGNPGEVGFAGSPGAR---GFPGAPGLPGLKGHRGHKGLEGPK-GEVGAPG 318

Query: 155 GPGTGAPLRP----------GLP----RTEAQPAAEELGFHRCFQEP------------- 187
             G   P  P          G+P    R   Q A  + G H    +P             
Sbjct: 319 SKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGQRGAHGMPGKPGPMGPLGIPGSSG 378

Query: 188 -PSSFTSTNYTSPSATPRPPAP-------GPPQSRGTSPLQPGSYPEYQASGADSWPPAA 239
            P +        P+    P  P       GPP   G SP  PG      A G D  P A 
Sbjct: 379 FPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPVG-SPGLPG------AIGTDGTPGAK 431

Query: 240 ENSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPADVAGHAFTN 299
             +      G P +   P   G +    P+G+  Q   P + G   +  P    G     
Sbjct: 432 GPTGSPGTSGPPGSAGPPGSPGPQGSTGPQGIRGQPGDPGVPGFKGEAGPKGEPGPHGIQ 491

Query: 300 GPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPG 359
           GP+           P E    GP     T   P P+   +G PG  NR    S  L  P 
Sbjct: 492 GPI---------GPPGEEGKRGPRGDPGTVGPPGPVG-ERGAPG--NRGFPGSDGLPGPK 539

Query: 360 AAHSAPRPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTS 419
            A                    ER P    G   ++G P    +   PG    A G+  +
Sbjct: 540 GAQG------------------ERGPVGSSGPKGSQGDPGRPGEPGLPG----ARGLTGN 577

Query: 420 PGPPDTE-----LAAPGP-----PPARLPQLWDPTAAPYPTP------PGGPLAATRSMF 463
           PG    E     L APG      PP  +     P +   P P      PG P  A  +  
Sbjct: 578 PGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGV 637

Query: 464 FNGQPSPGQRLCLPQSAPLPWPQVL----PTARPSPHGMEMLSRLPFP---AGGPEWQG- 515
              + +PG+   +  S P+  P +         P P G + L   P P    G P  QG 
Sbjct: 638 PGQRGAPGKDGEVGPSGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQGV 697

Query: 516 ----GSQGALGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQVS 571
               G+ G LG  G+   P E+     +   G   +   +G   P   P           
Sbjct: 698 PGDPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGSP----------G 747

Query: 572 PHGTPSLPPPRVVGASPSESPL---PSP-----------ATNTAGSTCSSLSP---MSSS 614
           P GTP    P  +   P E  +   P P           A  TAG+  +   P       
Sbjct: 748 PSGTPGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPG 807

Query: 615 PANPSSEESQLPGP---LGPSAFFHPPTHPQETGSP----FPSPEPPHSLPTHYQPEPAK 667
           PA P+ E+ + PGP   +GP      P    E G      F  P+ P   P   + EP +
Sbjct: 808 PAGPTGEKGE-PGPRGLVGPPGSRGNPGSRGENGPTGAVGFAGPQGPDGQP-GVKGEPGE 865

Query: 668 AFPFPADGLGAEGAFQCLEETPFPH-----EGPEVGRG-----GLQGFP----RAPPPYP 713
             P      G+ G  Q L  +P PH      G + GRG     G  GFP    R  PP P
Sbjct: 866 --PGQKGDAGSPGP-QGLAGSPGPHGPNGVPGLKGGRGTQGPPGATGFPGSAGRVGPPGP 922



 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 186/734 (25%), Positives = 227/734 (30%), Gaps = 141/734 (19%)

Query: 2    PGERPRGAPPPTMTGDLQPRQVA-----SSPGHPSQPPLEDNT--PATRTTKGAREAGGQ 54
            PGE  R  PP ++    QP  +       S G P +P    N   P  R   G     G 
Sbjct: 593  PGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAPGKDGEVGP 652

Query: 55   AQAMELPEAQPRQARDGELKPPSLRG-QAPSSTPGKRGSP--QTPPGRSPLQAPSRLAGR 111
            +  +  P     +   G   P   +G   P   PG+ G P  Q  PG      P  L  R
Sbjct: 653  SGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQGVPGDPGAVGP--LGPR 710

Query: 112  AEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQG-PG-TGAPLRPGLPRT 169
             E   P          R +P +   P    +     P  D P+G PG +G P   G P  
Sbjct: 711  GERGNP--------GERGEPGITGLPGEKGMAGGHGP--DGPKGSPGPSGTPGDTGPPGL 760

Query: 170  EAQPAAEEL-------GFHRCFQEPPSSFTSTN-----YTSPSATPRPPAP--------- 208
            +  P    +       G      E  +  T+ N        P   P P  P         
Sbjct: 761  QGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGP 820

Query: 209  ----GPPQSRGTSPLQPGSYPEYQASGADSWPPAAENSFPGANFGVPPAEPEPIPKGSRP 264
                GPP SRG     PGS  E   +GA  +   A    P    GV     EP  KG   
Sbjct: 821  RGLVGPPGSRGN----PGSRGENGPTGAVGF---AGPQGPDGQPGVKGEPGEPGQKGDAG 873

Query: 265  GGSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAY 324
               P+G++     P  HG +  P      G     G   F     +   P  A   GPA 
Sbjct: 874  SPGPQGLAGS---PGPHGPNGVPGLKGGRGTQGPPGATGFPGSAGRVGPPGPAGAPGPAG 930

Query: 325  PLPTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKILPERP 384
            PL  +P     P  +G PG   R  D  G    PG       P  D          P+ P
Sbjct: 931  PLG-EPGKEGPPGLRGDPGSHGRVGD-RGPAGPPGGPGDKGDPGEDGQPG------PDGP 982

Query: 385  PSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPG-PPPARLPQLWDP 443
            P          GP  +  QR          G+   PG    E   PG P PA  P    P
Sbjct: 983  P----------GPAGTTGQR----------GIVGMPGQRG-ERGMPGLPGPAGTPGKVGP 1021

Query: 444  TAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSR 503
            T A     P GP+    S    G+P P            P        R    G      
Sbjct: 1022 TGATGDKGPPGPVGPPGSNGPVGEPGPEG----------PAGNDGTPGRDGAVGERGDRG 1071

Query: 504  LPFPAGGPEWQGGSQGALGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTDPGAQPLFF 563
             P PAG P    GSQGA GT G    P +      + Q G P      G   P  +    
Sbjct: 1072 DPGPAGLP----GSQGAPGTPGPVGAPGD------AGQRGDPG---SRGPIGPPGRAGKR 1118

Query: 564  GVAQPQ-----VSPHGTPSLPPPRVVGASPSESPLPS-PATNTAGSTCSSLSPMS----S 613
            G+  PQ        HG       +          LP  P  N    +     P       
Sbjct: 1119 GLPGPQGPRGDKGDHGDRGDRGQKGHRGFTGLQGLPGPPGPNGEQGSAGIPGPFGPRGPP 1178

Query: 614  SPANPSSEESQLPGPLGP---------SAFFHPPTHPQETGSPFPSPEPPH------SLP 658
             P  PS +E   PGPLGP              P   P E G P P   P H       + 
Sbjct: 1179 GPVGPSGKEGN-PGPLGPIGPPGVRGSVGEAGPEGPPGEPGPPGPPGPPGHLTAALGDIM 1237

Query: 659  THY---QPEPAKAF 669
             HY    P+P   F
Sbjct: 1238 GHYDESMPDPLPEF 1251



 Score = 72.4 bits (176), Expect = 8e-12
 Identities = 317/1329 (23%), Positives = 405/1329 (30%), Gaps = 294/1329 (22%)

Query: 204  RPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPAAENSFPGANFGVP--PAEPEPIPKG 261
            RP   GPP S+G         P  +        P       G   GVP  P  P P    
Sbjct: 130  RPGPAGPPGSQG---------PRGERGPKGRPGPRGPQGIDGEP-GVPGQPGAPGPPGHP 179

Query: 262  SRPGGSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTG 321
            S PG  P G+S             +PF A +AG    +G          G  P      G
Sbjct: 180  SHPG--PDGLS-------------RPFSAQMAGLDEKSG-----LGSQVGLMPGSVGPVG 219

Query: 322  PAYPLPTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSLHKSLTKILP 381
            P  P   Q          GQ GG       +G    PG     P P      +      P
Sbjct: 220  PRGPQGLQ----------GQQGG-------AGPTGPPGEPGD-PGPMGPIGSRG-----P 256

Query: 382  ERPPS--AQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDT-------------- 425
            E PP    +DG     G P  +     PG    A G   +PG P                
Sbjct: 257  EGPPGKPGEDGEPGRNGNPGEVGFAGSPG----ARGFPGAPGLPGLKGHRGHKGLEGPKG 312

Query: 426  ELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWP 485
            E+ APG              +     P GP+ A   +   G P    RL  PQ AP    
Sbjct: 313  EVGAPG--------------SKGEAGPTGPMGAMGPLGPRGMPGERGRLG-PQGAP---- 353

Query: 486  QVLPTARPSPHGMEMLSRLPFPAGGPEWQG--GSQGALGTAGKTPGPREKLPAVRSSQGG 543
                  +   HGM        P G P   G  G+ G  G AG T     + P  +  + G
Sbjct: 354  -----GQRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETG 408

Query: 544  SPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNTAGS 603
             P      G+          G   P  SP GT   P      A P  SP P  +T   G 
Sbjct: 409  PPGPVGSPGLPGAIGTDGTPGAKGPTGSP-GTSGPPG----SAGPPGSPGPQGSTGPQG- 462

Query: 604  TCSSLSPMSSSPANPSSEESQLP-GPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTHYQ 662
                +      P  P  +    P G  GP     P   P E G   P  +P    P    
Sbjct: 463  ----IRGQPGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPV 518

Query: 663  PEPA----KAFPFPADGL----GAEGAFQCLEETPFPHEGPEVGRGGLQGFPRAP--PPY 712
             E      + FP  +DGL    GA+G     E  P    GP+    G QG P  P  P  
Sbjct: 519  GERGAPGNRGFP-GSDGLPGPKGAQG-----ERGPVGSSGPK----GSQGDPGRPGEPGL 568

Query: 713  PTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPG 772
            P       +  +   +  L                      G L A  +DG    PG  G
Sbjct: 569  PGARGLTGNPGVQGPEGKL----------------------GPLGAPGEDGRPGPPGSIG 606

Query: 773  LPSPPAAPRVP----ADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLP 828
            +   P +  +P    +    G    A    + G   A GKD  +     PS    P  L 
Sbjct: 607  IRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAPGKDGEVG----PSGPVGPPGLA 662

Query: 829  ASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSK 888
                +                G   +   P       D  A   P GPRG       + +
Sbjct: 663  GERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQGVPGDPGA-VGPLGPRGERGNPGERGE 721

Query: 889  AGVT--PESKAP-----PPLPAATPDPQTPRPGDRGCPA-RGRPKTRSLGLAPTEADAPS 940
             G+T  P  K       P  P  +P P +  PGD G P  +G P  R  G+A T      
Sbjct: 722  PGITGLPGEKGMAGGHGPDGPKGSPGP-SGTPGDTGPPGLQGMPGER--GIAGTPGPKGD 778

Query: 941  QGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRA--SGLRPRRNDG-LGERPPPRPRR- 996
            +G    +G               AEG+    G R     L P    G  GE+  P PR  
Sbjct: 779  RGGIGEKG---------------AEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGL 823

Query: 997  ---PRTQA-PGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELIL 1052
               P ++  PGSR +  P      A P+        +  P +  +K  A  G+ G + + 
Sbjct: 824  VGPPGSRGNPGSRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDA--GSPGPQGLA 881

Query: 1053 KIVQQKNRLREYDFASESEEDEQPPPRGP----GFRGRRGRGEKRKEVELTQGP--REDE 1106
                                   P P GP    G +G RG          TQGP      
Sbjct: 882  G---------------------SPGPHGPNGVPGLKGGRG----------TQGPPGATGF 910

Query: 1107 PQKPRKAARQEAGGDGAPANP-EEPGGSRPGPGRSPQARGPSRSLETGAAAREGGPKCAD 1165
            P    +       G   PA P  EPG   P PG         R  + G A   GGP    
Sbjct: 911  PGSAGRVGPPGPAGAPGPAGPLGEPGKEGP-PGLRGDPGSHGRVGDRGPAGPPGGPGDKG 969

Query: 1166 RPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTEALRSPPAACA 1225
             P    +     P     +   R  +  P +  E        P  T      +  P    
Sbjct: 970  DPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPAGTPG----KVGPTGAT 1025

Query: 1226 GEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSLLGGPGGTQAPVS 1285
            G+ G  PG   P  PP S    G P P G      P G+  TPG    +G  G    P  
Sbjct: 1026 GDKGP-PG---PVGPPGSNGPVGEPGPEG------PAGNDGTPGRDGAVGERGDRGDP-- 1073

Query: 1286 HNSKDPPARQPGEFLAPVANPSSTACPKPSVLSSKISSFGCDPAGFNRDPLGVP--VAKK 1343
                  PA  PG   AP   P     P  +           DP   +R P+G P    K+
Sbjct: 1074 -----GPAGLPGSQGAP-GTPGPVGAPGDAGQRG-------DPG--SRGPIGPPGRAGKR 1118

Query: 1344 GPQPYSSPHSELFLGPKDLAGCFLEELHPKPSARDAPPASSSCLCQDGEDAGSLEPQLPR 1403
            G      P  +   G     G   ++ H   +     P       + G  AG   P  PR
Sbjct: 1119 GLPGPQGPRGD--KGDHGDRGDRGQKGHRGFTGLQGLPGPPGPNGEQG-SAGIPGPFGPR 1175

Query: 1404 SPPGTAETEPGRAASPPTLESSSLFPDLPVDRFDPP-LYGSLSANRDSGLPFACADPPQK 1462
             PPG      G+  +P            P+    PP + GS+      G       PP +
Sbjct: 1176 GPPGPVGPS-GKEGNPG-----------PLGPIGPPGVRGSVGEAGPEG-------PPGE 1216

Query: 1463 TVPSDPPYP 1471
              P  PP P
Sbjct: 1217 PGPPGPPGP 1225



 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 117/455 (25%), Positives = 154/455 (33%), Gaps = 95/455 (20%)

Query: 3429 GAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEVA 3488
            G PG K  + +   P +     +PG    PG+D                        EV 
Sbjct: 615  GLPGPKGSSGDPGKPGEAGNAGVPGQRGAPGKD-----------------------GEVG 651

Query: 3489 PSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGDCALDGALE 3548
            PS   G P       +      +G   P+  Q  P P   P       G G         
Sbjct: 652  PSGPVGPPGLAGERGE------QGPPGPTGFQGLPGPPGPP-------GEGG-------- 690

Query: 3549 RPENEASPGSPGPLLQQALPLGASLPRPGARGQDAEGKRAPLVFSGKRRAPGARGRCAPD 3608
            +P ++  PG PG +     PLG   PR G RG             G+R  PG  G     
Sbjct: 691  KPGDQGVPGDPGAV----GPLG---PR-GERGN-----------PGERGEPGITG----- 726

Query: 3609 HFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSA---TKPAGCQSSSKDRSAASTPS-KA 3664
                   L  EK ++  H     GP+G+         T P G Q    +R  A TP  K 
Sbjct: 727  -------LPGEKGMAGGH--GPDGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKG 777

Query: 3665 LKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTKTG-GGSQPQ 3723
             +  +  + A G+ A  + ARG      P  P    GP+ +  G P P    G  GS+  
Sbjct: 778  DRGGIGEKGAEGT-AGNDGARGLPG---PLGPPGPAGPTGE-KGEPGPRGLVGPPGSRGN 832

Query: 3724 PAS-GQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPRE---AGEQGPHGSLG- 3778
            P S G+     A   A P  P   P  +  P     K     P     AG  GPHG  G 
Sbjct: 833  PGSRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPNGV 892

Query: 3779 PKEKGESSTKRKKGQVPGPARSESVGSFGRAPS-APDKPPRTPRKQATPS-RVLP-TKPK 3835
            P  KG   T+   G    P  +  VG  G A +  P  P   P K+  P  R  P +  +
Sbjct: 893  PGLKGGRGTQGPPGATGFPGSAGRVGPPGPAGAPGPAGPLGEPGKEGPPGLRGDPGSHGR 952

Query: 3836 PNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQG 3870
               +    PP     K +PG   +    G   P G
Sbjct: 953  VGDRGPAGPPGGPGDKGDPGEDGQPGPDGPPGPAG 987



 Score = 59.3 bits (142), Expect = 7e-08
 Identities = 134/534 (25%), Positives = 171/534 (32%), Gaps = 125/534 (23%)

Query: 3414 RGGRQPFAFRG-VRRPGAPGQKA-RALEGTL--PSKRRRVAMPGSAPGPGEDR-PPPRGS 3468
            +G   P   +G +  PG  G++  R   GT+  P        PG+   PG D  P P+G+
Sbjct: 482  KGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKGA 541

Query: 3469 S----PILSEGSLPALLHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPP 3524
                 P+ S G             P  ++G P    RP +P     RG       Q  P 
Sbjct: 542  QGERGPVGSSG-------------PKGSQGDPG---RPGEPGLPGARGLTGNPGVQG-PE 584

Query: 3525 PSLSPFPAALADGRGDCALDGALERPENEASPGSPGPLLQQALPLGASLPRP-GARGQDA 3583
              L P  A   DGR                 PG PG +  +  P    LP P G+ G   
Sbjct: 585  GKLGPLGAPGEDGR-----------------PGPPGSIGIRGQPGSMGLPGPKGSSGDPG 627

Query: 3584 E-GKRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSA 3642
            + G+       G+R APG  G   P        L  E+         +G P  T  +G  
Sbjct: 628  KPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPGLAGERG-------EQGPPGPTGFQGLP 680

Query: 3643 TKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELA----------RGTENGMK 3692
              P       K              P+ PR   G+  PGE            +G   G  
Sbjct: 681  GPPGPPGEGGKPGDQGVPGDPGAVGPLGPRGERGN--PGERGEPGITGLPGEKGMAGGHG 738

Query: 3693 PATPKAKPGPSS----------QGSGSPR-----PGTK-TGGGSQPQPASGQLQSETA-- 3734
            P  PK  PGPS           QG    R     PG K   GG   + A G   ++ A  
Sbjct: 739  PDGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARG 798

Query: 3735 -------TTPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQGPHGSLG--------- 3778
                     PA P+     P P  L     ++     P   GE GP G++G         
Sbjct: 799  LPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRG---NPGSRGENGPTGAVGFAGPQGPDG 855

Query: 3779 -PKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPD------------KPPRTPRKQAT 3825
             P  KGE     +KG    P      GS G  P  P+             PP       +
Sbjct: 856  QPGVKGEPGEPGQKGDAGSPGPQGLAGSPG--PHGPNGVPGLKGGRGTQGPPGATGFPGS 913

Query: 3826 PSRVLPTKPKPNSQNKPRPPPSEQRK-------AEPGHTQRKDRLGKAFPQGRP 3872
              RV P  P P     P  P  E  K        +PG   R    G A P G P
Sbjct: 914  AGRVGP--PGPAGAPGPAGPLGEPGKEGPPGLRGDPGSHGRVGDRGPAGPPGGP 965



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 209/874 (23%), Positives = 265/874 (30%), Gaps = 175/874 (20%)

Query: 2050 GSEGRTPERASS--PGLNKPLLATGDSPAPSVGDLAACAPSPTSAAHMPCSLGPLPREDP 2107
            GS+G   ER     PG   P    G+   P  G   A  P P   +H        P  D 
Sbjct: 138  GSQGPRGERGPKGRPGPRGPQGIDGEPGVP--GQPGAPGP-PGHPSH--------PGPDG 186

Query: 2108 LTSPSRAQ-------GGLGGQLPASPSCRDPPGPQQLLACSPAWAPLEEADGVQATTDTG 2160
            L+ P  AQ        GLG Q+   P    P GP+                G Q      
Sbjct: 187  LSRPFSAQMAGLDEKSGLGSQVGLMPGSVGPVGPR----------------GPQGLQGQQ 230

Query: 2161 AEDSPVAPPSLTTSPCDPKEALAGCLLQGE-GSPLEDPS---SWPPGSVSAVTCTHSGDT 2216
                P  PP     P  P   +     +G  G P ED     +  PG V       +   
Sbjct: 231  GGAGPTGPPGEPGDP-GPMGPIGSRGPEGPPGKPGEDGEPGRNGNPGEVGFAGSPGARGF 289

Query: 2217 PKDSTLRIPEDSRKEKLWESP-GRATSPPLAGAVSPSVAVRATGLSSTPTGDEAQAGRGL 2275
            P    L   +  R  K  E P G   +P   G   P+  + A G    P G   + GR  
Sbjct: 290  PGAPGLPGLKGHRGHKGLEGPKGEVGAPGSKGEAGPTGPMGAMGPLG-PRGMPGERGRLG 348

Query: 2276 PGPDPQSRGAPPHTNPDRM-PRGH-----SSYSPSNTARLGHREGQAVTAVPTEPPTLQG 2329
            P   P  RGA  H  P +  P G      SS  P N    G   G      P  P   +G
Sbjct: 349  PQGAPGQRGA--HGMPGKPGPMGPLGIPGSSGFPGNPGMKGEA-GPTGARGPEGPQGQRG 405

Query: 2330 -AGPDSPACLEGEMGTSSKEPEDPGTPETGRSGATKMPRVTCPSTGLGLGRTTAPSSTAS 2388
              GP  P    G  G    +        TG  G +  P    P    G   +T P     
Sbjct: 406  ETGPPGPVGSPGLPGAIGTDGTPGAKGPTGSPGTSGPPGSAGPPGSPGPQGSTGPQGIRG 465

Query: 2389 DFQSDSPQSHRNASHQTPQGDPLGPQDLK--------QRSRGYKKKPASTENGQWKGQAP 2440
              Q   P          P+G+P GP  ++        +  RG +  P +          P
Sbjct: 466  --QPGDPGVPGFKGEAGPKGEP-GPHGIQGPIGPPGEEGKRGPRGDPGTV--------GP 514

Query: 2441 HGPVTCEVCAASFRSGPGLSRHKARKHRPHPGAPAEPSPAALPAQQPLEPLAQKCQPPRK 2500
             GPV         R  PG        +R  PG+   P P    AQ    P+         
Sbjct: 515  PGPV-------GERGAPG--------NRGFPGSDGLPGPKG--AQGERGPV--------- 548

Query: 2501 KSHRVSGKERPNHSRGDPSHVTQP-----------PPAQGSKEVLRAPGSPHSQQLHPPS 2549
                  G   P  S+GDP    +P           P  QG +  L   G+P       P 
Sbjct: 549  ------GSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPP 602

Query: 2550 PTEHEVDVKTPASKPRPDQAREDELHPKQAEKREGRRWRREPTVDSPSHSEGKSNKKRGK 2609
             +            P P  +  D   P +A        R  P  D      G        
Sbjct: 603  GSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPG-- 660

Query: 2610 LRGRRLREESILPVSADVISD-----GRGSRPSPAMASY---AASPSHCLSVEGGPEADG 2661
            L G R  +    P     +       G G +P          A  P       G P   G
Sbjct: 661  LAGERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQGVPGDPGAVGPLGPRGERGNPGERG 720

Query: 2662 EQPPRLATL----------GPGVMEGAAETDQEALCAGETGAQKPPGDRMLC--PG-RMD 2708
            E  P +  L          GP   +G+          G  G Q  PG+R +   PG + D
Sbjct: 721  E--PGITGLPGEKGMAGGHGPDGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGD 778

Query: 2709 GAALGEQPTGQKGAS----ARGFWGPRETKALGVCKESG--SEPAEDSSRA-----HSRS 2757
               +GE+  G +G +    ARG  GP     LG    +G   E  E   R       SR 
Sbjct: 779  RGGIGEK--GAEGTAGNDGARGLPGP-----LGPPGPAGPTGEKGEPGPRGLVGPPGSRG 831

Query: 2758 EEGVWEENTP--------PLGPLGFPETSSSPAD-----STTSSCLQGLPDNPDTQGGVQ 2804
              G   EN P        P GP G P     P +        S   QGL  +P    G  
Sbjct: 832  NPGSRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSP----GPH 887

Query: 2805 GPEGPTPDASGSSAKDPPSLFDDEVSFSQLFPPG 2838
            GP G      G   + PP       S  ++ PPG
Sbjct: 888  GPNGVPGLKGGRGTQGPPGATGFPGSAGRVGPPG 921



 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 104/439 (23%), Positives = 139/439 (31%), Gaps = 49/439 (11%)

Query: 3428 PGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPP-PRGSSPILSEGSLPALLHLCSE 3486
            PG PG K       L   +  V  PGS    GE  P  P G+   L    +P        
Sbjct: 293  PGLPGLKGHRGHKGLEGPKGEVGAPGS---KGEAGPTGPMGAMGPLGPRGMPG------- 342

Query: 3487 VAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGDCALDGA 3546
                  +G       P     H + G   P      P  S  P    +    G     G 
Sbjct: 343  -----ERGRLGPQGAPGQRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGP 397

Query: 3547 LERPENEASPGSPGPLLQQALP--LGASLPRPGARG-QDAEGKRAPLVFSGKRRAPGARG 3603
                      G PGP+    LP  +G     PGA+G   + G   P   +G   +PG +G
Sbjct: 398  EGPQGQRGETGPPGPVGSPGLPGAIGTD-GTPGAKGPTGSPGTSGPPGSAGPPGSPGPQG 456

Query: 3604 RCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSAASTPSK 3663
               P   +      +  +        E GP+G         P G       R     P  
Sbjct: 457  STGPQGIR-----GQPGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPG- 510

Query: 3664 ALKFPVHPRKAVGSL-APGELARGTENGMK-PATPKAKPGPSSQGSGSPRPGTKTGGGSQ 3721
                 V P   VG   APG       +G+  P   + + GP   GS  P+ G++   G  
Sbjct: 511  ----TVGPPGPVGERGAPGNRGFPGSDGLPGPKGAQGERGP--VGSSGPK-GSQGDPGRP 563

Query: 3722 PQP----ASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQGPHGSL 3777
             +P    A G   +     P     P  +P  +  P    +      P   G  GP GS 
Sbjct: 564  GEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSS 623

Query: 3778 G-PKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQATPSRVLPTKPKP 3836
            G P + GE+      GQ   P +   VG     PS P  PP    ++       PT    
Sbjct: 624  GDPGKPGEAGNAGVPGQRGAPGKDGEVG-----PSGPVGPPGLAGERGEQGPPGPT---- 674

Query: 3837 NSQNKPRPPPSEQRKAEPG 3855
              Q  P PP       +PG
Sbjct: 675  GFQGLPGPPGPPGEGGKPG 693



 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 137/539 (25%), Positives = 171/539 (31%), Gaps = 124/539 (23%)

Query: 873  PSGPRGPSSGHPLKSKAGVTPESKAPPPLPAATPDPQTPRPGDRGCPARGRPKTRSLGLA 932
            P GP GP         AG T E   P P     P      PG RG        T ++G A
Sbjct: 802  PLGPPGP---------AGPTGEKGEPGPRGLVGPPGSRGNPGSRG----ENGPTGAVGFA 848

Query: 933  PTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPP 992
              +      G +   G+  +  + D  S G    +GS G    +G+ P    G G + PP
Sbjct: 849  GPQGPDGQPGVKGEPGEPGQ--KGDAGSPGPQGLAGSPGPHGPNGV-PGLKGGRGTQGPP 905

Query: 993  RPRRPRTQAPGSRADPAPRVPRAAALPEETRSSRRRRLPP--RKDPRKRKARG------- 1043
                  T  PGS     P  P  A  P        +  PP  R DP      G       
Sbjct: 906  GA----TGFPGSAGRVGPPGPAGAPGPAGPLGEPGKEGPPGLRGDPGSHGRVGDRGPAGP 961

Query: 1044 -GAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRGP----GFRGRRG-------RGE 1091
             G  G +                   +  ED QP P GP    G  G+RG       RGE
Sbjct: 962  PGGPGDK------------------GDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGE 1003

Query: 1092 KRKEVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLE 1151
            +   +    GP       P K     A GD  P  P  P GS  GP   P   GP+ +  
Sbjct: 1004 RG--MPGLPGPAGT----PGKVGPTGATGDKGPPGPVGPPGSN-GPVGEPGPEGPAGNDG 1056

Query: 1152 T----GAAAREG-----GPKCADRPSVAPKDPLQVPTNTETSEETRPS------------ 1190
            T    GA    G     GP        AP  P  V    +  +   P             
Sbjct: 1057 TPGRDGAVGERGDRGDPGPAGLPGSQGAPGTPGPVGAPGDAGQRGDPGSRGPIGPPGRAG 1116

Query: 1191 ---LDFPQ-----EAKEPETAEESAPDSTEFT--EALRSPPAACAGEMGAS--PGLLIPE 1238
               L  PQ     +    +  +        FT  + L  PP    GE G++  PG   P 
Sbjct: 1117 KRGLPGPQGPRGDKGDHGDRGDRGQKGHRGFTGLQGLPGPPGP-NGEQGSAGIPGPFGPR 1175

Query: 1239 QPP----PSRHD--------TGTPKPSGSLANTAPHGSSPTPGVGSLLGGPGGTQAP--- 1283
             PP    PS  +         G P   GS+    P G    PG     G PG   A    
Sbjct: 1176 GPPGPVGPSGKEGNPGPLGPIGPPGVRGSVGEAGPEGPPGEPGPPGPPGPPGHLTAALGD 1235

Query: 1284 -VSHNSKDPPARQPGEFLAPVANPSSTACPKPSV------LSSKISSFGCDPAGFNRDP 1335
             + H  +  P   P EF    A P       P V      LSS+I +    P G  + P
Sbjct: 1236 IMGHYDESMPDPLP-EFTEDQAAPDDKNKTDPGVHATLKSLSSQIETMR-SPDGSKKHP 1292



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 290/1238 (23%), Positives = 372/1238 (30%), Gaps = 243/1238 (19%)

Query: 1082 GFRGRRGRGEKRKEVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSP 1141
            G RGR G          +QGPR +   K R   R   G DG P  P +PG   PGP   P
Sbjct: 126  GIRGRPGPAGPPG----SQGPRGERGPKGRPGPRGPQGIDGEPGVPGQPGA--PGPPGHP 179

Query: 1142 QARGP---SRSLET-------------------------------GAAAREGGPKCADRP 1167
               GP   SR                                   G   ++GG      P
Sbjct: 180  SHPGPDGLSRPFSAQMAGLDEKSGLGSQVGLMPGSVGPVGPRGPQGLQGQQGGAGPTGPP 239

Query: 1168 SVAPKDPLQVPTNTETSEETRPSLDFPQEAKEP-------ETAEESAPDSTEFTEALRSP 1220
               P DP  +        E  P    P E  EP       E     +P +  F  A   P
Sbjct: 240  G-EPGDPGPMGPIGSRGPEGPPGK--PGEDGEPGRNGNPGEVGFAGSPGARGFPGAPGLP 296

Query: 1221 PAACAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSLLGGPGGT 1280
                 G  G   GL  P+    +    G   P+G +    P G    PG    LG  G  
Sbjct: 297  --GLKGHRG-HKGLEGPKGEVGAPGSKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQG-- 351

Query: 1281 QAPVSHNSKDPPARQPGEFLAPVANPSSTACPKPSVLSSKISSFGCDPAGFNRDPLGVPV 1340
             AP    +   P + PG  + P+  P S+  P    +  +    G       R P G P 
Sbjct: 352  -APGQRGAHGMPGK-PGP-MGPLGIPGSSGFPGNPGMKGEAGPTGA------RGPEG-PQ 401

Query: 1341 AKKG----PQPYSSPHSELFLGPKDLAGCFLEELHPKPSARDAPPASSSCLCQDGEDAGS 1396
             ++G    P P  SP     +G     G       P  S    PP S+      G   GS
Sbjct: 402  GQRGETGPPGPVGSPGLPGAIGTDGTPGAKGPTGSPGTS---GPPGSAGPPGSPGPQ-GS 457

Query: 1397 LEPQLPRSPPGT-----------AETEPG-----RAASPPTLESSSLFPDLPVDRFDPPL 1440
              PQ  R  PG             + EPG         PP  E        P     P  
Sbjct: 458  TGPQGIRGQPGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGP 517

Query: 1441 YGSLSANRDSGLPFACADPPQKTVPSD--PPYPSFLLLEEVSPMLPSHFPDLSGGKVLS- 1497
             G   A  + G P +   P  K    +  P   S     +  P  P   P L G + L+ 
Sbjct: 518  VGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQGDPGRPGE-PGLPGARGLTG 576

Query: 1498 --KTCPPERTVVPGAAPSLPGK-GSGCSVALMSHLSEDELEIQKLVTELESQLQRSKDTR 1554
                  PE  + P  AP   G+ G   S+ +                     L   K + 
Sbjct: 577  NPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPG-------------SMGLPGPKGSS 623

Query: 1555 GAPRELAEAESVGRVELGTGTEPPSQRRTCQATVPHEDTFSAADLTRVGESTAHREGAES 1614
            G P +  EA + G          P QR       P +D         VG      E  E 
Sbjct: 624  GDPGKPGEAGNAG---------VPGQR-----GAPGKDG-EVGPSGPVGPPGLAGERGEQ 668

Query: 1615 AVATVEAVQGRPGGTWPCPASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQPVQKAGA 1674
                    QG PG   P      PG   +      D  +  P  PRG   +  P ++   
Sbjct: 669  GPPGPTGFQGLPGPPGPPGEGGKPGDQGV----PGDPGAVGPLGPRGERGN--PGERGEP 722

Query: 1675 SKTGL---------------------CQAEGDSRPPQDVCLPEP---SKQPGPQLDAGSL 1710
              TGL                         GD+ PP    +P     +  PGP+ D G +
Sbjct: 723  GITGLPGEKGMAGGHGPDGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGDRGGI 782

Query: 1711 AKCSPDQELSFPKNKEAASSQESEDSLRLLPCEQRGGFLPEPGTADQP-HRGAPAPEAF- 1768
                          ++ A      D  R LP     G L  PG A     +G P P    
Sbjct: 783  -------------GEKGAEGTAGNDGARGLP-----GPLGPPGPAGPTGEKGEPGPRGLV 824

Query: 1769 GSPAVHLAPDLAFQGDGAPPLDATWPFGASPSHAAQGHSAGRAGGHLHPTAGRPGFEGNE 1828
            G P     P    +G+  P        GA      QG   G+ G    P  G PG +G+ 
Sbjct: 825  GPPGSRGNP--GSRGENGPT-------GAVGFAGPQGPD-GQPGVKGEP--GEPGQKGDA 872

Query: 1829 FAPA--GASSLTAPRGREAWLVPVPSPACVSNTHPSRRSQDP----ALSPPIRQLQLPGP 1882
             +P   G +    P G          P  V      R +Q P           ++  PGP
Sbjct: 873  GSPGPQGLAGSPGPHG----------PNGVPGLKGGRGTQGPPGATGFPGSAGRVGPPGP 922

Query: 1883 GVAKSKDGILGLQELTPAAQSPPRVNPSGLEGGTVEGGKVACGPAQGSPGGVQVTTLPAV 1942
              A    G LG          P +  P GL G     G+V      G PGG      P  
Sbjct: 923  AGAPGPAGPLG---------EPGKEGPPGLRGDPGSHGRVGDRGPAGPPGGPGDKGDPGE 973

Query: 1943 AGHQLGLEADGHWGLLGQAEKTQGQGTANQLQPENGVS--PGGTDNHASVNASPKTALTG 2000
             G       DG  G  G   +    G   Q + E G+   PG       V  +  T   G
Sbjct: 974  DGQP---GPDGPPGPAGTTGQRGIVGMPGQ-RGERGMPGLPGPAGTPGKVGPTGATGDKG 1029

Query: 2001 PTEGAVLLEKCKGSRAAMSLQEEAEPTPSPPSPNRESLALALTAAHSRSGSEGRTPERAS 2060
            P  G V      GS   +       P  +  +P R+  A+         G  G  P    
Sbjct: 1030 P-PGPV---GPPGSNGPVGEPGPEGPAGNDGTPGRDG-AVGERGDRGDPGPAG-LPGSQG 1083

Query: 2061 SPGLNKPLLATGDSPAPSVGDLAACAP-SPTSAAHMPCSLGPL-PREDPLTSPSRAQGGL 2118
            +PG   P+ A GD  A   GD  +  P  P   A      GP  PR D      R   G 
Sbjct: 1084 APGTPGPVGAPGD--AGQRGDPGSRGPIGPPGRAGKRGLPGPQGPRGDKGDHGDRGDRGQ 1141

Query: 2119 GGQ--LPASPSCRDPPGPQQLLACSPAWAPLEEADGVQATTDTGAEDS-----PVAPPSL 2171
             G            PPGP      +    P            +G E +     P+ PP +
Sbjct: 1142 KGHRGFTGLQGLPGPPGPNGEQGSAGIPGPFGPRGPPGPVGPSGKEGNPGPLGPIGPPGV 1201

Query: 2172 TTSPCDPKEALAGCLLQGEGSPLEDPSSWPPGSVSAVT 2209
              S  +     AG     EG P E     PPG    +T
Sbjct: 1202 RGSVGE-----AG----PEGPPGEPGPPGPPGPPGHLT 1230



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 98/382 (25%), Positives = 121/382 (31%), Gaps = 76/382 (19%)

Query: 3504 DPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGDCAL----DGALERPENEASPGSP 3559
            DPVT P   C + S   + P    + F       +G+  L     G   RP     PGS 
Sbjct: 84   DPVTPPGECCPVCS---QTPGGGNTNFGRGRKGQKGEPGLVPVVTGIRGRPGPAGPPGSQ 140

Query: 3560 GPLLQQALPLGASLPRPGARGQDAEGKRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKE 3619
            GP  ++  P G    RPG RG        P    G+   PG  G   P            
Sbjct: 141  GPRGERG-PKG----RPGPRG--------PQGIDGEPGVPGQPGAPGPPGHP-------- 179

Query: 3620 KEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLA 3679
                     S  GP G     SA      + S         P      PV PR   G   
Sbjct: 180  ---------SHPGPDGLSRPFSAQMAGLDEKSGLGSQVGLMPGSV--GPVGPRGPQG--- 225

Query: 3680 PGELARGTENGMKPATPKAKPG-PSSQG----SGSPRPGTKTGGGSQPQPASGQLQSETA 3734
                 +G + G  P  P  +PG P   G     G   P  K G   +P       +   A
Sbjct: 226  ----LQGQQGGAGPTGPPGEPGDPGPMGPIGSRGPEGPPGKPGEDGEPGRNGNPGEVGFA 281

Query: 3735 TTPAKPSFPSRSPAPERLPARAQAKSCTKGPR-EAGEQGPHGSLG-PKEKGESSTKRKKG 3792
             +P    FP     P             KG R   G +GP G +G P  KGE+      G
Sbjct: 282  GSPGARGFPGAPGLPG-----------LKGHRGHKGLEGPKGEVGAPGSKGEAGPTGPMG 330

Query: 3793 QVPGPARSESV-GSFGRAPSAPDKPPRTPRKQATPSRVLPTKPK--PNSQNKPRPPPSEQ 3849
             + GP     + G  GR    P   P        P +  P  P   P S   P  P    
Sbjct: 331  AM-GPLGPRGMPGERGRL--GPQGAPGQRGAHGMPGKPGPMGPLGIPGSSGFPGNP---G 384

Query: 3850 RKAEPGHTQRKDRLGKAFPQGR 3871
             K E G T  +   G   PQG+
Sbjct: 385  MKGEAGPTGAR---GPEGPQGQ 403



 Score = 39.3 bits (90), Expect = 0.078
 Identities = 94/391 (24%), Positives = 126/391 (32%), Gaps = 75/391 (19%)

Query: 3428 PGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDR--------PPPRGSSPILSEGSLPA 3479
            PG PG K    E   P        P   PGP            P  RG   +     LP 
Sbjct: 962  PGGPGDKGDPGEDGQPG-------PDGPPGPAGTTGQRGIVGMPGQRGERGM---PGLPG 1011

Query: 3480 LLHLCSEVAPSTT---KGWPETLERPVD--PVTHPIRGCELPSNHQECPPPSLSPFPAAL 3534
                  +V P+     KG P  +  P    PV  P  G E P+ +   P           
Sbjct: 1012 PAGTPGKVGPTGATGDKGPPGPVGPPGSNGPVGEP--GPEGPAGNDGTPGRD------GA 1063

Query: 3535 ADGRGDCALDGALERPENEASPGSPGPLLQQALPLGASLPRPGARGQDAE-GKRAPL--- 3590
               RGD    G    P ++ +PG+PG       P+GA    PG  GQ  + G R P+   
Sbjct: 1064 VGERGDRGDPGPAGLPGSQGAPGTPG-------PVGA----PGDAGQRGDPGSRGPIGPP 1112

Query: 3591 VFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQS 3650
              +GKR  PG +G   P   + DH  + ++         + G RG         P G   
Sbjct: 1113 GRAGKRGLPGPQG---PRGDKGDHGDRGDR--------GQKGHRGFTGLQGLPGPPG--- 1158

Query: 3651 SSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPG-PSSQGSGS 3709
             + ++ +A  P      P  PR   G + P     G E    P  P   PG   S G   
Sbjct: 1159 PNGEQGSAGIPG-----PFGPRGPPGPVGPS----GKEGNPGPLGPIGPPGVRGSVGEAG 1209

Query: 3710 PRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPREAG 3769
            P       G   P    G L +               P PE    +A      K      
Sbjct: 1210 PEGPPGEPGPPGPPGPPGHLTAALGDIMGHYDESMPDPLPEFTEDQAAPDDKNK-----T 1264

Query: 3770 EQGPHGSLGPKEKGESSTKRKKGQVPGPARS 3800
            + G H +L        + +   G    PAR+
Sbjct: 1265 DPGVHATLKSLSSQIETMRSPDGSKKHPART 1295



 Score = 38.9 bits (89), Expect = 0.10
 Identities = 29/96 (30%), Positives = 35/96 (36%), Gaps = 16/96 (16%)

Query: 3206 PAPKHHRGKRSAGKAAGSPG--DPWGQEGEAKKDSPGERAKPRARSTPSNPDGAATPDSA 3263
            P P    GK       G PG   P G  GE  + +PGER +P     P            
Sbjct: 683  PGPPGEGGKPGDQGVPGDPGAVGPLGPRGE--RGNPGERGEPGITGLPGEK--------- 731

Query: 3264 SATALADAGSPGPPRTTPSPSPDPWAGGEPLLQATP 3299
                +A    P  P+ +P PS  P   G P LQ  P
Sbjct: 732  ---GMAGGHGPDGPKGSPGPSGTPGDTGPPGLQGMP 764



 Score = 35.8 bits (81), Expect = 0.86
 Identities = 71/294 (24%), Positives = 84/294 (28%), Gaps = 41/294 (13%)

Query: 1684 GDSRPPQDVCLPEPSKQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRLLP-- 1741
            GD   P +   P P   PGP    G              +       Q  E  +  LP  
Sbjct: 966  GDKGDPGEDGQPGPDGPPGPAGTTGQ-------------RGIVGMPGQRGERGMPGLPGP 1012

Query: 1742 CEQRGGFLPEPGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPSH 1801
                G   P   T D+   G   P     P     P+     DG P  D     GA    
Sbjct: 1013 AGTPGKVGPTGATGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRD-----GAVGER 1067

Query: 1802 AAQGHS--AGRAGGHLHP----TAGRPGFEGNEFAPAGASSLTAP-RGREAWLVPVPSPA 1854
              +G    AG  G    P      G PG  G    P     +  P R  +  L     P 
Sbjct: 1068 GDRGDPGPAGLPGSQGAPGTPGPVGAPGDAGQRGDPGSRGPIGPPGRAGKRGLPGPQGPR 1127

Query: 1855 CVSNTHPSRRSQDPALSPPIRQLQ-LPGPGVAKSKDGILGLQELTPAAQSPPRVNPSGLE 1913
                 H  R  +          LQ LPGP     + G  G+         P  V PSG E
Sbjct: 1128 GDKGDHGDRGDRGQKGHRGFTGLQGLPGPPGPNGEQGSAGIPGPFGPRGPPGPVGPSGKE 1187

Query: 1914 GGT----------VEGGKVACGPAQGSPGGVQVTTLPAVAGHQLGLEAD--GHW 1955
            G            V G     GP +G PG       P   GH      D  GH+
Sbjct: 1188 GNPGPLGPIGPPGVRGSVGEAGP-EGPPGEPGPPGPPGPPGHLTAALGDIMGHY 1240



 Score = 35.0 bits (79), Expect = 1.5
 Identities = 36/133 (27%), Positives = 46/133 (34%), Gaps = 37/133 (27%)

Query: 3187 PGGLEGSSAVAHLLNSITEPAPKHHRG---KRSAGKAAGS--------------PGDPWG 3229
            P GL+G      +  +   P PK  RG   ++ A   AG+              P  P G
Sbjct: 757  PPGLQGMPGERGIAGT---PGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTG 813

Query: 3230 QEGEAKKDS----PGERAKPRARST-----------PSNPDG--AATPDSASATALADAG 3272
            ++GE         PG R  P +R             P  PDG      +        DAG
Sbjct: 814  EKGEPGPRGLVGPPGSRGNPGSRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAG 873

Query: 3273 SPGPPRTTPSPSP 3285
            SPGP     SP P
Sbjct: 874  SPGPQGLAGSPGP 886



 Score = 34.3 bits (77), Expect = 2.5
 Identities = 49/193 (25%), Positives = 61/193 (31%), Gaps = 20/193 (10%)

Query: 3692 KPATPKAKPGPSSQG-SGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPE 3750
            +P  P     PS  G  G  RP +    G   +   G   S+    P     P     P+
Sbjct: 169  QPGAPGPPGHPSHPGPDGLSRPFSAQMAGLDEKSGLG---SQVGLMPGSVG-PVGPRGPQ 224

Query: 3751 RLPARAQAKSCTKGPREAGEQGPHGSLG----------PKEKGESSTKRKKGQVPGPARS 3800
             L  +      T  P E G+ GP G +G          P E GE       G+V G A S
Sbjct: 225  GLQGQQGGAGPTGPPGEPGDPGPMGPIGSRGPEGPPGKPGEDGEPGRNGNPGEV-GFAGS 283

Query: 3801 ESVGSFGRAPSAPDKPPRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEP-GHTQR 3859
                 F  AP  P        K     +     P    +  P  P        P G    
Sbjct: 284  PGARGFPGAPGLPGLKGHRGHKGLEGPKGEVGAPGSKGEAGPTGPMGAMGPLGPRGMPGE 343

Query: 3860 KDRLGKAFPQGRP 3872
            + RLG   PQG P
Sbjct: 344  RGRLG---PQGAP 353



 Score = 34.3 bits (77), Expect = 2.5
 Identities = 27/74 (36%), Positives = 34/74 (45%), Gaps = 9/74 (12%)

Query: 3206 PAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPGERAKPRARSTPSNPDGAATPDS--A 3263
            P PK  +G+R      GS G P G +G+  +  PGE   P AR    NP G   P+    
Sbjct: 536  PGPKGAQGERGP---VGSSG-PKGSQGDPGR--PGEPGLPGARGLTGNP-GVQGPEGKLG 588

Query: 3264 SATALADAGSPGPP 3277
               A  + G PGPP
Sbjct: 589  PLGAPGEDGRPGPP 602



 Score = 32.7 bits (73), Expect = 7.3
 Identities = 67/264 (25%), Positives = 85/264 (32%), Gaps = 62/264 (23%)

Query: 2633 GSRPSPAMASYAASPSHCLSVEGGPEADGEQPPR--LATLGPGVMEGAAETDQEALCAGE 2690
            G   +P    +A SP       G P   G +  R      GP    GA  +  EA   G 
Sbjct: 270  GRNGNPGEVGFAGSPG-ARGFPGAPGLPGLKGHRGHKGLEGPKGEVGAPGSKGEAGPTGP 328

Query: 2691 TGAQKPPGDRMLCPGRMDGAALGEQPT-GQKGASARGFWG-PRETKALGVCKESG----- 2743
             GA  P G R + PG  +   LG Q   GQ+GA   G  G P     LG+   SG     
Sbjct: 329  MGAMGPLGPRGM-PG--ERGRLGPQGAPGQRGA--HGMPGKPGPMGPLGIPGSSGFPGNP 383

Query: 2744 ---SEPAEDSSRAHS-----RSEEG-------------VWEENTPPL-GPLGFPETSSSP 2781
                E     +R        R E G             +  + TP   GP G P TS  P
Sbjct: 384  GMKGEAGPTGARGPEGPQGQRGETGPPGPVGSPGLPGAIGTDGTPGAKGPTGSPGTSGPP 443

Query: 2782 AD-----------STTSSCLQGLPDNPDTQG--------------GVQGPEGPTPDASGS 2816
                         ST    ++G P +P   G              G+QGP GP  +    
Sbjct: 444  GSAGPPGSPGPQGSTGPQGIRGQPGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKR 503

Query: 2817 SAKDPPSLFDDEVSFSQLFPPGGR 2840
              +  P          +   PG R
Sbjct: 504  GPRGDPGTVGPPGPVGERGAPGNR 527


>gi|89142735 alpha 3 type IV collagen isoform 4 precursor [Homo
            sapiens]
          Length = 1494

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 255/1046 (24%), Positives = 328/1046 (31%), Gaps = 188/1046 (17%)

Query: 1    MPG-ERPRGAPPPTMTGDLQPRQVASSPGHPSQPPLED--NTPATRTTKGAREAGGQAQA 57
            +PG + P+G P    T   Q   +   PG P  P L      P  +   G + + G    
Sbjct: 462  IPGVDGPKGEPGLLCT---QCPYIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGSPGN 518

Query: 58   MELPEAQPRQARDGELKPPSLRGQA-----PSSTPGKRGSP--QTPPGRSPLQAPSRLAG 110
              LP         G+   P L+G+      P    G  G P  +  PGR  L       G
Sbjct: 519  TGLPGFPGFPGAQGD---PGLKGEKGETLQPEGQVGVPGDPGLRGQPGRKGLDGIPGTPG 575

Query: 111  RAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGP-GTGAPLRPGLPRT 169
              +G P  +  L ++  +        P +P       P    P GP G G    PGL  T
Sbjct: 576  -VKGLPGPKGELALSGEKGDQGPPGDPGSPGS-----PGPAGPAGPPGYGPQGEPGLQGT 629

Query: 170  EAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQ--PGSYPEY 227
            +  P A           PP         S S TP P  PGPP   G    Q  PG     
Sbjct: 630  QGVPGAPG---------PPGEAGPRGELSVS-TPVPGPPGPPGPPGHPGPQGPPGIPGSL 679

Query: 228  QASGADSWP-PAAENSFPGANFGVPPAEPEPIPKGSR--PGGSPR-GVSFQFPFPALHGA 283
               G    P P  E   PG  F  PP      PKG +  PG     G   +   P L G 
Sbjct: 680  GKCGDPGLPGPDGEPGIPGIGFPGPPG-----PKGDQGFPGTKGSLGCPGKMGEPGLPGK 734

Query: 284  STKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYP-LPTQPAPSPLPCYQGQP 342
               P        A   GP    F   +G   E      P  P LP  P    L   +G P
Sbjct: 735  PGLPGAKGEPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLDGPRGDP 794

Query: 343  GGLNRHSDLSGALSSPGAAHSAPR-----PFSDSLH-------KSLTKILPERPPSAQDG 390
            G         G    PG     PR     P  + L        K+  K  P  P   + G
Sbjct: 795  G----QPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKTGPKGDPGIPGLDRSG 850

Query: 391  LGSTRGPPS---------SLPQRHFPGQA--------------YRASGVDTSPGPPDT-- 425
                 G P           L QR +PG                    G    PGPP    
Sbjct: 851  FPGETGSPGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPPGNPG 910

Query: 426  ---ELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPL 482
               +  +PG P  +  Q   P A       G P  +  S     +  PG    L   A  
Sbjct: 911  TPGQRGSPGIPGVK-GQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPG----LKGFAGN 965

Query: 483  PWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREK--------- 533
            P  +      P   G++ L  LP PAG P    G +G LG+ G    P  +         
Sbjct: 966  PGEKG-NRGVPGMPGLKGLKGLPGPAGPP----GPRGDLGSTGNPGEPGLRGIPGSMGNM 1020

Query: 534  -LPAVRSSQG--------GSPALFTYNGMTDPGAQPLFFGVAQP-QVSPHGTPSLPPPRV 583
             +P  +  +G        G P L   +G+     +P +    +P    P G P LP    
Sbjct: 1021 GMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGDPGLPGDMG 1080

Query: 584  VGASPSESPLPSPATNTAGSTCSSLSPMSSS-PANPSSEESQ----LPGPLGPSAFFHPP 638
                  + P P      AG   +  SP S   P  P          + G LGP     PP
Sbjct: 1081 KKGEMGQ-PGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGPPGIRGPP 1139

Query: 639  THPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVG 698
              P   GSP P              +     P PA   G +G    L   P P   P  G
Sbjct: 1140 GLPGFPGSPGPMGIRGD--------QGRDGIPGPA---GEKGETGLLRAPPGPRGNP--G 1186

Query: 699  RGGLQGFPRAP--PPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLL 756
              G +G   AP  P  P    ++  A               R  + +  F       G +
Sbjct: 1187 AQGAKGDRGAPGFPGLPGRKGAMGDAG-------------PRGPTGIEGFPGPPGLPGAI 1233

Query: 757  LA-----RAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDP 811
            +      R   G + SPG PG P PP +  +      G + H       G A   G    
Sbjct: 1234 IPGQTGNRGPPGSRGSPGAPGPPGPPGSHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGR 1293

Query: 812  LRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADE 871
            L     P L     P P  D              +   G++ +  NP     F+      
Sbjct: 1294 LGAPGTPGL-----PGPRGDPGF-----------QGFPGVKGEKGNP----GFLGSIGPP 1333

Query: 872  EPSGPRGPSS--GHPLKSKAGVTPESKAPPPLPA-----ATPDPQTPRPGDRG-CPARGR 923
             P GP+GP    G P   K    P S  PP  P        P P  P PG+ G C  RG+
Sbjct: 1334 GPIGPKGPPGVRGDPGTLKIISLPGSPGPPGTPGEPGMQGEPGPPGP-PGNLGPCGPRGK 1392

Query: 924  PKTRSLGLAPTEADAPSQGRQQRRGK 949
            P     G   T   A  +G +  +G+
Sbjct: 1393 PGKD--GKPGTPGPAGEKGNKGSKGE 1416



 Score = 86.7 bits (213), Expect = 4e-16
 Identities = 353/1494 (23%), Positives = 441/1494 (29%), Gaps = 412/1494 (27%)

Query: 184  FQEPPSSFTSTNYTSPSATPRPPAP----------GPPQSRGTS-----------PLQPG 222
            F  PP S     +T P   P P  P          G    RG S           P  PG
Sbjct: 53   FPGPPGSPGQKGFTGPEGLPGPQGPKGFPGLPGLTGSKGVRGISGLPGFSGSPGLPGTPG 112

Query: 223  SYPEYQASGADSWPPA-AENSFPG--ANFGVP--------------PAEPEPIPKGSR-- 263
            +   Y   G      +  E  FPG     G P              PA+ E I   ++  
Sbjct: 113  NTGPYGLVGVPGCSGSKGEQGFPGLPGTLGYPGIPGAAGLKGQKGAPAKEEDIELDAKGD 172

Query: 264  PG--GSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVG-- 319
            PG  G+P       P P   G    P P    G     GP       P+G   E  +G  
Sbjct: 173  PGLPGAPGPQGLPGP-PGFPGPVGPPGPPGFFGFPGAMGP-----RGPKGHMGERVIGHK 226

Query: 320  --------TGPAYP----LPTQPAPSPLPCYQGQPG--GLNRHSDLSGALSSPGAAHSAP 365
                    TGP  P    + T   P      +G+ G  G        G    PG ++ + 
Sbjct: 227  GERGVKGLTGPPGPPGTVIVTLTGPDNRTDLKGEKGDKGAMGEPGPPGPSGLPGESYGSE 286

Query: 366  R--PFSDSLHKSLTKI-LPERPPSAQDGLGSTRGPPSSLPQRHFPGQ------------- 409
            +  P    L     K  +P  P S  +G+   RG P  + +    GQ             
Sbjct: 287  KGAPGDPGLQGKPGKDGVPGFPGS--EGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPT 344

Query: 410  ----AYRASGVDTSPGPPDTELAAPGPPPARLPQLWDPTAAP-YPTPPGGPLAATR---- 460
                 Y+  G + +PGP       PGP  AR PQ   P+  P  P  PG      R    
Sbjct: 345  EYYDTYQEKGDEGTPGP-------PGPRGARGPQ--GPSGPPGVPGSPGSSRPGLRGAPG 395

Query: 461  ------SMFFNGQP------SPGQRLC-----LPQSAPLPWPQ---VLPTARPSPHGME- 499
                  S    G+P      +PG   C     LP S   P P    V     P  HG+  
Sbjct: 396  WPGLKGSKGERGRPGKDAMGTPGSPGCAGSPGLPGSPGPPGPPGDIVFRKGPPGDHGLPG 455

Query: 500  -------------------MLSRLPFPAGGPEWQG-----------GSQGALGTAGKTPG 529
                               + ++ P+  G P   G           G QGA G  G    
Sbjct: 456  YLGSPGIPGVDGPKGEPGLLCTQCPYIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGS 515

Query: 530  P-REKLPAVRSSQG--GSPALFTYNGMT-----------DPG--AQPLFFGVAQPQVSPH 573
            P    LP      G  G P L    G T           DPG   QP   G+     +P 
Sbjct: 516  PGNTGLPGFPGFPGAQGDPGLKGEKGETLQPEGQVGVPGDPGLRGQPGRKGLDGIPGTP- 574

Query: 574  GTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQ-LPGPLGPS 632
            G   LP P+   A   E     P     G   S  SP  + PA P     Q  PG  G  
Sbjct: 575  GVKGLPGPKGELALSGEKGDQGP----PGDPGSPGSPGPAGPAGPPGYGPQGEPGLQGTQ 630

Query: 633  AFFHPPTHPQETG--------SPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQC 684
                 P  P E G        +P P P  P   P H  P+     P      G  G    
Sbjct: 631  GVPGAPGPPGEAGPRGELSVSTPVPGPPGPPGPPGHPGPQGPPGIPGSLGKCGDPG---- 686

Query: 685  LEETPFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLA 744
                  P    E G  G+ GFP  P P     F  +  SL                    
Sbjct: 687  -----LPGPDGEPGIPGI-GFPGPPGPKGDQGFPGTKGSLG------------------- 721

Query: 745  AFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQ 804
                            K G    PG PGLP     P V      G      T    G+  
Sbjct: 722  -------------CPGKMGEPGLPGKPGLPGAKGEPAVAMPGGPG------TPGFPGERG 762

Query: 805  AEGKDDPLRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSF 864
              G+   +    LP L  TP                     E L+G       P      
Sbjct: 763  NSGEHGEIGLPGLPGLPGTPG-------------------NEGLDGPRGDPGQP------ 797

Query: 865  IDVFADEEPSGPRGPSSGHPLKSKAGVTPESKAPPPLPAATPDPQTPRPGDRGCPARGRP 924
                    P G +GP  G  ++   G    ++  P L       Q  R G  G   +G P
Sbjct: 798  -------GPPGEQGP-PGRCIEGPRG----AQGLPGLNGL--KGQQGRRGKTG--PKGDP 841

Query: 925  KTRSLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRND 984
                L  +    +  S G    +G+   L ++             G  G    L P   D
Sbjct: 842  GIPGLDRSGFPGETGSPGIPGHQGEMGPLGQR-------------GYPGNPGILGPPGED 888

Query: 985  GL--------GERPPPRPRRPRTQAPGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDP 1036
            G+           PP  P  P T  PG R  P   +P             +R  P  K  
Sbjct: 889  GVIGMMGFPGAIGPPGPPGNPGT--PGQRGSPG--IPGVKG---------QRGTPGAKGE 935

Query: 1037 RKRKARGGAWGKELILKIVQQKNRLREYDFA-SESEEDEQPPPRGPGFRGRRGRGEKRKE 1095
            +  K   G  G   I  ++  K       FA +  E+  +  P  PG +G +G       
Sbjct: 936  QGDK---GNPGPSEISHVIGDKGEPGLKGFAGNPGEKGNRGVPGMPGLKGLKGL------ 986

Query: 1096 VELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGAA 1155
                  P    P  PR       G  G+  NP EP G R  PG       P    + G  
Sbjct: 987  ------PGPAGPPGPR-------GDLGSTGNPGEP-GLRGIPGSMGNMGMPGSKGKRGTL 1032

Query: 1156 AREGGPKCADRPSVAPKDPLQVPTNTE-TSEETRPSLDFPQEAKEPETAEESAPDSTEFT 1214
               G P  A RP +     LQ        SE TRP    P       T +   P      
Sbjct: 1033 ---GFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGP-------TGDPGLPGD---- 1078

Query: 1215 EALRSPPAACAGEMG--ASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGS 1272
                       GEMG    PG L P  P  +    G+P   G      PHG     G+  
Sbjct: 1079 -------MGKKGEMGQPGPPGHLGPAGPEGA---PGSPGSPGLPGKPGPHGDLGFKGIKG 1128

Query: 1273 LLGGPG-----------------GTQAPVSHNSKDPPARQPGEFLAPVANPSSTACPKPS 1315
            LLG PG                 G +     +    PA + GE     A P     P   
Sbjct: 1129 LLGPPGIRGPPGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNP--- 1185

Query: 1316 VLSSKISSFGCDPAGFNRDPLGVP--VAKKGPQPYSSPHS----ELFLGPKDLAGCFLEE 1369
                     G   A  +R   G P    +KG    + P      E F GP  L G  +  
Sbjct: 1186 ---------GAQGAKGDRGAPGFPGLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPG 1236

Query: 1370 L---HPKPSARDAP-------PASSSCLCQDGEDAGSLEPQLPRSPPGTAET--EPGRAA 1417
                   P +R +P       P  S  +   G D GS+    P+ PPGTA     PGR  
Sbjct: 1237 QTGNRGPPGSRGSPGAPGPPGPPGSHVIGIKG-DKGSMGHPGPKGPPGTAGDMGPPGRLG 1295

Query: 1418 SPPTLESSSLFPDLPVDRFDPPLYGSLSANRDSGLP--FACADPPQKTVPSDPP 1469
            +P T       P LP  R DP   G      + G P       PP    P  PP
Sbjct: 1296 APGT-------PGLPGPRGDPGFQGFPGVKGEKGNPGFLGSIGPPGPIGPKGPP 1342



 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 289/1237 (23%), Positives = 378/1237 (30%), Gaps = 221/1237 (17%)

Query: 208  PGPPQSRGTSPLQPGSYPEYQASGADSWP-----PAAENSFPGANFGVPPAEPEPIPKGS 262
            PGPP +   +   P +  + +    D        P   +  PG ++G     P       
Sbjct: 238  PGPPGTVIVTLTGPDNRTDLKGEKGDKGAMGEPGPPGPSGLPGESYGSEKGAPGDPGLQG 297

Query: 263  RPG-----GSP--RGVSFQFPFPALHGAS-TKPFPADVAGHAFTNGPLVFAFHQPQGAWP 314
            +PG     G P   GV     FP L G    K    D+    F      +  +Q +G   
Sbjct: 298  KPGKDGVPGFPGSEGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPTEYYDTYQEKG--- 354

Query: 315  EEAVGTGPAYPLPTQ--PAPSPLPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSL 372
             +    GP  P   +    PS  P   G PG  +    L GA   PG   S         
Sbjct: 355  -DEGTPGPPGPRGARGPQGPSGPPGVPGSPG--SSRPGLRGAPGWPGLKGSKG------- 404

Query: 373  HKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGP 432
                     ER    +D +G T G P        PG           PGPP   +   GP
Sbjct: 405  ---------ERGRPGKDAMG-TPGSPGCAGSPGLPGSP-------GPPGPPGDIVFRKGP 447

Query: 433  PPAR-LP-QLWDPTAAPYPTPPGGP-LAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLP 489
            P    LP  L  P       P G P L  T+  +  G P       L     +P  Q   
Sbjct: 448  PGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQCPYIPGPPGLPGLPGLHGVKGIPGRQGAA 507

Query: 490  TARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKL-----PAVRSSQG-- 542
              + SP G    + LP   G P  QG   G  G  G+T  P  ++     P +R   G  
Sbjct: 508  GLKGSP-GSPGNTGLPGFPGFPGAQG-DPGLKGEKGETLQPEGQVGVPGDPGLRGQPGRK 565

Query: 543  ---GSPALFTYNGMTDPGAQPLFFGVAQPQVSPH--GTPSLPPPRVVGASPSESPLPSPA 597
               G P      G+  P  +    G    Q  P   G+P  P P      P   P   P 
Sbjct: 566  GLDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGSPGPAGPAGPPGYGPQGEPG 625

Query: 598  TN-TAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSP--------- 647
               T G   +   P  + P    S  + +PGP GP     PP HP   G P         
Sbjct: 626  LQGTQGVPGAPGPPGEAGPRGELSVSTPVPGPPGPPG---PPGHPGPQGPPGIPGSLGKC 682

Query: 648  ----FPSPEPPHSLPTHYQPEPA-----KAFPFPADGLGAEG------------------ 680
                 P P+    +P    P P      + FP     LG  G                  
Sbjct: 683  GDPGLPGPDGEPGIPGIGFPGPPGPKGDQGFPGTKGSLGCPGKMGEPGLPGKPGLPGAKG 742

Query: 681  ----AFQCLEETP-FPHEGPEVGRGGLQGFPRAPP-PYPTHHFSLSSASLD--------Q 726
                A      TP FP E    G  G  G P  P  P    +  L     D        +
Sbjct: 743  EPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLDGPRGDPGQPGPPGE 802

Query: 727  LDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGL-----PSPPAAPR 781
                  C +  R    L      +   G    R K G +  PG PGL     P    +P 
Sbjct: 803  QGPPGRCIEGPRGAQGLPGLNGLKGQQG---RRGKTGPKGDPGIPGLDRSGFPGETGSPG 859

Query: 782  VPA-DAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFP-----LPASDLDME 835
            +P      G L         G     G+D  +     P     P P      P       
Sbjct: 860  IPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPPGNPGTPGQRGSPG 919

Query: 836  DDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAGVT--P 893
                     T    G +    NP   S    V  D+   G +G +     K   GV   P
Sbjct: 920  IPGVKGQRGTPGAKGEQGDKGNPG-PSEISHVIGDKGEPGLKGFAGNPGEKGNRGVPGMP 978

Query: 894  ESKAPP--PLPAATPDPQ-----TPRPGDRGCPARGRPKTR-SLGLAPTEADAPSQGRQQ 945
              K     P PA  P P+     T  PG+ G   RG P +  ++G+  ++    + G   
Sbjct: 979  GLKGLKGLPGPAGPPGPRGDLGSTGNPGEPGL--RGIPGSMGNMGMPGSKGKRGTLGFPG 1036

Query: 946  RRGKQ----LKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPPRPRRPRTQA 1001
            R G+     +   + D    G +EG+  G  G      P  + GL   P    ++     
Sbjct: 1037 RAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPG------PTGDPGL---PGDMGKKGEMGQ 1087

Query: 1002 PGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRL 1061
            PG      P  P  A       S     LP +  P       G  G + I      K  L
Sbjct: 1088 PGPPGHLGPAGPEGAP-----GSPGSPGLPGKPGPH------GDLGFKGI------KGLL 1130

Query: 1062 REYDFASESEEDEQPPPRGP-GFRGRRGR-------GEKRKE--VELTQGPREDEPQKPR 1111
                          P   GP G RG +GR       GEK +   +    GPR +   +  
Sbjct: 1131 GPPGIRGPPGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNPGAQGA 1190

Query: 1112 KAARQEAGGDGAP--------ANPEEPGGSR--PGPGRSPQARGPSRSLETGAAAREGGP 1161
            K  R   G  G P        A P  P G    PGP   P A  P ++   G     G P
Sbjct: 1191 KGDRGAPGFPGLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPGQTGNRGPPGSRGSP 1250

Query: 1162 KCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDS------TEFTE 1215
                    AP  P    ++    +  + S+  P     P TA +  P        T    
Sbjct: 1251 G-------APGPPGPPGSHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGRLGAPGTPGLP 1303

Query: 1216 ALRSPPA-----ACAGEMG--------ASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPH 1262
              R  P         GE G          PG + P+ PP  R D GT K      +  P 
Sbjct: 1304 GPRGDPGFQGFPGVKGEKGNPGFLGSIGPPGPIGPKGPPGVRGDPGTLKIISLPGSPGPP 1363

Query: 1263 GSSPTPGVGSLLG--GPGGTQAPVSHNSKDPPARQPG 1297
            G+   PG+    G  GP G   P     K     +PG
Sbjct: 1364 GTPGEPGMQGEPGPPGPPGNLGPCGPRGKPGKDGKPG 1400



 Score = 69.7 bits (169), Expect = 5e-11
 Identities = 281/1179 (23%), Positives = 364/1179 (30%), Gaps = 217/1179 (18%)

Query: 65   PRQAR--DGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRYIL 122
            PR AR   G   PP + G   SS PG RG+P  P  +       R    A G+P      
Sbjct: 364  PRGARGPQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSP--- 420

Query: 123  GIASSRTKPTLDETPENP-----------------QLEAAQLPEVDTPQG-PG---TGAP 161
            G A S   P     P  P                  L +  +P VD P+G PG   T  P
Sbjct: 421  GCAGSPGLPGSPGPPGPPGDIVFRKGPPGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQCP 480

Query: 162  LRPGLPRTEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQP 221
              PG P     P     G         ++    +  SP  T  P  PG P ++G   L+ 
Sbjct: 481  YIPGPPGLPGLPGLH--GVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFPGAQGDPGLKG 538

Query: 222  GSYPEYQASGADSWP--PAAENSFPGANF-----GVPPAEPEPIPKGSRPGGSPRGVSFQ 274
                  Q  G    P  P      PG        G P  +  P PKG       +G   Q
Sbjct: 539  EKGETLQPEGQVGVPGDPGLRGQ-PGRKGLDGIPGTPGVKGLPGPKGELALSGEKG--DQ 595

Query: 275  FPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSP 334
             P P   G+   P PA  AG              P G  P+   G      +P  P P  
Sbjct: 596  GP-PGDPGSPGSPGPAGPAG--------------PPGYGPQGEPGLQGTQGVPGAPGP-- 638

Query: 335  LPCYQGQPGGLNRHSDLSGALSSPG-AAHSAPR---PFSDSLHKSLTKILPERPPSAQDG 390
             P   G  G L+  + + G    PG   H  P+       SL K     LP   P  + G
Sbjct: 639  -PGEAGPRGELSVSTPVPGPPGPPGPPGHPGPQGPPGIPGSLGKCGDPGLP--GPDGEPG 695

Query: 391  LGST--RGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGPPPARLPQLWDPTAAPY 448
            +      GPP     + FPG      G    PG    ++  PG P    P L      P 
Sbjct: 696  IPGIGFPGPPGPKGDQGFPG----TKGSLGCPG----KMGEPGLPGK--PGLPGAKGEPA 745

Query: 449  PTPPGGPLAATRSMFFNGQPS-PGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFP 507
               PGGP          G P  PG+R                      HG   L  LP  
Sbjct: 746  VAMPGGP----------GTPGFPGER-----------------GNSGEHGEIGLPGLPGL 778

Query: 508  AGGPEWQGGSQGALGTAGKTPGPREKLPAVRSSQG--GSPALFTYNGMTDPGAQPLFFGV 565
             G P    G  G  G  G+   P E+ P  R  +G  G+  L   NG+     +      
Sbjct: 779  PGTP-GNEGLDGPRGDPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGR------ 831

Query: 566  AQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSS--PANPS---- 619
             + +  P G P +P     G   S  P  + +    G     + P+     P NP     
Sbjct: 832  -RGKTGPKGDPGIP-----GLDRSGFPGETGSPGIPGHQ-GEMGPLGQRGYPGNPGILGP 884

Query: 620  -SEESQL-----PGPLGPSAFFHPPTHPQETGSP-FPSPEPPHSLPTHYQPEPAKAFPFP 672
              E+  +     PG +GP      P  P + GSP  P  +     P     +  K  P P
Sbjct: 885  PGEDGVIGMMGFPGAIGPPGPPGNPGTPGQRGSPGIPGVKGQRGTPGAKGEQGDKGNPGP 944

Query: 673  AD-----GLGAEGAFQCLEETPFPHEGPEV----GRGGLQGFP-RAPPPYPTHHFSLSS- 721
            ++     G   E   +     P       V    G  GL+G P  A PP P      +  
Sbjct: 945  SEISHVIGDKGEPGLKGFAGNPGEKGNRGVPGMPGLKGLKGLPGPAGPPGPRGDLGSTGN 1004

Query: 722  ----------ASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPG-- 769
                       S+  + +        +       F       GL       G +  PG  
Sbjct: 1005 PGEPGLRGIPGSMGNMGM-----PGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYS 1059

Query: 770  ---PPGLPSPPAAPRVPAD-AHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPF 825
                PG P P   P +P D    G +         G A  EG      +  LP       
Sbjct: 1060 EGTRPGPPGPTGDPGLPGDMGKKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGK----- 1114

Query: 826  PLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPL 885
            P P  DL  +    L  L    + G       P              P G RG      +
Sbjct: 1115 PGPHGDLGFKGIKGL--LGPPGIRGPPGLPGFP----------GSPGPMGIRGDQGRDGI 1162

Query: 886  KSKAGVTPES--KAPPPLPAATPDPQTPRPGDRGCPA-RGRP-KTRSLGLAPTEADAPSQ 941
               AG   E+     PP P   P  Q  + GDRG P   G P +  ++G A        +
Sbjct: 1163 PGPAGEKGETGLLRAPPGPRGNPGAQGAK-GDRGAPGFPGLPGRKGAMGDAGPRGPTGIE 1221

Query: 942  GRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGL----GERPPPRPRRP 997
            G     G    +      + G     GS G     G       G+    G    P P+ P
Sbjct: 1222 GFPGPPGLPGAIIPGQTGNRGPPGSRGSPGAPGPPGPPGSHVIGIKGDKGSMGHPGPKGP 1281

Query: 998  -----------RTQAPGSRADPAPR-VPRAAALP----EETRSSRRRRLPPRKDPRKRKA 1041
                       R  APG+   P PR  P     P    E+        + P   P   K 
Sbjct: 1282 PGTAGDMGPPGRLGAPGTPGLPGPRGDPGFQGFPGVKGEKGNPGFLGSIGP-PGPIGPKG 1340

Query: 1042 RGGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRGP-------GFRGRRGRGEKRK 1094
              G  G    LKI+             E     +P P GP       G RG+ G+  K  
Sbjct: 1341 PPGVRGDPGTLKIISLPGSPGPPGTPGEPGMQGEPGPPGPPGNLGPCGPRGKPGKDGKPG 1400

Query: 1095 EVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGS 1133
                T GP  ++  K  K     AG DG P    + G S
Sbjct: 1401 ----TPGPAGEKGNKGSKGEPGPAGSDGLPGLKGKRGDS 1435



 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 200/845 (23%), Positives = 263/845 (31%), Gaps = 154/845 (18%)

Query: 477  PQSAPLPWPQVLPTARPSPH-GMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPR---- 531
            PQ   LP   VL  A P+   G     +      G + + G +G  G  G +PG +    
Sbjct: 9    PQVLLLPLLLVLLAAAPAASKGCVCKDKGQCFCDGAKGEKGEKGFPGPPG-SPGQKGFTG 67

Query: 532  -EKLPAVRSSQG--GSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASP 588
             E LP  +  +G  G P L    G+      P F G      +P  T       V G S 
Sbjct: 68   PEGLPGPQGPKGFPGLPGLTGSKGVRGISGLPGFSGSPGLPGTPGNTGPYGLVGVPGCSG 127

Query: 589  SESP-----LPSPATNTAGSTCSSLSPMSSSPANPSSEESQ------LPGPLGPSAFFHP 637
            S+       LP           + L     +PA     E        LPG  GP     P
Sbjct: 128  SKGEQGFPGLPGTLGYPGIPGAAGLKGQKGAPAKEEDIELDAKGDPGLPGAPGPQGLPGP 187

Query: 638  PTHPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEV 697
            P  P   G                 P P   F FP   +G  G    + E    H+G E 
Sbjct: 188  PGFPGPVG----------------PPGPPGFFGFPG-AMGPRGPKGHMGERVIGHKG-ER 229

Query: 698  GRGGLQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLL 757
            G  GL G P  PP                  V++T    D N + L              
Sbjct: 230  GVKGLTG-PPGPPG----------------TVIVTLTGPD-NRTDL-------------- 257

Query: 758  ARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFL 817
             + + G + + G PG P P   P     +  G           GD   +GK         
Sbjct: 258  -KGEKGDKGAMGEPGPPGPSGLPGESYGSEKG---------APGDPGLQGK--------- 298

Query: 818  PSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPR 877
            P     P   P S+  ++ +     L+ E  +G++ Q               D  P G R
Sbjct: 299  PGKDGVP-GFPGSE-GVKGNRGFPGLMGE--DGIKGQK-------------GDIGPPGFR 341

Query: 878  GPSSGHPLKSKAGVTPESKAPPPLPAATPDPQTPR--PGDRGCPARGRPKTRSLGLAPTE 935
            GP+  +    + G   E    PP P     PQ P   PG  G P   RP  R  G     
Sbjct: 342  GPTEYYDTYQEKG--DEGTPGPPGPRGARGPQGPSGPPGVPGSPGSSRPGLR--GAPGWP 397

Query: 936  ADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPP--- 992
                S+G + R GK        + + G+   +GS G   + G      D +  + PP   
Sbjct: 398  GLKGSKGERGRPGKDA------MGTPGSPGCAGSPGLPGSPGPPGPPGDIVFRKGPPGDH 451

Query: 993  -------RPRRPRTQA----PGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKA 1041
                    P  P        PG      P +P    LP        + +P R+     K 
Sbjct: 452  GLPGYLGSPGIPGVDGPKGEPGLLCTQCPYIPGPPGLPGLPGLHGVKGIPGRQGAAGLKG 511

Query: 1042 RGGAWGKELILKIVQQKNRLREYDFASESEEDEQPP-----PRGPGFRGRRGRGEKRKEV 1096
              G+ G   +           +     E  E  QP      P  PG RG+ GR +    +
Sbjct: 512  SPGSPGNTGLPGFPGFPGAQGDPGLKGEKGETLQPEGQVGVPGDPGLRGQPGR-KGLDGI 570

Query: 1097 ELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGAAA 1156
              T G +     K   A   E G  G P +P  PG   P     P   GP    E G   
Sbjct: 571  PGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGSPGPAGPAGPPGYGPQG--EPGLQG 628

Query: 1157 REGGPKCADRPSVA-PKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTE 1215
             +G P     P  A P+  L V T         P    P     P       P     + 
Sbjct: 629  TQGVPGAPGPPGEAGPRGELSVST---------PVPGPPGPPGPPGHPGPQGPPGIPGSL 679

Query: 1216 ALRSPPAACA--GEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSL 1273
                 P      GE G  PG+  P  PP  + D G P   GSL      G    PG   L
Sbjct: 680  GKCGDPGLPGPDGEPGI-PGIGFP-GPPGPKGDQGFPGTKGSLGCPGKMGEPGLPGKPGL 737

Query: 1274 LGGPG 1278
             G  G
Sbjct: 738  PGAKG 742



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 285/1227 (23%), Positives = 374/1227 (30%), Gaps = 204/1227 (16%)

Query: 1682 AEGDSRPPQDVCLPEPS--KQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRL 1739
            A G+  PP    LP  S   + G   D G   K   D    FP         E     R 
Sbjct: 266  AMGEPGPPGPSGLPGESYGSEKGAPGDPGLQGKPGKDGVPGFP-------GSEGVKGNRG 318

Query: 1740 LPCEQRGGFLPEPGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASP 1799
             P     G + E G   Q  +G   P  F  P  +         +G P      P G   
Sbjct: 319  FP-----GLMGEDGIKGQ--KGDIGPPGFRGPTEYYDTYQEKGDEGTPG-----PPGPRG 366

Query: 1800 SHAAQGHSAGRAGGHLHPTAGRPGFEGNEFAPA--GASSLTAPRGREAWLVPVPSPACVS 1857
            +   QG S G  G    P + RPG  G    P   G+       G++A   P  SP C  
Sbjct: 367  ARGPQGPS-GPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTP-GSPGCAG 424

Query: 1858 NTHPSRRSQDPALSPP------------------IRQLQLPGPGVAKSKDGILGLQELTP 1899
            +  P          PP                  +    +PG    K + G+L  Q   P
Sbjct: 425  S--PGLPGSPGPPGPPGDIVFRKGPPGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQ--CP 480

Query: 1900 AAQSPPRV-NPSGLEGGTVEGGKVACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLL 1958
                PP +    GL G     G+      +GSPG    T LP   G      A G  GL 
Sbjct: 481  YIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFP---GAQGDPGLK 537

Query: 1959 GQAEKTQGQGTANQLQPENGVS-PGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAA 2017
            G+  +T        LQPE  V  PG               + G T G   L   KG  A 
Sbjct: 538  GEKGET--------LQPEGQVGVPGDPGLRGQPGRKGLDGIPG-TPGVKGLPGPKGELAL 588

Query: 2018 MSLQEEAEPTPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAP 2077
               + +  P   P SP     A         +G  G  P+    PGL       G    P
Sbjct: 589  SGEKGDQGPPGDPGSPGSPGPA-------GPAGPPGYGPQ--GEPGLQGTQGVPGAPGPP 639

Query: 2078 SV----GDLAACAPSPTSAAHMPCSLGPLPREDPLTSPSRAQGGLGGQLPASPSCRDPPG 2133
                  G+L+   P P      P   GP     P   P    G LG      P    P G
Sbjct: 640  GEAGPRGELSVSTPVPGP----PGPPGPPGHPGP-QGPPGIPGSLG--KCGDPGLPGPDG 692

Query: 2134 PQQLLACSPAWAPLEEAD-GVQATTDT----GAEDSPVAP--PSLTTSPCDPKEALAGCL 2186
               +        P  + D G   T  +    G    P  P  P L  +  +P  A+ G  
Sbjct: 693  EPGIPGIGFPGPPGPKGDQGFPGTKGSLGCPGKMGEPGLPGKPGLPGAKGEPAVAMPG-- 750

Query: 2187 LQGEGS---PLEDPSSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSP 2243
              G G+   P E  +S   G +          TP +  L  P   R +     P     P
Sbjct: 751  --GPGTPGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLDGP---RGDPGQPGPPGEQGP 805

Query: 2244 PLAGAVSPSVAVRATGLSSTPTGDEAQAG-RGLPGPDPQSRGAPPHTNPDRMPRGHSSYS 2302
            P      P  A    GL+    G + Q G RG  GP    +G P     DR      + S
Sbjct: 806  PGRCIEGPRGAQGLPGLN----GLKGQQGRRGKTGP----KGDPGIPGLDRSGFPGETGS 857

Query: 2303 PSNTARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSSK--EPEDPGTPETGRS 2360
            P      G          P  P  L   G D    + G  G       P +PGTP  G+ 
Sbjct: 858  PGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPPGNPGTP--GQR 915

Query: 2361 GATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRNASHQTPQGDPLGPQDLKQRS 2420
            G+  +P V         G+   P +        +P     +     +G+P          
Sbjct: 916  GSPGIPGVK--------GQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEP--------GL 959

Query: 2421 RGYKKKPASTENGQWKGQAPHGPVTCEVCAASFRSGPGLSRHKARKHRPHPGAPAEPSPA 2480
            +G+   P    N                     R  PG+   K  K  P P  P  P   
Sbjct: 960  KGFAGNPGEKGN---------------------RGVPGMPGLKGLKGLPGPAGPPGPRGD 998

Query: 2481 ALPAQQPLEPLAQKCQPPRKKSHRVSGKERPNHSRGDPSHVTQP--PPAQGSKEVLRAPG 2538
                  P EP   +  P    +  + G +    + G P    +P  P   G +     PG
Sbjct: 999  LGSTGNPGEP-GLRGIPGSMGNMGMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPG 1057

Query: 2539 SPHSQQLHPPSPT-----EHEVDVKTPASKPRPDQAREDELHPKQAEKREGRRWRREPTV 2593
                 +  PP PT       ++  K    +P P       L P   E   G         
Sbjct: 1058 YSEGTRPGPPGPTGDPGLPGDMGKKGEMGQPGP----PGHLGPAGPEGAPGSPGSPGLPG 1113

Query: 2594 DSPSHSEGKSNKKRGKLRGRRLREESILP----------VSADVISDGRGSRPSPA---- 2639
                H +      +G L    +R    LP          +  D    GR   P PA    
Sbjct: 1114 KPGPHGDLGFKGIKGLLGPPGIRGPPGLPGFPGSPGPMGIRGD---QGRDGIPGPAGEKG 1170

Query: 2640 -MASYAASPSHCLSVEGGPEADGEQPPRLATLGPGVMEGAAETDQEALCAGETGAQKPPG 2698
                  A P       G P A G +  R A   PG + G      +A   G TG +  PG
Sbjct: 1171 ETGLLRAPP----GPRGNPGAQGAKGDRGAPGFPG-LPGRKGAMGDAGPRGPTGIEGFPG 1225

Query: 2699 DRMLCPGRMDGAALGEQPTGQKGA-SARGFWGPRETKALGVCKESGSEPAEDSSRAHSRS 2757
               L    + G      P G +G+  A G  GP  +  +G+  + GS           + 
Sbjct: 1226 PPGLPGAIIPGQTGNRGPPGSRGSPGAPGPPGPPGSHVIGIKGDKGS-----MGHPGPKG 1280

Query: 2758 EEGVWEENTPPLGPLGFPETSSSPADSTTSSCLQGLP------DNPDTQGGVQGPEGPTP 2811
              G   +  PP G LG P T   P         QG P       NP   G + GP GP  
Sbjct: 1281 PPGTAGDMGPP-GRLGAPGTPGLPGPRGDPG-FQGFPGVKGEKGNPGFLGSI-GPPGPI- 1336

Query: 2812 DASGSSAKDPPSLFDDEVSFSQLFPPG 2838
                   K PP +  D  +   +  PG
Sbjct: 1337 -----GPKGPPGVRGDPGTLKIISLPG 1358



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 176/713 (24%), Positives = 227/713 (31%), Gaps = 137/713 (19%)

Query: 28   GHPSQP-PLEDNTPATRTTKGAREAGGQAQAMELPEAQPRQARDGELKPPSLRGQAPSST 86
            G P QP P  +  P  R  +G R A G      L   Q R+ + G    P + G   S  
Sbjct: 792  GDPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKTGPKGDPGIPGLDRSGF 851

Query: 87   PGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQ 146
            PG+ GSP  P  +  +    +      G P    ILG       P  ++           
Sbjct: 852  PGETGSPGIPGHQGEMGPLGQ-----RGYPGNPGILG-------PPGEDGVIGMMGFPGA 899

Query: 147  LPEVDTPQGPGT----GAPLRPGLPRTEAQPAAE-ELGFHRCFQEPPSSFTSTNYTSPSA 201
            +     P  PGT    G+P  PG+      P A+ E G          S    +   P  
Sbjct: 900  IGPPGPPGNPGTPGQRGSPGIPGVKGQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPGL 959

Query: 202  TPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPAAENSFPGANFGVPPAEPEPIPKG 261
                  PG   +RG  P  PG        G    P  A    P  + G      EP  +G
Sbjct: 960  KGFAGNPGEKGNRGV-PGMPG------LKGLKGLPGPAGPPGPRGDLGSTGNPGEPGLRG 1012

Query: 262  --------SRPGGSPRGVSFQFP-------FPALHG-----------ASTKPFPADVAGH 295
                      PG   +  +  FP        P +HG             T+P P    G 
Sbjct: 1013 IPGSMGNMGMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGD 1072

Query: 296  AFTNGPL----VFAFHQPQG----AWPEEAVGTGPAYPLPTQPAPSPLPCYQG-----QP 342
                G +          P G    A PE A G+  +  LP +P P     ++G      P
Sbjct: 1073 PGLPGDMGKKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGP 1132

Query: 343  GGLNRHSDLSGALSSPG--------AAHSAPRPFSDSLHKSLTKIL--PERPPSAQDGLG 392
             G+     L G   SPG             P P  +     L +    P   P AQ   G
Sbjct: 1133 PGIRGPPGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNPGAQGAKG 1192

Query: 393  STRGPPSSLPQRHFPGQAYRASGV-DTSPGPPDTELAAPGPPPARLPQLWDPTAAPYPTP 451
              RG P       FPG   R   + D  P  P      PGPP   LP    P       P
Sbjct: 1193 D-RGAPG------FPGLPGRKGAMGDAGPRGPTGIEGFPGPP--GLPGAIIPGQTGNRGP 1243

Query: 452  PGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGP 511
            PG             + SPG        AP P         P P G  ++        G 
Sbjct: 1244 PG------------SRGSPG--------APGP---------PGPPGSHVI--------GI 1266

Query: 512  EWQGGSQGALGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQVS 571
            +   GS G  G  G      +  P  R    G+P L    G  DPG Q  F GV   + +
Sbjct: 1267 KGDKGSMGHPGPKGPPGTAGDMGPPGRLGAPGTPGLPGPRG--DPGFQG-FPGVKGEKGN 1323

Query: 572  PHGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSE-ESQLPGP-- 628
            P    S+ PP  +G          P T    S   S  P   +P  P  + E   PGP  
Sbjct: 1324 PGFLGSIGPPGPIGPKGPPGVRGDPGTLKIISLPGSPGP-PGTPGEPGMQGEPGPPGPPG 1382

Query: 629  -LGPSAFFHPPTHPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEG 680
             LGP      P    + G+P P+ E  +        + +K  P PA   G  G
Sbjct: 1383 NLGPCGPRGKPGKDGKPGTPGPAGEKGN--------KGSKGEPGPAGSDGLPG 1427



 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 116/476 (24%), Positives = 150/476 (31%), Gaps = 78/476 (16%)

Query: 3429 GAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEVA 3488
            G PG+K       +P  +    +PG A  PG     PRG          P L  +   + 
Sbjct: 964  GNPGEKGNRGVPGMPGLKGLKGLPGPAGPPG-----PRGDLGSTGNPGEPGLRGIPGSMG 1018

Query: 3489 ----PST-----TKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRG 3539
                P +     T G+P    RP  P  H ++G +    + E   P   P P       G
Sbjct: 1019 NMGMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPG-PPGPTGDPGLPG 1077

Query: 3540 DCALDGALERPENEASPGSPGPLLQQALPLGASLP-RPGARG----QDAEGKRAPLVFSG 3594
            D    G + +P      G  GP      P    LP +PG  G    +  +G   P    G
Sbjct: 1078 DMGKKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGPPGIRG 1137

Query: 3595 KRRAPGARGRCAPDHFQEDHLLQ-----KEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQ 3649
                PG  G   P   + D           ++  +  + +  GPRG           G Q
Sbjct: 1138 PPGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGN---------PGAQ 1188

Query: 3650 SSSKDRSAASTPS----KALKFPVHPRKAVGSLA-------PGELARGTENGMKPATPKA 3698
             +  DR A   P     K       PR   G          PG +  G      P   + 
Sbjct: 1189 GAKGDRGAPGFPGLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPGQTGNRGPPGSRG 1248

Query: 3699 KPG-PSSQGS-GSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARA 3756
             PG P   G  GS   G K   GS   P               P  P  +      P R 
Sbjct: 1249 SPGAPGPPGPPGSHVIGIKGDKGSMGHPG--------------PKGPPGTAGDMGPPGRL 1294

Query: 3757 QAKSCTKGPREAGEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKP 3816
             A      P   G  GP G   P  +G    K +KG  PG      +GS G  P  P  P
Sbjct: 1295 GA------PGTPGLPGPRGD--PGFQGFPGVKGEKGN-PG-----FLGSIG--PPGPIGP 1338

Query: 3817 PRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRP 3872
               P  +  P   L     P S   P  P     + EPG       LG   P+G+P
Sbjct: 1339 KGPPGVRGDPG-TLKIISLPGSPGPPGTPGEPGMQGEPGPPGPPGNLGPCGPRGKP 1393



 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 119/452 (26%), Positives = 148/452 (32%), Gaps = 83/452 (18%)

Query: 3428 PGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEV 3487
            PG+PGQK       LP  +     PG         P   GS  +     LP         
Sbjct: 57   PGSPGQKGFTGPEGLPGPQGPKGFPG--------LPGLTGSKGVRGISGLPGF------- 101

Query: 3488 APSTTKGWPETLERPVDPVTHPIRGCELPSNHQECP--PPSLS----PFPAALADGRGDC 3541
              S + G P T           + GC      Q  P  P +L     P  A L   +G  
Sbjct: 102  --SGSPGLPGTPGNTGPYGLVGVPGCSGSKGEQGFPGLPGTLGYPGIPGAAGLKGQKGAP 159

Query: 3542 AL--DGALERPENEASPGSPGPLLQQALPLGASLPRPGARGQDAEGKRAPLVFSGKRRAP 3599
            A   D  L+   +   PG+PGP   Q LP     P P        G   P  F G    P
Sbjct: 160  AKEEDIELDAKGDPGLPGAPGP---QGLPGPPGFPGP-------VGPPGPPGFFG---FP 206

Query: 3600 GARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKP---AGCQSSSKDRS 3656
            GA G   P     + ++  + E     +    GP GT    + T P      +    D+ 
Sbjct: 207  GAMGPRGPKGHMGERVIGHKGERGVKGLTGPPGPPGTVIV-TLTGPDNRTDLKGEKGDKG 265

Query: 3657 AASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATP--KAKPG-------PSSQGS 3707
            A   P      P  P     S  PGE + G+E G  P  P  + KPG       P S+G 
Sbjct: 266  AMGEPG-----PPGP-----SGLPGE-SYGSEKG-APGDPGLQGKPGKDGVPGFPGSEGV 313

Query: 3708 GSPR--PGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGP 3765
               R  PG     G + Q   G +       P +     +    E  P          GP
Sbjct: 314  KGNRGFPGLMGEDGIKGQ--KGDIGPPGFRGPTEYYDTYQEKGDEGTPG-------PPGP 364

Query: 3766 REA-GEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQA 3824
            R A G QGP G  G      SS    +G    P    S G  GR        P +P    
Sbjct: 365  RGARGPQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSPGCAG 424

Query: 3825 TPSRVLPTKPKPNSQNKPRPPPS-EQRKAEPG 3855
            +P   LP  P P     P PP     RK  PG
Sbjct: 425  SPG--LPGSPGP-----PGPPGDIVFRKGPPG 449



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 115/447 (25%), Positives = 136/447 (30%), Gaps = 89/447 (19%)

Query: 3414 RGGRQPFAFRG-VRRPGAPGQKARALEGTLP--SKRRRVAMPGSAPGPGEDRPPPRGSSP 3470
            +G R    F G   RPG PG      +   P  S+  R   PG    PG   P   G   
Sbjct: 1026 KGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGDPG--LPGDMGKKG 1083

Query: 3471 ILSEGSLPALLHLCSEVAPSTTKGWPETLERPVDPVTHP------IRGCELPSNHQECPP 3524
             + +   P  L       P    G P +   P  P  H       I+G   P   +   P
Sbjct: 1084 EMGQPGPPGHL---GPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGPPGIRG--P 1138

Query: 3525 PSLSPFPAALADG--RGDCALDG----ALERPEN---------EASPGSPGPLLQQALPL 3569
            P L  FP +      RGD   DG    A E+ E            +PG+ G    +  P 
Sbjct: 1139 PGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNPGAQGAKGDRGAPG 1198

Query: 3570 GASLP-RPGARGQDAEGKRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMV 3628
               LP R GA G    G R P    G    PG  G   P                     
Sbjct: 1199 FPGLPGRKGAMGD--AGPRGPTGIEGFPGPPGLPGAIIPGQ------------------T 1238

Query: 3629 SEGGPRGTFHKGSATKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAP-GELARGT 3687
               GP G+     A  P G   S          S     P  P    G + P G L    
Sbjct: 1239 GNRGPPGSRGSPGAPGPPGPPGSHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGRLGA-- 1296

Query: 3688 ENGMKPATPKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSR-- 3745
                 P TP   PGP         PG K   G +  P  G L S     P  P  P    
Sbjct: 1297 -----PGTP-GLPGPRGDPGFQGFPGVK---GEKGNP--GFLGSIGPPGPIGPKGPPGVR 1345

Query: 3746 -------------SPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPKEKGESSTKRKKG 3792
                         SP P   P     +       E G  GP G+LGP        K  K 
Sbjct: 1346 GDPGTLKIISLPGSPGPPGTPGEPGMQG------EPGPPGPPGNLGPCGPRGKPGKDGKP 1399

Query: 3793 QVPGPARSE-SVGSFGR-APSAPDKPP 3817
              PGPA  + + GS G   P+  D  P
Sbjct: 1400 GTPGPAGEKGNKGSKGEPGPAGSDGLP 1426



 Score = 40.8 bits (94), Expect = 0.027
 Identities = 117/495 (23%), Positives = 146/495 (29%), Gaps = 74/495 (14%)

Query: 3428 PGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEV 3487
            PG PG K       LP  +  +A+ G     G    P    SP  +  + P       E 
Sbjct: 571  PGTPGVKG------LPGPKGELALSGEKGDQGPPGDPGSPGSPGPAGPAGPPGYGPQGEP 624

Query: 3488 APSTTKGWPETLERPVDP-------VTHPIRGCELPSNHQECPPPSLSP-FPAALADGRG 3539
                T+G P     P +        V+ P+ G   P      P P   P  P +L    G
Sbjct: 625  GLQGTQGVPGAPGPPGEAGPRGELSVSTPVPGPPGPPGPPGHPGPQGPPGIPGSL----G 680

Query: 3540 DCALDGALERPENEAS------PGSPGPLLQQALP-LGASLPRPGARGQDAEGKRAPLVF 3592
             C  D  L  P+ E        PG PGP   Q  P    SL  PG  G+           
Sbjct: 681  KCG-DPGLPGPDGEPGIPGIGFPGPPGPKGDQGFPGTKGSLGCPGKMGEPG--------L 731

Query: 3593 SGKRRAPGARGR--CAPDHFQEDHLLQKEKEVSSSH----MVSEGGPRGTFHKGSATKPA 3646
             GK   PGA+G    A            E+  S  H    +    G  GT        P 
Sbjct: 732  PGKPGLPGAKGEPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLDGPR 791

Query: 3647 GCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPAT-PKAKPG---- 3701
            G             P + ++    PR A G   PG      + G +  T PK  PG    
Sbjct: 792  GDPGQPGPPGEQGPPGRCIE---GPRGAQG--LPGLNGLKGQQGRRGKTGPKGDPGIPGL 846

Query: 3702 --------------PSSQGSGSP--RPGTKTGGGSQPQPAS----GQLQSETATTPAKPS 3741
                          P  QG   P  + G     G    P      G +    A  P  P 
Sbjct: 847  DRSGFPGETGSPGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPP 906

Query: 3742 FPSRSPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPKE----KGESSTKRKKGQVPGP 3797
                +P     P     K     P   GEQG  G+ GP E     G+      KG    P
Sbjct: 907  GNPGTPGQRGSPGIPGVKGQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPGLKGFAGNP 966

Query: 3798 ARSESVGSFGRAPSAPDKPPRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHT 3857
                + G  G       K    P     P   L +   P        P S      PG  
Sbjct: 967  GEKGNRGVPGMPGLKGLKGLPGPAGPPGPRGDLGSTGNPGEPGLRGIPGSMGNMGMPGSK 1026

Query: 3858 QRKDRLGKAFPQGRP 3872
             ++  LG     GRP
Sbjct: 1027 GKRGTLGFPGRAGRP 1041



 Score = 37.7 bits (86), Expect = 0.23
 Identities = 34/115 (29%), Positives = 43/115 (37%), Gaps = 9/115 (7%)

Query: 3176 RGQARRSLGDLPGGLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAK 3235
            RGQ  R   D   G+ G+  V  L     E A    +G +      GSPG P G  G A 
Sbjct: 559  RGQPGRKGLD---GIPGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGSP-GPAGPAG 614

Query: 3236 KDSPGERAKPRARSTPS-----NPDGAATPDSASATALADAGSPGPPRTTPSPSP 3285
                G + +P  + T        P G A P    + +    G PGPP     P P
Sbjct: 615  PPGYGPQGEPGLQGTQGVPGAPGPPGEAGPRGELSVSTPVPGPPGPPGPPGHPGP 669



 Score = 35.0 bits (79), Expect = 1.5
 Identities = 43/143 (30%), Positives = 51/143 (35%), Gaps = 28/143 (19%)

Query: 3183 LGDLPG-----GLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKD 3237
            L  LPG     G+ G    A L  S   P      G      A G PG   G++GE  + 
Sbjct: 488  LPGLPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFPGAQGDPGLK-GEKGETLQP 546

Query: 3238 S--------PGERAKPRARST---PSNPDGAATPDSASATALA----DAGSPGPPRTTPS 3282
                     PG R +P  +     P  P     P      AL+    D G PG P +  S
Sbjct: 547  EGQVGVPGDPGLRGQPGRKGLDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGS 606

Query: 3283 PSPDPWAG-------GEPLLQAT 3298
            P P   AG       GEP LQ T
Sbjct: 607  PGPAGPAGPPGYGPQGEPGLQGT 629



 Score = 32.3 bits (72), Expect = 9.5
 Identities = 35/116 (30%), Positives = 39/116 (33%), Gaps = 28/116 (24%)

Query: 3205 EPAPKHHRGK--RSAGKAAGSPGDPWGQEGEAKKDS----PGERAKPRARSTPS------ 3252
            EP P    G    S G   G+PGDP G +G+  KD     PG       R  P       
Sbjct: 269  EPGPPGPSGLPGESYGSEKGAPGDP-GLQGKPGKDGVPGFPGSEGVKGNRGFPGLMGEDG 327

Query: 3253 --------NPDGAATPDSASAT--ALADAGSPGPP-----RTTPSPSPDPWAGGEP 3293
                     P G   P     T     D G+PGPP     R    PS  P   G P
Sbjct: 328  IKGQKGDIGPPGFRGPTEYYDTYQEKGDEGTPGPPGPRGARGPQGPSGPPGVPGSP 383


>gi|89142733 alpha 3 type IV collagen isoform 2 precursor [Homo
            sapiens]
          Length = 1637

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 255/1046 (24%), Positives = 328/1046 (31%), Gaps = 188/1046 (17%)

Query: 1    MPG-ERPRGAPPPTMTGDLQPRQVASSPGHPSQPPLED--NTPATRTTKGAREAGGQAQA 57
            +PG + P+G P    T   Q   +   PG P  P L      P  +   G + + G    
Sbjct: 462  IPGVDGPKGEPGLLCT---QCPYIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGSPGN 518

Query: 58   MELPEAQPRQARDGELKPPSLRGQA-----PSSTPGKRGSP--QTPPGRSPLQAPSRLAG 110
              LP         G+   P L+G+      P    G  G P  +  PGR  L       G
Sbjct: 519  TGLPGFPGFPGAQGD---PGLKGEKGETLQPEGQVGVPGDPGLRGQPGRKGLDGIPGTPG 575

Query: 111  RAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGP-GTGAPLRPGLPRT 169
              +G P  +  L ++  +        P +P       P    P GP G G    PGL  T
Sbjct: 576  -VKGLPGPKGELALSGEKGDQGPPGDPGSPGS-----PGPAGPAGPPGYGPQGEPGLQGT 629

Query: 170  EAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQ--PGSYPEY 227
            +  P A           PP         S S TP P  PGPP   G    Q  PG     
Sbjct: 630  QGVPGAPG---------PPGEAGPRGELSVS-TPVPGPPGPPGPPGHPGPQGPPGIPGSL 679

Query: 228  QASGADSWP-PAAENSFPGANFGVPPAEPEPIPKGSR--PGGSPR-GVSFQFPFPALHGA 283
               G    P P  E   PG  F  PP      PKG +  PG     G   +   P L G 
Sbjct: 680  GKCGDPGLPGPDGEPGIPGIGFPGPPG-----PKGDQGFPGTKGSLGCPGKMGEPGLPGK 734

Query: 284  STKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYP-LPTQPAPSPLPCYQGQP 342
               P        A   GP    F   +G   E      P  P LP  P    L   +G P
Sbjct: 735  PGLPGAKGEPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLDGPRGDP 794

Query: 343  GGLNRHSDLSGALSSPGAAHSAPR-----PFSDSLH-------KSLTKILPERPPSAQDG 390
            G         G    PG     PR     P  + L        K+  K  P  P   + G
Sbjct: 795  G----QPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKTGPKGDPGIPGLDRSG 850

Query: 391  LGSTRGPPS---------SLPQRHFPGQA--------------YRASGVDTSPGPPDT-- 425
                 G P           L QR +PG                    G    PGPP    
Sbjct: 851  FPGETGSPGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPPGNPG 910

Query: 426  ---ELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPL 482
               +  +PG P  +  Q   P A       G P  +  S     +  PG    L   A  
Sbjct: 911  TPGQRGSPGIPGVK-GQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPG----LKGFAGN 965

Query: 483  PWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREK--------- 533
            P  +      P   G++ L  LP PAG P    G +G LG+ G    P  +         
Sbjct: 966  PGEKG-NRGVPGMPGLKGLKGLPGPAGPP----GPRGDLGSTGNPGEPGLRGIPGSMGNM 1020

Query: 534  -LPAVRSSQG--------GSPALFTYNGMTDPGAQPLFFGVAQP-QVSPHGTPSLPPPRV 583
             +P  +  +G        G P L   +G+     +P +    +P    P G P LP    
Sbjct: 1021 GMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGDPGLPGDMG 1080

Query: 584  VGASPSESPLPSPATNTAGSTCSSLSPMSSS-PANPSSEESQ----LPGPLGPSAFFHPP 638
                  + P P      AG   +  SP S   P  P          + G LGP     PP
Sbjct: 1081 KKGEMGQ-PGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGPPGIRGPP 1139

Query: 639  THPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVG 698
              P   GSP P              +     P PA   G +G    L   P P   P  G
Sbjct: 1140 GLPGFPGSPGPMGIRGD--------QGRDGIPGPA---GEKGETGLLRAPPGPRGNP--G 1186

Query: 699  RGGLQGFPRAP--PPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLL 756
              G +G   AP  P  P    ++  A               R  + +  F       G +
Sbjct: 1187 AQGAKGDRGAPGFPGLPGRKGAMGDAG-------------PRGPTGIEGFPGPPGLPGAI 1233

Query: 757  LA-----RAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDP 811
            +      R   G + SPG PG P PP +  +      G + H       G A   G    
Sbjct: 1234 IPGQTGNRGPPGSRGSPGAPGPPGPPGSHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGR 1293

Query: 812  LRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADE 871
            L     P L     P P  D              +   G++ +  NP     F+      
Sbjct: 1294 LGAPGTPGL-----PGPRGDPGF-----------QGFPGVKGEKGNP----GFLGSIGPP 1333

Query: 872  EPSGPRGPSS--GHPLKSKAGVTPESKAPPPLPA-----ATPDPQTPRPGDRG-CPARGR 923
             P GP+GP    G P   K    P S  PP  P        P P  P PG+ G C  RG+
Sbjct: 1334 GPIGPKGPPGVRGDPGTLKIISLPGSPGPPGTPGEPGMQGEPGPPGP-PGNLGPCGPRGK 1392

Query: 924  PKTRSLGLAPTEADAPSQGRQQRRGK 949
            P     G   T   A  +G +  +G+
Sbjct: 1393 PGKD--GKPGTPGPAGEKGNKGSKGE 1416



 Score = 86.7 bits (213), Expect = 4e-16
 Identities = 353/1494 (23%), Positives = 441/1494 (29%), Gaps = 412/1494 (27%)

Query: 184  FQEPPSSFTSTNYTSPSATPRPPAP----------GPPQSRGTS-----------PLQPG 222
            F  PP S     +T P   P P  P          G    RG S           P  PG
Sbjct: 53   FPGPPGSPGQKGFTGPEGLPGPQGPKGFPGLPGLTGSKGVRGISGLPGFSGSPGLPGTPG 112

Query: 223  SYPEYQASGADSWPPA-AENSFPG--ANFGVP--------------PAEPEPIPKGSR-- 263
            +   Y   G      +  E  FPG     G P              PA+ E I   ++  
Sbjct: 113  NTGPYGLVGVPGCSGSKGEQGFPGLPGTLGYPGIPGAAGLKGQKGAPAKEEDIELDAKGD 172

Query: 264  PG--GSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVG-- 319
            PG  G+P       P P   G    P P    G     GP       P+G   E  +G  
Sbjct: 173  PGLPGAPGPQGLPGP-PGFPGPVGPPGPPGFFGFPGAMGP-----RGPKGHMGERVIGHK 226

Query: 320  --------TGPAYP----LPTQPAPSPLPCYQGQPG--GLNRHSDLSGALSSPGAAHSAP 365
                    TGP  P    + T   P      +G+ G  G        G    PG ++ + 
Sbjct: 227  GERGVKGLTGPPGPPGTVIVTLTGPDNRTDLKGEKGDKGAMGEPGPPGPSGLPGESYGSE 286

Query: 366  R--PFSDSLHKSLTKI-LPERPPSAQDGLGSTRGPPSSLPQRHFPGQ------------- 409
            +  P    L     K  +P  P S  +G+   RG P  + +    GQ             
Sbjct: 287  KGAPGDPGLQGKPGKDGVPGFPGS--EGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPT 344

Query: 410  ----AYRASGVDTSPGPPDTELAAPGPPPARLPQLWDPTAAP-YPTPPGGPLAATR---- 460
                 Y+  G + +PGP       PGP  AR PQ   P+  P  P  PG      R    
Sbjct: 345  EYYDTYQEKGDEGTPGP-------PGPRGARGPQ--GPSGPPGVPGSPGSSRPGLRGAPG 395

Query: 461  ------SMFFNGQP------SPGQRLC-----LPQSAPLPWPQ---VLPTARPSPHGME- 499
                  S    G+P      +PG   C     LP S   P P    V     P  HG+  
Sbjct: 396  WPGLKGSKGERGRPGKDAMGTPGSPGCAGSPGLPGSPGPPGPPGDIVFRKGPPGDHGLPG 455

Query: 500  -------------------MLSRLPFPAGGPEWQG-----------GSQGALGTAGKTPG 529
                               + ++ P+  G P   G           G QGA G  G    
Sbjct: 456  YLGSPGIPGVDGPKGEPGLLCTQCPYIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGS 515

Query: 530  P-REKLPAVRSSQG--GSPALFTYNGMT-----------DPG--AQPLFFGVAQPQVSPH 573
            P    LP      G  G P L    G T           DPG   QP   G+     +P 
Sbjct: 516  PGNTGLPGFPGFPGAQGDPGLKGEKGETLQPEGQVGVPGDPGLRGQPGRKGLDGIPGTP- 574

Query: 574  GTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQ-LPGPLGPS 632
            G   LP P+   A   E     P     G   S  SP  + PA P     Q  PG  G  
Sbjct: 575  GVKGLPGPKGELALSGEKGDQGP----PGDPGSPGSPGPAGPAGPPGYGPQGEPGLQGTQ 630

Query: 633  AFFHPPTHPQETG--------SPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQC 684
                 P  P E G        +P P P  P   P H  P+     P      G  G    
Sbjct: 631  GVPGAPGPPGEAGPRGELSVSTPVPGPPGPPGPPGHPGPQGPPGIPGSLGKCGDPG---- 686

Query: 685  LEETPFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLA 744
                  P    E G  G+ GFP  P P     F  +  SL                    
Sbjct: 687  -----LPGPDGEPGIPGI-GFPGPPGPKGDQGFPGTKGSLG------------------- 721

Query: 745  AFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQ 804
                            K G    PG PGLP     P V      G      T    G+  
Sbjct: 722  -------------CPGKMGEPGLPGKPGLPGAKGEPAVAMPGGPG------TPGFPGERG 762

Query: 805  AEGKDDPLRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSF 864
              G+   +    LP L  TP                     E L+G       P      
Sbjct: 763  NSGEHGEIGLPGLPGLPGTPG-------------------NEGLDGPRGDPGQP------ 797

Query: 865  IDVFADEEPSGPRGPSSGHPLKSKAGVTPESKAPPPLPAATPDPQTPRPGDRGCPARGRP 924
                    P G +GP  G  ++   G    ++  P L       Q  R G  G   +G P
Sbjct: 798  -------GPPGEQGP-PGRCIEGPRG----AQGLPGLNGL--KGQQGRRGKTG--PKGDP 841

Query: 925  KTRSLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRND 984
                L  +    +  S G    +G+   L ++             G  G    L P   D
Sbjct: 842  GIPGLDRSGFPGETGSPGIPGHQGEMGPLGQR-------------GYPGNPGILGPPGED 888

Query: 985  GL--------GERPPPRPRRPRTQAPGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDP 1036
            G+           PP  P  P T  PG R  P   +P             +R  P  K  
Sbjct: 889  GVIGMMGFPGAIGPPGPPGNPGT--PGQRGSPG--IPGVKG---------QRGTPGAKGE 935

Query: 1037 RKRKARGGAWGKELILKIVQQKNRLREYDFA-SESEEDEQPPPRGPGFRGRRGRGEKRKE 1095
            +  K   G  G   I  ++  K       FA +  E+  +  P  PG +G +G       
Sbjct: 936  QGDK---GNPGPSEISHVIGDKGEPGLKGFAGNPGEKGNRGVPGMPGLKGLKGL------ 986

Query: 1096 VELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGAA 1155
                  P    P  PR       G  G+  NP EP G R  PG       P    + G  
Sbjct: 987  ------PGPAGPPGPR-------GDLGSTGNPGEP-GLRGIPGSMGNMGMPGSKGKRGTL 1032

Query: 1156 AREGGPKCADRPSVAPKDPLQVPTNTE-TSEETRPSLDFPQEAKEPETAEESAPDSTEFT 1214
               G P  A RP +     LQ        SE TRP    P       T +   P      
Sbjct: 1033 ---GFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGP-------TGDPGLPGD---- 1078

Query: 1215 EALRSPPAACAGEMG--ASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGS 1272
                       GEMG    PG L P  P  +    G+P   G      PHG     G+  
Sbjct: 1079 -------MGKKGEMGQPGPPGHLGPAGPEGA---PGSPGSPGLPGKPGPHGDLGFKGIKG 1128

Query: 1273 LLGGPG-----------------GTQAPVSHNSKDPPARQPGEFLAPVANPSSTACPKPS 1315
            LLG PG                 G +     +    PA + GE     A P     P   
Sbjct: 1129 LLGPPGIRGPPGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNP--- 1185

Query: 1316 VLSSKISSFGCDPAGFNRDPLGVP--VAKKGPQPYSSPHS----ELFLGPKDLAGCFLEE 1369
                     G   A  +R   G P    +KG    + P      E F GP  L G  +  
Sbjct: 1186 ---------GAQGAKGDRGAPGFPGLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPG 1236

Query: 1370 L---HPKPSARDAP-------PASSSCLCQDGEDAGSLEPQLPRSPPGTAET--EPGRAA 1417
                   P +R +P       P  S  +   G D GS+    P+ PPGTA     PGR  
Sbjct: 1237 QTGNRGPPGSRGSPGAPGPPGPPGSHVIGIKG-DKGSMGHPGPKGPPGTAGDMGPPGRLG 1295

Query: 1418 SPPTLESSSLFPDLPVDRFDPPLYGSLSANRDSGLP--FACADPPQKTVPSDPP 1469
            +P T       P LP  R DP   G      + G P       PP    P  PP
Sbjct: 1296 APGT-------PGLPGPRGDPGFQGFPGVKGEKGNPGFLGSIGPPGPIGPKGPP 1342



 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 289/1237 (23%), Positives = 378/1237 (30%), Gaps = 221/1237 (17%)

Query: 208  PGPPQSRGTSPLQPGSYPEYQASGADSWP-----PAAENSFPGANFGVPPAEPEPIPKGS 262
            PGPP +   +   P +  + +    D        P   +  PG ++G     P       
Sbjct: 238  PGPPGTVIVTLTGPDNRTDLKGEKGDKGAMGEPGPPGPSGLPGESYGSEKGAPGDPGLQG 297

Query: 263  RPG-----GSP--RGVSFQFPFPALHGAS-TKPFPADVAGHAFTNGPLVFAFHQPQGAWP 314
            +PG     G P   GV     FP L G    K    D+    F      +  +Q +G   
Sbjct: 298  KPGKDGVPGFPGSEGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPTEYYDTYQEKG--- 354

Query: 315  EEAVGTGPAYPLPTQ--PAPSPLPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSL 372
             +    GP  P   +    PS  P   G PG  +    L GA   PG   S         
Sbjct: 355  -DEGTPGPPGPRGARGPQGPSGPPGVPGSPG--SSRPGLRGAPGWPGLKGSKG------- 404

Query: 373  HKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGP 432
                     ER    +D +G T G P        PG           PGPP   +   GP
Sbjct: 405  ---------ERGRPGKDAMG-TPGSPGCAGSPGLPGSP-------GPPGPPGDIVFRKGP 447

Query: 433  PPAR-LP-QLWDPTAAPYPTPPGGP-LAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLP 489
            P    LP  L  P       P G P L  T+  +  G P       L     +P  Q   
Sbjct: 448  PGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQCPYIPGPPGLPGLPGLHGVKGIPGRQGAA 507

Query: 490  TARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKL-----PAVRSSQG-- 542
              + SP G    + LP   G P  QG   G  G  G+T  P  ++     P +R   G  
Sbjct: 508  GLKGSP-GSPGNTGLPGFPGFPGAQG-DPGLKGEKGETLQPEGQVGVPGDPGLRGQPGRK 565

Query: 543  ---GSPALFTYNGMTDPGAQPLFFGVAQPQVSPH--GTPSLPPPRVVGASPSESPLPSPA 597
               G P      G+  P  +    G    Q  P   G+P  P P      P   P   P 
Sbjct: 566  GLDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGSPGPAGPAGPPGYGPQGEPG 625

Query: 598  TN-TAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSP--------- 647
               T G   +   P  + P    S  + +PGP GP     PP HP   G P         
Sbjct: 626  LQGTQGVPGAPGPPGEAGPRGELSVSTPVPGPPGPPG---PPGHPGPQGPPGIPGSLGKC 682

Query: 648  ----FPSPEPPHSLPTHYQPEPA-----KAFPFPADGLGAEG------------------ 680
                 P P+    +P    P P      + FP     LG  G                  
Sbjct: 683  GDPGLPGPDGEPGIPGIGFPGPPGPKGDQGFPGTKGSLGCPGKMGEPGLPGKPGLPGAKG 742

Query: 681  ----AFQCLEETP-FPHEGPEVGRGGLQGFPRAPP-PYPTHHFSLSSASLD--------Q 726
                A      TP FP E    G  G  G P  P  P    +  L     D        +
Sbjct: 743  EPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLDGPRGDPGQPGPPGE 802

Query: 727  LDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGL-----PSPPAAPR 781
                  C +  R    L      +   G    R K G +  PG PGL     P    +P 
Sbjct: 803  QGPPGRCIEGPRGAQGLPGLNGLKGQQG---RRGKTGPKGDPGIPGLDRSGFPGETGSPG 859

Query: 782  VPA-DAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFP-----LPASDLDME 835
            +P      G L         G     G+D  +     P     P P      P       
Sbjct: 860  IPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPPGNPGTPGQRGSPG 919

Query: 836  DDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAGVT--P 893
                     T    G +    NP   S    V  D+   G +G +     K   GV   P
Sbjct: 920  IPGVKGQRGTPGAKGEQGDKGNPG-PSEISHVIGDKGEPGLKGFAGNPGEKGNRGVPGMP 978

Query: 894  ESKAPP--PLPAATPDPQ-----TPRPGDRGCPARGRPKTR-SLGLAPTEADAPSQGRQQ 945
              K     P PA  P P+     T  PG+ G   RG P +  ++G+  ++    + G   
Sbjct: 979  GLKGLKGLPGPAGPPGPRGDLGSTGNPGEPGL--RGIPGSMGNMGMPGSKGKRGTLGFPG 1036

Query: 946  RRGKQ----LKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPPRPRRPRTQA 1001
            R G+     +   + D    G +EG+  G  G      P  + GL   P    ++     
Sbjct: 1037 RAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPG------PTGDPGL---PGDMGKKGEMGQ 1087

Query: 1002 PGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRL 1061
            PG      P  P  A       S     LP +  P       G  G + I      K  L
Sbjct: 1088 PGPPGHLGPAGPEGAP-----GSPGSPGLPGKPGPH------GDLGFKGI------KGLL 1130

Query: 1062 REYDFASESEEDEQPPPRGP-GFRGRRGR-------GEKRKE--VELTQGPREDEPQKPR 1111
                          P   GP G RG +GR       GEK +   +    GPR +   +  
Sbjct: 1131 GPPGIRGPPGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNPGAQGA 1190

Query: 1112 KAARQEAGGDGAP--------ANPEEPGGSR--PGPGRSPQARGPSRSLETGAAAREGGP 1161
            K  R   G  G P        A P  P G    PGP   P A  P ++   G     G P
Sbjct: 1191 KGDRGAPGFPGLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPGQTGNRGPPGSRGSP 1250

Query: 1162 KCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDS------TEFTE 1215
                    AP  P    ++    +  + S+  P     P TA +  P        T    
Sbjct: 1251 G-------APGPPGPPGSHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGRLGAPGTPGLP 1303

Query: 1216 ALRSPPA-----ACAGEMG--------ASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPH 1262
              R  P         GE G          PG + P+ PP  R D GT K      +  P 
Sbjct: 1304 GPRGDPGFQGFPGVKGEKGNPGFLGSIGPPGPIGPKGPPGVRGDPGTLKIISLPGSPGPP 1363

Query: 1263 GSSPTPGVGSLLG--GPGGTQAPVSHNSKDPPARQPG 1297
            G+   PG+    G  GP G   P     K     +PG
Sbjct: 1364 GTPGEPGMQGEPGPPGPPGNLGPCGPRGKPGKDGKPG 1400



 Score = 69.7 bits (169), Expect = 5e-11
 Identities = 281/1179 (23%), Positives = 364/1179 (30%), Gaps = 217/1179 (18%)

Query: 65   PRQAR--DGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRYIL 122
            PR AR   G   PP + G   SS PG RG+P  P  +       R    A G+P      
Sbjct: 364  PRGARGPQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSP--- 420

Query: 123  GIASSRTKPTLDETPENP-----------------QLEAAQLPEVDTPQG-PG---TGAP 161
            G A S   P     P  P                  L +  +P VD P+G PG   T  P
Sbjct: 421  GCAGSPGLPGSPGPPGPPGDIVFRKGPPGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQCP 480

Query: 162  LRPGLPRTEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQP 221
              PG P     P     G         ++    +  SP  T  P  PG P ++G   L+ 
Sbjct: 481  YIPGPPGLPGLPGLH--GVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFPGAQGDPGLKG 538

Query: 222  GSYPEYQASGADSWP--PAAENSFPGANF-----GVPPAEPEPIPKGSRPGGSPRGVSFQ 274
                  Q  G    P  P      PG        G P  +  P PKG       +G   Q
Sbjct: 539  EKGETLQPEGQVGVPGDPGLRGQ-PGRKGLDGIPGTPGVKGLPGPKGELALSGEKG--DQ 595

Query: 275  FPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSP 334
             P P   G+   P PA  AG              P G  P+   G      +P  P P  
Sbjct: 596  GP-PGDPGSPGSPGPAGPAG--------------PPGYGPQGEPGLQGTQGVPGAPGP-- 638

Query: 335  LPCYQGQPGGLNRHSDLSGALSSPG-AAHSAPR---PFSDSLHKSLTKILPERPPSAQDG 390
             P   G  G L+  + + G    PG   H  P+       SL K     LP   P  + G
Sbjct: 639  -PGEAGPRGELSVSTPVPGPPGPPGPPGHPGPQGPPGIPGSLGKCGDPGLP--GPDGEPG 695

Query: 391  LGST--RGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGPPPARLPQLWDPTAAPY 448
            +      GPP     + FPG      G    PG    ++  PG P    P L      P 
Sbjct: 696  IPGIGFPGPPGPKGDQGFPG----TKGSLGCPG----KMGEPGLPGK--PGLPGAKGEPA 745

Query: 449  PTPPGGPLAATRSMFFNGQPS-PGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFP 507
               PGGP          G P  PG+R                      HG   L  LP  
Sbjct: 746  VAMPGGP----------GTPGFPGER-----------------GNSGEHGEIGLPGLPGL 778

Query: 508  AGGPEWQGGSQGALGTAGKTPGPREKLPAVRSSQG--GSPALFTYNGMTDPGAQPLFFGV 565
             G P    G  G  G  G+   P E+ P  R  +G  G+  L   NG+     +      
Sbjct: 779  PGTP-GNEGLDGPRGDPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGR------ 831

Query: 566  AQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSS--PANPS---- 619
             + +  P G P +P     G   S  P  + +    G     + P+     P NP     
Sbjct: 832  -RGKTGPKGDPGIP-----GLDRSGFPGETGSPGIPGHQ-GEMGPLGQRGYPGNPGILGP 884

Query: 620  -SEESQL-----PGPLGPSAFFHPPTHPQETGSP-FPSPEPPHSLPTHYQPEPAKAFPFP 672
              E+  +     PG +GP      P  P + GSP  P  +     P     +  K  P P
Sbjct: 885  PGEDGVIGMMGFPGAIGPPGPPGNPGTPGQRGSPGIPGVKGQRGTPGAKGEQGDKGNPGP 944

Query: 673  AD-----GLGAEGAFQCLEETPFPHEGPEV----GRGGLQGFP-RAPPPYPTHHFSLSS- 721
            ++     G   E   +     P       V    G  GL+G P  A PP P      +  
Sbjct: 945  SEISHVIGDKGEPGLKGFAGNPGEKGNRGVPGMPGLKGLKGLPGPAGPPGPRGDLGSTGN 1004

Query: 722  ----------ASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPG-- 769
                       S+  + +        +       F       GL       G +  PG  
Sbjct: 1005 PGEPGLRGIPGSMGNMGM-----PGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYS 1059

Query: 770  ---PPGLPSPPAAPRVPAD-AHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPF 825
                PG P P   P +P D    G +         G A  EG      +  LP       
Sbjct: 1060 EGTRPGPPGPTGDPGLPGDMGKKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGK----- 1114

Query: 826  PLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPL 885
            P P  DL  +    L  L    + G       P              P G RG      +
Sbjct: 1115 PGPHGDLGFKGIKGL--LGPPGIRGPPGLPGFP----------GSPGPMGIRGDQGRDGI 1162

Query: 886  KSKAGVTPES--KAPPPLPAATPDPQTPRPGDRGCPA-RGRP-KTRSLGLAPTEADAPSQ 941
               AG   E+     PP P   P  Q  + GDRG P   G P +  ++G A        +
Sbjct: 1163 PGPAGEKGETGLLRAPPGPRGNPGAQGAK-GDRGAPGFPGLPGRKGAMGDAGPRGPTGIE 1221

Query: 942  GRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGL----GERPPPRPRRP 997
            G     G    +      + G     GS G     G       G+    G    P P+ P
Sbjct: 1222 GFPGPPGLPGAIIPGQTGNRGPPGSRGSPGAPGPPGPPGSHVIGIKGDKGSMGHPGPKGP 1281

Query: 998  -----------RTQAPGSRADPAPR-VPRAAALP----EETRSSRRRRLPPRKDPRKRKA 1041
                       R  APG+   P PR  P     P    E+        + P   P   K 
Sbjct: 1282 PGTAGDMGPPGRLGAPGTPGLPGPRGDPGFQGFPGVKGEKGNPGFLGSIGP-PGPIGPKG 1340

Query: 1042 RGGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRGP-------GFRGRRGRGEKRK 1094
              G  G    LKI+             E     +P P GP       G RG+ G+  K  
Sbjct: 1341 PPGVRGDPGTLKIISLPGSPGPPGTPGEPGMQGEPGPPGPPGNLGPCGPRGKPGKDGKPG 1400

Query: 1095 EVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGS 1133
                T GP  ++  K  K     AG DG P    + G S
Sbjct: 1401 ----TPGPAGEKGNKGSKGEPGPAGSDGLPGLKGKRGDS 1435



 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 200/845 (23%), Positives = 263/845 (31%), Gaps = 154/845 (18%)

Query: 477  PQSAPLPWPQVLPTARPSPH-GMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPR---- 531
            PQ   LP   VL  A P+   G     +      G + + G +G  G  G +PG +    
Sbjct: 9    PQVLLLPLLLVLLAAAPAASKGCVCKDKGQCFCDGAKGEKGEKGFPGPPG-SPGQKGFTG 67

Query: 532  -EKLPAVRSSQG--GSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASP 588
             E LP  +  +G  G P L    G+      P F G      +P  T       V G S 
Sbjct: 68   PEGLPGPQGPKGFPGLPGLTGSKGVRGISGLPGFSGSPGLPGTPGNTGPYGLVGVPGCSG 127

Query: 589  SESP-----LPSPATNTAGSTCSSLSPMSSSPANPSSEESQ------LPGPLGPSAFFHP 637
            S+       LP           + L     +PA     E        LPG  GP     P
Sbjct: 128  SKGEQGFPGLPGTLGYPGIPGAAGLKGQKGAPAKEEDIELDAKGDPGLPGAPGPQGLPGP 187

Query: 638  PTHPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEV 697
            P  P   G                 P P   F FP   +G  G    + E    H+G E 
Sbjct: 188  PGFPGPVG----------------PPGPPGFFGFPG-AMGPRGPKGHMGERVIGHKG-ER 229

Query: 698  GRGGLQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLL 757
            G  GL G P  PP                  V++T    D N + L              
Sbjct: 230  GVKGLTG-PPGPPG----------------TVIVTLTGPD-NRTDL-------------- 257

Query: 758  ARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFL 817
             + + G + + G PG P P   P     +  G           GD   +GK         
Sbjct: 258  -KGEKGDKGAMGEPGPPGPSGLPGESYGSEKG---------APGDPGLQGK--------- 298

Query: 818  PSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPR 877
            P     P   P S+  ++ +     L+ E  +G++ Q               D  P G R
Sbjct: 299  PGKDGVP-GFPGSE-GVKGNRGFPGLMGE--DGIKGQK-------------GDIGPPGFR 341

Query: 878  GPSSGHPLKSKAGVTPESKAPPPLPAATPDPQTPR--PGDRGCPARGRPKTRSLGLAPTE 935
            GP+  +    + G   E    PP P     PQ P   PG  G P   RP  R  G     
Sbjct: 342  GPTEYYDTYQEKG--DEGTPGPPGPRGARGPQGPSGPPGVPGSPGSSRPGLR--GAPGWP 397

Query: 936  ADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPP--- 992
                S+G + R GK        + + G+   +GS G   + G      D +  + PP   
Sbjct: 398  GLKGSKGERGRPGKDA------MGTPGSPGCAGSPGLPGSPGPPGPPGDIVFRKGPPGDH 451

Query: 993  -------RPRRPRTQA----PGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKA 1041
                    P  P        PG      P +P    LP        + +P R+     K 
Sbjct: 452  GLPGYLGSPGIPGVDGPKGEPGLLCTQCPYIPGPPGLPGLPGLHGVKGIPGRQGAAGLKG 511

Query: 1042 RGGAWGKELILKIVQQKNRLREYDFASESEEDEQPP-----PRGPGFRGRRGRGEKRKEV 1096
              G+ G   +           +     E  E  QP      P  PG RG+ GR +    +
Sbjct: 512  SPGSPGNTGLPGFPGFPGAQGDPGLKGEKGETLQPEGQVGVPGDPGLRGQPGR-KGLDGI 570

Query: 1097 ELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGAAA 1156
              T G +     K   A   E G  G P +P  PG   P     P   GP    E G   
Sbjct: 571  PGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGSPGPAGPAGPPGYGPQG--EPGLQG 628

Query: 1157 REGGPKCADRPSVA-PKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTE 1215
             +G P     P  A P+  L V T         P    P     P       P     + 
Sbjct: 629  TQGVPGAPGPPGEAGPRGELSVST---------PVPGPPGPPGPPGHPGPQGPPGIPGSL 679

Query: 1216 ALRSPPAACA--GEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSL 1273
                 P      GE G  PG+  P  PP  + D G P   GSL      G    PG   L
Sbjct: 680  GKCGDPGLPGPDGEPGI-PGIGFP-GPPGPKGDQGFPGTKGSLGCPGKMGEPGLPGKPGL 737

Query: 1274 LGGPG 1278
             G  G
Sbjct: 738  PGAKG 742



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 285/1227 (23%), Positives = 374/1227 (30%), Gaps = 204/1227 (16%)

Query: 1682 AEGDSRPPQDVCLPEPS--KQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRL 1739
            A G+  PP    LP  S   + G   D G   K   D    FP         E     R 
Sbjct: 266  AMGEPGPPGPSGLPGESYGSEKGAPGDPGLQGKPGKDGVPGFP-------GSEGVKGNRG 318

Query: 1740 LPCEQRGGFLPEPGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASP 1799
             P     G + E G   Q  +G   P  F  P  +         +G P      P G   
Sbjct: 319  FP-----GLMGEDGIKGQ--KGDIGPPGFRGPTEYYDTYQEKGDEGTPG-----PPGPRG 366

Query: 1800 SHAAQGHSAGRAGGHLHPTAGRPGFEGNEFAPA--GASSLTAPRGREAWLVPVPSPACVS 1857
            +   QG S G  G    P + RPG  G    P   G+       G++A   P  SP C  
Sbjct: 367  ARGPQGPS-GPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTP-GSPGCAG 424

Query: 1858 NTHPSRRSQDPALSPP------------------IRQLQLPGPGVAKSKDGILGLQELTP 1899
            +  P          PP                  +    +PG    K + G+L  Q   P
Sbjct: 425  S--PGLPGSPGPPGPPGDIVFRKGPPGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQ--CP 480

Query: 1900 AAQSPPRV-NPSGLEGGTVEGGKVACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLL 1958
                PP +    GL G     G+      +GSPG    T LP   G      A G  GL 
Sbjct: 481  YIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFP---GAQGDPGLK 537

Query: 1959 GQAEKTQGQGTANQLQPENGVS-PGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAA 2017
            G+  +T        LQPE  V  PG               + G T G   L   KG  A 
Sbjct: 538  GEKGET--------LQPEGQVGVPGDPGLRGQPGRKGLDGIPG-TPGVKGLPGPKGELAL 588

Query: 2018 MSLQEEAEPTPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAP 2077
               + +  P   P SP     A         +G  G  P+    PGL       G    P
Sbjct: 589  SGEKGDQGPPGDPGSPGSPGPA-------GPAGPPGYGPQ--GEPGLQGTQGVPGAPGPP 639

Query: 2078 SV----GDLAACAPSPTSAAHMPCSLGPLPREDPLTSPSRAQGGLGGQLPASPSCRDPPG 2133
                  G+L+   P P      P   GP     P   P    G LG      P    P G
Sbjct: 640  GEAGPRGELSVSTPVPGP----PGPPGPPGHPGP-QGPPGIPGSLG--KCGDPGLPGPDG 692

Query: 2134 PQQLLACSPAWAPLEEAD-GVQATTDT----GAEDSPVAP--PSLTTSPCDPKEALAGCL 2186
               +        P  + D G   T  +    G    P  P  P L  +  +P  A+ G  
Sbjct: 693  EPGIPGIGFPGPPGPKGDQGFPGTKGSLGCPGKMGEPGLPGKPGLPGAKGEPAVAMPG-- 750

Query: 2187 LQGEGS---PLEDPSSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSP 2243
              G G+   P E  +S   G +          TP +  L  P   R +     P     P
Sbjct: 751  --GPGTPGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLDGP---RGDPGQPGPPGEQGP 805

Query: 2244 PLAGAVSPSVAVRATGLSSTPTGDEAQAG-RGLPGPDPQSRGAPPHTNPDRMPRGHSSYS 2302
            P      P  A    GL+    G + Q G RG  GP    +G P     DR      + S
Sbjct: 806  PGRCIEGPRGAQGLPGLN----GLKGQQGRRGKTGP----KGDPGIPGLDRSGFPGETGS 857

Query: 2303 PSNTARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSSK--EPEDPGTPETGRS 2360
            P      G          P  P  L   G D    + G  G       P +PGTP  G+ 
Sbjct: 858  PGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPPGNPGTP--GQR 915

Query: 2361 GATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRNASHQTPQGDPLGPQDLKQRS 2420
            G+  +P V         G+   P +        +P     +     +G+P          
Sbjct: 916  GSPGIPGVK--------GQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEP--------GL 959

Query: 2421 RGYKKKPASTENGQWKGQAPHGPVTCEVCAASFRSGPGLSRHKARKHRPHPGAPAEPSPA 2480
            +G+   P    N                     R  PG+   K  K  P P  P  P   
Sbjct: 960  KGFAGNPGEKGN---------------------RGVPGMPGLKGLKGLPGPAGPPGPRGD 998

Query: 2481 ALPAQQPLEPLAQKCQPPRKKSHRVSGKERPNHSRGDPSHVTQP--PPAQGSKEVLRAPG 2538
                  P EP   +  P    +  + G +    + G P    +P  P   G +     PG
Sbjct: 999  LGSTGNPGEP-GLRGIPGSMGNMGMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPG 1057

Query: 2539 SPHSQQLHPPSPT-----EHEVDVKTPASKPRPDQAREDELHPKQAEKREGRRWRREPTV 2593
                 +  PP PT       ++  K    +P P       L P   E   G         
Sbjct: 1058 YSEGTRPGPPGPTGDPGLPGDMGKKGEMGQPGP----PGHLGPAGPEGAPGSPGSPGLPG 1113

Query: 2594 DSPSHSEGKSNKKRGKLRGRRLREESILP----------VSADVISDGRGSRPSPA---- 2639
                H +      +G L    +R    LP          +  D    GR   P PA    
Sbjct: 1114 KPGPHGDLGFKGIKGLLGPPGIRGPPGLPGFPGSPGPMGIRGD---QGRDGIPGPAGEKG 1170

Query: 2640 -MASYAASPSHCLSVEGGPEADGEQPPRLATLGPGVMEGAAETDQEALCAGETGAQKPPG 2698
                  A P       G P A G +  R A   PG + G      +A   G TG +  PG
Sbjct: 1171 ETGLLRAPP----GPRGNPGAQGAKGDRGAPGFPG-LPGRKGAMGDAGPRGPTGIEGFPG 1225

Query: 2699 DRMLCPGRMDGAALGEQPTGQKGA-SARGFWGPRETKALGVCKESGSEPAEDSSRAHSRS 2757
               L    + G      P G +G+  A G  GP  +  +G+  + GS           + 
Sbjct: 1226 PPGLPGAIIPGQTGNRGPPGSRGSPGAPGPPGPPGSHVIGIKGDKGS-----MGHPGPKG 1280

Query: 2758 EEGVWEENTPPLGPLGFPETSSSPADSTTSSCLQGLP------DNPDTQGGVQGPEGPTP 2811
              G   +  PP G LG P T   P         QG P       NP   G + GP GP  
Sbjct: 1281 PPGTAGDMGPP-GRLGAPGTPGLPGPRGDPG-FQGFPGVKGEKGNPGFLGSI-GPPGPI- 1336

Query: 2812 DASGSSAKDPPSLFDDEVSFSQLFPPG 2838
                   K PP +  D  +   +  PG
Sbjct: 1337 -----GPKGPPGVRGDPGTLKIISLPG 1358



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 176/713 (24%), Positives = 227/713 (31%), Gaps = 137/713 (19%)

Query: 28   GHPSQP-PLEDNTPATRTTKGAREAGGQAQAMELPEAQPRQARDGELKPPSLRGQAPSST 86
            G P QP P  +  P  R  +G R A G      L   Q R+ + G    P + G   S  
Sbjct: 792  GDPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKTGPKGDPGIPGLDRSGF 851

Query: 87   PGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQ 146
            PG+ GSP  P  +  +    +      G P    ILG       P  ++           
Sbjct: 852  PGETGSPGIPGHQGEMGPLGQ-----RGYPGNPGILG-------PPGEDGVIGMMGFPGA 899

Query: 147  LPEVDTPQGPGT----GAPLRPGLPRTEAQPAAE-ELGFHRCFQEPPSSFTSTNYTSPSA 201
            +     P  PGT    G+P  PG+      P A+ E G          S    +   P  
Sbjct: 900  IGPPGPPGNPGTPGQRGSPGIPGVKGQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPGL 959

Query: 202  TPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPAAENSFPGANFGVPPAEPEPIPKG 261
                  PG   +RG  P  PG        G    P  A    P  + G      EP  +G
Sbjct: 960  KGFAGNPGEKGNRGV-PGMPG------LKGLKGLPGPAGPPGPRGDLGSTGNPGEPGLRG 1012

Query: 262  --------SRPGGSPRGVSFQFP-------FPALHG-----------ASTKPFPADVAGH 295
                      PG   +  +  FP        P +HG             T+P P    G 
Sbjct: 1013 IPGSMGNMGMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGD 1072

Query: 296  AFTNGPL----VFAFHQPQG----AWPEEAVGTGPAYPLPTQPAPSPLPCYQG-----QP 342
                G +          P G    A PE A G+  +  LP +P P     ++G      P
Sbjct: 1073 PGLPGDMGKKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGP 1132

Query: 343  GGLNRHSDLSGALSSPG--------AAHSAPRPFSDSLHKSLTKIL--PERPPSAQDGLG 392
             G+     L G   SPG             P P  +     L +    P   P AQ   G
Sbjct: 1133 PGIRGPPGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNPGAQGAKG 1192

Query: 393  STRGPPSSLPQRHFPGQAYRASGV-DTSPGPPDTELAAPGPPPARLPQLWDPTAAPYPTP 451
              RG P       FPG   R   + D  P  P      PGPP   LP    P       P
Sbjct: 1193 D-RGAPG------FPGLPGRKGAMGDAGPRGPTGIEGFPGPP--GLPGAIIPGQTGNRGP 1243

Query: 452  PGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGP 511
            PG             + SPG        AP P         P P G  ++        G 
Sbjct: 1244 PG------------SRGSPG--------APGP---------PGPPGSHVI--------GI 1266

Query: 512  EWQGGSQGALGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQVS 571
            +   GS G  G  G      +  P  R    G+P L    G  DPG Q  F GV   + +
Sbjct: 1267 KGDKGSMGHPGPKGPPGTAGDMGPPGRLGAPGTPGLPGPRG--DPGFQG-FPGVKGEKGN 1323

Query: 572  PHGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSE-ESQLPGP-- 628
            P    S+ PP  +G          P T    S   S  P   +P  P  + E   PGP  
Sbjct: 1324 PGFLGSIGPPGPIGPKGPPGVRGDPGTLKIISLPGSPGP-PGTPGEPGMQGEPGPPGPPG 1382

Query: 629  -LGPSAFFHPPTHPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEG 680
             LGP      P    + G+P P+ E  +        + +K  P PA   G  G
Sbjct: 1383 NLGPCGPRGKPGKDGKPGTPGPAGEKGN--------KGSKGEPGPAGSDGLPG 1427



 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 116/476 (24%), Positives = 150/476 (31%), Gaps = 78/476 (16%)

Query: 3429 GAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEVA 3488
            G PG+K       +P  +    +PG A  PG     PRG          P L  +   + 
Sbjct: 964  GNPGEKGNRGVPGMPGLKGLKGLPGPAGPPG-----PRGDLGSTGNPGEPGLRGIPGSMG 1018

Query: 3489 ----PST-----TKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRG 3539
                P +     T G+P    RP  P  H ++G +    + E   P   P P       G
Sbjct: 1019 NMGMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPG-PPGPTGDPGLPG 1077

Query: 3540 DCALDGALERPENEASPGSPGPLLQQALPLGASLP-RPGARG----QDAEGKRAPLVFSG 3594
            D    G + +P      G  GP      P    LP +PG  G    +  +G   P    G
Sbjct: 1078 DMGKKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGPPGIRG 1137

Query: 3595 KRRAPGARGRCAPDHFQEDHLLQ-----KEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQ 3649
                PG  G   P   + D           ++  +  + +  GPRG           G Q
Sbjct: 1138 PPGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGN---------PGAQ 1188

Query: 3650 SSSKDRSAASTPS----KALKFPVHPRKAVGSLA-------PGELARGTENGMKPATPKA 3698
             +  DR A   P     K       PR   G          PG +  G      P   + 
Sbjct: 1189 GAKGDRGAPGFPGLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPGQTGNRGPPGSRG 1248

Query: 3699 KPG-PSSQGS-GSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARA 3756
             PG P   G  GS   G K   GS   P               P  P  +      P R 
Sbjct: 1249 SPGAPGPPGPPGSHVIGIKGDKGSMGHPG--------------PKGPPGTAGDMGPPGRL 1294

Query: 3757 QAKSCTKGPREAGEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKP 3816
             A      P   G  GP G   P  +G    K +KG  PG      +GS G  P  P  P
Sbjct: 1295 GA------PGTPGLPGPRGD--PGFQGFPGVKGEKGN-PG-----FLGSIG--PPGPIGP 1338

Query: 3817 PRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRP 3872
               P  +  P   L     P S   P  P     + EPG       LG   P+G+P
Sbjct: 1339 KGPPGVRGDPG-TLKIISLPGSPGPPGTPGEPGMQGEPGPPGPPGNLGPCGPRGKP 1393



 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 119/452 (26%), Positives = 148/452 (32%), Gaps = 83/452 (18%)

Query: 3428 PGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEV 3487
            PG+PGQK       LP  +     PG         P   GS  +     LP         
Sbjct: 57   PGSPGQKGFTGPEGLPGPQGPKGFPG--------LPGLTGSKGVRGISGLPGF------- 101

Query: 3488 APSTTKGWPETLERPVDPVTHPIRGCELPSNHQECP--PPSLS----PFPAALADGRGDC 3541
              S + G P T           + GC      Q  P  P +L     P  A L   +G  
Sbjct: 102  --SGSPGLPGTPGNTGPYGLVGVPGCSGSKGEQGFPGLPGTLGYPGIPGAAGLKGQKGAP 159

Query: 3542 AL--DGALERPENEASPGSPGPLLQQALPLGASLPRPGARGQDAEGKRAPLVFSGKRRAP 3599
            A   D  L+   +   PG+PGP   Q LP     P P        G   P  F G    P
Sbjct: 160  AKEEDIELDAKGDPGLPGAPGP---QGLPGPPGFPGP-------VGPPGPPGFFG---FP 206

Query: 3600 GARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKP---AGCQSSSKDRS 3656
            GA G   P     + ++  + E     +    GP GT    + T P      +    D+ 
Sbjct: 207  GAMGPRGPKGHMGERVIGHKGERGVKGLTGPPGPPGTVIV-TLTGPDNRTDLKGEKGDKG 265

Query: 3657 AASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATP--KAKPG-------PSSQGS 3707
            A   P      P  P     S  PGE + G+E G  P  P  + KPG       P S+G 
Sbjct: 266  AMGEPG-----PPGP-----SGLPGE-SYGSEKG-APGDPGLQGKPGKDGVPGFPGSEGV 313

Query: 3708 GSPR--PGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGP 3765
               R  PG     G + Q   G +       P +     +    E  P          GP
Sbjct: 314  KGNRGFPGLMGEDGIKGQ--KGDIGPPGFRGPTEYYDTYQEKGDEGTPG-------PPGP 364

Query: 3766 REA-GEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQA 3824
            R A G QGP G  G      SS    +G    P    S G  GR        P +P    
Sbjct: 365  RGARGPQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSPGCAG 424

Query: 3825 TPSRVLPTKPKPNSQNKPRPPPS-EQRKAEPG 3855
            +P   LP  P P     P PP     RK  PG
Sbjct: 425  SPG--LPGSPGP-----PGPPGDIVFRKGPPG 449



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 115/447 (25%), Positives = 136/447 (30%), Gaps = 89/447 (19%)

Query: 3414 RGGRQPFAFRG-VRRPGAPGQKARALEGTLP--SKRRRVAMPGSAPGPGEDRPPPRGSSP 3470
            +G R    F G   RPG PG      +   P  S+  R   PG    PG   P   G   
Sbjct: 1026 KGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGDPG--LPGDMGKKG 1083

Query: 3471 ILSEGSLPALLHLCSEVAPSTTKGWPETLERPVDPVTHP------IRGCELPSNHQECPP 3524
             + +   P  L       P    G P +   P  P  H       I+G   P   +   P
Sbjct: 1084 EMGQPGPPGHL---GPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGPPGIRG--P 1138

Query: 3525 PSLSPFPAALADG--RGDCALDG----ALERPEN---------EASPGSPGPLLQQALPL 3569
            P L  FP +      RGD   DG    A E+ E            +PG+ G    +  P 
Sbjct: 1139 PGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNPGAQGAKGDRGAPG 1198

Query: 3570 GASLP-RPGARGQDAEGKRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMV 3628
               LP R GA G    G R P    G    PG  G   P                     
Sbjct: 1199 FPGLPGRKGAMGD--AGPRGPTGIEGFPGPPGLPGAIIPGQ------------------T 1238

Query: 3629 SEGGPRGTFHKGSATKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAP-GELARGT 3687
               GP G+     A  P G   S          S     P  P    G + P G L    
Sbjct: 1239 GNRGPPGSRGSPGAPGPPGPPGSHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGRLGA-- 1296

Query: 3688 ENGMKPATPKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSR-- 3745
                 P TP   PGP         PG K   G +  P  G L S     P  P  P    
Sbjct: 1297 -----PGTP-GLPGPRGDPGFQGFPGVK---GEKGNP--GFLGSIGPPGPIGPKGPPGVR 1345

Query: 3746 -------------SPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPKEKGESSTKRKKG 3792
                         SP P   P     +       E G  GP G+LGP        K  K 
Sbjct: 1346 GDPGTLKIISLPGSPGPPGTPGEPGMQG------EPGPPGPPGNLGPCGPRGKPGKDGKP 1399

Query: 3793 QVPGPARSE-SVGSFGR-APSAPDKPP 3817
              PGPA  + + GS G   P+  D  P
Sbjct: 1400 GTPGPAGEKGNKGSKGEPGPAGSDGLP 1426



 Score = 40.8 bits (94), Expect = 0.027
 Identities = 117/495 (23%), Positives = 146/495 (29%), Gaps = 74/495 (14%)

Query: 3428 PGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEV 3487
            PG PG K       LP  +  +A+ G     G    P    SP  +  + P       E 
Sbjct: 571  PGTPGVKG------LPGPKGELALSGEKGDQGPPGDPGSPGSPGPAGPAGPPGYGPQGEP 624

Query: 3488 APSTTKGWPETLERPVDP-------VTHPIRGCELPSNHQECPPPSLSP-FPAALADGRG 3539
                T+G P     P +        V+ P+ G   P      P P   P  P +L    G
Sbjct: 625  GLQGTQGVPGAPGPPGEAGPRGELSVSTPVPGPPGPPGPPGHPGPQGPPGIPGSL----G 680

Query: 3540 DCALDGALERPENEAS------PGSPGPLLQQALP-LGASLPRPGARGQDAEGKRAPLVF 3592
             C  D  L  P+ E        PG PGP   Q  P    SL  PG  G+           
Sbjct: 681  KCG-DPGLPGPDGEPGIPGIGFPGPPGPKGDQGFPGTKGSLGCPGKMGEPG--------L 731

Query: 3593 SGKRRAPGARGR--CAPDHFQEDHLLQKEKEVSSSH----MVSEGGPRGTFHKGSATKPA 3646
             GK   PGA+G    A            E+  S  H    +    G  GT        P 
Sbjct: 732  PGKPGLPGAKGEPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLDGPR 791

Query: 3647 GCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPAT-PKAKPG---- 3701
            G             P + ++    PR A G   PG      + G +  T PK  PG    
Sbjct: 792  GDPGQPGPPGEQGPPGRCIE---GPRGAQG--LPGLNGLKGQQGRRGKTGPKGDPGIPGL 846

Query: 3702 --------------PSSQGSGSP--RPGTKTGGGSQPQPAS----GQLQSETATTPAKPS 3741
                          P  QG   P  + G     G    P      G +    A  P  P 
Sbjct: 847  DRSGFPGETGSPGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPP 906

Query: 3742 FPSRSPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPKE----KGESSTKRKKGQVPGP 3797
                +P     P     K     P   GEQG  G+ GP E     G+      KG    P
Sbjct: 907  GNPGTPGQRGSPGIPGVKGQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPGLKGFAGNP 966

Query: 3798 ARSESVGSFGRAPSAPDKPPRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHT 3857
                + G  G       K    P     P   L +   P        P S      PG  
Sbjct: 967  GEKGNRGVPGMPGLKGLKGLPGPAGPPGPRGDLGSTGNPGEPGLRGIPGSMGNMGMPGSK 1026

Query: 3858 QRKDRLGKAFPQGRP 3872
             ++  LG     GRP
Sbjct: 1027 GKRGTLGFPGRAGRP 1041



 Score = 37.7 bits (86), Expect = 0.23
 Identities = 34/115 (29%), Positives = 43/115 (37%), Gaps = 9/115 (7%)

Query: 3176 RGQARRSLGDLPGGLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAK 3235
            RGQ  R   D   G+ G+  V  L     E A    +G +      GSPG P G  G A 
Sbjct: 559  RGQPGRKGLD---GIPGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGSP-GPAGPAG 614

Query: 3236 KDSPGERAKPRARSTPS-----NPDGAATPDSASATALADAGSPGPPRTTPSPSP 3285
                G + +P  + T        P G A P    + +    G PGPP     P P
Sbjct: 615  PPGYGPQGEPGLQGTQGVPGAPGPPGEAGPRGELSVSTPVPGPPGPPGPPGHPGP 669



 Score = 35.0 bits (79), Expect = 1.5
 Identities = 43/143 (30%), Positives = 51/143 (35%), Gaps = 28/143 (19%)

Query: 3183 LGDLPG-----GLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKD 3237
            L  LPG     G+ G    A L  S   P      G      A G PG   G++GE  + 
Sbjct: 488  LPGLPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFPGAQGDPGLK-GEKGETLQP 546

Query: 3238 S--------PGERAKPRARST---PSNPDGAATPDSASATALA----DAGSPGPPRTTPS 3282
                     PG R +P  +     P  P     P      AL+    D G PG P +  S
Sbjct: 547  EGQVGVPGDPGLRGQPGRKGLDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGS 606

Query: 3283 PSPDPWAG-------GEPLLQAT 3298
            P P   AG       GEP LQ T
Sbjct: 607  PGPAGPAGPPGYGPQGEPGLQGT 629



 Score = 32.3 bits (72), Expect = 9.5
 Identities = 35/116 (30%), Positives = 39/116 (33%), Gaps = 28/116 (24%)

Query: 3205 EPAPKHHRGK--RSAGKAAGSPGDPWGQEGEAKKDS----PGERAKPRARSTPS------ 3252
            EP P    G    S G   G+PGDP G +G+  KD     PG       R  P       
Sbjct: 269  EPGPPGPSGLPGESYGSEKGAPGDP-GLQGKPGKDGVPGFPGSEGVKGNRGFPGLMGEDG 327

Query: 3253 --------NPDGAATPDSASAT--ALADAGSPGPP-----RTTPSPSPDPWAGGEP 3293
                     P G   P     T     D G+PGPP     R    PS  P   G P
Sbjct: 328  IKGQKGDIGPPGFRGPTEYYDTYQEKGDEGTPGPPGPRGARGPQGPSGPPGVPGSP 383


>gi|89142730 alpha 3 type IV collagen isoform 1 precursor [Homo
            sapiens]
          Length = 1670

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 255/1046 (24%), Positives = 328/1046 (31%), Gaps = 188/1046 (17%)

Query: 1    MPG-ERPRGAPPPTMTGDLQPRQVASSPGHPSQPPLED--NTPATRTTKGAREAGGQAQA 57
            +PG + P+G P    T   Q   +   PG P  P L      P  +   G + + G    
Sbjct: 462  IPGVDGPKGEPGLLCT---QCPYIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGSPGN 518

Query: 58   MELPEAQPRQARDGELKPPSLRGQA-----PSSTPGKRGSP--QTPPGRSPLQAPSRLAG 110
              LP         G+   P L+G+      P    G  G P  +  PGR  L       G
Sbjct: 519  TGLPGFPGFPGAQGD---PGLKGEKGETLQPEGQVGVPGDPGLRGQPGRKGLDGIPGTPG 575

Query: 111  RAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGP-GTGAPLRPGLPRT 169
              +G P  +  L ++  +        P +P       P    P GP G G    PGL  T
Sbjct: 576  -VKGLPGPKGELALSGEKGDQGPPGDPGSPGS-----PGPAGPAGPPGYGPQGEPGLQGT 629

Query: 170  EAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQ--PGSYPEY 227
            +  P A           PP         S S TP P  PGPP   G    Q  PG     
Sbjct: 630  QGVPGAPG---------PPGEAGPRGELSVS-TPVPGPPGPPGPPGHPGPQGPPGIPGSL 679

Query: 228  QASGADSWP-PAAENSFPGANFGVPPAEPEPIPKGSR--PGGSPR-GVSFQFPFPALHGA 283
               G    P P  E   PG  F  PP      PKG +  PG     G   +   P L G 
Sbjct: 680  GKCGDPGLPGPDGEPGIPGIGFPGPPG-----PKGDQGFPGTKGSLGCPGKMGEPGLPGK 734

Query: 284  STKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYP-LPTQPAPSPLPCYQGQP 342
               P        A   GP    F   +G   E      P  P LP  P    L   +G P
Sbjct: 735  PGLPGAKGEPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLDGPRGDP 794

Query: 343  GGLNRHSDLSGALSSPGAAHSAPR-----PFSDSLH-------KSLTKILPERPPSAQDG 390
            G         G    PG     PR     P  + L        K+  K  P  P   + G
Sbjct: 795  G----QPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKTGPKGDPGIPGLDRSG 850

Query: 391  LGSTRGPPS---------SLPQRHFPGQA--------------YRASGVDTSPGPPDT-- 425
                 G P           L QR +PG                    G    PGPP    
Sbjct: 851  FPGETGSPGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPPGNPG 910

Query: 426  ---ELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPL 482
               +  +PG P  +  Q   P A       G P  +  S     +  PG    L   A  
Sbjct: 911  TPGQRGSPGIPGVK-GQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPG----LKGFAGN 965

Query: 483  PWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREK--------- 533
            P  +      P   G++ L  LP PAG P    G +G LG+ G    P  +         
Sbjct: 966  PGEKG-NRGVPGMPGLKGLKGLPGPAGPP----GPRGDLGSTGNPGEPGLRGIPGSMGNM 1020

Query: 534  -LPAVRSSQG--------GSPALFTYNGMTDPGAQPLFFGVAQP-QVSPHGTPSLPPPRV 583
             +P  +  +G        G P L   +G+     +P +    +P    P G P LP    
Sbjct: 1021 GMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGDPGLPGDMG 1080

Query: 584  VGASPSESPLPSPATNTAGSTCSSLSPMSSS-PANPSSEESQ----LPGPLGPSAFFHPP 638
                  + P P      AG   +  SP S   P  P          + G LGP     PP
Sbjct: 1081 KKGEMGQ-PGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGPPGIRGPP 1139

Query: 639  THPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVG 698
              P   GSP P              +     P PA   G +G    L   P P   P  G
Sbjct: 1140 GLPGFPGSPGPMGIRGD--------QGRDGIPGPA---GEKGETGLLRAPPGPRGNP--G 1186

Query: 699  RGGLQGFPRAP--PPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLL 756
              G +G   AP  P  P    ++  A               R  + +  F       G +
Sbjct: 1187 AQGAKGDRGAPGFPGLPGRKGAMGDAG-------------PRGPTGIEGFPGPPGLPGAI 1233

Query: 757  LA-----RAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDP 811
            +      R   G + SPG PG P PP +  +      G + H       G A   G    
Sbjct: 1234 IPGQTGNRGPPGSRGSPGAPGPPGPPGSHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGR 1293

Query: 812  LRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADE 871
            L     P L     P P  D              +   G++ +  NP     F+      
Sbjct: 1294 LGAPGTPGL-----PGPRGDPGF-----------QGFPGVKGEKGNP----GFLGSIGPP 1333

Query: 872  EPSGPRGPSS--GHPLKSKAGVTPESKAPPPLPA-----ATPDPQTPRPGDRG-CPARGR 923
             P GP+GP    G P   K    P S  PP  P        P P  P PG+ G C  RG+
Sbjct: 1334 GPIGPKGPPGVRGDPGTLKIISLPGSPGPPGTPGEPGMQGEPGPPGP-PGNLGPCGPRGK 1392

Query: 924  PKTRSLGLAPTEADAPSQGRQQRRGK 949
            P     G   T   A  +G +  +G+
Sbjct: 1393 PGKD--GKPGTPGPAGEKGNKGSKGE 1416



 Score = 86.7 bits (213), Expect = 4e-16
 Identities = 353/1494 (23%), Positives = 441/1494 (29%), Gaps = 412/1494 (27%)

Query: 184  FQEPPSSFTSTNYTSPSATPRPPAP----------GPPQSRGTS-----------PLQPG 222
            F  PP S     +T P   P P  P          G    RG S           P  PG
Sbjct: 53   FPGPPGSPGQKGFTGPEGLPGPQGPKGFPGLPGLTGSKGVRGISGLPGFSGSPGLPGTPG 112

Query: 223  SYPEYQASGADSWPPA-AENSFPG--ANFGVP--------------PAEPEPIPKGSR-- 263
            +   Y   G      +  E  FPG     G P              PA+ E I   ++  
Sbjct: 113  NTGPYGLVGVPGCSGSKGEQGFPGLPGTLGYPGIPGAAGLKGQKGAPAKEEDIELDAKGD 172

Query: 264  PG--GSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVG-- 319
            PG  G+P       P P   G    P P    G     GP       P+G   E  +G  
Sbjct: 173  PGLPGAPGPQGLPGP-PGFPGPVGPPGPPGFFGFPGAMGP-----RGPKGHMGERVIGHK 226

Query: 320  --------TGPAYP----LPTQPAPSPLPCYQGQPG--GLNRHSDLSGALSSPGAAHSAP 365
                    TGP  P    + T   P      +G+ G  G        G    PG ++ + 
Sbjct: 227  GERGVKGLTGPPGPPGTVIVTLTGPDNRTDLKGEKGDKGAMGEPGPPGPSGLPGESYGSE 286

Query: 366  R--PFSDSLHKSLTKI-LPERPPSAQDGLGSTRGPPSSLPQRHFPGQ------------- 409
            +  P    L     K  +P  P S  +G+   RG P  + +    GQ             
Sbjct: 287  KGAPGDPGLQGKPGKDGVPGFPGS--EGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPT 344

Query: 410  ----AYRASGVDTSPGPPDTELAAPGPPPARLPQLWDPTAAP-YPTPPGGPLAATR---- 460
                 Y+  G + +PGP       PGP  AR PQ   P+  P  P  PG      R    
Sbjct: 345  EYYDTYQEKGDEGTPGP-------PGPRGARGPQ--GPSGPPGVPGSPGSSRPGLRGAPG 395

Query: 461  ------SMFFNGQP------SPGQRLC-----LPQSAPLPWPQ---VLPTARPSPHGME- 499
                  S    G+P      +PG   C     LP S   P P    V     P  HG+  
Sbjct: 396  WPGLKGSKGERGRPGKDAMGTPGSPGCAGSPGLPGSPGPPGPPGDIVFRKGPPGDHGLPG 455

Query: 500  -------------------MLSRLPFPAGGPEWQG-----------GSQGALGTAGKTPG 529
                               + ++ P+  G P   G           G QGA G  G    
Sbjct: 456  YLGSPGIPGVDGPKGEPGLLCTQCPYIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGS 515

Query: 530  P-REKLPAVRSSQG--GSPALFTYNGMT-----------DPG--AQPLFFGVAQPQVSPH 573
            P    LP      G  G P L    G T           DPG   QP   G+     +P 
Sbjct: 516  PGNTGLPGFPGFPGAQGDPGLKGEKGETLQPEGQVGVPGDPGLRGQPGRKGLDGIPGTP- 574

Query: 574  GTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSEESQ-LPGPLGPS 632
            G   LP P+   A   E     P     G   S  SP  + PA P     Q  PG  G  
Sbjct: 575  GVKGLPGPKGELALSGEKGDQGP----PGDPGSPGSPGPAGPAGPPGYGPQGEPGLQGTQ 630

Query: 633  AFFHPPTHPQETG--------SPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQC 684
                 P  P E G        +P P P  P   P H  P+     P      G  G    
Sbjct: 631  GVPGAPGPPGEAGPRGELSVSTPVPGPPGPPGPPGHPGPQGPPGIPGSLGKCGDPG---- 686

Query: 685  LEETPFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLA 744
                  P    E G  G+ GFP  P P     F  +  SL                    
Sbjct: 687  -----LPGPDGEPGIPGI-GFPGPPGPKGDQGFPGTKGSLG------------------- 721

Query: 745  AFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQ 804
                            K G    PG PGLP     P V      G      T    G+  
Sbjct: 722  -------------CPGKMGEPGLPGKPGLPGAKGEPAVAMPGGPG------TPGFPGERG 762

Query: 805  AEGKDDPLRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSF 864
              G+   +    LP L  TP                     E L+G       P      
Sbjct: 763  NSGEHGEIGLPGLPGLPGTPG-------------------NEGLDGPRGDPGQP------ 797

Query: 865  IDVFADEEPSGPRGPSSGHPLKSKAGVTPESKAPPPLPAATPDPQTPRPGDRGCPARGRP 924
                    P G +GP  G  ++   G    ++  P L       Q  R G  G   +G P
Sbjct: 798  -------GPPGEQGP-PGRCIEGPRG----AQGLPGLNGL--KGQQGRRGKTG--PKGDP 841

Query: 925  KTRSLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRND 984
                L  +    +  S G    +G+   L ++             G  G    L P   D
Sbjct: 842  GIPGLDRSGFPGETGSPGIPGHQGEMGPLGQR-------------GYPGNPGILGPPGED 888

Query: 985  GL--------GERPPPRPRRPRTQAPGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDP 1036
            G+           PP  P  P T  PG R  P   +P             +R  P  K  
Sbjct: 889  GVIGMMGFPGAIGPPGPPGNPGT--PGQRGSPG--IPGVKG---------QRGTPGAKGE 935

Query: 1037 RKRKARGGAWGKELILKIVQQKNRLREYDFA-SESEEDEQPPPRGPGFRGRRGRGEKRKE 1095
            +  K   G  G   I  ++  K       FA +  E+  +  P  PG +G +G       
Sbjct: 936  QGDK---GNPGPSEISHVIGDKGEPGLKGFAGNPGEKGNRGVPGMPGLKGLKGL------ 986

Query: 1096 VELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGAA 1155
                  P    P  PR       G  G+  NP EP G R  PG       P    + G  
Sbjct: 987  ------PGPAGPPGPR-------GDLGSTGNPGEP-GLRGIPGSMGNMGMPGSKGKRGTL 1032

Query: 1156 AREGGPKCADRPSVAPKDPLQVPTNTE-TSEETRPSLDFPQEAKEPETAEESAPDSTEFT 1214
               G P  A RP +     LQ        SE TRP    P       T +   P      
Sbjct: 1033 ---GFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGP-------TGDPGLPGD---- 1078

Query: 1215 EALRSPPAACAGEMG--ASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGS 1272
                       GEMG    PG L P  P  +    G+P   G      PHG     G+  
Sbjct: 1079 -------MGKKGEMGQPGPPGHLGPAGPEGA---PGSPGSPGLPGKPGPHGDLGFKGIKG 1128

Query: 1273 LLGGPG-----------------GTQAPVSHNSKDPPARQPGEFLAPVANPSSTACPKPS 1315
            LLG PG                 G +     +    PA + GE     A P     P   
Sbjct: 1129 LLGPPGIRGPPGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNP--- 1185

Query: 1316 VLSSKISSFGCDPAGFNRDPLGVP--VAKKGPQPYSSPHS----ELFLGPKDLAGCFLEE 1369
                     G   A  +R   G P    +KG    + P      E F GP  L G  +  
Sbjct: 1186 ---------GAQGAKGDRGAPGFPGLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPG 1236

Query: 1370 L---HPKPSARDAP-------PASSSCLCQDGEDAGSLEPQLPRSPPGTAET--EPGRAA 1417
                   P +R +P       P  S  +   G D GS+    P+ PPGTA     PGR  
Sbjct: 1237 QTGNRGPPGSRGSPGAPGPPGPPGSHVIGIKG-DKGSMGHPGPKGPPGTAGDMGPPGRLG 1295

Query: 1418 SPPTLESSSLFPDLPVDRFDPPLYGSLSANRDSGLP--FACADPPQKTVPSDPP 1469
            +P T       P LP  R DP   G      + G P       PP    P  PP
Sbjct: 1296 APGT-------PGLPGPRGDPGFQGFPGVKGEKGNPGFLGSIGPPGPIGPKGPP 1342



 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 289/1237 (23%), Positives = 378/1237 (30%), Gaps = 221/1237 (17%)

Query: 208  PGPPQSRGTSPLQPGSYPEYQASGADSWP-----PAAENSFPGANFGVPPAEPEPIPKGS 262
            PGPP +   +   P +  + +    D        P   +  PG ++G     P       
Sbjct: 238  PGPPGTVIVTLTGPDNRTDLKGEKGDKGAMGEPGPPGPSGLPGESYGSEKGAPGDPGLQG 297

Query: 263  RPG-----GSP--RGVSFQFPFPALHGAS-TKPFPADVAGHAFTNGPLVFAFHQPQGAWP 314
            +PG     G P   GV     FP L G    K    D+    F      +  +Q +G   
Sbjct: 298  KPGKDGVPGFPGSEGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPTEYYDTYQEKG--- 354

Query: 315  EEAVGTGPAYPLPTQ--PAPSPLPCYQGQPGGLNRHSDLSGALSSPGAAHSAPRPFSDSL 372
             +    GP  P   +    PS  P   G PG  +    L GA   PG   S         
Sbjct: 355  -DEGTPGPPGPRGARGPQGPSGPPGVPGSPG--SSRPGLRGAPGWPGLKGSKG------- 404

Query: 373  HKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGP 432
                     ER    +D +G T G P        PG           PGPP   +   GP
Sbjct: 405  ---------ERGRPGKDAMG-TPGSPGCAGSPGLPGSP-------GPPGPPGDIVFRKGP 447

Query: 433  PPAR-LP-QLWDPTAAPYPTPPGGP-LAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLP 489
            P    LP  L  P       P G P L  T+  +  G P       L     +P  Q   
Sbjct: 448  PGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQCPYIPGPPGLPGLPGLHGVKGIPGRQGAA 507

Query: 490  TARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKL-----PAVRSSQG-- 542
              + SP G    + LP   G P  QG   G  G  G+T  P  ++     P +R   G  
Sbjct: 508  GLKGSP-GSPGNTGLPGFPGFPGAQG-DPGLKGEKGETLQPEGQVGVPGDPGLRGQPGRK 565

Query: 543  ---GSPALFTYNGMTDPGAQPLFFGVAQPQVSPH--GTPSLPPPRVVGASPSESPLPSPA 597
               G P      G+  P  +    G    Q  P   G+P  P P      P   P   P 
Sbjct: 566  GLDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGSPGPAGPAGPPGYGPQGEPG 625

Query: 598  TN-TAGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSP--------- 647
               T G   +   P  + P    S  + +PGP GP     PP HP   G P         
Sbjct: 626  LQGTQGVPGAPGPPGEAGPRGELSVSTPVPGPPGPPG---PPGHPGPQGPPGIPGSLGKC 682

Query: 648  ----FPSPEPPHSLPTHYQPEPA-----KAFPFPADGLGAEG------------------ 680
                 P P+    +P    P P      + FP     LG  G                  
Sbjct: 683  GDPGLPGPDGEPGIPGIGFPGPPGPKGDQGFPGTKGSLGCPGKMGEPGLPGKPGLPGAKG 742

Query: 681  ----AFQCLEETP-FPHEGPEVGRGGLQGFPRAPP-PYPTHHFSLSSASLD--------Q 726
                A      TP FP E    G  G  G P  P  P    +  L     D        +
Sbjct: 743  EPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLDGPRGDPGQPGPPGE 802

Query: 727  LDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGL-----PSPPAAPR 781
                  C +  R    L      +   G    R K G +  PG PGL     P    +P 
Sbjct: 803  QGPPGRCIEGPRGAQGLPGLNGLKGQQG---RRGKTGPKGDPGIPGLDRSGFPGETGSPG 859

Query: 782  VPA-DAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFP-----LPASDLDME 835
            +P      G L         G     G+D  +     P     P P      P       
Sbjct: 860  IPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPPGNPGTPGQRGSPG 919

Query: 836  DDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAGVT--P 893
                     T    G +    NP   S    V  D+   G +G +     K   GV   P
Sbjct: 920  IPGVKGQRGTPGAKGEQGDKGNPG-PSEISHVIGDKGEPGLKGFAGNPGEKGNRGVPGMP 978

Query: 894  ESKAPP--PLPAATPDPQ-----TPRPGDRGCPARGRPKTR-SLGLAPTEADAPSQGRQQ 945
              K     P PA  P P+     T  PG+ G   RG P +  ++G+  ++    + G   
Sbjct: 979  GLKGLKGLPGPAGPPGPRGDLGSTGNPGEPGL--RGIPGSMGNMGMPGSKGKRGTLGFPG 1036

Query: 946  RRGKQ----LKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPPRPRRPRTQA 1001
            R G+     +   + D    G +EG+  G  G      P  + GL   P    ++     
Sbjct: 1037 RAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPG------PTGDPGL---PGDMGKKGEMGQ 1087

Query: 1002 PGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRL 1061
            PG      P  P  A       S     LP +  P       G  G + I      K  L
Sbjct: 1088 PGPPGHLGPAGPEGAP-----GSPGSPGLPGKPGPH------GDLGFKGI------KGLL 1130

Query: 1062 REYDFASESEEDEQPPPRGP-GFRGRRGR-------GEKRKE--VELTQGPREDEPQKPR 1111
                          P   GP G RG +GR       GEK +   +    GPR +   +  
Sbjct: 1131 GPPGIRGPPGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNPGAQGA 1190

Query: 1112 KAARQEAGGDGAP--------ANPEEPGGSR--PGPGRSPQARGPSRSLETGAAAREGGP 1161
            K  R   G  G P        A P  P G    PGP   P A  P ++   G     G P
Sbjct: 1191 KGDRGAPGFPGLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPGQTGNRGPPGSRGSP 1250

Query: 1162 KCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDS------TEFTE 1215
                    AP  P    ++    +  + S+  P     P TA +  P        T    
Sbjct: 1251 G-------APGPPGPPGSHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGRLGAPGTPGLP 1303

Query: 1216 ALRSPPA-----ACAGEMG--------ASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPH 1262
              R  P         GE G          PG + P+ PP  R D GT K      +  P 
Sbjct: 1304 GPRGDPGFQGFPGVKGEKGNPGFLGSIGPPGPIGPKGPPGVRGDPGTLKIISLPGSPGPP 1363

Query: 1263 GSSPTPGVGSLLG--GPGGTQAPVSHNSKDPPARQPG 1297
            G+   PG+    G  GP G   P     K     +PG
Sbjct: 1364 GTPGEPGMQGEPGPPGPPGNLGPCGPRGKPGKDGKPG 1400



 Score = 69.7 bits (169), Expect = 5e-11
 Identities = 281/1179 (23%), Positives = 364/1179 (30%), Gaps = 217/1179 (18%)

Query: 65   PRQAR--DGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRYIL 122
            PR AR   G   PP + G   SS PG RG+P  P  +       R    A G+P      
Sbjct: 364  PRGARGPQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSP--- 420

Query: 123  GIASSRTKPTLDETPENP-----------------QLEAAQLPEVDTPQG-PG---TGAP 161
            G A S   P     P  P                  L +  +P VD P+G PG   T  P
Sbjct: 421  GCAGSPGLPGSPGPPGPPGDIVFRKGPPGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQCP 480

Query: 162  LRPGLPRTEAQPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQP 221
              PG P     P     G         ++    +  SP  T  P  PG P ++G   L+ 
Sbjct: 481  YIPGPPGLPGLPGLH--GVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFPGAQGDPGLKG 538

Query: 222  GSYPEYQASGADSWP--PAAENSFPGANF-----GVPPAEPEPIPKGSRPGGSPRGVSFQ 274
                  Q  G    P  P      PG        G P  +  P PKG       +G   Q
Sbjct: 539  EKGETLQPEGQVGVPGDPGLRGQ-PGRKGLDGIPGTPGVKGLPGPKGELALSGEKG--DQ 595

Query: 275  FPFPALHGASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSP 334
             P P   G+   P PA  AG              P G  P+   G      +P  P P  
Sbjct: 596  GP-PGDPGSPGSPGPAGPAG--------------PPGYGPQGEPGLQGTQGVPGAPGP-- 638

Query: 335  LPCYQGQPGGLNRHSDLSGALSSPG-AAHSAPR---PFSDSLHKSLTKILPERPPSAQDG 390
             P   G  G L+  + + G    PG   H  P+       SL K     LP   P  + G
Sbjct: 639  -PGEAGPRGELSVSTPVPGPPGPPGPPGHPGPQGPPGIPGSLGKCGDPGLP--GPDGEPG 695

Query: 391  LGST--RGPPSSLPQRHFPGQAYRASGVDTSPGPPDTELAAPGPPPARLPQLWDPTAAPY 448
            +      GPP     + FPG      G    PG    ++  PG P    P L      P 
Sbjct: 696  IPGIGFPGPPGPKGDQGFPG----TKGSLGCPG----KMGEPGLPGK--PGLPGAKGEPA 745

Query: 449  PTPPGGPLAATRSMFFNGQPS-PGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFP 507
               PGGP          G P  PG+R                      HG   L  LP  
Sbjct: 746  VAMPGGP----------GTPGFPGER-----------------GNSGEHGEIGLPGLPGL 778

Query: 508  AGGPEWQGGSQGALGTAGKTPGPREKLPAVRSSQG--GSPALFTYNGMTDPGAQPLFFGV 565
             G P    G  G  G  G+   P E+ P  R  +G  G+  L   NG+     +      
Sbjct: 779  PGTP-GNEGLDGPRGDPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGR------ 831

Query: 566  AQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSS--PANPS---- 619
             + +  P G P +P     G   S  P  + +    G     + P+     P NP     
Sbjct: 832  -RGKTGPKGDPGIP-----GLDRSGFPGETGSPGIPGHQ-GEMGPLGQRGYPGNPGILGP 884

Query: 620  -SEESQL-----PGPLGPSAFFHPPTHPQETGSP-FPSPEPPHSLPTHYQPEPAKAFPFP 672
              E+  +     PG +GP      P  P + GSP  P  +     P     +  K  P P
Sbjct: 885  PGEDGVIGMMGFPGAIGPPGPPGNPGTPGQRGSPGIPGVKGQRGTPGAKGEQGDKGNPGP 944

Query: 673  AD-----GLGAEGAFQCLEETPFPHEGPEV----GRGGLQGFP-RAPPPYPTHHFSLSS- 721
            ++     G   E   +     P       V    G  GL+G P  A PP P      +  
Sbjct: 945  SEISHVIGDKGEPGLKGFAGNPGEKGNRGVPGMPGLKGLKGLPGPAGPPGPRGDLGSTGN 1004

Query: 722  ----------ASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPG-- 769
                       S+  + +        +       F       GL       G +  PG  
Sbjct: 1005 PGEPGLRGIPGSMGNMGM-----PGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYS 1059

Query: 770  ---PPGLPSPPAAPRVPAD-AHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPF 825
                PG P P   P +P D    G +         G A  EG      +  LP       
Sbjct: 1060 EGTRPGPPGPTGDPGLPGDMGKKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGK----- 1114

Query: 826  PLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPL 885
            P P  DL  +    L  L    + G       P              P G RG      +
Sbjct: 1115 PGPHGDLGFKGIKGL--LGPPGIRGPPGLPGFP----------GSPGPMGIRGDQGRDGI 1162

Query: 886  KSKAGVTPES--KAPPPLPAATPDPQTPRPGDRGCPA-RGRP-KTRSLGLAPTEADAPSQ 941
               AG   E+     PP P   P  Q  + GDRG P   G P +  ++G A        +
Sbjct: 1163 PGPAGEKGETGLLRAPPGPRGNPGAQGAK-GDRGAPGFPGLPGRKGAMGDAGPRGPTGIE 1221

Query: 942  GRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGL----GERPPPRPRRP 997
            G     G    +      + G     GS G     G       G+    G    P P+ P
Sbjct: 1222 GFPGPPGLPGAIIPGQTGNRGPPGSRGSPGAPGPPGPPGSHVIGIKGDKGSMGHPGPKGP 1281

Query: 998  -----------RTQAPGSRADPAPR-VPRAAALP----EETRSSRRRRLPPRKDPRKRKA 1041
                       R  APG+   P PR  P     P    E+        + P   P   K 
Sbjct: 1282 PGTAGDMGPPGRLGAPGTPGLPGPRGDPGFQGFPGVKGEKGNPGFLGSIGP-PGPIGPKG 1340

Query: 1042 RGGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRGP-------GFRGRRGRGEKRK 1094
              G  G    LKI+             E     +P P GP       G RG+ G+  K  
Sbjct: 1341 PPGVRGDPGTLKIISLPGSPGPPGTPGEPGMQGEPGPPGPPGNLGPCGPRGKPGKDGKPG 1400

Query: 1095 EVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGS 1133
                T GP  ++  K  K     AG DG P    + G S
Sbjct: 1401 ----TPGPAGEKGNKGSKGEPGPAGSDGLPGLKGKRGDS 1435



 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 200/845 (23%), Positives = 263/845 (31%), Gaps = 154/845 (18%)

Query: 477  PQSAPLPWPQVLPTARPSPH-GMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPR---- 531
            PQ   LP   VL  A P+   G     +      G + + G +G  G  G +PG +    
Sbjct: 9    PQVLLLPLLLVLLAAAPAASKGCVCKDKGQCFCDGAKGEKGEKGFPGPPG-SPGQKGFTG 67

Query: 532  -EKLPAVRSSQG--GSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASP 588
             E LP  +  +G  G P L    G+      P F G      +P  T       V G S 
Sbjct: 68   PEGLPGPQGPKGFPGLPGLTGSKGVRGISGLPGFSGSPGLPGTPGNTGPYGLVGVPGCSG 127

Query: 589  SESP-----LPSPATNTAGSTCSSLSPMSSSPANPSSEESQ------LPGPLGPSAFFHP 637
            S+       LP           + L     +PA     E        LPG  GP     P
Sbjct: 128  SKGEQGFPGLPGTLGYPGIPGAAGLKGQKGAPAKEEDIELDAKGDPGLPGAPGPQGLPGP 187

Query: 638  PTHPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEV 697
            P  P   G                 P P   F FP   +G  G    + E    H+G E 
Sbjct: 188  PGFPGPVG----------------PPGPPGFFGFPG-AMGPRGPKGHMGERVIGHKG-ER 229

Query: 698  GRGGLQGFPRAPPPYPTHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLL 757
            G  GL G P  PP                  V++T    D N + L              
Sbjct: 230  GVKGLTG-PPGPPG----------------TVIVTLTGPD-NRTDL-------------- 257

Query: 758  ARAKDGHQRSPGPPGLPSPPAAPRVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFL 817
             + + G + + G PG P P   P     +  G           GD   +GK         
Sbjct: 258  -KGEKGDKGAMGEPGPPGPSGLPGESYGSEKG---------APGDPGLQGK--------- 298

Query: 818  PSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPR 877
            P     P   P S+  ++ +     L+ E  +G++ Q               D  P G R
Sbjct: 299  PGKDGVP-GFPGSE-GVKGNRGFPGLMGE--DGIKGQK-------------GDIGPPGFR 341

Query: 878  GPSSGHPLKSKAGVTPESKAPPPLPAATPDPQTPR--PGDRGCPARGRPKTRSLGLAPTE 935
            GP+  +    + G   E    PP P     PQ P   PG  G P   RP  R  G     
Sbjct: 342  GPTEYYDTYQEKG--DEGTPGPPGPRGARGPQGPSGPPGVPGSPGSSRPGLR--GAPGWP 397

Query: 936  ADAPSQGRQQRRGKQLKLFRKDLDSGGAAEGSGSGGGGRASGLRPRRNDGLGERPPP--- 992
                S+G + R GK        + + G+   +GS G   + G      D +  + PP   
Sbjct: 398  GLKGSKGERGRPGKDA------MGTPGSPGCAGSPGLPGSPGPPGPPGDIVFRKGPPGDH 451

Query: 993  -------RPRRPRTQA----PGSRADPAPRVPRAAALPEETRSSRRRRLPPRKDPRKRKA 1041
                    P  P        PG      P +P    LP        + +P R+     K 
Sbjct: 452  GLPGYLGSPGIPGVDGPKGEPGLLCTQCPYIPGPPGLPGLPGLHGVKGIPGRQGAAGLKG 511

Query: 1042 RGGAWGKELILKIVQQKNRLREYDFASESEEDEQPP-----PRGPGFRGRRGRGEKRKEV 1096
              G+ G   +           +     E  E  QP      P  PG RG+ GR +    +
Sbjct: 512  SPGSPGNTGLPGFPGFPGAQGDPGLKGEKGETLQPEGQVGVPGDPGLRGQPGR-KGLDGI 570

Query: 1097 ELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRSPQARGPSRSLETGAAA 1156
              T G +     K   A   E G  G P +P  PG   P     P   GP    E G   
Sbjct: 571  PGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGSPGPAGPAGPPGYGPQG--EPGLQG 628

Query: 1157 REGGPKCADRPSVA-PKDPLQVPTNTETSEETRPSLDFPQEAKEPETAEESAPDSTEFTE 1215
             +G P     P  A P+  L V T         P    P     P       P     + 
Sbjct: 629  TQGVPGAPGPPGEAGPRGELSVST---------PVPGPPGPPGPPGHPGPQGPPGIPGSL 679

Query: 1216 ALRSPPAACA--GEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTAPHGSSPTPGVGSL 1273
                 P      GE G  PG+  P  PP  + D G P   GSL      G    PG   L
Sbjct: 680  GKCGDPGLPGPDGEPGI-PGIGFP-GPPGPKGDQGFPGTKGSLGCPGKMGEPGLPGKPGL 737

Query: 1274 LGGPG 1278
             G  G
Sbjct: 738  PGAKG 742



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 285/1227 (23%), Positives = 374/1227 (30%), Gaps = 204/1227 (16%)

Query: 1682 AEGDSRPPQDVCLPEPS--KQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRL 1739
            A G+  PP    LP  S   + G   D G   K   D    FP         E     R 
Sbjct: 266  AMGEPGPPGPSGLPGESYGSEKGAPGDPGLQGKPGKDGVPGFP-------GSEGVKGNRG 318

Query: 1740 LPCEQRGGFLPEPGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASP 1799
             P     G + E G   Q  +G   P  F  P  +         +G P      P G   
Sbjct: 319  FP-----GLMGEDGIKGQ--KGDIGPPGFRGPTEYYDTYQEKGDEGTPG-----PPGPRG 366

Query: 1800 SHAAQGHSAGRAGGHLHPTAGRPGFEGNEFAPA--GASSLTAPRGREAWLVPVPSPACVS 1857
            +   QG S G  G    P + RPG  G    P   G+       G++A   P  SP C  
Sbjct: 367  ARGPQGPS-GPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTP-GSPGCAG 424

Query: 1858 NTHPSRRSQDPALSPP------------------IRQLQLPGPGVAKSKDGILGLQELTP 1899
            +  P          PP                  +    +PG    K + G+L  Q   P
Sbjct: 425  S--PGLPGSPGPPGPPGDIVFRKGPPGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQ--CP 480

Query: 1900 AAQSPPRV-NPSGLEGGTVEGGKVACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLL 1958
                PP +    GL G     G+      +GSPG    T LP   G      A G  GL 
Sbjct: 481  YIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFP---GAQGDPGLK 537

Query: 1959 GQAEKTQGQGTANQLQPENGVS-PGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAA 2017
            G+  +T        LQPE  V  PG               + G T G   L   KG  A 
Sbjct: 538  GEKGET--------LQPEGQVGVPGDPGLRGQPGRKGLDGIPG-TPGVKGLPGPKGELAL 588

Query: 2018 MSLQEEAEPTPSPPSPNRESLALALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAP 2077
               + +  P   P SP     A         +G  G  P+    PGL       G    P
Sbjct: 589  SGEKGDQGPPGDPGSPGSPGPA-------GPAGPPGYGPQ--GEPGLQGTQGVPGAPGPP 639

Query: 2078 SV----GDLAACAPSPTSAAHMPCSLGPLPREDPLTSPSRAQGGLGGQLPASPSCRDPPG 2133
                  G+L+   P P      P   GP     P   P    G LG      P    P G
Sbjct: 640  GEAGPRGELSVSTPVPGP----PGPPGPPGHPGP-QGPPGIPGSLG--KCGDPGLPGPDG 692

Query: 2134 PQQLLACSPAWAPLEEAD-GVQATTDT----GAEDSPVAP--PSLTTSPCDPKEALAGCL 2186
               +        P  + D G   T  +    G    P  P  P L  +  +P  A+ G  
Sbjct: 693  EPGIPGIGFPGPPGPKGDQGFPGTKGSLGCPGKMGEPGLPGKPGLPGAKGEPAVAMPG-- 750

Query: 2187 LQGEGS---PLEDPSSWPPGSVSAVTCTHSGDTPKDSTLRIPEDSRKEKLWESPGRATSP 2243
              G G+   P E  +S   G +          TP +  L  P   R +     P     P
Sbjct: 751  --GPGTPGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLDGP---RGDPGQPGPPGEQGP 805

Query: 2244 PLAGAVSPSVAVRATGLSSTPTGDEAQAG-RGLPGPDPQSRGAPPHTNPDRMPRGHSSYS 2302
            P      P  A    GL+    G + Q G RG  GP    +G P     DR      + S
Sbjct: 806  PGRCIEGPRGAQGLPGLN----GLKGQQGRRGKTGP----KGDPGIPGLDRSGFPGETGS 857

Query: 2303 PSNTARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEGEMGTSSK--EPEDPGTPETGRS 2360
            P      G          P  P  L   G D    + G  G       P +PGTP  G+ 
Sbjct: 858  PGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPPGNPGTP--GQR 915

Query: 2361 GATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRNASHQTPQGDPLGPQDLKQRS 2420
            G+  +P V         G+   P +        +P     +     +G+P          
Sbjct: 916  GSPGIPGVK--------GQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEP--------GL 959

Query: 2421 RGYKKKPASTENGQWKGQAPHGPVTCEVCAASFRSGPGLSRHKARKHRPHPGAPAEPSPA 2480
            +G+   P    N                     R  PG+   K  K  P P  P  P   
Sbjct: 960  KGFAGNPGEKGN---------------------RGVPGMPGLKGLKGLPGPAGPPGPRGD 998

Query: 2481 ALPAQQPLEPLAQKCQPPRKKSHRVSGKERPNHSRGDPSHVTQP--PPAQGSKEVLRAPG 2538
                  P EP   +  P    +  + G +    + G P    +P  P   G +     PG
Sbjct: 999  LGSTGNPGEP-GLRGIPGSMGNMGMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPG 1057

Query: 2539 SPHSQQLHPPSPT-----EHEVDVKTPASKPRPDQAREDELHPKQAEKREGRRWRREPTV 2593
                 +  PP PT       ++  K    +P P       L P   E   G         
Sbjct: 1058 YSEGTRPGPPGPTGDPGLPGDMGKKGEMGQPGP----PGHLGPAGPEGAPGSPGSPGLPG 1113

Query: 2594 DSPSHSEGKSNKKRGKLRGRRLREESILP----------VSADVISDGRGSRPSPA---- 2639
                H +      +G L    +R    LP          +  D    GR   P PA    
Sbjct: 1114 KPGPHGDLGFKGIKGLLGPPGIRGPPGLPGFPGSPGPMGIRGD---QGRDGIPGPAGEKG 1170

Query: 2640 -MASYAASPSHCLSVEGGPEADGEQPPRLATLGPGVMEGAAETDQEALCAGETGAQKPPG 2698
                  A P       G P A G +  R A   PG + G      +A   G TG +  PG
Sbjct: 1171 ETGLLRAPP----GPRGNPGAQGAKGDRGAPGFPG-LPGRKGAMGDAGPRGPTGIEGFPG 1225

Query: 2699 DRMLCPGRMDGAALGEQPTGQKGA-SARGFWGPRETKALGVCKESGSEPAEDSSRAHSRS 2757
               L    + G      P G +G+  A G  GP  +  +G+  + GS           + 
Sbjct: 1226 PPGLPGAIIPGQTGNRGPPGSRGSPGAPGPPGPPGSHVIGIKGDKGS-----MGHPGPKG 1280

Query: 2758 EEGVWEENTPPLGPLGFPETSSSPADSTTSSCLQGLP------DNPDTQGGVQGPEGPTP 2811
              G   +  PP G LG P T   P         QG P       NP   G + GP GP  
Sbjct: 1281 PPGTAGDMGPP-GRLGAPGTPGLPGPRGDPG-FQGFPGVKGEKGNPGFLGSI-GPPGPI- 1336

Query: 2812 DASGSSAKDPPSLFDDEVSFSQLFPPG 2838
                   K PP +  D  +   +  PG
Sbjct: 1337 -----GPKGPPGVRGDPGTLKIISLPG 1358



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 176/713 (24%), Positives = 227/713 (31%), Gaps = 137/713 (19%)

Query: 28   GHPSQP-PLEDNTPATRTTKGAREAGGQAQAMELPEAQPRQARDGELKPPSLRGQAPSST 86
            G P QP P  +  P  R  +G R A G      L   Q R+ + G    P + G   S  
Sbjct: 792  GDPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKTGPKGDPGIPGLDRSGF 851

Query: 87   PGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRYILGIASSRTKPTLDETPENPQLEAAQ 146
            PG+ GSP  P  +  +    +      G P    ILG       P  ++           
Sbjct: 852  PGETGSPGIPGHQGEMGPLGQ-----RGYPGNPGILG-------PPGEDGVIGMMGFPGA 899

Query: 147  LPEVDTPQGPGT----GAPLRPGLPRTEAQPAAE-ELGFHRCFQEPPSSFTSTNYTSPSA 201
            +     P  PGT    G+P  PG+      P A+ E G          S    +   P  
Sbjct: 900  IGPPGPPGNPGTPGQRGSPGIPGVKGQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPGL 959

Query: 202  TPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPAAENSFPGANFGVPPAEPEPIPKG 261
                  PG   +RG  P  PG        G    P  A    P  + G      EP  +G
Sbjct: 960  KGFAGNPGEKGNRGV-PGMPG------LKGLKGLPGPAGPPGPRGDLGSTGNPGEPGLRG 1012

Query: 262  --------SRPGGSPRGVSFQFP-------FPALHG-----------ASTKPFPADVAGH 295
                      PG   +  +  FP        P +HG             T+P P    G 
Sbjct: 1013 IPGSMGNMGMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGD 1072

Query: 296  AFTNGPL----VFAFHQPQG----AWPEEAVGTGPAYPLPTQPAPSPLPCYQG-----QP 342
                G +          P G    A PE A G+  +  LP +P P     ++G      P
Sbjct: 1073 PGLPGDMGKKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGP 1132

Query: 343  GGLNRHSDLSGALSSPG--------AAHSAPRPFSDSLHKSLTKIL--PERPPSAQDGLG 392
             G+     L G   SPG             P P  +     L +    P   P AQ   G
Sbjct: 1133 PGIRGPPGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNPGAQGAKG 1192

Query: 393  STRGPPSSLPQRHFPGQAYRASGV-DTSPGPPDTELAAPGPPPARLPQLWDPTAAPYPTP 451
              RG P       FPG   R   + D  P  P      PGPP   LP    P       P
Sbjct: 1193 D-RGAPG------FPGLPGRKGAMGDAGPRGPTGIEGFPGPP--GLPGAIIPGQTGNRGP 1243

Query: 452  PGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLPFPAGGP 511
            PG             + SPG        AP P         P P G  ++        G 
Sbjct: 1244 PG------------SRGSPG--------APGP---------PGPPGSHVI--------GI 1266

Query: 512  EWQGGSQGALGTAGKTPGPREKLPAVRSSQGGSPALFTYNGMTDPGAQPLFFGVAQPQVS 571
            +   GS G  G  G      +  P  R    G+P L    G  DPG Q  F GV   + +
Sbjct: 1267 KGDKGSMGHPGPKGPPGTAGDMGPPGRLGAPGTPGLPGPRG--DPGFQG-FPGVKGEKGN 1323

Query: 572  PHGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPANPSSE-ESQLPGP-- 628
            P    S+ PP  +G          P T    S   S  P   +P  P  + E   PGP  
Sbjct: 1324 PGFLGSIGPPGPIGPKGPPGVRGDPGTLKIISLPGSPGP-PGTPGEPGMQGEPGPPGPPG 1382

Query: 629  -LGPSAFFHPPTHPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLGAEG 680
             LGP      P    + G+P P+ E  +        + +K  P PA   G  G
Sbjct: 1383 NLGPCGPRGKPGKDGKPGTPGPAGEKGN--------KGSKGEPGPAGSDGLPG 1427



 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 116/476 (24%), Positives = 150/476 (31%), Gaps = 78/476 (16%)

Query: 3429 GAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEVA 3488
            G PG+K       +P  +    +PG A  PG     PRG          P L  +   + 
Sbjct: 964  GNPGEKGNRGVPGMPGLKGLKGLPGPAGPPG-----PRGDLGSTGNPGEPGLRGIPGSMG 1018

Query: 3489 ----PST-----TKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRG 3539
                P +     T G+P    RP  P  H ++G +    + E   P   P P       G
Sbjct: 1019 NMGMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPG-PPGPTGDPGLPG 1077

Query: 3540 DCALDGALERPENEASPGSPGPLLQQALPLGASLP-RPGARG----QDAEGKRAPLVFSG 3594
            D    G + +P      G  GP      P    LP +PG  G    +  +G   P    G
Sbjct: 1078 DMGKKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGPPGIRG 1137

Query: 3595 KRRAPGARGRCAPDHFQEDHLLQ-----KEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQ 3649
                PG  G   P   + D           ++  +  + +  GPRG           G Q
Sbjct: 1138 PPGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGN---------PGAQ 1188

Query: 3650 SSSKDRSAASTPS----KALKFPVHPRKAVGSLA-------PGELARGTENGMKPATPKA 3698
             +  DR A   P     K       PR   G          PG +  G      P   + 
Sbjct: 1189 GAKGDRGAPGFPGLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPGQTGNRGPPGSRG 1248

Query: 3699 KPG-PSSQGS-GSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARA 3756
             PG P   G  GS   G K   GS   P               P  P  +      P R 
Sbjct: 1249 SPGAPGPPGPPGSHVIGIKGDKGSMGHPG--------------PKGPPGTAGDMGPPGRL 1294

Query: 3757 QAKSCTKGPREAGEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKP 3816
             A      P   G  GP G   P  +G    K +KG  PG      +GS G  P  P  P
Sbjct: 1295 GA------PGTPGLPGPRGD--PGFQGFPGVKGEKGN-PG-----FLGSIG--PPGPIGP 1338

Query: 3817 PRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRP 3872
               P  +  P   L     P S   P  P     + EPG       LG   P+G+P
Sbjct: 1339 KGPPGVRGDPG-TLKIISLPGSPGPPGTPGEPGMQGEPGPPGPPGNLGPCGPRGKP 1393



 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 119/452 (26%), Positives = 148/452 (32%), Gaps = 83/452 (18%)

Query: 3428 PGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEV 3487
            PG+PGQK       LP  +     PG         P   GS  +     LP         
Sbjct: 57   PGSPGQKGFTGPEGLPGPQGPKGFPG--------LPGLTGSKGVRGISGLPGF------- 101

Query: 3488 APSTTKGWPETLERPVDPVTHPIRGCELPSNHQECP--PPSLS----PFPAALADGRGDC 3541
              S + G P T           + GC      Q  P  P +L     P  A L   +G  
Sbjct: 102  --SGSPGLPGTPGNTGPYGLVGVPGCSGSKGEQGFPGLPGTLGYPGIPGAAGLKGQKGAP 159

Query: 3542 AL--DGALERPENEASPGSPGPLLQQALPLGASLPRPGARGQDAEGKRAPLVFSGKRRAP 3599
            A   D  L+   +   PG+PGP   Q LP     P P        G   P  F G    P
Sbjct: 160  AKEEDIELDAKGDPGLPGAPGP---QGLPGPPGFPGP-------VGPPGPPGFFG---FP 206

Query: 3600 GARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKP---AGCQSSSKDRS 3656
            GA G   P     + ++  + E     +    GP GT    + T P      +    D+ 
Sbjct: 207  GAMGPRGPKGHMGERVIGHKGERGVKGLTGPPGPPGTVIV-TLTGPDNRTDLKGEKGDKG 265

Query: 3657 AASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPATP--KAKPG-------PSSQGS 3707
            A   P      P  P     S  PGE + G+E G  P  P  + KPG       P S+G 
Sbjct: 266  AMGEPG-----PPGP-----SGLPGE-SYGSEKG-APGDPGLQGKPGKDGVPGFPGSEGV 313

Query: 3708 GSPR--PGTKTGGGSQPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGP 3765
               R  PG     G + Q   G +       P +     +    E  P          GP
Sbjct: 314  KGNRGFPGLMGEDGIKGQ--KGDIGPPGFRGPTEYYDTYQEKGDEGTPG-------PPGP 364

Query: 3766 REA-GEQGPHGSLGPKEKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQA 3824
            R A G QGP G  G      SS    +G    P    S G  GR        P +P    
Sbjct: 365  RGARGPQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSPGCAG 424

Query: 3825 TPSRVLPTKPKPNSQNKPRPPPS-EQRKAEPG 3855
            +P   LP  P P     P PP     RK  PG
Sbjct: 425  SPG--LPGSPGP-----PGPPGDIVFRKGPPG 449



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 115/447 (25%), Positives = 136/447 (30%), Gaps = 89/447 (19%)

Query: 3414 RGGRQPFAFRG-VRRPGAPGQKARALEGTLP--SKRRRVAMPGSAPGPGEDRPPPRGSSP 3470
            +G R    F G   RPG PG      +   P  S+  R   PG    PG   P   G   
Sbjct: 1026 KGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGDPG--LPGDMGKKG 1083

Query: 3471 ILSEGSLPALLHLCSEVAPSTTKGWPETLERPVDPVTHP------IRGCELPSNHQECPP 3524
             + +   P  L       P    G P +   P  P  H       I+G   P   +   P
Sbjct: 1084 EMGQPGPPGHL---GPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGPPGIRG--P 1138

Query: 3525 PSLSPFPAALADG--RGDCALDG----ALERPEN---------EASPGSPGPLLQQALPL 3569
            P L  FP +      RGD   DG    A E+ E            +PG+ G    +  P 
Sbjct: 1139 PGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNPGAQGAKGDRGAPG 1198

Query: 3570 GASLP-RPGARGQDAEGKRAPLVFSGKRRAPGARGRCAPDHFQEDHLLQKEKEVSSSHMV 3628
               LP R GA G    G R P    G    PG  G   P                     
Sbjct: 1199 FPGLPGRKGAMGD--AGPRGPTGIEGFPGPPGLPGAIIPGQ------------------T 1238

Query: 3629 SEGGPRGTFHKGSATKPAGCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAP-GELARGT 3687
               GP G+     A  P G   S          S     P  P    G + P G L    
Sbjct: 1239 GNRGPPGSRGSPGAPGPPGPPGSHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGRLGA-- 1296

Query: 3688 ENGMKPATPKAKPGPSSQGSGSPRPGTKTGGGSQPQPASGQLQSETATTPAKPSFPSR-- 3745
                 P TP   PGP         PG K   G +  P  G L S     P  P  P    
Sbjct: 1297 -----PGTP-GLPGPRGDPGFQGFPGVK---GEKGNP--GFLGSIGPPGPIGPKGPPGVR 1345

Query: 3746 -------------SPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPKEKGESSTKRKKG 3792
                         SP P   P     +       E G  GP G+LGP        K  K 
Sbjct: 1346 GDPGTLKIISLPGSPGPPGTPGEPGMQG------EPGPPGPPGNLGPCGPRGKPGKDGKP 1399

Query: 3793 QVPGPARSE-SVGSFGR-APSAPDKPP 3817
              PGPA  + + GS G   P+  D  P
Sbjct: 1400 GTPGPAGEKGNKGSKGEPGPAGSDGLP 1426



 Score = 40.8 bits (94), Expect = 0.027
 Identities = 117/495 (23%), Positives = 146/495 (29%), Gaps = 74/495 (14%)

Query: 3428 PGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPALLHLCSEV 3487
            PG PG K       LP  +  +A+ G     G    P    SP  +  + P       E 
Sbjct: 571  PGTPGVKG------LPGPKGELALSGEKGDQGPPGDPGSPGSPGPAGPAGPPGYGPQGEP 624

Query: 3488 APSTTKGWPETLERPVDP-------VTHPIRGCELPSNHQECPPPSLSP-FPAALADGRG 3539
                T+G P     P +        V+ P+ G   P      P P   P  P +L    G
Sbjct: 625  GLQGTQGVPGAPGPPGEAGPRGELSVSTPVPGPPGPPGPPGHPGPQGPPGIPGSL----G 680

Query: 3540 DCALDGALERPENEAS------PGSPGPLLQQALP-LGASLPRPGARGQDAEGKRAPLVF 3592
             C  D  L  P+ E        PG PGP   Q  P    SL  PG  G+           
Sbjct: 681  KCG-DPGLPGPDGEPGIPGIGFPGPPGPKGDQGFPGTKGSLGCPGKMGEPG--------L 731

Query: 3593 SGKRRAPGARGR--CAPDHFQEDHLLQKEKEVSSSH----MVSEGGPRGTFHKGSATKPA 3646
             GK   PGA+G    A            E+  S  H    +    G  GT        P 
Sbjct: 732  PGKPGLPGAKGEPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLDGPR 791

Query: 3647 GCQSSSKDRSAASTPSKALKFPVHPRKAVGSLAPGELARGTENGMKPAT-PKAKPG---- 3701
            G             P + ++    PR A G   PG      + G +  T PK  PG    
Sbjct: 792  GDPGQPGPPGEQGPPGRCIE---GPRGAQG--LPGLNGLKGQQGRRGKTGPKGDPGIPGL 846

Query: 3702 --------------PSSQGSGSP--RPGTKTGGGSQPQPAS----GQLQSETATTPAKPS 3741
                          P  QG   P  + G     G    P      G +    A  P  P 
Sbjct: 847  DRSGFPGETGSPGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPP 906

Query: 3742 FPSRSPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPKE----KGESSTKRKKGQVPGP 3797
                +P     P     K     P   GEQG  G+ GP E     G+      KG    P
Sbjct: 907  GNPGTPGQRGSPGIPGVKGQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPGLKGFAGNP 966

Query: 3798 ARSESVGSFGRAPSAPDKPPRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQRKAEPGHT 3857
                + G  G       K    P     P   L +   P        P S      PG  
Sbjct: 967  GEKGNRGVPGMPGLKGLKGLPGPAGPPGPRGDLGSTGNPGEPGLRGIPGSMGNMGMPGSK 1026

Query: 3858 QRKDRLGKAFPQGRP 3872
             ++  LG     GRP
Sbjct: 1027 GKRGTLGFPGRAGRP 1041



 Score = 37.7 bits (86), Expect = 0.23
 Identities = 34/115 (29%), Positives = 43/115 (37%), Gaps = 9/115 (7%)

Query: 3176 RGQARRSLGDLPGGLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAK 3235
            RGQ  R   D   G+ G+  V  L     E A    +G +      GSPG P G  G A 
Sbjct: 559  RGQPGRKGLD---GIPGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGSP-GPAGPAG 614

Query: 3236 KDSPGERAKPRARSTPS-----NPDGAATPDSASATALADAGSPGPPRTTPSPSP 3285
                G + +P  + T        P G A P    + +    G PGPP     P P
Sbjct: 615  PPGYGPQGEPGLQGTQGVPGAPGPPGEAGPRGELSVSTPVPGPPGPPGPPGHPGP 669



 Score = 35.0 bits (79), Expect = 1.5
 Identities = 43/143 (30%), Positives = 51/143 (35%), Gaps = 28/143 (19%)

Query: 3183 LGDLPG-----GLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKD 3237
            L  LPG     G+ G    A L  S   P      G      A G PG   G++GE  + 
Sbjct: 488  LPGLPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFPGAQGDPGLK-GEKGETLQP 546

Query: 3238 S--------PGERAKPRARST---PSNPDGAATPDSASATALA----DAGSPGPPRTTPS 3282
                     PG R +P  +     P  P     P      AL+    D G PG P +  S
Sbjct: 547  EGQVGVPGDPGLRGQPGRKGLDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGS 606

Query: 3283 PSPDPWAG-------GEPLLQAT 3298
            P P   AG       GEP LQ T
Sbjct: 607  PGPAGPAGPPGYGPQGEPGLQGT 629



 Score = 32.3 bits (72), Expect = 9.5
 Identities = 35/116 (30%), Positives = 39/116 (33%), Gaps = 28/116 (24%)

Query: 3205 EPAPKHHRGK--RSAGKAAGSPGDPWGQEGEAKKDS----PGERAKPRARSTPS------ 3252
            EP P    G    S G   G+PGDP G +G+  KD     PG       R  P       
Sbjct: 269  EPGPPGPSGLPGESYGSEKGAPGDP-GLQGKPGKDGVPGFPGSEGVKGNRGFPGLMGEDG 327

Query: 3253 --------NPDGAATPDSASAT--ALADAGSPGPP-----RTTPSPSPDPWAGGEP 3293
                     P G   P     T     D G+PGPP     R    PS  P   G P
Sbjct: 328  IKGQKGDIGPPGFRGPTEYYDTYQEKGDEGTPGPPGPRGARGPQGPSGPPGVPGSP 383


>gi|89276751 alpha 1 type V collagen preproprotein [Homo sapiens]
          Length = 1838

 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 262/1076 (24%), Positives = 321/1076 (29%), Gaps = 213/1076 (19%)

Query: 6    PRGAP-PPTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQAMELPEAQ 64
            PRG P  P   G L P+     PG P    + D  P  +   G +   G       P AQ
Sbjct: 671  PRGLPGEPGPRGLLGPKGPPGPPGPPGVTGM-DGQPGPKGNVGPQGEPGPPGQQGNPGAQ 729

Query: 65   PRQARDGELKPPSLRGQAPSSTPGKRGSP-----------QTPPGRSPLQAPSRLAGRAE 113
                  G + PP  +G  P   PG  G P           + PPG    Q P    G   
Sbjct: 730  GLPGPQGAIGPPGEKG--PLGKPGLPGMPGADGPPGHPGKEGPPGEKGGQGPPGPQGPI- 786

Query: 114  GSPPQRYILGIASSR-TKPTLDETPENPQLEAAQLPEVDTPQG-PGTGAPLRPGLPRTEA 171
            G P  R + G    R  K T  E  E+        P      G  G    + P  PR E 
Sbjct: 787  GYPGPRGVKGADGIRGLKGTKGEKGED------GFPGFKGDMGIKGDRGEIGPPGPRGED 840

Query: 172  QPAAEELGFHRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQA-S 230
             P   +                     P+  P P  P   + +   P  PG YP  Q   
Sbjct: 841  GPEGPK-----------------GRGGPNGDPGPLGPPGEKGKLGVPGLPG-YPGRQGPK 882

Query: 231  GADSWPPAAENSFPGANF--------GVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHG 282
            G+  +P      FPGAN         G P    +  P G R    PRG++ +   P   G
Sbjct: 883  GSIGFP-----GFPGANGEKGGRGTPGKPGPRGQRGPTGPRGERGPRGITGK---PGPKG 934

Query: 283  ASTKPFPADVAGHAFTNGPLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQP 342
             S    PA   G    NGP      Q    +P      GP  P P  P    LP + GQ 
Sbjct: 935  NSGGDGPAGPPGERGPNGP------QGPTGFP------GPKGP-PGPPGKDGLPGHPGQR 981

Query: 343  G--GLNRHSDLSG--ALSSPGAAHSAPRPFSDSLHKSLTKILPERPPSAQ--DGLGSTRG 396
            G  G    +   G   +  P        P  +  H       P  PP  Q   GL    G
Sbjct: 982  GETGFQGKTGPPGPPGVVGPQGPTGETGPMGERGHPG-----PPGPPGEQGLPGLAGKEG 1036

Query: 397  P-----PSSLPQRHFPGQAYRASGVDTSPGPPDT-----ELAAPGPP-PARLPQLWDPTA 445
                  P+ LP +  P       G    PGP            PGPP PA  P    P  
Sbjct: 1037 TKGDPGPAGLPGKDGPPGLRGFPGDRGLPGPVGALGLKGNEGPPGPPGPAGSPGERGPAG 1096

Query: 446  APYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSAPLPWPQVLPTARPSPHGMEMLSRLP 505
            A       GP+         G P P      P           P       G++    LP
Sbjct: 1097 A------AGPIGIPGRPGPQGPPGPAGEKGAPGEKG-------PQGPAGRDGLQGPVGLP 1143

Query: 506  FPAG--GPEWQGGSQGALGTAGKTPGPREK----LPAVRSSQG--GSPALFTYNGMTDPG 557
             PAG  GP  + G +G +G  G+     +K     P     QG  G P     +G   P 
Sbjct: 1144 GPAGPVGPPGEDGDKGEIGEPGQKGSKGDKGEQGPPGPTGPQGPIGQPGPSGADGEPGPR 1203

Query: 558  AQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNTAGSTCSSLSPMSSSPAN 617
             Q   FG  +    P G P   PP  VG      P P       G       P    P  
Sbjct: 1204 GQQGLFG-QKGDEGPRGFPG--PPGPVGL--QGLPGPPGEKGETGDVGQMGPPGPPGPRG 1258

Query: 618  PSSEESQLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTHYQPEPAKAFPFPADGLG 677
            PS       GP GP      P    E G P  + EP   LP    P   K         G
Sbjct: 1259 PSGAPG-ADGPQGPPGGIGNPGAVGEKGEPGEAGEP--GLPGEGGPPGPKGERGEKGESG 1315

Query: 678  AEGAFQCLEETPFPHEGPEVGRGGLQGFPRAP-PPYPTHHFSLSSASLDQLDVLLTCRQC 736
              GA         P +    G  G  GFP  P PP             D+ D        
Sbjct: 1316 PSGAAGPPGPKGPPGDDGPKGSPGPVGFPGDPGPPGEPGPAGQDGPPGDKGD-------- 1367

Query: 737  DRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAP-RVPADAHAGLLSHAK 795
                                    + G   SPGP G P P   P +      AG      
Sbjct: 1368 ----------------------DGEPGQTGSPGPTGEPGPSGPPGKRGPPGPAGPEGRQG 1405

Query: 796  TFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLPASDLDMEDDAKLDSLITEALNGMEYQS 855
                 G+A  EG   P +TG +    A   P P                 + L G+    
Sbjct: 1406 EKGAKGEAGLEG--PPG