Guide to the Human Genome
Home | Table of Contents | Search text | Search genes | Search sequences | Purchase | FAQ | Blog | Help

Search of human proteins with 16933557

BLASTP 2.2.11 [Jun-05-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|16933557 dachsous 1 precursor [Homo sapiens]
         (3298 letters)

Database: hs.faa 
           37,866 sequences; 18,247,518 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|16933557 dachsous 1 precursor [Homo sapiens]                      6543   0.0  
gi|47059046 dachsous 2 isoform 1 [Homo sapiens]                      1397   0.0  
gi|165932370 FAT tumor suppressor homolog 4 [Homo sapiens]           1152   0.0  
gi|189571674 cadherin-like 23 isoform 1 precursor [Homo sapiens]      922   0.0  
gi|66346693 FAT tumor suppressor 1 precursor [Homo sapiens]           922   0.0  
gi|148886692 FAT tumor suppressor homolog 3 [Homo sapiens]            880   0.0  
gi|216548385 dachsous 2 isoform 2 [Homo sapiens]                      807   0.0  
gi|13787217 FAT tumor suppressor 2 precursor [Homo sapiens]           802   0.0  
gi|145309304 cadherin EGF LAG seven-pass G-type receptor 3 [Homo...   431   e-120
gi|13325064 cadherin EGF LAG seven-pass G-type receptor 2 [Homo ...   425   e-118
gi|7656967 cadherin EGF LAG seven-pass G-type receptor 1 [Homo s...   414   e-115
gi|216548395 dachsous 2 isoform 3 [Homo sapiens]                      398   e-110
gi|27754773 protocadherin 1 isoform 2 precursor [Homo sapiens]        348   4e-95
gi|27754771 protocadherin 1 isoform 1 precursor [Homo sapiens]        348   4e-95
gi|157426847 protocadherin 19 isoform a [Homo sapiens]                342   5e-93
gi|157426845 protocadherin 19 isoform b [Homo sapiens]                342   5e-93
gi|7657443 protocadherin 11 X-linked isoform a precursor [Homo s...   330   2e-89
gi|14589922 protocadherin 11 X-linked isoform d [Homo sapiens]        330   2e-89
gi|14589920 protocadherin 11 X-linked isoform c [Homo sapiens]        330   2e-89
gi|14589918 protocadherin 11 X-linked isoform b precursor [Homo ...   330   2e-89
gi|14589946 protocadherin 11 Y-linked isoform c [Homo sapiens]        327   1e-88
gi|14589944 protocadherin 11 Y-linked isoform b [Homo sapiens]        327   1e-88
gi|14589942 protocadherin 11 Y-linked isoform a [Homo sapiens]        327   1e-88
gi|94538350 protocadherin 17 precursor [Homo sapiens]                 322   5e-87
gi|14196451 protocadherin gamma subfamily A, 11 isoform 2 precur...   317   2e-85
gi|11128039 protocadherin gamma subfamily A, 11 isoform 1 precur...   317   2e-85
gi|7706113 protocadherin 12 precursor [Homo sapiens]                  316   2e-85
gi|14277682 protocadherin gamma subfamily C, 4 isoform 2 precurs...   315   4e-85
gi|11128025 protocadherin gamma subfamily C, 4 isoform 1 precurs...   315   4e-85
gi|11128041 protocadherin gamma subfamily A, 10 isoform 1 precur...   314   8e-85

>gi|16933557 dachsous 1 precursor [Homo sapiens]
          Length = 3298

 Score = 6543 bits (16975), Expect = 0.0
 Identities = 3298/3298 (100%), Positives = 3298/3298 (100%)

Query: 1    MQKELGIVPSCPGMKSPRPHLLLPLLLLLLLLLGAGVPGAWGQAGSLDLQIDEEQPAGTL 60
            MQKELGIVPSCPGMKSPRPHLLLPLLLLLLLLLGAGVPGAWGQAGSLDLQIDEEQPAGTL
Sbjct: 1    MQKELGIVPSCPGMKSPRPHLLLPLLLLLLLLLGAGVPGAWGQAGSLDLQIDEEQPAGTL 60

Query: 61   IGDISAGLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDREQRDRYRFTAV 120
            IGDISAGLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDREQRDRYRFTAV
Sbjct: 61   IGDISAGLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDREQRDRYRFTAV 120

Query: 121  TPDGATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGY 180
            TPDGATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGY
Sbjct: 121  TPDGATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGY 180

Query: 181  ALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQAL 240
            ALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQAL
Sbjct: 181  ALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQAL 240

Query: 241  LDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSE 300
            LDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSE
Sbjct: 241  LDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSE 300

Query: 301  GDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQP 360
            GDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQP
Sbjct: 301  GDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQP 360

Query: 361  SMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSV 420
            SMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSV
Sbjct: 361  SMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSV 420

Query: 421  IYLVCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPE 480
            IYLVCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPE
Sbjct: 421  IYLVCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPE 480

Query: 481  PLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYEL 540
            PLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYEL
Sbjct: 481  PLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYEL 540

Query: 541  EPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQV 600
            EPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQV
Sbjct: 541  EPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQV 600

Query: 601  TATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAV 660
            TATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAV
Sbjct: 601  TATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAV 660

Query: 661  DGGGLKSMVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRL 720
            DGGGLKSMVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRL
Sbjct: 661  DGGGLKSMVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRL 720

Query: 721  SYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISI 780
            SYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISI
Sbjct: 721  SYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISI 780

Query: 781  VPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPPGRLAPVTLSLSGGDPRGLFSLD 840
            VPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPPGRLAPVTLSLSGGDPRGLFSLD
Sbjct: 781  VPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPPGRLAPVTLSLSGGDPRGLFSLD 840

Query: 841  AVSGLLQTLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDT 900
            AVSGLLQTLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDT
Sbjct: 841  AVSGLLQTLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDT 900

Query: 901  VLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSG 960
            VLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSG
Sbjct: 901  VLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSG 960

Query: 961  GPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVL 1020
            GPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVL
Sbjct: 961  GPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVL 1020

Query: 1021 QVQAQAPDGGPITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKA 1080
            QVQAQAPDGGPITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKA
Sbjct: 1021 QVQAQAPDGGPITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKA 1080

Query: 1081 ELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRL 1140
            ELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRL
Sbjct: 1081 ELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRL 1140

Query: 1141 TYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVA 1200
            TYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVA
Sbjct: 1141 TYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVA 1200

Query: 1201 VLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPG 1260
            VLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPG
Sbjct: 1201 VLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPG 1260

Query: 1261 SELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEP 1320
            SELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEP
Sbjct: 1261 SELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEP 1320

Query: 1321 PPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFA 1380
            PPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFA
Sbjct: 1321 PPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFA 1380

Query: 1381 LDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDP 1440
            LDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDP
Sbjct: 1381 LDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDP 1440

Query: 1441 LALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRG 1500
            LALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRG
Sbjct: 1441 LALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRG 1500

Query: 1501 LDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQPP 1560
            LDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQPP
Sbjct: 1501 LDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQPP 1560

Query: 1561 GPAALHVVARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVV 1620
            GPAALHVVARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVV
Sbjct: 1561 GPAALHVVARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVV 1620

Query: 1621 ASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGA 1680
            ASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGA
Sbjct: 1621 ASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGA 1680

Query: 1681 NGQVTYGGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVA 1740
            NGQVTYGGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVA
Sbjct: 1681 NGQVTYGGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVA 1740

Query: 1741 VEDENDHAPTFGSAHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILDGDPSGAFVL 1800
            VEDENDHAPTFGSAHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILDGDPSGAFVL
Sbjct: 1741 VEDENDHAPTFGSAHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILDGDPSGAFVL 1800

Query: 1801 DLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAY 1860
            DLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAY
Sbjct: 1801 DLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAY 1860

Query: 1861 SVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGELRTAAALDRE 1920
            SVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGELRTAAALDRE
Sbjct: 1861 SVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGELRTAAALDRE 1920

Query: 1921 QCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPT 1980
            QCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPT
Sbjct: 1921 QCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPT 1980

Query: 1981 LALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLFIVA 2040
            LALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLFIVA
Sbjct: 1981 LALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLFIVA 2040

Query: 2041 TDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHAGGTNG 2100
            TDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHAGGTNG
Sbjct: 2041 TDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHAGGTNG 2100

Query: 2101 PITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFTVLTLT 2160
            PITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFTVLTLT
Sbjct: 2101 PITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFTVLTLT 2160

Query: 2161 LQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLF 2220
            LQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLF
Sbjct: 2161 LQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLF 2220

Query: 2221 HVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP 2280
            HVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP
Sbjct: 2221 HVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP 2280

Query: 2281 WELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFE 2340
            WELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFE
Sbjct: 2281 WELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFE 2340

Query: 2341 QCDRYQLQLLAHDGPHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSA 2400
            QCDRYQLQLLAHDGPHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSA
Sbjct: 2341 QCDRYQLQLLAHDGPHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSA 2400

Query: 2401 TDRDSGANGHISYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAP 2460
            TDRDSGANGHISYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAP
Sbjct: 2401 TDRDSGANGHISYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAP 2460

Query: 2461 GRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDY 2520
            GRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDY
Sbjct: 2461 GRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDY 2520

Query: 2521 SIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQP 2580
            SIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQP
Sbjct: 2521 SIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQP 2580

Query: 2581 PQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFT 2640
            PQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFT
Sbjct: 2581 PQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFT 2640

Query: 2641 VSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHFALAPVTIEVQDVN 2700
            VSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHFALAPVTIEVQDVN
Sbjct: 2641 VSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHFALAPVTIEVQDVN 2700

Query: 2701 DHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFAL 2760
            DHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFAL
Sbjct: 2701 DHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFAL 2760

Query: 2761 NSSTGELRARVPFDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYDPVFLAPAFHF 2820
            NSSTGELRARVPFDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYDPVFLAPAFHF
Sbjct: 2761 NSSTGELRARVPFDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYDPVFLAPAFHF 2820

Query: 2821 QVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSSPYFGINQTTGALYLRVDSRAPGSG 2880
            QVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSSPYFGINQTTGALYLRVDSRAPGSG
Sbjct: 2821 QVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSSPYFGINQTTGALYLRVDSRAPGSG 2880

Query: 2881 TATSGGGGRTRREAPRELRLEVIARGPLPGSRSATVPVTVDITHTALGLAPDLNLLLVGA 2940
            TATSGGGGRTRREAPRELRLEVIARGPLPGSRSATVPVTVDITHTALGLAPDLNLLLVGA
Sbjct: 2881 TATSGGGGRTRREAPRELRLEVIARGPLPGSRSATVPVTVDITHTALGLAPDLNLLLVGA 2940

Query: 2941 VAASLGVVVVLALAALVLGLVRARSRKAEAAPGPMSQAAPLASDSLQKLGREPPSPPPSE 3000
            VAASLGVVVVLALAALVLGLVRARSRKAEAAPGPMSQAAPLASDSLQKLGREPPSPPPSE
Sbjct: 2941 VAASLGVVVVLALAALVLGLVRARSRKAEAAPGPMSQAAPLASDSLQKLGREPPSPPPSE 3000

Query: 3001 HLYHQTLPSYGGPGAGGPYPRGGSLDPSHSSGRGSAEAAEDDEIRMINEFPRVASVASSL 3060
            HLYHQTLPSYGGPGAGGPYPRGGSLDPSHSSGRGSAEAAEDDEIRMINEFPRVASVASSL
Sbjct: 3001 HLYHQTLPSYGGPGAGGPYPRGGSLDPSHSSGRGSAEAAEDDEIRMINEFPRVASVASSL 3060

Query: 3061 AARGPDSGIQQDADGLSDTSCEPPAPDTWYKGRKAGLLLPGAGATLYREEGPPATATAFL 3120
            AARGPDSGIQQDADGLSDTSCEPPAPDTWYKGRKAGLLLPGAGATLYREEGPPATATAFL
Sbjct: 3061 AARGPDSGIQQDADGLSDTSCEPPAPDTWYKGRKAGLLLPGAGATLYREEGPPATATAFL 3120

Query: 3121 GGCGLSPAPTGDYGFPADGKPCVAGALTAIVAGEEELRGSYNWDYLLSWCPQFQPLASVF 3180
            GGCGLSPAPTGDYGFPADGKPCVAGALTAIVAGEEELRGSYNWDYLLSWCPQFQPLASVF
Sbjct: 3121 GGCGLSPAPTGDYGFPADGKPCVAGALTAIVAGEEELRGSYNWDYLLSWCPQFQPLASVF 3180

Query: 3181 TEIARLKDEARPCPPAPRIDPPPLITAVAHPGAKSVPPKPANTAAARAIFPPASHRSPIS 3240
            TEIARLKDEARPCPPAPRIDPPPLITAVAHPGAKSVPPKPANTAAARAIFPPASHRSPIS
Sbjct: 3181 TEIARLKDEARPCPPAPRIDPPPLITAVAHPGAKSVPPKPANTAAARAIFPPASHRSPIS 3240

Query: 3241 HEGSLSSAAMSPSFSPSLSPLAARSPVVSPFGVAQGPSASALSAESGLEPPDDTELHI 3298
            HEGSLSSAAMSPSFSPSLSPLAARSPVVSPFGVAQGPSASALSAESGLEPPDDTELHI
Sbjct: 3241 HEGSLSSAAMSPSFSPSLSPLAARSPVVSPFGVAQGPSASALSAESGLEPPDDTELHI 3298


>gi|47059046 dachsous 2 isoform 1 [Homo sapiens]
          Length = 2916

 Score = 1397 bits (3617), Expect = 0.0
 Identities = 973/2917 (33%), Positives = 1458/2917 (49%), Gaps = 210/2917 (7%)

Query: 483  PEVALPGSFVVR-------------VTARDPDQGTNGQVTYSLAPGAHTHW----FSIDP 525
            PE  L G+ V R             VTA D D G  G + YSL  G  ++     F IDP
Sbjct: 54   PETELWGAIVFRSQEENAKPVKETEVTASDADSGLYGFIEYSLYDGFLSYEAPQAFRIDP 113

Query: 526  TSGIITTAASLDYELEPQP-QLIVVATDGGLPP----------LASSATVSVALQDVNDN 574
              G I  +  +D E +P    L+V A DG              L++ A V V L+DVNDN
Sbjct: 114  HDGQICVSQDIDRERDPATYDLLVEAKDGDEQRMTHLALVKGGLSAQAFVRVDLEDVNDN 173

Query: 575  EPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAH 634
             P F  + Y  S+ + TQPGT  + V ATD DSG +G ++Y L  G  SS    F ID+ 
Sbjct: 174  HPVFNPSTYVTSISDETQPGTEIINVLATDQDSGIYGTVAYELIPGNVSS---LFTIDST 230

Query: 635  SGDVCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMV-YVKVFLSDENDNPPQFYPREYAAS 693
            +G       +      S+ +F+        L+  +  ++ F   E D        E +  
Sbjct: 231  TGLYSPEVEI-----LSAVNFSADKEVMNSLEMFLPLLRHFKKVERDEEAAEKKFEASRG 285

Query: 694  ISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRAN 753
               +      +  L+  D    + G  +   +A  +  L       G++ +  PL+   +
Sbjct: 286  WFMRFKGRRHLHYLKVQDEAASADGEAAARYVANLAKIL-----GEGIIYLTLPLSHLES 340

Query: 754  SVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQ 813
            + + L + A+DGGGL A  +A V I I   T  P  FE+ +Y F V EDV   + +G V+
Sbjct: 341  TTLSLMVSAQDGGGLTAVINADVTIHIFQTTLAPAEFERPKYTFLVYEDVPEDSPIGTVK 400

Query: 814  AHNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGPVLELEVRAGSGVPP 873
            A  P     P+   +S GD  G FS+    G ++T +PLD E   PV+ L V+A  G  P
Sbjct: 401  AREPLNSSEPIFYRISSGDLGGKFSIHPRLGTIRTRKPLDHETQ-PVVVLTVQAQLGSAP 459

Query: 874  AFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTL 933
            A +   V + + DVNDN PAF    D + +   T PGT +Y  RA D DSG N  + +++
Sbjct: 460  ACSSTEVNITVMDVNDNHPAFLRTSDEIRISQTTPPGTALYLARAEDRDSGRNGLIRYSI 519

Query: 934  LAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGT 993
             +   G F +D   G + L   LG        L L A D G  P+ +   L VV++    
Sbjct: 520  ASPQPGVFAIDRALGVLFLNGSLGAGEQRELTLTLRAEDQGVHPQAALLVLTVVIEK--- 576

Query: 994  RGLAPR--FNSPTYRVDLPSGTTAGTQVLQVQAQAPDG-----GPITYHLAAEGASSPFG 1046
            R  +P   F    Y+V++    +  TQ+LQ QA  P G      P+ Y L     S+ FG
Sbjct: 577  REHSPSWTFEHLVYQVEVSESLSPMTQMLQTQAH-PLGPQRAASPLRYSLEPSVDSAMFG 635

Query: 1047 LEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLS 1106
            + P +GW+++R   D E+ + Y  +V A       L  Q  + TV V + ++N++SP   
Sbjct: 636  IRPYTGWIYLRRQFDYESTQTYNFRVFAWIPEDGFL--QNVSTTVIVRVWDENDNSPTFL 693

Query: 1107 EDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTL 1166
             D  FL V E+  P   +G++ A D DSG NG+L Y L     D K F+++P TG   T+
Sbjct: 694  HDVLFLKVEESPVPQGVIGKITAIDMDSGKNGQLLYFLLS---DGKFFKMNPNTGPAGTI 750

Query: 1167 QT--------------------------------------------LDREQQSSYQLLVQ 1182
                                                          LDRE +  +++ V 
Sbjct: 751  YVITWADGAAAFSGTDFAFSSDELQAFVLKSLFCELGEGELINWVALDREHRGHHEMTVL 810

Query: 1183 VQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAK 1242
            V D GSPPR+ T  V+V+V D+NDN P F Q     G  L ++V +  P   LVTT+ AK
Sbjct: 811  VTDRGSPPRNATMAVYVSVTDINDNRPFFPQC--LPGKELHVKVLEGQPVNMLVTTVFAK 868

Query: 1243 DPDEGENGTILYTLTGP-GSELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPR 1301
            DPDEG N  + Y+++    S+ F +  ++GE+ T   L    RP Y +++ A DQG PP 
Sbjct: 869  DPDEGNNAEVTYSVSSEDSSDHFKIDANNGEIRTTTILSYDYRPSYRMSVIATDQGVPPL 928

Query: 1302 SASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAG 1361
                 + +QV+P   L++    +++      +P        E L+P  ++  + + +   
Sbjct: 929  QGQAVVNIQVIP---LSKGRAIMSQNIRHLIIP--------ENLKPTKIMSLIKSSDHLQ 977

Query: 1362 V---GALTYTLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAG-A 1417
                G L +++V   D +G F +D+++G L+L++ LD+E    +    +  +       +
Sbjct: 978  QHYNGKLHFSIVAD-DKDGHFEIDSSTGDLFLSKELDYETTSHYLFRVITTDHSKNLSLS 1036

Query: 1418 RLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLL 1477
              + + + V+D+N+H+P+F  + + +++ EN   G  +Y F A D DG   NS ++Y + 
Sbjct: 1037 STVFLSIDVEDQNDHSPSFQDELIVISVEENVPIGTLVYVFNAKDDDGSFLNSRIQYYIE 1096

Query: 1478 RQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVT 1537
               P      +    G L     LDRE+ P ++L V A+D+  N + RR   ++A++ + 
Sbjct: 1097 SHNPGTNPFLIHPSFGTLVTVSRLDRESIPTVILTVTASDQAVNVTDRRLRSLTAQIVIL 1156

Query: 1538 DENDNAPVFASPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGH-FRLHS 1596
            D ND+ P F S     + ED   G    H+ A DPD G   +V+Y + SG +   F L  
Sbjct: 1157 DVNDHNPTFISFPNAHVKEDVTVGSLVHHITAHDPDEGRNGKVTYSILSGNENMTFMLDE 1216

Query: 1597 STGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSV 1656
            S+G L+   PLD E + +H+LTV+A D G+P  S++Q LTV+V DVNDEAP F+Q  Y  
Sbjct: 1217 SSGLLTTTCPLDYEMKTQHILTVLALDDGTPALSSSQTLTVTVLDVNDEAPVFKQHLYEA 1276

Query: 1657 LLRENNPPGTSLLTLRATDPDVGANGQVTYG---GVSSESFSLDPDTGVLTTLRALDREE 1713
             ++EN  PG  +  + A D D G N ++ +    G S E F ++ DTG + T   LDRE 
Sbjct: 1277 SVKENQNPGEFVTRVEALDRDSGVNSKLQFEIMPGASFELFEINSDTGEVVTTTILDREI 1336

Query: 1714 QEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQTLTMLR 1773
            QE   L V  +D G P   +  T+   VEDENDHAP F  +   +EV E Q+P+ +  + 
Sbjct: 1337 QEVFTLRVLVRDGGFPSLSSTTTILCTVEDENDHAPEFIVSSYDIEVLENQEPEVVYTVL 1396

Query: 1774 ASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQP 1833
            ASD D G N  ++Y I+DG+    F ++  SGE  T R LDRE    F L I   D G P
Sbjct: 1397 ASDMDAGNNRAVEYHIIDGNTDECFTINEMSGELSTTRALDREQISNFTLVILCSDLGDP 1456

Query: 1834 ALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYY 1893
              S+ + L V VLDANDH+P+FP   Y   V ED   GT++L L A D D G NG   Y+
Sbjct: 1457 PRSSVIHLQVRVLDANDHSPSFPTLYYQSSVREDAEVGTVVLVLSAVDKDEGLNGQTEYF 1516

Query: 1894 LGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDV 1953
            L    +GAF ++P SG L+T+  LDRE    +TFS  A D +  G  STTV + + V DV
Sbjct: 1517 LTDEASGAFTIDPMSGTLKTSNTLDREARSQHTFSAVARDCSIQGSRSTTVIIKVYVTDV 1576

Query: 1954 NDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTTV 2013
            ND+ P    +P  + L    P+  T  +    +RA+D D G N ++++  A T     ++
Sbjct: 1577 NDNDPVLEQNPFDVFLSPESPTNQTTVI----VRADDLDLGPNGTVVFSFAETQSM-FSI 1631

Query: 2014 DSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASS 2073
            D YTGEI+  ++P +       L +  TD G PAR+ TG++++ ++GE  +   F     
Sbjct: 1632 DKYTGEIQFQQNP-SSEYFPIWLQLKVTDQGIPARTTTGLLVIHMEGEDVK-ISFSHHLY 1689

Query: 2074 EATIRENAPPGTPIVSPRAVHAGGTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLD 2133
            +  + EN   GT IV+ +A         + YSI SGNE G  S+   +G +TV+  + LD
Sbjct: 1690 KGLVTENCEAGTSIVTVKAFAPDSIQDSMKYSIFSGNEDGVLSLCSKSGQLTVKEPKFLD 1749

Query: 2134 FEVSPRLRLVLQAESGGAFAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQV 2193
            FEV   ++L++ AES G  A+  + + +QD NDN+P F +  Y A + ES+     ++QV
Sbjct: 1750 FEVRNEVQLIVLAESSGHRAYCKVAVLIQDENDNSPCFEQSIYQASVSESQLYNAHVIQV 1809

Query: 2194 EADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRG 2253
             A DLD G  G I YS+ +       F +D  +G ITT AILD E+ +   L++ ATD+G
Sbjct: 1810 FATDLDSGLNGLIEYSILSGNQEEA-FQIDALSGVITTKAILDYELTSSYSLIVQATDKG 1868

Query: 2254 SPALVGSATLTVMVIDTNDNRPTIPQPWELRVSEDALLGSEIAQVTGNDVD-SGPVLWYV 2312
             P L  +  + V V D NDN P       + ++ED+L G  +  V+ +DVD +   ++  
Sbjct: 1869 MPRLSNTTVIKVQVTDINDNAPAFLPSEAVEITEDSLPGVIVTHVSVHDVDLNSAFIFSF 1928

Query: 2313 LSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVLVEDVNDN 2372
               S P   F++ +  G V L   LDFE+   Y+L +   D  H     L V V DVNDN
Sbjct: 1929 AKESNPGTKFAIDQNTGVVVLVKTLDFEEMTEYELLIQISDSVHYTEGALVVRVLDVNDN 1988

Query: 2373 APAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTLF 2432
             P FSQ  YQV + E  P G ++L++SATD +S  N +ISY + S +  FS+DP NGT+F
Sbjct: 1989 PPVFSQDFYQVTVPESIPVGYSVLTLSATDLES--NENISYRILSSSKEFSIDPKNGTIF 2046

Query: 2433 TIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVT 2492
            TI   + L  D       ++EA D G P   A   V + ++D N++AP FT+  Y ++++
Sbjct: 2047 TISPVLLL--DTISTTQFLVEASDGGNPDLRALTLVEIGIEDMNNYAPEFTVKSYNLSLS 2104

Query: 2493 EDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALG 2552
            ED   GSTL+T    D D +R +  V+YSIISGN    F +E +   +        + +G
Sbjct: 2105 EDALVGSTLVTFSNIDHDWTRENTYVEYSIISGNSQNNFHVETKFFHSEYPY----KQVG 2160

Query: 2553 CLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVP 2612
             LVLL  LD E+   + L + A+D G PP SS   +++ VLDVNDNPP F+  SY   V 
Sbjct: 2161 YLVLLHSLDREASASHELVILASDSGCPPLSSTAVISIQVLDVNDNPPNFSSLSYHTHVK 2220

Query: 2613 EDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQAR 2672
            E TP+G+ +  V A+D D G H  + + + SG+  G F L+E++G L L   LD E   +
Sbjct: 2221 ESTPLGSHITVVSANDRDTGSHAEIIYNIISGNEKGHFYLEENTGVLYLIKPLDYEKMTK 2280

Query: 2673 HQLVVQAADPAGAHFALAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAID 2732
              L VQA+D    HF+ A V + V D NDH P F  +  S  V EN P  + + +++A+D
Sbjct: 2281 FTLTVQASDAEKKHFSFAVVFVSVLDDNDHAPQFMFSSFSCIVPENLPISSTICSINALD 2340

Query: 2733 GDAGAFGRLRYSLLEAGPGPEG----REAFALNSSTGELRARVPFDYEHTESFRLLVGAA 2788
             DAG +G L YS++       G     + F ++  TG++ A+   DYE+   + L V A 
Sbjct: 2341 FDAGPYGELTYSIVSPCFLTHGMSYDHDLFLIDPLTGDIHAKQILDYENGNKYCLTVQAK 2400

Query: 2789 DAGNLSASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGLV 2848
            D G+ +AS+ V V + G DE++P+F    + F +PE  +    +G V+A+D D G DG++
Sbjct: 2401 DKGDATASLVVWVDIEGIDEFEPIFTQDQYFFTLPEKNKDRQLIGRVEASDADAGIDGVI 2460

Query: 2849 LYSLATSSPYFGINQTTGALYL-----RVDSRAPGSGTATSGGGGRTRREAPRELRLEVI 2903
            LYSL TSSP+F +N+T G +YL      + S+     T                L +++I
Sbjct: 2461 LYSLGTSSPFFSVNKTNGNIYLIRALPLIKSQLNKEDT----------------LEMKII 2504

Query: 2904 ARGPLPGSRSATVPVTVDITHTALGLAPDLNLLLVGAVAASLGVVV-----VLALAALVL 2958
            A  P   S+ A+  V V+++ ++ G       L V A + S+ +VV     ++ +  L++
Sbjct: 2505 AHSPKSDSKFASCTVFVNVSFSSEGTP-----LAVFASSFSISLVVSFLVFLILICILIV 2559

Query: 2959 GLVRARSRKA-----EAAPGPMSQAAPLASDSLQKLGREPPSPPPSEHLYHQTLPSYGGP 3013
             ++R + +       E     +     +  D+      +      +E +     P +   
Sbjct: 2560 MILRHKQKDTINNYEEKKTSSLDADLRVTRDASVLKAFQKTDDCSNEVVPVDATPEWLSL 2619

Query: 3014 GAGGPYPRGGSLDPSHSSGRGS--AEAAEDDEIRMINEFPRVASVASSLA---ARGPDSG 3068
             +            S+SSG  S   E AED EI+ INE P      S+L+   +R PDSG
Sbjct: 2620 ISIMEKDIVNLYRHSNSSGHCSVEGETAEDKEIQRINEHPYRKCSDSALSDHESRVPDSG 2679

Query: 3069 IQQDADGLSDTSCE---------PPAPDTWYKGRKAGLLLPGAGATLYREEGPPATATAF 3119
            I +D+D LS  S E           A  T+ +G +      G   T  +    P T    
Sbjct: 2680 IPRDSDQLSCLSGETDVMVTAETAEASQTFGEGDQG----EGCSTTCAQNNVLPQTVQKR 2735

Query: 3120 LGGCGLSPAPTGDYGFPADGKPCVAGALTAIVAGEEELRGSYNWDYLLSWCPQFQPLASV 3179
                 +      +  F +  +     AL+     + + + +Y+W+YLLSW P+FQPLASV
Sbjct: 2736 EAKESILADVRKESVFISGDQEVRCAALSTQTTSDHDGKDNYHWNYLLSWEPKFQPLASV 2795

Query: 3180 FTEIARLKDEARPCPPAPR-----IDPPPLITAVAHPGAKSVPPKPANTAAARAIFPPAS 3234
            F +IA+LKDE    P  P+     + PPPLITAVA PG K+VPP+    A      PP  
Sbjct: 2796 FNDIAKLKDEHLHMPGIPKEKKSFVFPPPLITAVAQPGIKAVPPR--MPAVNLGQVPPKH 2853

Query: 3235 HRSPIS-HEGSLSSAAMSPSFSPSLSPLAARSPVVSP 3270
             RSPI  H GSL    M+P+FSPSLS L  + P +SP
Sbjct: 2854 PRSPIPYHLGSLPE-GMTPNFSPSLSLLTMQPPALSP 2889



 Score =  621 bits (1601), Expect = e-177
 Identities = 623/2180 (28%), Positives = 940/2180 (43%), Gaps = 195/2180 (8%)

Query: 53   EEQPAGTLIGDISAGLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDREQR 112
            E+ P  + IG + A  P  ++ P+ Y IS+ +   +G   +I    G +RT + LD E +
Sbjct: 388  EDVPEDSPIGTVKAREPLNSSEPIFYRISSGD---LGGKFSIHPRLGTIRTRKPLDHETQ 444

Query: 113  DRYRFTAVT-----PDGATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPA 167
                 T        P  ++ EV + V D+ND+ PAF +    +++ + T  GT   L  A
Sbjct: 445  PVVVLTVQAQLGSAPACSSTEVNITVMDVNDNHPAFLRTSDEIRISQTTPPGTALYLARA 504

Query: 168  RDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSHYMLQLEA 227
             D D+GR G   Y+++    G  F ++   G        L + G L    +    L L A
Sbjct: 505  EDRDSGRNGLIRYSIASPQPG-VFAIDRALG-------VLFLNGSLGAGEQRELTLTLRA 556

Query: 228  YDGGSPPRRAQALLDVTLLDINDHAPA--FNQSRYHAVVSESLAPGSPVLQVFASDADAG 285
             D G  P+ A  +L V +++  +H+P+  F    Y   VSESL+P + +LQ  A      
Sbjct: 557  EDQGVHPQAALLVLTV-VIEKREHSPSWTFEHLVYQVEVSESLSPMTQMLQTQAHPL-GP 614

Query: 286  VNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQA---RDGGAHPE 342
               A     +   S     F I  +TG + L R  D+E  + +   V A    DG    +
Sbjct: 615  QRAASPLRYSLEPSVDSAMFGIRPYTGWIYLRRQFDYESTQTYNFRVFAWIPEDG--FLQ 672

Query: 343  LGSAFVTVHVRDANDNQPSM--TVIFLSADGSPQVSEAAPPGQLVARISVSDPD------ 394
              S  V V V D NDN P+    V+FL  + SP       P  ++ +I+  D D      
Sbjct: 673  NVSTTVIVRVWDENDNSPTFLHDVLFLKVEESP------VPQGVIGKITAIDMDSGKNGQ 726

Query: 395  -------DGDFAHVNVS---------LEGGEGHFALSTQDSVI-----------YLVCVA 427
                   DG F  +N +         +   +G  A S  D               L C  
Sbjct: 727  LLYFLLSDGKFFKMNPNTGPAGTIYVITWADGAAAFSGTDFAFSSDELQAFVLKSLFCEL 786

Query: 428  RR--------LDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRP 479
                      LDRE R  + + V  TD GSPP  A  A  + VTD+NDN P F + L   
Sbjct: 787  GEGELINWVALDREHRGHHEMTVLVTDRGSPPRNATMAVYVSVTDINDNRPFFPQCLPGK 846

Query: 480  EPLPEVALPGS----FVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAAS 535
            E L    L G      V  V A+DPD+G N +VTYS++    +  F ID  +G I T   
Sbjct: 847  E-LHVKVLEGQPVNMLVTTVFAKDPDEGNNAEVTYSVSSEDSSDHFKIDANNGEIRTTTI 905

Query: 536  LDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGT 595
            L Y+  P  ++ V+ATD G+PPL   A V++ +  ++       +   +  +PE  +P  
Sbjct: 906  LSYDYRPSYRMSVIATDQGVPPLQGQAVVNIQVIPLSKGRAIMSQNIRHLIIPENLKPTK 965

Query: 596  CFLQVTATDADSGPF-GLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFD 654
                + ++D     + G L +S+   +       F ID+ +GD+  ++ LD +   S + 
Sbjct: 966  IMSLIKSSDHLQQHYNGKLHFSI---VADDKDGHFEIDSSTGDLFLSKELDYET-TSHYL 1021

Query: 655  FTVTAVDGG---GLKSMVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHD 711
            F V   D      L S V++ + + D+ND+ P F       S+    P GT V    A D
Sbjct: 1022 FRVITTDHSKNLSLSSTVFLSIDVEDQNDHSPSFQDELIVISVEENVPIGTLVYVFNAKD 1081

Query: 712  PDQGS--HGRLSYHILA---GNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGG 766
             D GS  + R+ Y+I +   G +P  F +    G L     L R +   V L + A D  
Sbjct: 1082 -DDGSFLNSRIQYYIESHNPGTNP--FLIHPSFGTLVTVSRLDRESIPTVILTVTASDQA 1138

Query: 767  GLQAEPSAR---VDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNP-PGRLA 822
                +   R     I I+      P F        V EDV  G+ V  + AH+P  GR  
Sbjct: 1139 VNVTDRRLRSLTAQIVILDVNDHNPTFISFPNA-HVKEDVTVGSLVHHITAHDPDEGRNG 1197

Query: 823  PVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRV 882
             VT S+  G+    F LD  SGLL T  PLD E+    +   +    G P   +   + V
Sbjct: 1198 KVTYSILSGNENMTFMLDESSGLLTTTCPLDYEMKTQHILTVLALDDGTPALSSSQTLTV 1257

Query: 883  LLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGG-GAF 941
             + DVND +P F        +  N  PG  +  + ALD DSGVNS++ F ++ G     F
Sbjct: 1258 TVLDVNDEAPVFKQHLYEASVKENQNPGEFVTRVEALDRDSGVNSKLQFEIMPGASFELF 1317

Query: 942  TVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFN 1001
             ++  TG V     L         L +  RDGG P  +S   +   V+D      AP F 
Sbjct: 1318 EINSDTGEVVTTTILDREIQEVFTLRVLVRDGGFPSLSSTTTILCTVEDENDH--APEFI 1375

Query: 1002 SPTYRVDLPSGTTAGT--QVLQVQAQAPDGGPITYHLAAEGASSPFGLEPQSGWLWVRAA 1059
              +Y +++           VL     A +   + YH+        F +   SG L    A
Sbjct: 1376 VSSYDIEVLENQEPEVVYTVLASDMDAGNNRAVEYHIIDGNTDECFTINEMSGELSTTRA 1435

Query: 1060 LDREAQELYILKVMAVSGSKAELGQQTGTATV--RVSILNQNEHSPRLSEDPTFLAVAEN 1117
            LDRE    + L ++      ++LG    ++ +  +V +L+ N+HSP         +V E+
Sbjct: 1436 LDREQISNFTLVILC-----SDLGDPPRSSVIHLQVRVLDANDHSPSFPTLYYQSSVRED 1490

Query: 1118 QPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSY 1177
               GT V  + A D+D G NG+  Y L    E S AF I P +G + T  TLDRE +S +
Sbjct: 1491 AEVGTVVLVLSAVDKDEGLNGQTEYFL--TDEASGAFTIDPMSGTLKTSNTLDREARSQH 1548

Query: 1178 QLLVQVQDGG-SPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLV 1236
                  +D      RSTT  + V V D+NDN P   Q          + +    P     
Sbjct: 1549 TFSAVARDCSIQGSRSTTVIIKVYVTDVNDNDPVLEQ------NPFDVFLSPESPTNQTT 1602

Query: 1237 TTLQAKDPDEGENGTILYTLTGPGSELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQ 1296
              ++A D D G NGT++++     S +FS+  ++GE+           P + L L   DQ
Sbjct: 1603 VIVRADDLDLGPNGTVVFSFAETQS-MFSIDKYTGEIQFQQNPSSEYFPIW-LQLKVTDQ 1660

Query: 1297 GSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAA 1356
            G P R+ +  L++ +              E    +    +      E    G+ + +V A
Sbjct: 1661 GIPARTTTGLLVIHM------------EGEDVKISFSHHLYKGLVTENCEAGTSIVTVKA 1708

Query: 1357 PEPAGV-GALTYTLVGGADPEGTFALDAASGRLYLARP--LDFEAGPPWRALTVRAEGPG 1413
              P  +  ++ Y++  G + +G  +L + SG+L +  P  LDFE     + L V AE  G
Sbjct: 1709 FAPDSIQDSMKYSIFSG-NEDGVLSLCSKSGQLTVKEPKFLDFEVRNEVQ-LIVLAESSG 1766

Query: 1414 GAGARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVR 1473
                   +V V +QDEN+++P F +     ++ E+    A +    A+D D  G N  + 
Sbjct: 1767 HRA--YCKVAVLIQDENDNSPCFEQSIYQASVSESQLYNAHVIQVFATDLDS-GLNGLIE 1823

Query: 1474 YRLL--RQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVS 1531
            Y +L   QE    A ++DA +G ++    LD E T +  L+V+ATD+      R +    
Sbjct: 1824 YSILSGNQE---EAFQIDALSGVITTKAILDYELTSSYSLIVQATDK---GMPRLSNTTV 1877

Query: 1532 ARVFVTDENDNAPVFASPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGH 1591
             +V VTD NDNAP F     V + ED  PG    HV   D DL  A   S+   S     
Sbjct: 1878 IKVQVTDINDNAPAFLPSEAVEITEDSLPGVIVTHVSVHDVDLNSAFIFSFAKESNPGTK 1937

Query: 1592 FRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQ 1651
            F +  +TG + +V+ LD E+  E+ L +  SD       A   L V V DVND  P F Q
Sbjct: 1938 FAIDQNTGVVVLVKTLDFEEMTEYELLIQISDSVHYTEGA---LVVRVLDVNDNPPVFSQ 1994

Query: 1652 QEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGV-SSESFSLDPDTGVLTTLR-AL 1709
              Y V + E+ P G S+LTL AT  D+ +N  ++Y  + SS+ FS+DP  G + T+   L
Sbjct: 1995 DFYQVTVPESIPVGYSVLTLSAT--DLESNENISYRILSSSKEFSIDPKNGTIFTISPVL 2052

Query: 1710 DREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPE-GQDPQT 1768
              +        V A D G+P       V + +ED N++AP F     +L + E      T
Sbjct: 2053 LLDTISTTQFLVEASDGGNPDLRALTLVEIGIEDMNNYAPEFTVKSYNLSLSEDALVGST 2112

Query: 1769 LTMLRASDPD-VGANGQLQYRILDGDPSGAFVLDL----------ASGEFGTMRPLDREV 1817
            L      D D    N  ++Y I+ G+    F ++             G    +  LDRE 
Sbjct: 2113 LVTFSNIDHDWTRENTYVEYSIISGNSQNNFHVETKFFHSEYPYKQVGYLVLLHSLDREA 2172

Query: 1818 EPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQL 1877
              + +L I A D G P LS+T ++++ VLD ND+ P F   +Y   V E  P G+ +  +
Sbjct: 2173 SASHELVILASDSGCPPLSSTAVISIQVLDVNDNPPNFSSLSYHTHVKESTPLGSHITVV 2232

Query: 1878 QAHDPDAGANGHVTYYLGAGT-AGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAA 1936
             A+D D G++  + Y + +G   G F LE ++G L     LD E+   +T +V A D A 
Sbjct: 2233 SANDRDTGSHAEIIYNIISGNEKGHFYLEENTGVLYLIKPLDYEKMTKFTLTVQASD-AE 2291

Query: 1937 AGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGAN 1996
                S  V V ++V D NDHAP F  S     +P   P  ST    + ++ A D DAG  
Sbjct: 2292 KKHFSFAV-VFVSVLDDNDHAPQFMFSSFSCIVPENLPISST----ICSINALDFDAGPY 2346

Query: 1997 ASILYRLAGTPPPGTT-----------VDSYTGEIRVARSPVALGPRDRVLFIVATDLGR 2045
              + Y +    P   T           +D  TG+I   +           L + A D G 
Sbjct: 2347 GELTYSIVS--PCFLTHGMSYDHDLFLIDPLTGDIHAKQILDYENGNKYCLTVQAKDKG- 2403

Query: 2046 PARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHA-GGTNGPITY 2104
               +A+ V+ V ++G  E  P F +     T+ E       I    A  A  G +G I Y
Sbjct: 2404 -DATASLVVWVDIEGIDEFEPIFTQDQYFFTLPEKNKDRQLIGRVEASDADAGIDGVILY 2462

Query: 2105 SILSGNEKGTFSIQPSTGAI 2124
            S+  G     FS+  + G I
Sbjct: 2463 SL--GTSSPFFSVNKTNGNI 2480



 Score =  615 bits (1587), Expect = e-175
 Identities = 679/2533 (26%), Positives = 1066/2533 (42%), Gaps = 267/2533 (10%)

Query: 276  QVFASDADAGVNGAVTYEINRRQSEGDGP--FSIDAHTGLLQLERPLDFEQ-RRVHELVV 332
            +V ASDAD+G+ G + Y +       + P  F ID H G + + + +D E+    ++L+V
Sbjct: 78   EVTASDADSGLYGFIEYSLYDGFLSYEAPQAFRIDPHDGQICVSQDIDRERDPATYDLLV 137

Query: 333  QARDGG----AHPEL------GSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPG 382
            +A+DG      H  L        AFV V + D NDN P    +F  +     +S+   PG
Sbjct: 138  EAKDGDEQRMTHLALVKGGLSAQAFVRVDLEDVNDNHP----VFNPSTYVTSISDETQPG 193

Query: 383  QLVARISVSDPDDGDFAHV-------NVS----LEGGEGHFALSTQ-------------- 417
              +  +  +D D G +  V       NVS    ++   G ++   +              
Sbjct: 194  TEIINVLATDQDSGIYGTVAYELIPGNVSSLFTIDSTTGLYSPEVEILSAVNFSADKEVM 253

Query: 418  DSVIYLVCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLY 477
            +S+   + + R   + ERD          S    +R +    LH   V D A + D +  
Sbjct: 254  NSLEMFLPLLRHFKKVERDEEAAEKKFEASRGWFMRFKGRRHLHYLKVQDEAASADGEAA 313

Query: 478  RPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLD 537
                     + G  ++ +T                            P S + +T  S  
Sbjct: 314  ARYVANLAKILGEGIIYLTL---------------------------PLSHLESTTLS-- 344

Query: 538  YELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYN----ASLPEGTQP 593
                    L+V A DGG      +A V++ +        +F+R  Y       +PE +  
Sbjct: 345  --------LMVSAQDGGGLTAVINADVTIHIFQTTLAPAEFERPKYTFLVYEDVPEDSPI 396

Query: 594  GTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSF 653
            GT   +     ++   + + S  LG          F I    G + T + LD +  P   
Sbjct: 397  GTVKAREPLNSSEPIFYRISSGDLGG--------KFSIHPRLGTIRTRKPLDHETQPVVV 448

Query: 654  DFTVTAVDGGGLKSMVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPD 713
                  +      S   V + + D NDN P F        IS  +PPGTA+   RA D D
Sbjct: 449  LTVQAQLGSAPACSSTEVNITVMDVNDNHPAFLRTSDEIRISQTTPPGTALYLARAEDRD 508

Query: 714  QGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPS 773
             G +G + Y I A   P +F +D   G+L +   L       + L + AED  G+  + +
Sbjct: 509  SGRNGLIRYSI-ASPQPGVFAIDRALGVLFLNGSLGAGEQRELTLTLRAED-QGVHPQAA 566

Query: 774  ARVDISIVPGTPTPP--IFEQLQYVFSVPEDVAPGTSVGIVQAH--NPPGRLAPVTLSLS 829
              V   ++      P   FE L Y   V E ++P T +   QAH   P    +P+  SL 
Sbjct: 567  LLVLTVVIEKREHSPSWTFEHLVYQVEVSESLSPMTQMLQTQAHPLGPQRAASPLRYSLE 626

Query: 830  GGDPRGLFSLDAVSGLLQTLRPLDRELLGPVLELEVRAGSGVPPAFAVARVR----VLLD 885
                  +F +   +G +   R  D E          R  + +P    +  V     V + 
Sbjct: 627  PSVDSAMFGIRPYTGWIYLRRQFDYE---STQTYNFRVFAWIPEDGFLQNVSTTVIVRVW 683

Query: 886  DVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDP 945
            D NDNSP F      + +  +  P   I  + A+D DSG N ++ + LL+  G  F ++P
Sbjct: 684  DENDNSPTFLHDVLFLKVEESPVPQGVIGKITAIDMDSGKNGQLLYFLLS-DGKFFKMNP 742

Query: 946  TTGHVRLMRPLGPSGGPA------------------------------------------ 963
             TG    +  +  + G A                                          
Sbjct: 743  NTGPAGTIYVITWADGAAAFSGTDFAFSSDELQAFVLKSLFCELGEGELINWVALDREHR 802

Query: 964  --HELELEARDGGSPPRTSHFRLRVVVQDVG-TRGLAPR-FNSPTYRVDLPSGTTAGTQV 1019
              HE+ +   D GSPPR +   + V V D+   R   P+        V +  G      V
Sbjct: 803  GHHEMTVLVTDRGSPPRNATMAVYVSVTDINDNRPFFPQCLPGKELHVKVLEGQPVNMLV 862

Query: 1020 LQVQAQAPDGG---PITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVS 1076
              V A+ PD G    +TY +++E +S  F ++  +G +     L  + +  Y + V+A  
Sbjct: 863  TTVFAKDPDEGNNAEVTYSVSSEDSSDHFKIDANNGEIRTTTILSYDYRPSYRMSVIATD 922

Query: 1077 GSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDR-DSG 1135
                 L    G A V + ++  ++    +S++   L + EN  P   +  + ++D     
Sbjct: 923  QGVPPL---QGQAVVNIQVIPLSKGRAIMSQNIRHLIIPENLKPTKIMSLIKSSDHLQQH 979

Query: 1136 PNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQD-GGSPPRSTT 1194
             NG+L +S+    +D   F I   TG++   + LD E  S Y   V   D   +   S+T
Sbjct: 980  YNGKLHFSIVADDKDGH-FEIDSSTGDLFLSKELDYETTSHYLFRVITTDHSKNLSLSST 1038

Query: 1195 GTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGE--NGTI 1252
              + + V D ND+SP+F          + I V + VP GTLV    AKD D+G   N  I
Sbjct: 1039 VFLSIDVEDQNDHSPSFQDEL------IVISVEENVPIGTLVYVFNAKD-DDGSFLNSRI 1091

Query: 1253 LYTLT--GPGSELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQ 1310
             Y +    PG+  F +HP  G L+T + L R   P  +LT++A DQ        L+ L  
Sbjct: 1092 QYYIESHNPGTNPFLIHPSFGTLVTVSRLDRESIPTVILTVTASDQAVNVTDRRLRSLTA 1151

Query: 1311 VLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAA--PEPAGVGALTYT 1368
             +    + +  P      P A V   +TV        GSL+  + A  P+    G +TY+
Sbjct: 1152 QIVILDVNDHNPTFIS-FPNAHVKEDVTV--------GSLVHHITAHDPDEGRNGKVTYS 1202

Query: 1369 LVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALTVRAEGPG-GAGARLLRVQVQVQ 1427
            ++ G +   TF LD +SG L    PLD+E       LTV A   G  A +    + V V 
Sbjct: 1203 ILSG-NENMTFMLDESSGLLTTTCPLDYEM-KTQHILTVLALDDGTPALSSSQTLTVTVL 1260

Query: 1428 DENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALR 1487
            D N+ AP F +     ++ EN  PG  +    A D D  G NS +++ ++          
Sbjct: 1261 DVNDEAPVFKQHLYEASVKENQNPGEFVTRVEALDRDS-GVNSKLQFEIM-PGASFELFE 1318

Query: 1488 LDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVF- 1546
            +++ TG +     LDRE      L V   D         ++  +    V DEND+AP F 
Sbjct: 1319 INSDTGEVVTTTILDREIQEVFTLRVLVRD---GGFPSLSSTTTILCTVEDENDHAPEFI 1375

Query: 1547 ASPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGG-DGHFRLHSSTGALSVVR 1605
             S   + + E+Q P      V+A D D G    V Y +  G  D  F ++  +G LS  R
Sbjct: 1376 VSSYDIEVLENQEP-EVVYTVLASDMDAGNNRAVEYHIIDGNTDECFTINEMSGELSTTR 1434

Query: 1606 PLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPG 1665
             LDREQ +   L ++ SD G PPRS+   L V V D ND +P+F    Y   +RE+   G
Sbjct: 1435 ALDREQISNFTLVILCSDLGDPPRSSVIHLQVRVLDANDHSPSFPTLYYQSSVREDAEVG 1494

Query: 1666 TSLLTLRATDPDVGANGQVTY--GGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYA 1723
            T +L L A D D G NGQ  Y     +S +F++DP +G L T   LDRE + +   +  A
Sbjct: 1495 TVVLVLSAVDKDEGLNGQTEYFLTDEASGAFTIDPMSGTLKTSNTLDREARSQHTFSAVA 1554

Query: 1724 QD---RGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEV-PEGQDPQTLTMLRASDPDV 1779
            +D   +GS  + T V ++V V D ND+ P        + + PE    QT  ++RA D D+
Sbjct: 1555 RDCSIQGS--RSTTVIIKVYVTDVNDNDPVLEQNPFDVFLSPESPTNQTTVIVRADDLDL 1612

Query: 1780 GANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATL 1839
            G NG + +     +    F +D  +GE    +    E  P + L+++  D G PA + T 
Sbjct: 1613 GPNGTVVFSF--AETQSMFSIDKYTGEIQFQQNPSSEYFPIW-LQLKVTDQGIPARTTTG 1669

Query: 1840 LLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTA 1899
            LL +  ++  D   +F    Y   V E+  AGT ++ ++A  PD+  +            
Sbjct: 1670 LLVIH-MEGEDVKISFSHHLYKGLVTENCEAGTSIVTVKAFAPDSIQDSMKYSIFSGNED 1728

Query: 1900 GAFLLEPSSGEL--RTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHA 1957
            G   L   SG+L  +    LD E        V  +  A +        V + ++D ND++
Sbjct: 1729 GVLSLCSKSGQLTVKEPKFLDFE----VRNEVQLIVLAESSGHRAYCKVAVLIQDENDNS 1784

Query: 1958 PTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYR-LAGTPPPGTTVDSY 2016
            P F  S  +  +             +  + A D D+G N  I Y  L+G       +D+ 
Sbjct: 1785 PCFEQSIYQASVSES----QLYNAHVIQVFATDLDSGLNGLIEYSILSGNQEEAFQIDAL 1840

Query: 2017 TGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEAT 2076
            +G I               L + ATD G P  S T VI V +    +  P F   S    
Sbjct: 1841 SGVITTKAILDYELTSSYSLIVQATDKGMPRLSNTTVIKVQVTDINDNAPAF-LPSEAVE 1899

Query: 2077 IRENAPPGTPIVSPRAVHAGGTNGPITYSILSGNEKGT-FSIQPSTGAITVRSAEGLDFE 2135
            I E++ PG  IV+  +VH    N    +S    +  GT F+I  +TG + +   + LDFE
Sbjct: 1900 ITEDSLPGV-IVTHVSVHDVDLNSAFIFSFAKESNPGTKFAIDQNTGVVVL--VKTLDFE 1956

Query: 2136 VSPRLRLVLQAESGGAFAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEA 2195
                  L++Q      +    L + + D NDN P F +  Y   +PES P+   +L + A
Sbjct: 1957 EMTEYELLIQISDSVHYTEGALVVRVLDVNDNPPVFSQDFYQVTVPESIPVGYSVLTLSA 2016

Query: 2196 DDLDQGSGGQISYSLAASQPARGLFHVDPTTGTI-TTTAILDREIWAETRLVLMATDRGS 2254
             DL+  S   ISY + +S      F +DP  GTI T + +L  +  + T+ ++ A+D G+
Sbjct: 2017 TDLE--SNENISYRILSSSKE---FSIDPKNGTIFTISPVLLLDTISTTQFLVEASDGGN 2071

Query: 2255 PALVGSATLTVMVIDTNDNRPTIP-QPWELRVSEDALLGSEIAQVTGNDVD---SGPVLW 2310
            P L     + + + D N+  P    + + L +SEDAL+GS +   +  D D       + 
Sbjct: 2072 PDLRALTLVEIGIEDMNNYAPEFTVKSYNLSLSEDALVGSTLVTFSNIDHDWTRENTYVE 2131

Query: 2311 YVLSPSGPQDPFSVG----------RYGGRVSLTGPLDFEQCDRYQLQLLAHDG---PHE 2357
            Y +     Q+ F V           +  G + L   LD E    ++L +LA D    P  
Sbjct: 2132 YSIISGNSQNNFHVETKFFHSEYPYKQVGYLVLLHSLDREASASHELVILASDSGCPPLS 2191

Query: 2358 GRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLAS 2417
              A +++ V DVNDN P FS   Y   + E TP GS I  VSA DRD+G++  I Y++ S
Sbjct: 2192 STAVISIQVLDVNDNPPNFSSLSYHTHVKESTPLGSHITVVSANDRDTGSHAEIIYNIIS 2251

Query: 2418 PAD--GFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQ 2475
              +   F ++ N G L+ I     L ++      + ++A D       + A V V + D 
Sbjct: 2252 GNEKGHFYLEENTGVLYLI---KPLDYEKMTKFTLTVQASD-AEKKHFSFAVVFVSVLDD 2307

Query: 2476 NDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISG---NWGRVFQ 2532
            NDHAP F  S +   V E+LP  ST+ ++ A D D    +  + YSI+S      G  + 
Sbjct: 2308 NDHAPQFMFSSFSCIVPENLPISSTICSINALDFDAG-PYGELTYSIVSPCFLTHGMSYD 2366

Query: 2533 LEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTV 2592
             +  L +            G +   + LD+E+  +Y LTV A D+G    S VV V +  
Sbjct: 2367 HDLFLIDP---------LTGDIHAKQILDYENGNKYCLTVQAKDKGDATASLVVWVDIEG 2417

Query: 2593 LDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFEL 2652
            +D  +  P+FT+  Y  T+PE       +  VEASDAD G  G++ +++ +  P   F +
Sbjct: 2418 ID--EFEPIFTQDQYFFTLPEKNKDRQLIGRVEASDADAGIDGVILYSLGTSSP--FFSV 2473

Query: 2653 DESSGTLRLAHAL 2665
            ++++G + L  AL
Sbjct: 2474 NKTNGNIYLIRAL 2486



 Score =  606 bits (1562), Expect = e-172
 Identities = 657/2488 (26%), Positives = 1040/2488 (41%), Gaps = 259/2488 (10%)

Query: 167  ARDADAGRLGTQGYALSGDG-----AGETFRLETRPGPDGTPVPELVVTGELDRE-NRSH 220
            A DAD+G  G   Y+L  DG     A + FR++   G       ++ V+ ++DRE + + 
Sbjct: 81   ASDADSGLYGFIEYSLY-DGFLSYEAPQAFRIDPHDG-------QICVSQDIDRERDPAT 132

Query: 221  YMLQLEAYDGGSPPRR----------AQALLDVTLLDINDHAPAFNQSRYHAVVSESLAP 270
            Y L +EA DG                AQA + V L D+ND+ P FN S Y   +S+   P
Sbjct: 133  YDLLVEAKDGDEQRMTHLALVKGGLSAQAFVRVDLEDVNDNHPVFNPSTYVTSISDETQP 192

Query: 271  GSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHEL 330
            G+ ++ V A+D D+G+ G V YE+          F+ID+ TGL   E             
Sbjct: 193  GTEIINVLATDQDSGIYGTVAYEL--IPGNVSSLFTIDSTTGLYSPEVE----------- 239

Query: 331  VVQARDGGAHPELGSAF-----VTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLV 385
            ++ A +  A  E+ ++      +  H +    ++ +    F ++ G     +       +
Sbjct: 240  ILSAVNFSADKEVMNSLEMFLPLLRHFKKVERDEEAAEKKFEASRGWFMRFKGRRHLHYL 299

Query: 386  ARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTAT 445
                 +   DG+ A   V+      + A    + +IYL      L   E    +L V+A 
Sbjct: 300  KVQDEAASADGEAAARYVA------NLAKILGEGIIYLTLPLSHL---ESTTLSLMVSAQ 350

Query: 446  DSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYR---PEPLPEVALPGSFVVRVTARDPDQ 502
            D G       A   +H+         F+R  Y     E +PE +  G+    V AR+P  
Sbjct: 351  DGGGLTAVINADVTIHIFQTTLAPAEFERPKYTFLVYEDVPEDSPIGT----VKAREP-L 405

Query: 503  GTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSA 562
             ++  + Y ++ G     FSI P  G I T   LD+E +P   L V A  G   P  SS 
Sbjct: 406  NSSEPIFYRISSGDLGGKFSIHPRLGTIRTRKPLDHETQPVVVLTVQAQLGS-APACSST 464

Query: 563  TVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLG 622
             V++ + DVNDN P F RT     + + T PGT      A D DSG  GL+ YS    + 
Sbjct: 465  EVNITVMDVNDNHPAFLRTSDEIRISQTTPPGTALYLARAEDRDSGRNGLIRYS----IA 520

Query: 623  SSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGG-GLKSMVYVKVFLSDENDN 681
            S     F ID   G +    +L   +       T+ A D G   ++ + V   + ++ ++
Sbjct: 521  SPQPGVFAIDRALGVLFLNGSLGAGE-QRELTLTLRAEDQGVHPQAALLVLTVVIEKREH 579

Query: 682  PPQ--FYPREYAASISAQSPPGTAVLRLRAHD-PDQGSHGRLSYHILAGNSPPLFTLDEQ 738
             P   F    Y   +S    P T +L+ +AH    Q +   L Y +       +F +   
Sbjct: 580  SPSWTFEHLVYQVEVSESLSPMTQMLQTQAHPLGPQRAASPLRYSLEPSVDSAMFGIRPY 639

Query: 739  SGLLTVAWPLARRANSVVQLEIGA---EDGGGLQAEPSARVDISIVPGTPTPPIFEQLQY 795
            +G + +       +       + A   ED  G     S  V + +       P F     
Sbjct: 640  TGWIYLRRQFDYESTQTYNFRVFAWIPED--GFLQNVSTTVIVRVWDENDNSPTFLHDVL 697

Query: 796  VFSVPEDVAPGTSVGIVQA---------------------------HNPPGRLAPVT--- 825
               V E   P   +G + A                             P G +  +T   
Sbjct: 698  FLKVEESPVPQGVIGKITAIDMDSGKNGQLLYFLLSDGKFFKMNPNTGPAGTIYVITWAD 757

Query: 826  --LSLSGGDPRGLFSLDAV-------------SGLLQTLRPLDRELLGPVLELEVRAGSG 870
               + SG D    FS D +              G L     LDRE  G      +    G
Sbjct: 758  GAAAFSGTD--FAFSSDELQAFVLKSLFCELGEGELINWVALDREHRGHHEMTVLVTDRG 815

Query: 871  VPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTP----IYTLRALDPDSGVN 926
             PP  A   V V + D+NDN P FP       L      G P    + T+ A DPD G N
Sbjct: 816  SPPRNATMAVYVSVTDINDNRPFFPQCLPGKELHVKVLEGQPVNMLVTTVFAKDPDEGNN 875

Query: 927  SRVTFTLLA-GGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLR 985
            + VT+++ +      F +D   G +R    L     P++ + + A D G PP      + 
Sbjct: 876  AEVTYSVSSEDSSDHFKIDANNGEIRTTTILSYDYRPSYRMSVIATDQGVPPLQGQAVVN 935

Query: 986  VVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQV-----QAQAPDGGPITYHLAAEG 1040
            + V  + ++G A    S   R  +       T+++ +       Q    G + + + A+ 
Sbjct: 936  IQVIPL-SKGRA--IMSQNIRHLIIPENLKPTKIMSLIKSSDHLQQHYNGKLHFSIVADD 992

Query: 1041 ASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNE 1100
                F ++  +G L++   LD E    Y+ +V+    SK      + T  + + + +QN+
Sbjct: 993  KDGHFEIDSSTGDLFLSKELDYETTSHYLFRVITTDHSKNL--SLSSTVFLSIDVEDQND 1050

Query: 1101 HSPRLSEDPTFLAVAENQPPGTSVGRVFATDRD-SGPNGRLTYSLQQLSEDSKAFRIHPQ 1159
            HSP   ++   ++V EN P GT V    A D D S  N R+ Y ++  +  +  F IHP 
Sbjct: 1051 HSPSFQDELIVISVEENVPIGTLVYVFNAKDDDGSFLNSRIQYYIESHNPGTNPFLIHPS 1110

Query: 1160 TGEVTTLQTLDREQQSSYQLLVQVQDGG---SPPRSTTGTVHVAVLDLNDNSPTFLQASG 1216
             G + T+  LDRE   +  L V   D     +  R  + T  + +LD+ND++PTF+    
Sbjct: 1111 FGTLVTVSRLDRESIPTVILTVTASDQAVNVTDRRLRSLTAQIVILDVNDHNPTFISFPN 1170

Query: 1217 AAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYT-LTGPGSELFSLHPHSGELLT 1275
            A        V + V  G+LV  + A DPDEG NG + Y+ L+G  +  F L   SG L T
Sbjct: 1171 A-------HVKEDVTVGSLVHHITAHDPDEGRNGKVTYSILSGNENMTFMLDESSGLLTT 1223

Query: 1276 AAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPV 1335
              PL    +  ++LT+ A D G+P  S+S  L V VL          D+ +  P      
Sbjct: 1224 TCPLDYEMKTQHILTVLALDDGTPALSSSQTLTVTVL----------DVNDEAPVFK-QH 1272

Query: 1336 VLTVTAAEGLRPGSLLGSV-AAPEPAGVGA-LTYTLVGGADPEGTFALDAASGRLYLARP 1393
            +   +  E   PG  +  V A    +GV + L + ++ GA  E  F +++ +G +     
Sbjct: 1273 LYEASVKENQNPGEFVTRVEALDRDSGVNSKLQFEIMPGASFE-LFEINSDTGEVVTTTI 1331

Query: 1394 LDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGA 1453
            LD E    +    +  +G   + +    +   V+DEN+HAP F      + + EN EP  
Sbjct: 1332 LDREIQEVFTLRVLVRDGGFPSLSSTTTILCTVEDENDHAPEFIVSSYDIEVLENQEP-E 1390

Query: 1454 ALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLV 1513
             +YT  ASD D  G N  V Y ++          ++  +G LS  R LDRE      L++
Sbjct: 1391 VVYTVLASDMDA-GNNRAVEYHIIDGNTD-ECFTINEMSGELSTTRALDREQISNFTLVI 1448

Query: 1514 EATDRPANASRRRAARVSARVFVTDENDNAPVFAS---PSRVRLPEDQPPGPAALHVVAR 1570
              +D        R++ +  +V V D ND++P F +    S VR  ED   G   L + A 
Sbjct: 1449 LCSDL---GDPPRSSVIHLQVRVLDANDHSPSFPTLYYQSSVR--EDAEVGTVVLVLSAV 1503

Query: 1571 DPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASD---HGSP 1627
            D D G   +  Y L     G F +   +G L     LDRE R++H  + VA D    GS 
Sbjct: 1504 DKDEGLNGQTEYFLTDEASGAFTIDPMSGTLKTSNTLDREARSQHTFSAVARDCSIQGS- 1562

Query: 1628 PRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYG 1687
             RS T ++ V V DVND  P  +Q  + V L   +P   + + +RA D D+G NG V + 
Sbjct: 1563 -RSTTVIIKVYVTDVNDNDPVLEQNPFDVFLSPESPTNQTTVIVRADDLDLGPNGTVVFS 1621

Query: 1688 GVSSES-FSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDEND 1746
               ++S FS+D  TG +   +     E   I L +   D+G P + T   + + +E E+ 
Sbjct: 1622 FAETQSMFSIDKYTGEI-QFQQNPSSEYFPIWLQLKVTDQGIPARTTTGLLVIHMEGEDV 1680

Query: 1747 HAPTFGSAHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILDGDPSGAFVLDLASGE 1806
                    +  L     +   ++  ++A  PD      ++Y I  G+  G   L   SG+
Sbjct: 1681 KISFSHHLYKGLVTENCEAGTSIVTVKAFAPD-SIQDSMKYSIFSGNEDGVLSLCSKSGQ 1739

Query: 1807 FGTMRP--LDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEV 1864
                 P  LD EV    QL + A   G  A      + V + D ND++P F    Y   V
Sbjct: 1740 LTVKEPKFLDFEVRNEVQLIVLAESSGHRAYCK---VAVLIQDENDNSPCFEQSIYQASV 1796

Query: 1865 PEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGT-AGAFLLEPSSGELRTAAALDREQCP 1923
             E       ++Q+ A D D+G NG + Y + +G    AF ++  SG + T A LD E   
Sbjct: 1797 SESQLYNAHVIQVFATDLDSGLNGLIEYSILSGNQEEAFQIDALSGVITTKAILDYELTS 1856

Query: 1924 SYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTL-A 1982
            SY+  V A D      LS T  + + V D+ND+AP F        LP      +  +L  
Sbjct: 1857 SYSLIVQATD-KGMPRLSNTTVIKVQVTDINDNAPAF--------LPSEAVEITEDSLPG 1907

Query: 1983 LATLRAEDRDAGANASILYRLAGTPPPGT--TVDSYTGEIRVARSPVALGPRDRVLFIVA 2040
            +        D   N++ ++  A    PGT   +D  TG + + ++   L   +   + + 
Sbjct: 1908 VIVTHVSVHDVDLNSAFIFSFAKESNPGTKFAIDQNTGVVVLVKT---LDFEEMTEYELL 1964

Query: 2041 TDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHAGGTNG 2100
              +        G ++V +    +  P F +   + T+ E+ P G  +++  A     +N 
Sbjct: 1965 IQISDSVHYTEGALVVRVLDVNDNPPVFSQDFYQVTVPESIPVGYSVLTLSATDL-ESNE 2023

Query: 2101 PITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRL--------VLQAESGG-- 2150
             I+Y ILS +++  FSI P  G I         F +SP L L        +++A  GG  
Sbjct: 2024 NISYRILSSSKE--FSIDPKNGTI---------FTISPVLLLDTISTTQFLVEASDGGNP 2072

Query: 2151 -AFAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLD-QGSGGQISY 2208
               A T++ + ++D N+ AP F    Y   L E   +   L+     D D       + Y
Sbjct: 2073 DLRALTLVEIGIEDMNNYAPEFTVKSYNLSLSEDALVGSTLVTFSNIDHDWTRENTYVEY 2132

Query: 2209 SLAASQPARGLFHVD----------PTTGTITTTAILDREIWAETRLVLMATDRGSPALV 2258
            S+ +   ++  FHV+             G +     LDRE  A   LV++A+D G P L 
Sbjct: 2133 SIISGN-SQNNFHVETKFFHSEYPYKQVGYLVLLHSLDREASASHELVILASDSGCPPLS 2191

Query: 2259 GSATLTVMVIDTNDNRPTIPQ-PWELRVSEDALLGSEIAQVTGNDVDSG---PVLWYVLS 2314
             +A +++ V+D NDN P      +   V E   LGS I  V+ ND D+G    +++ ++S
Sbjct: 2192 STAVISIQVLDVNDNPPNFSSLSYHTHVKESTPLGSHITVVSANDRDTGSHAEIIYNIIS 2251

Query: 2315 PSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDG--PHEGRANLTVLVEDVNDN 2372
                +  F +    G + L  PLD+E+  ++ L + A D    H   A + V V D ND+
Sbjct: 2252 -GNEKGHFYLEENTGVLYLIKPLDYEKMTKFTLTVQASDAEKKHFSFAVVFVSVLDDNDH 2310

Query: 2373 APAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPA----------DGF 2422
            AP F  S +  ++ E+ P  S I S++A D D+G  G ++Y + SP           D F
Sbjct: 2311 APQFMFSSFSCIVPENLPISSTICSINALDFDAGPYGELTYSIVSPCFLTHGMSYDHDLF 2370

Query: 2423 SVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSF 2482
             +DP  G    I     L ++      + ++A+D G     A   V V ++  ++  P F
Sbjct: 2371 LIDPLTG---DIHAKQILDYENGNKYCLTVQAKDKG--DATASLVVWVDIEGIDEFEPIF 2425

Query: 2483 TLSHYRVAVTEDLPPGSTLLTLEATDAD 2510
            T   Y   + E       +  +EA+DAD
Sbjct: 2426 TQDQYFFTLPEKNKDRQLIGRVEASDAD 2453



 Score =  573 bits (1476), Expect = e-162
 Identities = 664/2577 (25%), Positives = 1100/2577 (42%), Gaps = 275/2577 (10%)

Query: 388  ISVSDPDDGDFAHVNVSLEGG------EGHFALSTQDSVIYLVCVARRLDREERDA-YNL 440
            ++ SD D G +  +  SL  G         F +   D  I   CV++ +DRE   A Y+L
Sbjct: 79   VTASDADSGLYGFIEYSLYDGFLSYEAPQAFRIDPHDGQI---CVSQDIDRERDPATYDL 135

Query: 441  RVTATDSGSPP----------LRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGS 490
             V A D               L A+A   + + DVNDN P F+   Y    + +   PG+
Sbjct: 136  LVEAKDGDEQRMTHLALVKGGLSAQAFVRVDLEDVNDNHPVFNPSTYVTS-ISDETQPGT 194

Query: 491  FVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGI----ITTAASLDYELEPQPQL 546
             ++ V A D D G  G V Y L PG  +  F+ID T+G+    +   +++++  + +   
Sbjct: 195  EIINVLATDQDSGIYGTVAYELIPGNVSSLFTIDSTTGLYSPEVEILSAVNFSADKE--- 251

Query: 547  IVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQP-GTCFLQVTATDA 605
            ++ + +  LP L     V    +D    E +F+ +       +G +      +Q  A  A
Sbjct: 252  VMNSLEMFLPLLRHFKKVE---RDEEAAEKKFEASRGWFMRFKGRRHLHYLKVQDEAASA 308

Query: 606  DSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGL 665
            D         +L   LG             G +  T  L   +  ++    V+A DGGGL
Sbjct: 309  DGEAAARYVANLAKILG------------EGIIYLTLPLSHLES-TTLSLMVSAQDGGGL 355

Query: 666  KSMVY--VKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYH 723
             +++   V + +      P +F   +Y   +    P  + +  ++A +P   S   + Y 
Sbjct: 356  TAVINADVTIHIFQTTLAPAEFERPKYTFLVYEDVPEDSPIGTVKAREPLNSSE-PIFYR 414

Query: 724  ILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPG 783
            I +G+    F++  + G +    PL      VV L + A+ G    A  S  V+I+++  
Sbjct: 415  ISSGDLGGKFSIHPRLGTIRTRKPLDHETQPVVVLTVQAQLGSA-PACSSTEVNITVMDV 473

Query: 784  TPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHN-PPGRLAPVTLSLSGGDPRGLFSLDAV 842
                P F +      + +   PGT++ + +A +   GR   +  S++   P G+F++D  
Sbjct: 474  NDNHPAFLRTSDEIRISQTTPPGTALYLARAEDRDSGRNGLIRYSIASPQP-GVFAIDRA 532

Query: 843  SGLLQTLRPL----DRELLGPVLELEVRA-GSGVPPAFAVARVRVLLDDVNDNSPA--FP 895
             G+L     L     RE     L L +RA   GV P  A+  + V+++   ++SP+  F 
Sbjct: 533  LGVLFLNGSLGAGEQRE-----LTLTLRAEDQGVHPQAALLVLTVVIEK-REHSPSWTFE 586

Query: 896  APEDTVLLPPNTAPGTPIYTLRA--LDPDSGVNSRVTFTLLAGGGGA-FTVDPTTGHVRL 952
                 V +  + +P T +   +A  L P     S + ++L      A F + P TG + L
Sbjct: 587  HLVYQVEVSESLSPMTQMLQTQAHPLGPQRAA-SPLRYSLEPSVDSAMFGIRPYTGWIYL 645

Query: 953  MRPLGPSGGPAHELELEA---RDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVD- 1008
             R         +   + A    DG          L+ V   V  R      NSPT+  D 
Sbjct: 646  RRQFDYESTQTYNFRVFAWIPEDG---------FLQNVSTTVIVRVWDENDNSPTFLHDV 696

Query: 1009 ---------LPSGTTAGTQVLQVQAQAPDGGPITYHLAAEGASSPFGLEPQSG------- 1052
                     +P G     ++  +   +   G + Y L ++G    F + P +G       
Sbjct: 697  LFLKVEESPVPQGVIG--KITAIDMDSGKNGQLLYFLLSDGKF--FKMNPNTGPAGTIYV 752

Query: 1053 --WLWVRA-------ALDREAQELYILKVMAVSGSKAEL--------------------- 1082
              W    A       A   +  + ++LK +     + EL                     
Sbjct: 753  ITWADGAAAFSGTDFAFSSDELQAFVLKSLFCELGEGELINWVALDREHRGHHEMTVLVT 812

Query: 1083 ----GQQTGTATVRVSILNQNEHSP----RLSEDPTFLAVAENQPPGTSVGRVFATDRDS 1134
                  +  T  V VS+ + N++ P     L      + V E QP    V  VFA D D 
Sbjct: 813  DRGSPPRNATMAVYVSVTDINDNRPFFPQCLPGKELHVKVLEGQPVNMLVTTVFAKDPDE 872

Query: 1135 GPNGRLTYSLQQLSEDSK-AFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRST 1193
            G N  +TYS+   SEDS   F+I    GE+ T   L  + + SY++ V   D G PP   
Sbjct: 873  GNNAEVTYSVS--SEDSSDHFKIDANNGEIRTTTILSYDYRPSYRMSVIATDQGVPPLQG 930

Query: 1194 TGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDP-DEGENGTI 1252
               V++ V+ L+       Q          + +P+ + P  +++ +++ D   +  NG +
Sbjct: 931  QAVVNIQVIPLSKGRAIMSQ------NIRHLIIPENLKPTKIMSLIKSSDHLQQHYNGKL 984

Query: 1253 LYTLTGPGSE-LFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQV 1311
             +++     +  F +   +G+L  +  L      HY+  +   D      S +L L   V
Sbjct: 985  HFSIVADDKDGHFEIDSSTGDLFLSKELDYETTSHYLFRVITTD-----HSKNLSLSSTV 1039

Query: 1312 LPSARLAEPPPDLAERDPAAP--VPVVLTVTAAEGLRPGSLLGSVAAPEPAGV---GALT 1366
              S        D+ +++  +P     ++ ++  E +  G+L+    A +  G      + 
Sbjct: 1040 FLSI-------DVEDQNDHSPSFQDELIVISVEENVPIGTLVYVFNAKDDDGSFLNSRIQ 1092

Query: 1367 YTLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALTVRAEGPG----GAGARLLRV 1422
            Y +         F +  + G L     LD E+  P   LTV A            R L  
Sbjct: 1093 YYIESHNPGTNPFLIHPSFGTLVTVSRLDRES-IPTVILTVTASDQAVNVTDRRLRSLTA 1151

Query: 1423 QVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPP 1482
            Q+ + D N+H P F   P A  + E+   G+ ++   A D D  G N  V Y +L     
Sbjct: 1152 QIVILDVNDHNPTFISFPNA-HVKEDVTVGSLVHHITAHDPD-EGRNGKVTYSILSGNEN 1209

Query: 1483 VPALRLDARTGALSAPRGLDRETTPALLLLVEATD--RPANASRRRAARVSARVFVTDEN 1540
            +    LD  +G L+    LD E     +L V A D   PA +S +     +  V V D N
Sbjct: 1210 M-TFMLDESSGLLTTTCPLDYEMKTQHILTVLALDDGTPALSSSQ-----TLTVTVLDVN 1263

Query: 1541 DNAPVFASP-SRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGH-FRLHSST 1598
            D APVF        + E+Q PG     V A D D G  +++ + +  G     F ++S T
Sbjct: 1264 DEAPVFKQHLYEASVKENQNPGEFVTRVEALDRDSGVNSKLQFEIMPGASFELFEINSDT 1323

Query: 1599 GALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLL 1658
            G +     LDRE +    L V+  D G P  S+T  +  +V D ND AP F    Y + +
Sbjct: 1324 GEVVTTTILDREIQEVFTLRVLVRDGGFPSLSSTTTILCTVEDENDHAPEFIVSSYDIEV 1383

Query: 1659 RENNPPGTSLLTLRATDPDVGANGQVTY---GGVSSESFSLDPDTGVLTTLRALDREEQE 1715
             EN  P   + T+ A+D D G N  V Y    G + E F+++  +G L+T RALDRE+  
Sbjct: 1384 LENQEPEV-VYTVLASDMDAGNNRAVEYHIIDGNTDECFTINEMSGELSTTRALDREQIS 1442

Query: 1716 EINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQTLTM-LRA 1774
               L +   D G PP+ + + ++V V D NDH+P+F + +    V E  +  T+ + L A
Sbjct: 1443 NFTLVILCSDLGDPPRSSVIHLQVRVLDANDHSPSFPTLYYQSSVREDAEVGTVVLVLSA 1502

Query: 1775 SDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGG-QP 1833
             D D G NGQ +Y + D + SGAF +D  SG   T   LDRE          ARD   Q 
Sbjct: 1503 VDKDEGLNGQTEYFLTD-EASGAFTIDPMSGTLKTSNTLDREARSQHTFSAVARDCSIQG 1561

Query: 1834 ALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYY 1893
            + S T+++ V V D ND+ P      + V +  + P     + ++A D D G NG V + 
Sbjct: 1562 SRSTTVIIKVYVTDVNDNDPVLEQNPFDVFLSPESPTNQTTVIVRADDLDLGPNGTVVFS 1621

Query: 1894 LGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDV 1953
              A T   F ++  +GE++       E  P +   +   D     P  TT  + +   + 
Sbjct: 1622 F-AETQSMFSIDKYTGEIQFQQNPSSEYFPIW-LQLKVTDQGI--PARTTTGLLVIHMEG 1677

Query: 1954 NDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTTV 2013
             D   +F +  L   L        T   ++ T++A   D+  ++      +G      ++
Sbjct: 1678 EDVKISF-SHHLYKGLVTENCEAGT---SIVTVKAFAPDSIQDSMKYSIFSGNEDGVLSL 1733

Query: 2014 DSYTGEIRVARSPVALG--PRDRV-LFIVATDLGRPARSATGVIIVGLQGEAERGPRFPR 2070
             S +G++ V + P  L    R+ V L ++A   G  A     V+I   Q E +  P F +
Sbjct: 1734 CSKSGQLTV-KEPKFLDFEVRNEVQLIVLAESSGHRAYCKVAVLI---QDENDNSPCFEQ 1789

Query: 2071 ASSEATIRENAPPGTPIVSPRAVHA-GGTNGPITYSILSGNEKGTFSIQPSTGAITVRSA 2129
            +  +A++ E+      ++   A     G NG I YSILSGN++  F I   +G IT ++ 
Sbjct: 1790 SIYQASVSESQLYNAHVIQVFATDLDSGLNGLIEYSILSGNQEEAFQIDALSGVITTKAI 1849

Query: 2130 EGLDFEVSPRLRLVLQAESGGAFAF---TVLTLTLQDANDNAPRFLRPHYVAFLPESRPL 2186
              LD+E++    L++QA   G       TV+ + + D NDNAP FL    V    +S P 
Sbjct: 1850 --LDYELTSSYSLIVQATDKGMPRLSNTTVIKVQVTDINDNAPAFLPSEAVEITEDSLP- 1906

Query: 2187 EGPLL-QVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRL 2245
             G ++  V   D+D  S    S++  ++   +  F +D  TG +     LD E   E  L
Sbjct: 1907 -GVIVTHVSVHDVDLNSAFIFSFAKESNPGTK--FAIDQNTGVVVLVKTLDFEEMTEYEL 1963

Query: 2246 VLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP-WELRVSEDALLGSEIAQVTGNDVD 2304
            ++  +D           L V V+D NDN P   Q  +++ V E   +G  +  ++  D++
Sbjct: 1964 LIQISD---SVHYTEGALVVRVLDVNDNPPVFSQDFYQVTVPESIPVGYSVLTLSATDLE 2020

Query: 2305 SGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGP-LDFEQCDRYQLQLLAHDGPHEGRANLT 2363
            S   + Y +  S  +  FS+    G +    P L  +     Q  + A DG +     LT
Sbjct: 2021 SNENISYRILSSSKE--FSIDPKNGTIFTISPVLLLDTISTTQFLVEASDGGNPDLRALT 2078

Query: 2364 VL---VEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRD-SGANGHISYHLAS-- 2417
            ++   +ED+N+ AP F+   Y + L E    GS +++ S  D D +  N ++ Y + S  
Sbjct: 2079 LVEIGIEDMNNYAPEFTVKSYNLSLSEDALVGSTLVTFSNIDHDWTRENTYVEYSIISGN 2138

Query: 2418 PADGFSVDP---NNGTLFTIVGTVALGH----DGSGAVDVVLEARDHGAPGRAARATVHV 2470
              + F V+    ++   +  VG + L H    + S + ++V+ A D G P  ++ A + +
Sbjct: 2139 SQNNFHVETKFFHSEYPYKQVGYLVLLHSLDREASASHELVILASDSGCPPLSSTAVISI 2198

Query: 2471 QLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRV 2530
            Q+ D ND+ P+F+   Y   V E  P GS +  + A D D + SHA + Y+IISGN    
Sbjct: 2199 QVLDVNDNPPNFSSLSYHTHVKESTPLGSHITVVSANDRD-TGSHAEIIYNIISGNEKGH 2257

Query: 2531 FQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTV 2590
            F LE                 G L L++PLD+E +T++ LTV A+D  +    S   V V
Sbjct: 2258 FYLEEN--------------TGVLYLIKPLDYEKMTKFTLTVQASD-AEKKHFSFAVVFV 2302

Query: 2591 TVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSS------- 2643
            +VLD ND+ P F  +S+   VPE+ P+ + +  + A D D GP+G + +++ S       
Sbjct: 2303 SVLDDNDHAPQFMFSSFSCIVPENLPISSTICSINALDFDAGPYGELTYSIVSPCFLTHG 2362

Query: 2644 -GDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHFALAPVTIEVQDVNDH 2702
                  LF +D  +G +     LD E   ++ L VQA D   A  +L  V ++++ +++ 
Sbjct: 2363 MSYDHDLFLIDPLTGDIHAKQILDYENGNKYCLTVQAKDKGDATASLV-VWVDIEGIDEF 2421

Query: 2703 GPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNS 2762
             P F  +    ++ E      L+  + A D DAG  G + YSL  + P       F++N 
Sbjct: 2422 EPIFTQDQYFFTLPEKNKDRQLIGRVEASDADAGIDGVILYSLGTSSP------FFSVNK 2475

Query: 2763 STGE---LRA----RVPFDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYDPV 2812
            + G    +RA    +   + E T   +++  +  + +  AS TV V V+   E  P+
Sbjct: 2476 TNGNIYLIRALPLIKSQLNKEDTLEMKIIAHSPKSDSKFASCTVFVNVSFSSEGTPL 2532



 Score =  570 bits (1469), Expect = e-162
 Identities = 535/1871 (28%), Positives = 831/1871 (44%), Gaps = 171/1871 (9%)

Query: 69   PAGTAAPLMYFISAQEGSGV--GTDLAI--DEHSGVVRTAR-------------VLDREQ 111
            PAGT    +Y I+  +G+    GTD A   DE    V  +               LDRE 
Sbjct: 746  PAGT----IYVITWADGAAAFSGTDFAFSSDELQAFVLKSLFCELGEGELINWVALDREH 801

Query: 112  RDRYRFTAVTPD------GATVEVTVRVADINDHAPAFPQARAA----LQVPEHTAFGTR 161
            R  +  T +  D       AT+ V V V DIND+ P FPQ        ++V E       
Sbjct: 802  RGHHEMTVLVTDRGSPPRNATMAVYVSVTDINDNRPFFPQCLPGKELHVKVLEGQPVNML 861

Query: 162  YPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSHY 221
                 A+D D G      Y++S + + + F+++   G       E+  T  L  + R  Y
Sbjct: 862  VTTVFAKDPDEGNNAEVTYSVSSEDSSDHFKIDANNG-------EIRTTTILSYDYRPSY 914

Query: 222  MLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASD 281
             + + A D G PP + QA++++ ++ ++      +Q+  H ++ E+L P   +  + +SD
Sbjct: 915  RMSVIATDQGVPPLQGQAVVNIQVIPLSKGRAIMSQNIRHLIIPENLKPTKIMSLIKSSD 974

Query: 282  -ADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAH 340
                  NG + + I     + DG F ID+ TG L L + LD+E    +   V   D   +
Sbjct: 975  HLQQHYNGKLHFSIVA--DDKDGHFEIDSSTGDLFLSKELDYETTSHYLFRVITTDHSKN 1032

Query: 341  PELGSA-FVTVHVRDANDNQPSMT--VIFLSADGSPQVSEAAPPGQLVARISVSDPDDGD 397
              L S  F+++ V D ND+ PS    +I +S      V E  P G LV   +  D DDG 
Sbjct: 1033 LSLSSTVFLSIDVEDQNDHSPSFQDELIVIS------VEENVPIGTLVYVFNAKD-DDGS 1085

Query: 398  FAHVNV-----SLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSG---- 448
            F +  +     S   G   F +      +  V    RLDRE      L VTA+D      
Sbjct: 1086 FLNSRIQYYIESHNPGTNPFLIHPSFGTLVTVS---RLDRESIPTVILTVTASDQAVNVT 1142

Query: 449  SPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQV 508
               LR+  A ++ + DVND+ P F    +    + E    GS V  +TA DPD+G NG+V
Sbjct: 1143 DRRLRSLTAQIV-ILDVNDHNPTFIS--FPNAHVKEDVTVGSLVHHITAHDPDEGRNGKV 1199

Query: 509  TYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVAL 568
            TYS+  G     F +D +SG++TT   LDYE++ Q  L V+A D G P L+SS T++V +
Sbjct: 1200 TYSILSGNENMTFMLDESSGLLTTTCPLDYEMKTQHILTVLALDDGTPALSSSQTLTVTV 1259

Query: 569  QDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPP 628
             DVND  P F++  Y AS+ E   PG    +V A D DSG    L + +  G   +    
Sbjct: 1260 LDVNDEAPVFKQHLYEASVKENQNPGEFVTRVEALDRDSGVNSKLQFEIMPG---ASFEL 1316

Query: 629  FRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGG--GLKSMVYVKVFLSDENDNPPQFY 686
            F I++ +G+V TT  LDR+     F   V   DGG   L S   +   + DEND+ P+F 
Sbjct: 1317 FEINSDTGEVVTTTILDREI-QEVFTLRVLVRDGGFPSLSSTTTILCTVEDENDHAPEFI 1375

Query: 687  PREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAW 746
               Y   +     P   V  + A D D G++  + YHI+ GN+   FT++E SG L+   
Sbjct: 1376 VSSYDIEVLENQEP-EVVYTVLASDMDAGNNRAVEYHIIDGNTDECFTINEMSGELSTTR 1434

Query: 747  PLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPG 806
             L R   S   L I   D G         + + ++      P F  L Y  SV ED   G
Sbjct: 1435 ALDREQISNFTLVILCSDLGDPPRSSVIHLQVRVLDANDHSPSFPTLYYQSSVREDAEVG 1494

Query: 807  TSVGIVQAHNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGP-VLELEV 865
            T V ++ A +    L   T      +  G F++D +SG L+T   LDRE           
Sbjct: 1495 TVVLVLSAVDKDEGLNGQTEYFLTDEASGAFTIDPMSGTLKTSNTLDREARSQHTFSAVA 1554

Query: 866  RAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGV 925
            R  S          ++V + DVNDN P        V L P +        +RA D D G 
Sbjct: 1555 RDCSIQGSRSTTVIIKVYVTDVNDNDPVLEQNPFDVFLSPESPTNQTTVIVRADDLDLGP 1614

Query: 926  NSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLR 985
            N  V F+  A     F++D  TG ++  +       P   L+L+  D G P RT+     
Sbjct: 1615 NGTVVFS-FAETQSMFSIDKYTGEIQFQQNPSSEYFPIW-LQLKVTDQGIPARTT---TG 1669

Query: 986  VVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDG--GPITYHLAAEGASS 1043
            ++V  +    +   F+   Y+  +     AGT ++ V+A APD     + Y + +     
Sbjct: 1670 LLVIHMEGEDVKISFSHHLYKGLVTENCEAGTSIVTVKAFAPDSIQDSMKYSIFSGNEDG 1729

Query: 1044 PFGLEPQSGWLWVRAA--LDREAQ-ELYILKVMAVSGSKAELGQQTGTATVRVSILNQNE 1100
               L  +SG L V+    LD E + E+ ++ +   SG +A          V V I ++N+
Sbjct: 1730 VLSLCSKSGQLTVKEPKFLDFEVRNEVQLIVLAESSGHRA-------YCKVAVLIQDEND 1782

Query: 1101 HSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQT 1160
            +SP   +     +V+E+Q     V +VFATD DSG NG + YS+   +++ +AF+I   +
Sbjct: 1783 NSPCFEQSIYQASVSESQLYNAHVIQVFATDLDSGLNGLIEYSILSGNQE-EAFQIDALS 1841

Query: 1161 GEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGG 1220
            G +TT   LD E  SSY L+VQ  D G P  S T  + V V D+NDN+P FL +      
Sbjct: 1842 GVITTKAILDYELTSSYSLIVQATDKGMPRLSNTTVIKVQVTDINDNAPAFLPSEA---- 1897

Query: 1221 GLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTL---TGPGSELFSLHPHSGELLTAA 1277
               +++ +   PG +VT +   D D   N   +++    + PG++ F++  ++G ++   
Sbjct: 1898 ---VEITEDSLPGVIVTHVSVHDVD--LNSAFIFSFAKESNPGTK-FAIDQNTGVVVLVK 1951

Query: 1278 PLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVL 1337
             L   E   Y L +   D       A   L+V+VL    + + PP  ++           
Sbjct: 1952 TLDFEEMTEYELLIQISDSVHYTEGA---LVVRVLD---VNDNPPVFSQD--------FY 1997

Query: 1338 TVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAASGRLYLARPLDFE 1397
             VT  E +  G  + +++A +      ++Y ++  +     F++D  +G ++   P+   
Sbjct: 1998 QVTVPESIPVGYSVLTLSATDLESNENISYRILSSSK---EFSIDPKNGTIFTISPVLLL 2054

Query: 1398 AGPPWRALTVRAEGPGGAGARLLR-VQVQVQDENEHAPAFARDPLALALPENPEPGAALY 1456
                     V A   G    R L  V++ ++D N +AP F      L+L E+   G+ L 
Sbjct: 2055 DTISTTQFLVEASDGGNPDLRALTLVEIGIEDMNNYAPEFTVKSYNLSLSEDALVGSTLV 2114

Query: 1457 TFRASDADGPGPNSDVRYRLL---------------RQEPPVPALRLDARTGALSAPRGL 1501
            TF   D D    N+ V Y ++                 E P        + G L     L
Sbjct: 2115 TFSNIDHDWTRENTYVEYSIISGNSQNNFHVETKFFHSEYPY------KQVGYLVLLHSL 2168

Query: 1502 DRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPS-RVRLPEDQPP 1560
            DRE + +  L++ A+D   +     ++     + V D NDN P F+S S    + E  P 
Sbjct: 2169 DREASASHELVILASD---SGCPPLSSTAVISIQVLDVNDNPPNFSSLSYHTHVKESTPL 2225

Query: 1561 GPAALHVVARDPDLGEAARVSYRLASGGD-GHFRLHSSTGALSVVRPLDREQRAEHVLTV 1619
            G     V A D D G  A + Y + SG + GHF L  +TG L +++PLD E+  +  LTV
Sbjct: 2226 GSHITVVSANDRDTGSHAEIIYNIISGNEKGHFYLEENTGVLYLIKPLDYEKMTKFTLTV 2285

Query: 1620 VASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVG 1679
             ASD       +  V+ VSV D ND AP F    +S ++ EN P  +++ ++ A D D G
Sbjct: 2286 QASD-AEKKHFSFAVVFVSVLDDNDHAPQFMFSSFSCIVPENLPISSTICSINALDFDAG 2344

Query: 1680 ANGQVTYGGVS-----------SESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGS 1728
              G++TY  VS            + F +DP TG +   + LD E   +  LTV A+D+G 
Sbjct: 2345 PYGELTYSIVSPCFLTHGMSYDHDLFLIDPLTGDIHAKQILDYENGNKYCLTVQAKDKGD 2404

Query: 1729 PPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPE-GQDPQTLTMLRASDPDVGANGQLQY 1787
                  + V V +E  ++  P F        +PE  +D Q +  + ASD D G +G + Y
Sbjct: 2405 --ATASLVVWVDIEGIDEFEPIFTQDQYFFTLPEKNKDRQLIGRVEASDADAGIDGVILY 2462

Query: 1788 RILDGDPSGAFVLDLASGEFGTMRPL-----DREVEPAFQLRIEARDGGQPALSATLLLT 1842
             +  G  S  F ++  +G    +R L         E   +++I A      +  A+  + 
Sbjct: 2463 SL--GTSSPFFSVNKTNGNIYLIRALPLIKSQLNKEDTLEMKIIAHSPKSDSKFASCTVF 2520

Query: 1843 VTVLDANDHAP 1853
            V V  +++  P
Sbjct: 2521 VNVSFSSEGTP 2531



 Score =  566 bits (1459), Expect = e-160
 Identities = 592/2191 (27%), Positives = 945/2191 (43%), Gaps = 213/2191 (9%)

Query: 152  VPEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTG 211
            VPE +  GT    EP   ++        Y +S    G  F +  R G   T  P      
Sbjct: 390  VPEDSPIGTVKAREPLNSSEP-----IFYRISSGDLGGKFSIHPRLGTIRTRKP------ 438

Query: 212  ELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPG 271
             LD E +   +L ++A   GS P  +   +++T++D+ND+ PAF ++     +S++  PG
Sbjct: 439  -LDHETQPVVVLTVQA-QLGSAPACSSTEVNITVMDVNDNHPAFLRTSDEIRISQTTPPG 496

Query: 272  SPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELV 331
            + +    A D D+G NG + Y I    S   G F+ID   G+L L   L   ++R   L 
Sbjct: 497  TALYLARAEDRDSGRNGLIRYSI---ASPQPGVFAIDRALGVLFLNGSLGAGEQRELTLT 553

Query: 332  VQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEA-APPGQLVARISV 390
            ++A D G HP+     +TV V +  ++ PS T  F       +VSE+ +P  Q++   + 
Sbjct: 554  LRAEDQGVHPQAALLVLTV-VIEKREHSPSWT--FEHLVYQVEVSESLSPMTQMLQTQAH 610

Query: 391  SDPDDGDFAHVNVSLEGG--EGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSG 448
                    + +  SLE       F +      IYL    R+ D E    YN RV A    
Sbjct: 611  PLGPQRAASPLRYSLEPSVDSAMFGIRPYTGWIYL---RRQFDYESTQTYNFRVFAWIPE 667

Query: 449  SPPLR-AEAAFVLHVTDVNDNAPAF--DRQLYRPEPLPEVALPGSFVVRVTARDPDQGTN 505
               L+      ++ V D NDN+P F  D    + E  P   +P   + ++TA D D G N
Sbjct: 668  DGFLQNVSTTVIVRVWDENDNSPTFLHDVLFLKVEESP---VPQGVIGKITAIDMDSGKN 724

Query: 506  GQVTYSLAPGAHTHWFSIDPTSG------IITTA-------------------------- 533
            GQ+ Y L   +   +F ++P +G      +IT A                          
Sbjct: 725  GQLLYFLL--SDGKFFKMNPNTGPAGTIYVITWADGAAAFSGTDFAFSSDELQAFVLKSL 782

Query: 534  ------------ASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRT 581
                         +LD E     ++ V+ TD G PP  ++  V V++ D+NDN P F + 
Sbjct: 783  FCELGEGELINWVALDREHRGHHEMTVLVTDRGSPPRNATMAVYVSVTDINDNRPFFPQC 842

Query: 582  F----YNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGD 637
                  +  + EG         V A D D G    ++YS+ +      S  F+IDA++G+
Sbjct: 843  LPGKELHVKVLEGQPVNMLVTTVFAKDPDEGNNAEVTYSVSS---EDSSDHFKIDANNGE 899

Query: 638  VCTTRTLDRDQGPSSFDFTVTAVDGG--GLKSMVYVKVFLSDENDNPPQFYPREYAASIS 695
            + TT  L  D  P S+  +V A D G   L+    V +          Q  P     +I 
Sbjct: 900  IRTTTILSYDYRP-SYRMSVIATDQGVPPLQGQAVVNI----------QVIPLSKGRAIM 948

Query: 696  AQS----------PPGTAVLRLRAHDP-DQGSHGRLSYHILAGNSPPLFTLDEQSGLLTV 744
            +Q+           P   +  +++ D   Q  +G+L + I+A +    F +D  +G L +
Sbjct: 949  SQNIRHLIIPENLKPTKIMSLIKSSDHLQQHYNGKLHFSIVADDKDGHFEIDSSTGDLFL 1008

Query: 745  AWPLARRANSVVQLEIGAED-GGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDV 803
            +  L     S     +   D    L    +  + I +       P F+    V SV E+V
Sbjct: 1009 SKELDYETTSHYLFRVITTDHSKNLSLSSTVFLSIDVEDQNDHSPSFQDELIVISVEENV 1068

Query: 804  APGTSVGIVQAHNPPGRL--APVTLSLSGGDP-RGLFSLDAVSGLLQTLRPLDRELLGPV 860
              GT V +  A +  G    + +   +   +P    F +    G L T+  LDRE +  V
Sbjct: 1069 PIGTLVYVFNAKDDDGSFLNSRIQYYIESHNPGTNPFLIHPSFGTLVTVSRLDRESIPTV 1128

Query: 861  LELEVRAGSGVPPAFAVAR---VRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLR 917
            +     +   V       R    ++++ DVND++P F +  +  +    T  G+ ++ + 
Sbjct: 1129 ILTVTASDQAVNVTDRRLRSLTAQIVILDVNDHNPTFISFPNAHVKEDVTV-GSLVHHIT 1187

Query: 918  ALDPDSGVNSRVTFTLLAGGGG-AFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSP 976
            A DPD G N +VT+++L+G     F +D ++G +    PL       H L + A D G+P
Sbjct: 1188 AHDPDEGRNGKVTYSILSGNENMTFMLDESSGLLTTTCPLDYEMKTQHILTVLALDDGTP 1247

Query: 977  PRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGG---PIT 1033
              +S   L V V DV     AP F    Y   +      G  V +V+A   D G    + 
Sbjct: 1248 ALSSSQTLTVTVLDVNDE--APVFKQHLYEASVKENQNPGEFVTRVEALDRDSGVNSKLQ 1305

Query: 1034 YHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRV 1093
            + +    +   F +   +G +     LDRE QE++ L+V+   G    L   + T T+  
Sbjct: 1306 FEIMPGASFELFEINSDTGEVVTTTILDREIQEVFTLRVLVRDGGFPSL---SSTTTILC 1362

Query: 1094 SILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKA 1153
            ++ ++N+H+P        + V ENQ P   V  V A+D D+G N  + Y +   + D + 
Sbjct: 1363 TVEDENDHAPEFIVSSYDIEVLENQEPEV-VYTVLASDMDAGNNRAVEYHIIDGNTD-EC 1420

Query: 1154 FRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQ 1213
            F I+  +GE++T + LDREQ S++ L++   D G PPRS+   + V VLD ND+SP+F  
Sbjct: 1421 FTINEMSGELSTTRALDREQISNFTLVILCSDLGDPPRSSVIHLQVRVLDANDHSPSFPT 1480

Query: 1214 ASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHSGEL 1273
                +       V +    GT+V  L A D DEG NG   Y LT   S  F++ P SG L
Sbjct: 1481 LYYQS------SVREDAEVGTVVLVLSAVDKDEGLNGQTEYFLTDEASGAFTIDPMSGTL 1534

Query: 1274 LTAAPLIRAERPHYVLTLSAHD---QGSPPRSASLQLLV-QVLPSARLAEPPPDLAERDP 1329
             T+  L R  R  +  +  A D   QGS   +  +++ V  V  +  + E  P      P
Sbjct: 1535 KTSNTLDREARSQHTFSAVARDCSIQGSRSTTVIIKVYVTDVNDNDPVLEQNPFDVFLSP 1594

Query: 1330 AAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAASGRLY 1389
             +P      +  A+ L  G          P G    ++     A+ +  F++D  +G + 
Sbjct: 1595 ESPTNQTTVIVRADDLDLG----------PNGTVVFSF-----AETQSMFSIDKYTGEIQ 1639

Query: 1390 LARPLDFEAGPPWRALTVRAEG-PGGAGARLLRVQVQVQDENEHAPAFARDPLALALPEN 1448
              +    E  P W  L V  +G P      LL + ++ +D      +F+       + EN
Sbjct: 1640 FQQNPSSEYFPIWLQLKVTDQGIPARTTTGLLVIHMEGEDVK---ISFSHHLYKGLVTEN 1696

Query: 1449 PEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSA--PRGLDRETT 1506
             E G ++ T +A   D       ++Y +         L L +++G L+   P+ LD E  
Sbjct: 1697 CEAGTSIVTVKAFAPD--SIQDSMKYSIFSGNED-GVLSLCSKSGQLTVKEPKFLDFEVR 1753

Query: 1507 PALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVF-ASPSRVRLPEDQPPGPAAL 1565
              + L+V A       S    A     V + DENDN+P F  S  +  + E Q      +
Sbjct: 1754 NEVQLIVLA------ESSGHRAYCKVAVLIQDENDNSPCFEQSIYQASVSESQLYNAHVI 1807

Query: 1566 HVVARDPDLGEAARVSYRLASGG-DGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDH 1624
             V A D D G    + Y + SG  +  F++ + +G ++    LD E  + + L V A+D 
Sbjct: 1808 QVFATDLDSGLNGLIEYSILSGNQEEAFQIDALSGVITTKAILDYELTSSYSLIVQATDK 1867

Query: 1625 GSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQV 1684
            G P  S T V+ V V D+ND AP F   E +V + E++ PG  +  +   D D+ +    
Sbjct: 1868 GMPRLSNTTVIKVQVTDINDNAPAFLPSE-AVEITEDSLPGVIVTHVSVHDVDLNSAFIF 1926

Query: 1685 TYGGVSS--ESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVE 1742
            ++   S+    F++D +TGV+  ++ LD EE  E  L +   D       T   + V V 
Sbjct: 1927 SFAKESNPGTKFAIDQNTGVVVLVKTLDFEEMTEYELLIQISD---SVHYTEGALVVRVL 1983

Query: 1743 DENDHAPTFGSAHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILDGDPSGAFVLDL 1802
            D ND+ P F      + VPE   P   ++L  S  D+ +N  + YRIL    S  F +D 
Sbjct: 1984 DVNDNPPVFSQDFYQVTVPE-SIPVGYSVLTLSATDLESNENISYRILSS--SKEFSIDP 2040

Query: 1803 ASGEFGTMRP-LDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYS 1861
             +G   T+ P L  +     Q  +EA DGG P L A  L+ + + D N++AP F V +Y+
Sbjct: 2041 KNGTIFTISPVLLLDTISTTQFLVEASDGGNPDLRALTLVEIGIEDMNNYAPEFTVKSYN 2100

Query: 1862 VEVPEDVPAGTLLLQLQAHDPD-AGANGHVTYYLGAGTA-GAFLLE----------PSSG 1909
            + + ED   G+ L+     D D    N +V Y + +G +   F +E             G
Sbjct: 2101 LSLSEDALVGSTLVTFSNIDHDWTRENTYVEYSIISGNSQNNFHVETKFFHSEYPYKQVG 2160

Query: 1910 ELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRL 1969
             L    +LDRE   S+   + A D +   PLS+T  ++I V DVND+ P F +      +
Sbjct: 2161 YLVLLHSLDREASASHELVILASD-SGCPPLSSTAVISIQVLDVNDNPPNFSSLSYHTHV 2219

Query: 1970 PRPGPSFSTPTLALATLRAEDRDAGANASILYR-LAGTPPPGTTVDSYTGEIRVARSPVA 2028
                P  S  T+    + A DRD G++A I+Y  ++G       ++  TG + + + P+ 
Sbjct: 2220 KESTPLGSHITV----VSANDRDTGSHAEIIYNIISGNEKGHFYLEENTGVLYLIK-PLD 2274

Query: 2029 LGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIV 2088
                 +    V          +  V+ V +  + +  P+F  +S    + EN P  + I 
Sbjct: 2275 YEKMTKFTLTVQASDAEKKHFSFAVVFVSVLDDNDHAPQFMFSSFSCIVPENLPISSTIC 2334

Query: 2089 SPRAV-HAGGTNGPITYSILS--------GNEKGTFSIQPSTGAITVRSAEGLDFEVSPR 2139
            S  A+    G  G +TYSI+S          +   F I P TG I  +    LD+E   +
Sbjct: 2335 SINALDFDAGPYGELTYSIVSPCFLTHGMSYDHDLFLIDPLTGDIHAKQI--LDYENGNK 2392

Query: 2140 LRLVLQA-ESGGAFAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDL 2198
              L +QA + G A A  V+ + ++  ++  P F +  Y   LPE       + +VEA D 
Sbjct: 2393 YCLTVQAKDKGDATASLVVWVDIEGIDEFEPIFTQDQYFFTLPEKNKDRQLIGRVEASDA 2452

Query: 2199 DQGSGGQISYSLAASQPARGLFHVDPTTGTI 2229
            D G  G I YSL  S P    F V+ T G I
Sbjct: 2453 DAGIDGVILYSLGTSSP---FFSVNKTNGNI 2480



 Score =  551 bits (1421), Expect = e-156
 Identities = 634/2490 (25%), Positives = 1023/2490 (41%), Gaps = 266/2490 (10%)

Query: 94   IDEHSGVVRTARVLDREQR-------------DRYRFT--AVTPDGATVEVTVRV--ADI 136
            ID H G +  ++ +DRE+              D  R T  A+   G + +  VRV   D+
Sbjct: 111  IDPHDGQICVSQDIDRERDPATYDLLVEAKDGDEQRMTHLALVKGGLSAQAFVRVDLEDV 170

Query: 137  NDHAPAFPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETR 196
            ND+ P F  +     + + T  GT      A D D+G  GT  Y L        F +++ 
Sbjct: 171  NDNHPVFNPSTYVTSISDETQPGTEIINVLATDQDSGIYGTVAYELIPGNVSSLFTIDST 230

Query: 197  PGPDGTPVPEL-VVTGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAF 255
             G     V  L  V    D+E  +   + L          R +   +            F
Sbjct: 231  TGLYSPEVEILSAVNFSADKEVMNSLEMFLPLLRHFKKVERDEEAAEKKFEASRGWFMRF 290

Query: 256  NQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQ 315
               R+              L+V    A A    A  Y  N  +  G+G         ++ 
Sbjct: 291  KGRRH-----------LHYLKVQDEAASADGEAAARYVANLAKILGEG---------IIY 330

Query: 316  LERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHV-----RDANDNQPSMTVIFLSAD 370
            L  PL   +     L+V A+DGG    + +A VT+H+       A   +P  T +     
Sbjct: 331  LTLPLSHLESTTLSLMVSAQDGGGLTAVINADVTIHIFQTTLAPAEFERPKYTFLVYE-- 388

Query: 371  GSPQVSEAAPPGQLVAR--ISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVAR 428
                V E +P G + AR  ++ S+P         +S     G F++  +   +  +   +
Sbjct: 389  ---DVPEDSPIGTVKAREPLNSSEP-----IFYRISSGDLGGKFSIHPR---LGTIRTRK 437

Query: 429  RLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALP 488
             LD E +    L V A   GS P  +     + V DVNDN PAF R       + +   P
Sbjct: 438  PLDHETQPVVVLTVQA-QLGSAPACSSTEVNITVMDVNDNHPAFLRTSDEIR-ISQTTPP 495

Query: 489  GSFVVRVTARDPDQGTNGQVTYSLA---PGAHTHWFSIDPTSGIITTAASLDYELEPQPQ 545
            G+ +    A D D G NG + YS+A   PG     F+ID   G++    SL    + +  
Sbjct: 496  GTALYLARAEDRDSGRNGLIRYSIASPQPGV----FAIDRALGVLFLNGSLGAGEQRELT 551

Query: 546  LIVVATDGGLPPLASSATVSVALQDVNDNEPQ--FQRTFYNASLPEGTQPGTCFLQVTAT 603
            L + A D G+ P A+   ++V ++   ++ P   F+   Y   + E   P T  LQ  A 
Sbjct: 552  LTLRAEDQGVHPQAALLVLTVVIEK-REHSPSWTFEHLVYQVEVSESLSPMTQMLQTQAH 610

Query: 604  DADSGP---FGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTA- 659
                GP      L YSL   + S+    F I  ++G +   R  D  +   +++F V A 
Sbjct: 611  PL--GPQRAASPLRYSLEPSVDSA---MFGIRPYTGWIYLRRQFDY-ESTQTYNFRVFAW 664

Query: 660  --VDG--GGLKSMVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQG 715
               DG    + + V V+V+  DENDN P F        +     P   + ++ A D D G
Sbjct: 665  IPEDGFLQNVSTTVIVRVW--DENDNSPTFLHDVLFLKVEESPVPQGVIGKITAIDMDSG 722

Query: 716  SHGRLSYHILAG--------NSPP---------------------LFTLDEQSGLL---- 742
             +G+L Y +L+         N+ P                      F+ DE    +    
Sbjct: 723  KNGQLLYFLLSDGKFFKMNPNTGPAGTIYVITWADGAAAFSGTDFAFSSDELQAFVLKSL 782

Query: 743  --------TVAW-PLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQL 793
                     + W  L R      ++ +   D G      +  V +S+       P F Q 
Sbjct: 783  FCELGEGELINWVALDREHRGHHEMTVLVTDRGSPPRNATMAVYVSVTDINDNRPFFPQC 842

Query: 794  QYVFSVPEDVAPGTSVGI----VQAHNP-PGRLAPVTLSLSGGDPRGLFSLDAVSGLLQT 848
                 +   V  G  V +    V A +P  G  A VT S+S  D    F +DA +G ++T
Sbjct: 843  LPGKELHVKVLEGQPVNMLVTTVFAKDPDEGNNAEVTYSVSSEDSSDHFKIDANNGEIRT 902

Query: 849  LRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTA 908
               L  +         +    GVPP    A V + +  ++            +++P N  
Sbjct: 903  TTILSYDYRPSYRMSVIATDQGVPPLQGQAVVNIQVIPLSKGRAIMSQNIRHLIIPENLK 962

Query: 909  PGTPIYTLRALDP-DSGVNSRVTFTLLAGG-GGAFTVDPTTGHVRLMRPLGPSGGPAHEL 966
            P   +  +++ D      N ++ F+++A    G F +D +TG + L +          EL
Sbjct: 963  PTKIMSLIKSSDHLQQHYNGKLHFSIVADDKDGHFEIDSSTGDLFLSK----------EL 1012

Query: 967  ELEARDGGSPPRTSHFRLRVVVQD-----------------VGTRGLAPRFNSPTYRVDL 1009
            + E         TSH+  RV+  D                       +P F      + +
Sbjct: 1013 DYET--------TSHYLFRVITTDHSKNLSLSSTVFLSIDVEDQNDHSPSFQDELIVISV 1064

Query: 1010 PSGTTAGTQVLQVQAQAPDG----GPITYHLAAEG-ASSPFGLEPQSGWLWVRAALDREA 1064
                  GT V    A+  DG      I Y++ +    ++PF + P  G L   + LDRE+
Sbjct: 1065 EENVPIGTLVYVFNAKDDDGSFLNSRIQYYIESHNPGTNPFLIHPSFGTLVTVSRLDRES 1124

Query: 1065 QELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSV 1124
                IL V A   +     ++  + T ++ IL+ N+H+P     P    V E+   G+ V
Sbjct: 1125 IPTVILTVTASDQAVNVTDRRLRSLTAQIVILDVNDHNPTFISFPN-AHVKEDVTVGSLV 1183

Query: 1125 GRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQ 1184
              + A D D G NG++TYS+     ++  F +   +G +TT   LD E ++ + L V   
Sbjct: 1184 HHITAHDPDEGRNGKVTYSILS-GNENMTFMLDESSGLLTTTCPLDYEMKTQHILTVLAL 1242

Query: 1185 DGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDP 1244
            D G+P  S++ T+ V VLD+ND +P F Q    A       V +   PG  VT ++A D 
Sbjct: 1243 DDGTPALSSSQTLTVTVLDVNDEAPVFKQHLYEA------SVKENQNPGEFVTRVEALDR 1296

Query: 1245 DEGENGTILY-TLTGPGSELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSA 1303
            D G N  + +  + G   ELF ++  +GE++T   L R  +  + L +   D G P  S+
Sbjct: 1297 DSGVNSKLQFEIMPGASFELFEINSDTGEVVTTTILDREIQEVFTLRVLVRDGGFPSLSS 1356

Query: 1304 SLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLT--VTAAEGLRPGSLLGSVAAPEPAG 1361
            +  +L  V              + +  AP  +V +  +   E   P  +   +A+   AG
Sbjct: 1357 TTTILCTV-------------EDENDHAPEFIVSSYDIEVLENQEPEVVYTVLASDMDAG 1403

Query: 1362 VG-ALTYTLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLL 1420
               A+ Y ++ G   E  F ++  SG L   R LD E    +  + + ++      + ++
Sbjct: 1404 NNRAVEYHIIDGNTDE-CFTINEMSGELSTTRALDREQISNFTLVILCSDLGDPPRSSVI 1462

Query: 1421 RVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQE 1480
             +QV+V D N+H+P+F       ++ E+ E G  +    A D D  G N    Y L   +
Sbjct: 1463 HLQVRVLDANDHSPSFPTLYYQSSVREDAEVGTVVLVLSAVDKD-EGLNGQTEYFL--TD 1519

Query: 1481 PPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDEN 1540
                A  +D  +G L     LDRE          A D     S  R+  V  +V+VTD N
Sbjct: 1520 EASGAFTIDPMSGTLKTSNTLDREARSQHTFSAVARDCSIQGS--RSTTVIIKVYVTDVN 1577

Query: 1541 DNAPVF-ASPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGHFRLHSSTG 1599
            DN PV   +P  V L  + P     + V A D DLG    V +  A      F +   TG
Sbjct: 1578 DNDPVLEQNPFDVFLSPESPTNQTTVIVRADDLDLGPNGTVVFSFAE-TQSMFSIDKYTG 1636

Query: 1600 ALSVVRPLDREQRAEHV---LTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSV 1656
             +       +   +E+    L +  +D G P R+ T +L + + +  D   +F    Y  
Sbjct: 1637 EIQ----FQQNPSSEYFPIWLQLKVTDQGIPARTTTGLLVIHM-EGEDVKISFSHHLYKG 1691

Query: 1657 LLRENNPPGTSLLTLRATDPDVGANGQ--VTYGGVSSESFSLDPDTGVLTTL--RALDRE 1712
            L+ EN   GTS++T++A  PD   +      + G      SL   +G LT    + LD E
Sbjct: 1692 LVTENCEAGTSIVTVKAFAPDSIQDSMKYSIFSGNEDGVLSLCSKSGQLTVKEPKFLDFE 1751

Query: 1713 EQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQT-LTM 1771
             + E+ L V A+  G      +  V V ++DEND++P F  +     V E Q     +  
Sbjct: 1752 VRNEVQLIVLAESSG---HRAYCKVAVLIQDENDNSPCFEQSIYQASVSESQLYNAHVIQ 1808

Query: 1772 LRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGG 1831
            + A+D D G NG ++Y IL G+   AF +D  SG   T   LD E+  ++ L ++A D G
Sbjct: 1809 VFATDLDSGLNGLIEYSILSGNQEEAFQIDALSGVITTKAILDYELTSSYSLIVQATDKG 1868

Query: 1832 QPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVT 1891
             P LS T ++ V V D ND+APAF +P+ +VE+ ED   G ++  +  HD D  +    +
Sbjct: 1869 MPRLSNTTVIKVQVTDINDNAPAF-LPSEAVEITEDSLPGVIVTHVSVHDVDLNSAFIFS 1927

Query: 1892 YYLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVR 1951
            +   +     F ++ ++G +     LD E+   Y   +   D        T  ++ + V 
Sbjct: 1928 FAKESNPGTKFAIDQNTGVVVLVKTLDFEEMTEYELLIQISDSVH----YTEGALVVRVL 1983

Query: 1952 DVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGT 2011
            DVND+ P F     ++ +P   P      +  + L     D  +N +I YR+  +     
Sbjct: 1984 DVNDNPPVFSQDFYQVTVPESIP------VGYSVLTLSATDLESNENISYRILSSSKE-F 2036

Query: 2012 TVDSYTGEIRVARSPVALGPRDRVLFIV-ATDLGRPARSATGVIIVGLQGEAERGPRFPR 2070
            ++D   G I      + L       F+V A+D G P   A  ++ +G++      P F  
Sbjct: 2037 SIDPKNGTIFTISPVLLLDTISTTQFLVEASDGGNPDLRALTLVEIGIEDMNNYAPEFTV 2096

Query: 2071 ASSEATIRENAPPGTPIVSPRAVHAGGT--NGPITYSILSGNEKGTFSIQ--------PS 2120
             S   ++ E+A  G+ +V+   +    T  N  + YSI+SGN +  F ++        P 
Sbjct: 2097 KSYNLSLSEDALVGSTLVTFSNIDHDWTRENTYVEYSIISGNSQNNFHVETKFFHSEYPY 2156

Query: 2121 TGAITVRSAEGLDFEVSPRLRLVLQAESGGA---FAFTVLTLTLQDANDNAPRFLRPHYV 2177
                 +     LD E S    LV+ A   G     +  V+++ + D NDN P F    Y 
Sbjct: 2157 KQVGYLVLLHSLDREASASHELVILASDSGCPPLSSTAVISIQVLDVNDNPPNFSSLSYH 2216

Query: 2178 AFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDR 2237
              + ES PL   +  V A+D D GS  +I Y++ +    +G F+++  TG +     LD 
Sbjct: 2217 THVKESTPLGSHITVVSANDRDTGSHAEIIYNIISGN-EKGHFYLEENTGVLYLIKPLDY 2275

Query: 2238 EIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIP-QPWELRVSEDALLGSEIA 2296
            E   +  L + A+D         A + V V+D ND+ P      +   V E+  + S I 
Sbjct: 2276 EKMTKFTLTVQASD-AEKKHFSFAVVFVSVLDDNDHAPQFMFSSFSCIVPENLPISSTIC 2334

Query: 2297 QVTGNDVDSGP---VLWYVLSP-------SGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQ 2346
             +   D D+GP   + + ++SP       S   D F +    G +     LD+E  ++Y 
Sbjct: 2335 SINALDFDAGPYGELTYSIVSPCFLTHGMSYDHDLFLIDPLTGDIHAKQILDYENGNKYC 2394

Query: 2347 LQLLAHDGPHEGRANLTVLV--EDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRD 2404
            L + A D   +  A+L V V  E +++  P F+Q  Y   L E       I  V A+D D
Sbjct: 2395 LTVQAKD-KGDATASLVVWVDIEGIDEFEPIFTQDQYFFTLPEKNKDRQLIGRVEASDAD 2453

Query: 2405 SGANGHISYHLASPADGFSVDPNNGTLFTI 2434
            +G +G I Y L + +  FSV+  NG ++ I
Sbjct: 2454 AGIDGVILYSLGTSSPFFSVNKTNGNIYLI 2483


>gi|165932370 FAT tumor suppressor homolog 4 [Homo sapiens]
          Length = 4981

 Score = 1152 bits (2981), Expect = 0.0
 Identities = 895/2945 (30%), Positives = 1397/2945 (47%), Gaps = 194/2945 (6%)

Query: 41   WGQAGSLDLQIDEEQPAGTLI-------GDISAGLPAGTAAPLMYFISAQEGSGVGTDLA 93
            + Q    D+ + E  P GT +       GD+      GT        S QE         
Sbjct: 582  FSQPEGYDVSVVENAPTGTELLMLRATDGDLGDN---GTVR-----FSLQEAETDRRSFR 633

Query: 94   IDEHSGVVRTARVLDREQRDRYRFTAVT------PDGATVEVTVRVADINDHAPAFPQAR 147
            +D  SG + T   LDRE++  Y    +       P  +   + V + DIND++P F   +
Sbjct: 634  LDPVSGRLSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQ 693

Query: 148  AALQVPEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPEL 207
                + E+   G+      A D D G  GT  Y++S  G    F++  + G   T +   
Sbjct: 694  YFAHIKENEPGGSYITTVSATDPDLGTNGTVKYSISA-GDRSRFQVNAQSGVISTRMA-- 750

Query: 208  VVTGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSES 267
                 LDRE ++ Y LQ+ A DGG+     QA++ +T+LD  D+ P F+Q  Y  VV E+
Sbjct: 751  -----LDREEKTAYQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQVAYSFVVFEN 805

Query: 268  LAPGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRV 327
            +A G  V  V AS  D  +N  ++Y I     +G   F+I+  TG L     +D E++  
Sbjct: 806  VALGYHVGSVSASTMD--LNSNISYLITTGDQKG--MFAINQVTGQLTTANVIDREEQSF 861

Query: 328  HELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVAR 387
            ++L V A  G      G   V + V+D NDN P     FL A  S  V E    G  + +
Sbjct: 862  YQLKVVASGGTV---TGDTMVNITVKDLNDNSPH----FLQAIESVNVVENWQAGHSIFQ 914

Query: 388  ISVSDPDDGDFAHVNVSL-EGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATD 446
                DPD+G    V  SL +  +  FA++ ++  I L+     LD     +Y + + A+D
Sbjct: 915  AKAVDPDEGVNGMVLYSLKQNPKNLFAINEKNGTISLL---GPLD-VHAGSYQIEILASD 970

Query: 447  SGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNG 506
             G P L +     ++V DVNDN+P FD+  Y    L E     S   +V A D D G NG
Sbjct: 971  MGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVT-LSESEPVNSRFFKVQASDKDSGANG 1029

Query: 507  QVTYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSV 566
            ++ Y++A G     F I P  G +   + LD EL+ +  L+VVA+D  + PL+++  V+V
Sbjct: 1030 EIAYTIAEGNTGDAFGIFP-DGQLYIKSELDRELQDRYVLMVVASDRAVEPLSATVNVTV 1088

Query: 567  ALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGS 626
             L+DVNDN P F  T Y     E  + G+   +V+A D D GP G + YS          
Sbjct: 1089 ILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSF-----EMVQ 1143

Query: 627  PPFRIDAHSGDVCTTRTLDRD-----QGPSSFDFTVTAVDGG---GLKSMVYVKVFLSDE 678
            P F + A SG++  T   DR+     +G + F FTV A D G    LK    V V++ D 
Sbjct: 1144 PDFELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDI 1203

Query: 679  NDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQ 738
            NDN P+F    Y A+IS  +   T VLR+ A D D+G++G + Y I+ GN    F +D  
Sbjct: 1204 NDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFAIDST 1263

Query: 739  SGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFS 798
            SG +T+   L   A     L I A D G +    +  ++I I+      P F +      
Sbjct: 1264 SGQVTLIGKLDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVD 1323

Query: 799  VPEDVAPGTSVGIVQA-HNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELL 857
            V E++  G  V  V A  +  G  A +  S++G +  G FS+   +G +   + LD E  
Sbjct: 1324 VLENMRIGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTGSIFLAKKLDFETQ 1383

Query: 858  GPVLELEVRA-GSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTL 916
              + +L + A   G PP  +   V + + D NDN P+FP  +    +  N   GT + ++
Sbjct: 1384 S-LYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVISV 1442

Query: 917  RALDPDSGVNSRVTFTLLAG--GGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGG 974
             A DPD+ +N ++++T++     G  FT+D   G +     +        EL ++A D  
Sbjct: 1443 TAHDPDADINGQLSYTIIQQMPRGNHFTIDEVKGTIYTNAEIDREFANLFELTVKANDQA 1502

Query: 975  SPPRTSHFRLR---VVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPD--- 1028
             P  T  + L+   ++V D+      P F S       PS    G+ +  + A  PD   
Sbjct: 1503 VPIETRRYALKNVTILVTDLNDN--VPMFISQNALAADPSAVI-GSVLTTIMAADPDEGA 1559

Query: 1029 GGPITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGT 1088
             G I Y +   G +  F ++  SG L V +AL   +Q +Y L V A      +LG +   
Sbjct: 1560 NGEIEYEII-NGDTDTFIVDRYSGDLRVASALV-PSQLIYNLIVSAT-----DLGPERRK 1612

Query: 1089 ATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLS 1148
            +T  ++I+ Q    P  ++      + E +P GT+V  + A     G    + Y +  + 
Sbjct: 1613 STTELTIILQGLDGPVFTQPKYITILKEGEPIGTNVISIEAAS-PRGSEAPVEYYIVSVR 1671

Query: 1149 EDSKA----FRIHPQTGEVTTLQTLDREQQSSYQLL--VQVQDGGSPPRSTTGTVHVAVL 1202
             + K     F I   TG + T   LDREQ +   L+    ++   + PR+    V + + 
Sbjct: 1672 CEEKTVGRLFTIGRHTGIIQTAAILDREQGACLYLVDVYAIEKSTAFPRTQRAEVEITLQ 1731

Query: 1203 DLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSE 1262
            D+NDN P F          L + V + +  G+ +  L A D DEG N  + YT+     +
Sbjct: 1732 DINDNPPVFPTDM------LDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISGADD 1785

Query: 1263 LFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPP 1322
             F + P SG+L+    L R  R  Y L + A D     +S+ +++ + V           
Sbjct: 1786 SFRIDPESGDLIATRRLDRERRSKYSLLVRADDG---LQSSDMRINITV----------S 1832

Query: 1323 DLAERDPAAPVPVVLTVTAAEGLRPGSLLGSV-AAPEPAGV-GALTYTLVGGADPEGTFA 1380
            D+ +  P    PV  +    E   PGSL+ ++ A  + +GV G +TY +V   D +G F 
Sbjct: 1833 DVNDHTPKFSRPVY-SFDIPEDTIPGSLVAAILATDDDSGVNGEITY-IVNEDDEDGIFF 1890

Query: 1381 LDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDP 1440
            L+  +G   L R LD+E    +  LTVRAE  GG     +RV   + D N++ P F+ + 
Sbjct: 1891 LNPITGVFNLTRLLDYEV-QQYYILTVRAED-GGGQFTTIRVYFNILDVNDNPPIFSLNS 1948

Query: 1441 LALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRG 1500
             + +L EN   G+ +  F  +DAD  G NS + Y +   +  +    +D + G L   + 
Sbjct: 1949 YSTSLMENLPVGSTVLVFNVTDADD-GINSQLTYSIASGDS-LGQFTVD-KNGVLKVLKA 2005

Query: 1501 LDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQPP 1560
            LDRE+     L+V+  D P   + R  +     + + D NDN P F SP    +PE+ P 
Sbjct: 2006 LDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTYIPENTPI 2065

Query: 1561 GPAALHVVARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVV 1620
                    A DPD G  + + Y L +     F + +  G + +   LDRE+ + + LTVV
Sbjct: 2066 DTVVFKAQATDPDSGPNSYIEYTLLNPLGNKFSIGTIDGEVRLTGELDREEVSNYTLTVV 2125

Query: 1621 ASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGA 1680
            A+D G P  S++  + V V D+ND  P F Q  Y V + EN   GT ++ + A D D G 
Sbjct: 2126 ATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGT 2185

Query: 1681 NGQVTYG---GVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTV 1737
            NGQV YG   G +++ F +D  TG +T  + LDRE+    +LTV A DRGS P+    TV
Sbjct: 2186 NGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTV 2245

Query: 1738 RVAVEDENDHAPTFGSAHLSLEVPE--GQDPQTLTMLRASDPDVGANGQLQYRILDGDPS 1795
             + + D ND  P F  +  S+ VPE  G  P+T+  + A D D G+N +L Y +  G+  
Sbjct: 2246 SIVLLDINDFVPVFELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNED 2305

Query: 1796 GAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAF 1855
             AF L  ASGE G  + LDRE +  F L I A D G PAL+ T  + V V D ND+ P F
Sbjct: 2306 NAFTLS-ASGELGVTQSLDRETKERFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTF 2364

Query: 1856 PVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGELRTAA 1915
               AY   +PED P GT +L + A D DA  N  +      G    F + PS+G++ T+A
Sbjct: 2365 ASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVIRI---IGGNSQFTINPSTGQIITSA 2421

Query: 1916 ALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPS 1975
             LDRE   +YT  V   D  +  PLS++ SV +TV DVND+ P F   P    +P P   
Sbjct: 2422 LLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSP--- 2478

Query: 1976 FSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRV 2035
             + P   +  +   D D G N+ + Y L+G       +D   G I +A  P+  G  +  
Sbjct: 2479 -TLPGSFVFAVTVTDADIGPNSELHYSLSGRNSEKFHIDPLRGAI-MAAGPLN-GASEVT 2535

Query: 2036 LFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRA-SSEATIR--ENAPPGTPIVSPRA 2092
              +   D G   ++ +  + V    +A+    FP+  + E T    EN P  + + +   
Sbjct: 2536 FSVHVKDGGSFPKTDSTTVTVRFVNKAD----FPKVRAKEQTFMFPENQPVSSLVTTITG 2591

Query: 2093 VHAGGTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAF 2152
                G   P++Y I SGN   TF I   TG +++  ++ LDFE   +  + ++A  GG  
Sbjct: 2592 SSLRGE--PMSYYIASGNLGNTFQIDQLTGQVSI--SQPLDFEKIQKYVVWIEARDGGFP 2647

Query: 2153 AFT---VLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYS 2209
             F+    L +T+ D NDNAP F    +++ + E+      +L V A D D G  GQ+ Y 
Sbjct: 2648 PFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLS-PRKILTVSAMDKDSGPNGQLDYE 2706

Query: 2210 LAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVID 2269
            +         F ++  TG I +   LDRE  +   L + ++D+GSP+   S  + + ++D
Sbjct: 2707 IVNGN-MENSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMINILD 2765

Query: 2270 TNDNRPTIPQPWELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDPFSVGRYGG 2329
             NDN P   Q +   V E++ LG  + +VT +D D G       S      PF++    G
Sbjct: 2766 ENDNAPRFSQIFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYSIMDASLPFTINPSTG 2825

Query: 2330 RVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHT 2389
             + ++ PL+ E  DRY++++ AHD       ++T+ V D+NDNAP FS++ Y +   E T
Sbjct: 2826 DIVISRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELT 2885

Query: 2390 PPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSGAVD 2449
              GS +  V ATD D G+NG + Y + S ++ F ++   G +F           G   V+
Sbjct: 2886 EIGSKVTQVFATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQILKYQNVTGFSNVN 2945

Query: 2450 V-----VLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTL 2504
            +     ++ + D G P   +  TV + + D ND+AP F  S Y   VT+++  G+ L+ +
Sbjct: 2946 INRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRV 3005

Query: 2505 EATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFES 2564
             A D      ++ V+Y I + N    F+L+                 G + +   L  + 
Sbjct: 3006 TAIDDKDFGLNSEVEYFISNDNHLGKFKLD--------------NDTGWISVASSLISDL 3051

Query: 2565 LTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHV 2624
               + +TV A D+G PP SS   V +TV + N + P F+++    T+PE   +G+ +  V
Sbjct: 3052 NQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTV 3111

Query: 2625 EASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPAG 2684
             A D D   +GL+++++SSG+  G+F ++ S+G L LA ALD E   +H++ + A D   
Sbjct: 3112 SARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGW 3171

Query: 2685 -AHFALAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRY 2743
             A      VT+ V DVND+ P F  +    +V EN P GT V  L+A D D+G    + Y
Sbjct: 3172 VARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAY 3231

Query: 2744 SLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAADAGN--LSASVTVSV 2801
            ++  +       + F ++ +TG +  +   D+E  +S+ L V A +  +    +  TV++
Sbjct: 3232 TVQSS-----DSDLFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNI 3286

Query: 2802 LVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSS--PYF 2859
             + G +EY P F++  ++F++ E A +G  +G V A+D D G DG V Y +  +S    F
Sbjct: 3287 QLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGF 3346

Query: 2860 GINQTTGALYLRVDSRAPGSGTATSGGGGRTRREAPRELRLEVIAR--GPLPGSRSATVP 2917
             IN+ TG +Y+                 G   RE    + L+V+A+  G + G+    V 
Sbjct: 3347 QINKKTGQIYV----------------SGILDREKEERVSLKVLAKNFGSIRGADIDEVT 3390

Query: 2918 VTVDI 2922
            V V +
Sbjct: 3391 VNVTV 3395



 Score = 1116 bits (2886), Expect = 0.0
 Identities = 916/2936 (31%), Positives = 1389/2936 (47%), Gaps = 188/2936 (6%)

Query: 12   PGMKSPRPHLLLPLL----LLLLLLLGAGVPG-AW--GQAGSLDLQIDEEQPAGTLIGDI 64
            P   + RP L L  L    LL +  L + +PG AW  G       Q+ EEQP GTL+G I
Sbjct: 5    PDRATGRPWLPLHTLSVSQLLRVFWLLSLLPGQAWVHGAEPRQVFQVLEEQPPGTLVGTI 64

Query: 65   SAGLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDREQRDRYRFTAVTPDG 124
                   T     Y +S           AI+  +G + T   +DRE         V    
Sbjct: 65   Q------TRPGFTYRLSESHAL-----FAINSSTGALYTTSTIDRESLPSDVINLVVLSS 113

Query: 125  ATV---EVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGYA 181
            A     EV V V D+ND+AP FP     +   E ++ G +  L+ A D+D G  G    +
Sbjct: 114  APTYPTEVRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDTATDSDIGSNGVDHRS 173

Query: 182  ---LSGDGAGETFRLETRPGPDGTPV-PELVVTGELDRENRSHYMLQLEAYDGGSPPRRA 237
               + G+ AG  FRL+    P G      LV  G LDRE    Y L +E  D G P RR 
Sbjct: 174  YRIIRGNEAGR-FRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRG 232

Query: 238  QALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRR 297
               ++VT+ DIND+ P F  S Y A V E    GS VLQV A+DAD G N  + Y   R 
Sbjct: 233  YLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRY---RL 289

Query: 298  QSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDAND 357
            Q EG  PF +D  TGL+ +  PLDFE RR + L VQA D G     G A   + + D ND
Sbjct: 290  QDEGT-PFQMDPETGLITVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVND 348

Query: 358  NQPSMTVIFLSADGS-PQVSEAAPPGQLVARISVSDPDD-GDFAHVNVSLEGG--EGHFA 413
            N P +   +  A      V E A  G +VA ++V+D D      +++V + GG  + HF 
Sbjct: 349  NDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFE 408

Query: 414  L-STQDSVIYLVCVARRLDREERDAYNLRVTATDS-GSPPLRA------EAAFVLHVTDV 465
            + S++   + L+ VA  LDRE   +YNL V+ +D+ G+PP  A       A+ V+ V D+
Sbjct: 409  VQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDI 468

Query: 466  NDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDP 525
            ND+ P F +Q+YR   L E A PGS+V  ++A D D G N  + YS+  G    WF I  
Sbjct: 469  NDHPPVFSQQVYRVN-LSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLGWFHISE 527

Query: 526  TSGIITTAAS--LDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQF-QRTF 582
             SG++TT +S  LD EL  Q  L + A D G+ P  S A + V L DVND +P F Q   
Sbjct: 528  HSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEG 587

Query: 583  YNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTR 642
            Y+ S+ E    GT  L + ATD D G  G + +SL      +    FR+D  SG + T  
Sbjct: 588  YDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQE--AETDRRSFRLDPVSGRLSTIS 645

Query: 643  TLDRDQGPSSFDFTVTAVDGGG--LKSMVYVKVFLSDENDNPPQFYPREYAASISAQSPP 700
            +LDR++  + +   V A D G     SM  + V L D NDN P FYP +Y A I    P 
Sbjct: 646  SLDREE-QAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPG 704

Query: 701  GTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEI 760
            G+ +  + A DPD G++G + Y I AG+    F ++ QSG+++    L R   +  QL+I
Sbjct: 705  GSYITTVSATDPDLGTNGTVKYSISAGDR-SRFQVNAQSGVISTRMALDREEKTAYQLQI 763

Query: 761  GAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPPGR 820
             A DGG LQ+   A V I+++     PP+F Q+ Y F V E+VA G  VG V A +    
Sbjct: 764  VATDGGNLQSPNQAIVTITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSA-STMDL 822

Query: 821  LAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGPVLELEVRAGSGVPPAFAVARV 880
             + ++  ++ GD +G+F+++ V+G L T   +DRE      +L+V A  G      +  V
Sbjct: 823  NSNISYLITTGDQKGMFAINQVTGQLTTANVIDREEQS-FYQLKVVASGGTVTGDTM--V 879

Query: 881  RVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGA 940
             + + D+NDNSP F    ++V +  N   G  I+  +A+DPD GVN  V ++L       
Sbjct: 880  NITVKDLNDNSPHFLQAIESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQNPKNL 939

Query: 941  FTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRF 1000
            F ++   G + L+ PL    G ++++E+ A D G P  +S   L V V DV     +P F
Sbjct: 940  FAINEKNGTISLLGPLDVHAG-SYQIEILASDMGVPQLSSSVILTVYVHDVNDN--SPVF 996

Query: 1001 NSPTYRVDLPSGTTAGTQVLQVQAQAPD---GGPITYHLAAEGASSPFGLEPQSGWLWVR 1057
            +  +Y V L       ++  +VQA   D    G I Y +A       FG+ P  G L+++
Sbjct: 997  DQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGDAFGIFP-DGQLYIK 1055

Query: 1058 AALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAEN 1117
            + LDRE Q+ Y+L V+A   S   +   + T  V V + + N++ P  +         E 
Sbjct: 1056 SELDRELQDRYVLMVVA---SDRAVEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEE 1112

Query: 1118 QPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQ---- 1173
            Q  G+ VG+V A D+D GPNG + YS + +  D   F +H  +GE+T     DRE     
Sbjct: 1113 QRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPD---FELHAISGEITNTHQFDRESLMRR 1169

Query: 1174 --QSSYQLLVQVQDGGSP-PRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRV 1230
               + +   V   D G P P     TVHV + D+NDN+P FL+    A       + +  
Sbjct: 1170 RGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQA------TISESA 1223

Query: 1231 PPGTLVTTLQAKDPDEGENGTILYT-LTGPGSELFSLHPHSGELLTAAPLIRAERPHYVL 1289
               T V  + A D DEG NG I Y+ + G     F++   SG++     L     P Y L
Sbjct: 1224 ANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFAIDSTSGQVTLIGKLDYEATPAYSL 1283

Query: 1290 TLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGS 1349
             + A D G+ P +++  L + +L          D  +  P+ P    L V   E +R G 
Sbjct: 1284 VIQAVDSGTIPLNSTCTLNIDIL----------DENDNTPSFP-KSTLFVDVLENMRIGE 1332

Query: 1350 LLGSVAAPE-PAGVGALTYTLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALTVR 1408
            L+ SV A +  +G  A  Y  + G +  GTF++   +G ++LA+ LDFE    ++ L + 
Sbjct: 1333 LVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTGSIFLAKKLDFETQSLYK-LNIT 1391

Query: 1409 AEGPG-GAGARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPG 1467
            A+  G    +  + V + V+D N++ P+F    +  ++ EN   G ++ +  A D D   
Sbjct: 1392 AKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVISVTAHDPDA-D 1450

Query: 1468 PNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRA 1527
             N  + Y +++Q P      +D   G +     +DRE      L V+A D+      RR 
Sbjct: 1451 INGQLSYTIIQQMPRGNHFTIDEVKGTIYTNAEIDREFANLFELTVKANDQAVPIETRRY 1510

Query: 1528 ARVSARVFVTDENDNAPVFASPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASG 1587
            A  +  + VTD NDN P+F S + +        G     ++A DPD G    + Y + +G
Sbjct: 1511 ALKNVTILVTDLNDNVPMFISQNALAADPSAVIGSVLTTIMAADPDEGANGEIEYEIING 1570

Query: 1588 GDGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAP 1647
                F +   +G L V   L   Q   + L V A+D G   R +T  LT+ +  +  + P
Sbjct: 1571 DTDTFIVDRYSGDLRVASALVPSQLI-YNLIVSATDLGPERRKSTTELTIILQGL--DGP 1627

Query: 1648 TFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVS--------SESFSLDPD 1699
             F Q +Y  +L+E  P GT+++++ A  P  G+   V Y  VS           F++   
Sbjct: 1628 VFTQPKYITILKEGEPIGTNVISIEAASPR-GSEAPVEYYIVSVRCEEKTVGRLFTIGRH 1686

Query: 1700 TGVLTTLRALDREEQEEINLT-VYAQDRGSP-PQLTHVTVRVAVEDENDHAPTFGSAHLS 1757
            TG++ T   LDRE+   + L  VYA ++ +  P+     V + ++D ND+ P F +  L 
Sbjct: 1687 TGIIQTAAILDREQGACLYLVDVYAIEKSTAFPRTQRAEVEITLQDINDNPPVFPTDMLD 1746

Query: 1758 LEVPEG-QDPQTLTMLRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDRE 1816
            L V E   D   +  L A D D GAN  + Y I+ G    +F +D  SG+    R LDRE
Sbjct: 1747 LTVEENIGDGSKIMQLTAMDADEGANALVTYTIISG-ADDSFRIDPESGDLIATRRLDRE 1805

Query: 1817 VEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQ 1876
                + L + A DG Q   S+ + + +TV D NDH P F  P YS ++PED   G+L+  
Sbjct: 1806 RRSKYSLLVRADDGLQ---SSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAA 1862

Query: 1877 LQAHDPDAGANGHVTYYLGAGTA-GAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGA 1935
            + A D D+G NG +TY +      G F L P +G       LD E    Y  +V A DG 
Sbjct: 1863 ILATDDDSGVNGEITYIVNEDDEDGIFFLNPITGVFNLTRLLDYEVQQYYILTVRAEDG- 1921

Query: 1936 AAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGA 1995
              G   TT+ V   + DVND+ P F  +     L    P  ST    +      D D G 
Sbjct: 1922 --GGQFTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGST----VLVFNVTDADDGI 1975

Query: 1996 NASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLFIVATDLGR-PAR--SATG 2052
            N+ + Y +A     G       G ++V ++          L +   DL + PA   ++T 
Sbjct: 1976 NSQLTYSIASGDSLGQFTVDKNGVLKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTA 2035

Query: 2053 VIIVGLQGEAERGPRFPRASSEAT-IRENAPPGTPIVSPRAVHA-GGTNGPITYSILS-- 2108
             + + L    +  P F   S + T I EN P  T +   +A     G N  I Y++L+  
Sbjct: 2036 QVSIILLDVNDNPPTF--LSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPL 2093

Query: 2109 GNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGG---AFAFTVLTLTLQDAN 2165
            GN+   FSI    G   VR    LD E      L + A   G     + T + + + D N
Sbjct: 2094 GNK---FSIGTIDG--EVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDIN 2148

Query: 2166 DNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPT 2225
            DN P F +  Y   + E+      ++QV A D D+G+ GQ+ Y +      +  F +D  
Sbjct: 2149 DNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQE-FRIDSV 2207

Query: 2226 TGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIP-QPWELR 2284
            TG IT    LDRE      L + ATDRGS     ++T++++++D ND  P     P+ + 
Sbjct: 2208 TGAITVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFELSPYSVN 2267

Query: 2285 VSED-ALLGSEIAQVTGNDVDSG--PVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQ 2341
            V E+   L   I QV   D D G    L YVL      + F++    G + +T  LD E 
Sbjct: 2268 VPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNEDNAFTLSA-SGELGVTQSLDRET 2326

Query: 2342 CDRYQLQLLAHDGPH---EGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSV 2398
             +R+ L + A D       G   + V+V+DVNDN P F+   Y   + E  P G+ +L V
Sbjct: 2327 KERFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLV 2386

Query: 2399 SATDRDSGANGHISYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHG 2458
            +A+D D+  N  I   +      F+++P+ G + T   +  L  +      +V+   D G
Sbjct: 2387 NASDADASKNAVI--RIIGGNSQFTINPSTGQIIT---SALLDRETKDNYTLVVVCSDAG 2441

Query: 2459 APGRAARAT-VHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAA 2517
            +P   + +T V V + D ND+ P F    Y   +     PGS +  +  TDAD    ++ 
Sbjct: 2442 SPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSPTLPGSFVFAVTVTDAD-IGPNSE 2500

Query: 2518 VDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADR 2577
            + YS +SG     F ++P L  A  +AGP                   ++   +V   D 
Sbjct: 2501 LHYS-LSGRNSEKFHIDP-LRGAIMAAGP---------------LNGASEVTFSVHVKDG 2543

Query: 2578 GQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLV 2637
            G  P++    VTV  ++  D P V  +       PE+ PV + +  +  S     P   +
Sbjct: 2544 GSFPKTDSTTVTVRFVNKADFPKVRAK-EQTFMFPENQPVSSLVTTITGSSLRGEP---M 2599

Query: 2638 RFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHF-ALAPVTIEV 2696
             + ++SG+    F++D+ +G + ++  LD E   ++ + ++A D     F +   + I V
Sbjct: 2600 SYYIASGNLGNTFQIDQLTGQVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITV 2659

Query: 2697 QDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGRE 2756
             DVND+ P F  +   + + EN  P  ++ T+ A+D D+G  G+L Y ++          
Sbjct: 2660 LDVNDNAPIFKEDPFISEILENLSPRKIL-TVSAMDKDSGPNGQLDYEIVNGNM----EN 2714

Query: 2757 AFALNSSTGELRARVPFDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYD--PVFL 2814
            +F++N +TGE+R+  P D E    + L + ++D G+ S S +V V++   DE D  P F 
Sbjct: 2715 SFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRF- 2773

Query: 2815 APAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSSPYFGINQTTGALYL 2870
            +  F   VPE +  G+++  V  +DED G + +  YS+  +S  F IN +TG + +
Sbjct: 2774 SQIFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYSIMDASLPFTINPSTGDIVI 2829



 Score =  933 bits (2411), Expect = 0.0
 Identities = 839/2894 (28%), Positives = 1314/2894 (45%), Gaps = 209/2894 (7%)

Query: 53   EEQPAGTLIGDISAGLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDREQR 112
            E    G  +G +SA       + + Y I+  +  G+    AI++ +G + TA V+DRE++
Sbjct: 804  ENVALGYHVGSVSAST-MDLNSNISYLITTGDQKGM---FAINQVTGQLTTANVIDREEQ 859

Query: 113  DRYRFTAVTPDGATVE---VTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPARD 169
              Y+   V   G       V + V D+ND++P F QA  ++ V E+   G       A D
Sbjct: 860  SFYQLKVVASGGTVTGDTMVNITVKDLNDNSPHFLQAIESVNVVENWQAGHSIFQAKAVD 919

Query: 170  ADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSHYMLQLEAYD 229
             D G  G   Y+L        F +  + G        + + G LD    S Y +++ A D
Sbjct: 920  PDEGVNGMVLYSLK-QNPKNLFAINEKNGT-------ISLLGPLDVHAGS-YQIEILASD 970

Query: 230  GGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGA 289
             G P   +  +L V + D+ND++P F+Q  Y   +SES    S   +V ASD D+G NG 
Sbjct: 971  MGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGE 1030

Query: 290  VTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVT 349
            + Y I    + GD  F I    G L ++  LD E +  + L+V A D    P   +  VT
Sbjct: 1031 IAYTIAEGNT-GDA-FGIFPD-GQLYIKSELDRELQDRYVLMVVASDRAVEPLSATVNVT 1087

Query: 350  VHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGE 409
            V + D NDN+P    +F S + +    E    G  V ++S  D D G    V  S E  +
Sbjct: 1088 VILEDVNDNRP----LFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQ 1143

Query: 410  GHFALSTQDSVIYLVCVARRLDREE------RDAYNLRVTATDSGSP-PLRAEAAFVLHV 462
              F L      I       + DRE          ++  V ATD G P PL+ +A   +++
Sbjct: 1144 PDFELHAISGEI---TNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYM 1200

Query: 463  TDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFS 522
             D+NDNAP F +  Y+   + E A   + V+RV+A D D+G NG + YS+  G     F+
Sbjct: 1201 KDINDNAPKFLKDFYQAT-ISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFA 1259

Query: 523  IDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTF 582
            ID TSG +T    LDYE  P   L++ A D G  PL S+ T+++ + D NDN P F ++ 
Sbjct: 1260 IDSTSGQVTLIGKLDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKST 1319

Query: 583  YNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTR 642
                + E  + G     VTATD+DSG    L YS+    G++    F I  ++G +   +
Sbjct: 1320 LFVDVLENMRIGELVSSVTATDSDSGDNADLYYSI---TGTNNHGTFSISPNTGSIFLAK 1376

Query: 643  TLDRDQGPSSFDFTVTAVDGGG--LKSMVYVKVFLSDENDNPPQFYPREYAASISAQSPP 700
             LD +   S +   +TA D G     S + V + + D NDNPP F P +   SI    P 
Sbjct: 1377 KLDFET-QSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPI 1435

Query: 701  GTAVLRLRAHDPDQGSHGRLSYHILA----GNSPPLFTLDEQSGLLTVAWPLARRANSVV 756
            GT+V+ + AHDPD   +G+LSY I+     GN    FT+DE  G +     + R   ++ 
Sbjct: 1436 GTSVISVTAHDPDADINGQLSYTIIQQMPRGNH---FTIDEVKGTIYTNAEIDREFANLF 1492

Query: 757  QLEIGAEDGGGLQAEPSA-------RVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSV 809
            +L + A D    QA P          V I +       P+F     + + P  V      
Sbjct: 1493 ELTVKAND----QAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPSAVIGSVLT 1548

Query: 810  GIVQAHNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGPVLELEVRAGS 869
             I+ A    G    +   +  GD    F +D  SG L+    L    L  +  L V A  
Sbjct: 1549 TIMAADPDEGANGEIEYEIINGDT-DTFIVDRYSGDLRVASALVPSQL--IYNLIVSATD 1605

Query: 870  -GVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSR 928
             G     +   + ++L  ++   P F  P+   +L      GT + ++ A  P  G  + 
Sbjct: 1606 LGPERRKSTTELTIILQGLD--GPVFTQPKYITILKEGEPIGTNVISIEAASP-RGSEAP 1662

Query: 929  VTFTLLAGG------GGAFTVDPTTGHVRLMRPLGPSGGPA-HELELEARDGGSP-PRTS 980
            V + +++        G  FT+   TG ++    L    G   + +++ A +  +  PRT 
Sbjct: 1663 VEYYIVSVRCEEKTVGRLFTIGRHTGIIQTAAILDREQGACLYLVDVYAIEKSTAFPRTQ 1722

Query: 981  HFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGP---ITYHLA 1037
               + + +QD+      P F +    + +      G++++Q+ A   D G    +TY + 
Sbjct: 1723 RAEVEITLQDINDN--PPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTII 1780

Query: 1038 AEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILN 1097
            + GA   F ++P+SG L     LDRE +  Y L V      +A+ G Q+    + +++ +
Sbjct: 1781 S-GADDSFRIDPESGDLIATRRLDRERRSKYSLLV------RADDGLQSSDMRINITVSD 1833

Query: 1098 QNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIH 1157
             N+H+P+ S       + E+  PG+ V  + ATD DSG NG +TY + +  ED   F ++
Sbjct: 1834 VNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDEDG-IFFLN 1892

Query: 1158 PQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGA 1217
            P TG     + LD E Q  Y L V+ +DGG   + TT  V+  +LD+NDN P F   S +
Sbjct: 1893 PITGVFNLTRLLDYEVQQYYILTVRAEDGGG--QFTTIRVYFNILDVNDNPPIFSLNSYS 1950

Query: 1218 AGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHSGELLTAA 1277
                    + + +P G+ V      D D+G N  + Y++    S        +G L    
Sbjct: 1951 TS------LMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTVDKNGVLKVLK 2004

Query: 1278 PLIRAERPHYVLTLSAHDQGSPPRSASLQLL-VQVLPSARLAEPPPDLAERDPAAP--VP 1334
             L R  +  Y L +  HD    P S       V ++       PP  L+ +    P   P
Sbjct: 2005 ALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTYIPENTP 2064

Query: 1335 VVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGT-FALDAASGRLYLARP 1393
            +   V  A+   P S   S           + YTL+   +P G  F++    G + L   
Sbjct: 2065 IDTVVFKAQATDPDSGPNSY----------IEYTLL---NPLGNKFSIGTIDGEVRLTGE 2111

Query: 1394 LDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGA 1453
            LD E    +    V  +    + +    V V V D N++ P FA+    + + EN   G 
Sbjct: 2112 LDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGT 2171

Query: 1454 ALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLV 1513
             +    A+D D  G N  VRY ++         R+D+ TGA++  + LDRE TP   L V
Sbjct: 2172 DIIQVFAADGD-EGTNGQVRYGIVNGNTN-QEFRIDSVTGAITVAKPLDREKTPTYHLTV 2229

Query: 1514 EATDRPANASRRRAARVSARVFVTDENDNAPVFA-SPSRVRLPEDQPPGPAA-LHVVARD 1571
            +ATDR    S  R    +  + + D ND  PVF  SP  V +PE+    P   L VVARD
Sbjct: 2230 QATDR---GSTPRTDTSTVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTILQVVARD 2286

Query: 1572 PDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSA 1631
             D G  +++SY L  G + +    S++G L V + LDRE +   VL + A+D GSP  + 
Sbjct: 2287 DDRGSNSKLSYVLFGGNEDNAFTLSASGELGVTQSLDRETKERFVLMITATDSGSPALTG 2346

Query: 1632 TQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSS 1691
            T  + V V DVND  PTF  + Y   + E+ P GT +L + A+D D   N  +   G +S
Sbjct: 2347 TGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVIRIIGGNS 2406

Query: 1692 ESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVT-VRVAVEDENDHAPT 1750
            + F+++P TG + T   LDRE ++   L V   D GSP  L+  T V V V D ND+ P 
Sbjct: 2407 Q-FTINPSTGQIITSALLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPR 2465

Query: 1751 FGSAHLSLEVPEGQDPQTLTM-LRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGT 1809
            F        +P    P +    +  +D D+G N +L Y  L G  S  F +D   G    
Sbjct: 2466 FQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYS-LSGRNSEKFHIDPLRGAIMA 2524

Query: 1810 MRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVP 1869
              PL+   E  F + +  +DGG    + +  +TV  ++  D  P       +   PE+ P
Sbjct: 2525 AGPLNGASEVTFSVHV--KDGGSFPKTDSTTVTVRFVNKADF-PKVRAKEQTFMFPENQP 2581

Query: 1870 AGTLLLQLQAHDPDAGANGH-VTYYLGAGTAG-AFLLEPSSGELRTAAALDREQCPSYTF 1927
              +L+  +      +   G  ++YY+ +G  G  F ++  +G++  +  LD E+   Y  
Sbjct: 2582 VSSLVTTITG----SSLRGEPMSYYIASGNLGNTFQIDQLTGQVSISQPLDFEKIQKYVV 2637

Query: 1928 SVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLR 1987
             + A DG    P S+   + ITV DVND+AP F   P    +       +     + T+ 
Sbjct: 2638 WIEARDGGFP-PFSSYEKLDITVLDVNDNAPIFKEDPFISEILE-----NLSPRKILTVS 2691

Query: 1988 AEDRDAGANASILYRLA-GTPPPGTTVDSYTGEIRVARSPVALGPRDR------VLFIVA 2040
            A D+D+G N  + Y +  G      +++  TGEIR  R      P DR      VL I +
Sbjct: 2692 AMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRSVR------PLDREKVSHYVLTIKS 2745

Query: 2041 TDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHAG-GTN 2099
            +D G P++S +  +++ +  E +  PRF +  S A + EN+P G  +          G N
Sbjct: 2746 SDKGSPSQSTSVKVMINILDENDNAPRFSQIFS-AHVPENSPLGYTVTRVTTSDEDIGIN 2804

Query: 2100 GPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFTVLTL 2159
                YSI+  +    F+I PSTG I +  +  L+ E + R R+ + A   G    T +T+
Sbjct: 2805 AISRYSIMDASLP--FTINPSTGDIVI--SRPLNREDTDRYRIRVSAHDSGWTVSTDVTI 2860

Query: 2160 TLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGL 2219
             + D NDNAPRF R  Y    PE   +   + QV A D D+GS GQ+ Y + +       
Sbjct: 2861 FVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKSQSE---Y 2917

Query: 2220 FHVDPTTGTITTTAILDREIWA--------ETRLVLMATDRGSPALVGSATLTVMVIDTN 2271
            F ++ TTG I    IL  +               ++ ++DRG P+L+   T+T+ ++D+N
Sbjct: 2918 FRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSN 2977

Query: 2272 DNRPT-IPQPWELRVSEDALLGSEIAQVTG-NDVDSG--PVLWYVLSPSGPQDPFSVGRY 2327
            DN P  +   +   V+++  +G+++ +VT  +D D G    + Y +S       F +   
Sbjct: 2978 DNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDND 3037

Query: 2328 GGRVSLTGPLDFEQCDRYQLQLLAHDG---PHEGRANLTVLVEDVNDNAPAFSQSLYQVM 2384
             G +S+   L  +    + + + A D    P   +A + + V + N + P FSQS     
Sbjct: 3038 TGWISVASSLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSAT 3097

Query: 2385 LLEHTPPGSAILSVSATDRDSGANGHISYHLASPADG--FSVDPNNGTLFTIVGTVALGH 2442
            + E    GS + +VSA DRD+  NG I Y ++S  +   F+++ + G L       AL +
Sbjct: 3098 IPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTL---AKALDY 3154

Query: 2443 DGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLL 2502
            +     ++ + A D G   R    +V V + D ND++P F    Y   V E+ P G+T++
Sbjct: 3155 ELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVI 3214

Query: 2503 TLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDF 2562
             L ATDAD S ++A + Y++ S +   +F ++P                G +     LDF
Sbjct: 3215 HLNATDAD-SGTNAVIAYTVQSSD-SDLFVIDPNT--------------GVITTQGFLDF 3258

Query: 2563 ESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELL 2622
            E+   Y+LTV A +     + S   V + +   N+  P F    Y   + E  P G  + 
Sbjct: 3259 ETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVG 3318

Query: 2623 HVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADP 2682
             V ASD D G  G V + +        F++++ +G + ++  LD E + R  L V A + 
Sbjct: 3319 EVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNF 3378

Query: 2683 A---GAHFALAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDA-GAF 2738
                GA      V + V D ND  P F LN+ S  ++E  P GT VT + A D D+  ++
Sbjct: 3379 GSIRGADIDEVTVNVTVLDANDP-PIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSW 3437

Query: 2739 GRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAADAGNLSASVT 2798
             R  Y +   G G E   AF++N  TG++      D E    + L V A D+G  SA+ +
Sbjct: 3438 SRFSYFI---GSGNENG-AFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSATGS 3493

Query: 2799 VSVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDED----GGADGLVLYSLAT 2854
             S+LVT ED  D   +      +V E  R G  +  +Q+TD D     G     L S   
Sbjct: 3494 ASLLVTLEDINDNGPMLTVSEGEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGP 3553

Query: 2855 SSPYFGINQTTGAL 2868
            ++ YF ++ T G L
Sbjct: 3554 ATSYFSLS-TAGVL 3566



 Score =  879 bits (2270), Expect = 0.0
 Identities = 768/2628 (29%), Positives = 1216/2628 (46%), Gaps = 206/2628 (7%)

Query: 52   DEEQPAGTLIGDISA-GLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDRE 110
            +EEQ AG+ +G +SA     G    + Y         V  D  +   SG +      DRE
Sbjct: 1110 EEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEM-----VQPDFELHAISGEITNTHQFDRE 1164

Query: 111  QRDRYRFTAV---------------TPDGATVEVTVRVADINDHAPAFPQARAALQVPEH 155
               R R TAV                 D ATV V ++  DIND+AP F +      + E 
Sbjct: 1165 SLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMK--DINDNAPKFLKDFYQATISES 1222

Query: 156  TAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDR 215
             A  T+     A D D G  G   Y++        F +++  G       ++ + G+LD 
Sbjct: 1223 AANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFAIDSTSG-------QVTLIGKLDY 1275

Query: 216  ENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVL 275
            E    Y L ++A D G+ P  +   L++ +LD ND+ P+F +S     V E++  G  V 
Sbjct: 1276 EATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVS 1335

Query: 276  QVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQAR 335
             V A+D+D+G N  + Y I    + G   FSI  +TG + L + LDFE + +++L + A+
Sbjct: 1336 SVTATDSDSGDNADLYYSITGTNNHGT--FSISPNTGSIFLAKKLDFETQSLYKLNITAK 1393

Query: 336  DGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPD- 394
            D G  P   +  V +HVRD NDN PS    F   D    + E  P G  V  ++  DPD 
Sbjct: 1394 DQGRPPRSSTMSVVIHVRDFNDNPPS----FPPGDIFKSIVENIPIGTSVISVTAHDPDA 1449

Query: 395  --DGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPL 452
              +G  ++  +       HF +      IY       +DRE  + + L V A D   P  
Sbjct: 1450 DINGQLSYTIIQQMPRGNHFTIDEVKGTIY---TNAEIDREFANLFELTVKANDQAVPIE 1506

Query: 453  RAEAAF---VLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVT 509
                A     + VTD+NDN P F  Q          A+ GS +  + A DPD+G NG++ 
Sbjct: 1507 TRRYALKNVTILVTDLNDNVPMFISQ--NALAADPSAVIGSVLTTIMAADPDEGANGEIE 1564

Query: 510  YSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQ 569
            Y +  G  T  F +D  SG +  A++L    +    LIV ATD G     S+  +++ LQ
Sbjct: 1565 YEIING-DTDTFIVDRYSGDLRVASAL-VPSQLIYNLIVSATDLGPERRKSTTELTIILQ 1622

Query: 570  DVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATD--ADSGPFGLLSYSLGAGLGSSGSP 627
             ++   P F +  Y   L EG   GT  + + A        P      S+     + G  
Sbjct: 1623 GLDG--PVFTQPKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRL 1680

Query: 628  PFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMVY-------VKVFLSDEND 680
             F I  H+G + T   LDR+QG   +   V A++    KS  +       V++ L D ND
Sbjct: 1681 -FTIGRHTGIIQTAAILDREQGACLYLVDVYAIE----KSTAFPRTQRAEVEITLQDIND 1735

Query: 681  NPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSG 740
            NPP F       ++      G+ +++L A D D+G++  ++Y I++G +   F +D +SG
Sbjct: 1736 NPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISG-ADDSFRIDPESG 1794

Query: 741  LLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVP 800
             L     L R   S   L + A+DG  LQ+    R++I++       P F +  Y F +P
Sbjct: 1795 DLIATRRLDRERRSKYSLLVRADDG--LQSS-DMRINITVSDVNDHTPKFSRPVYSFDIP 1851

Query: 801  EDVAPGTSVGIVQA-HNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGP 859
            ED  PG+ V  + A  +  G    +T  ++  D  G+F L+ ++G+    R LD E+   
Sbjct: 1852 EDTIPGSLVAAILATDDDSGVNGEITYIVNEDDEDGIFFLNPITGVFNLTRLLDYEVQQY 1911

Query: 860  VLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRAL 919
             + L VRA  G    F   RV   + DVNDN P F     +  L  N   G+ +      
Sbjct: 1912 YI-LTVRAEDG-GGQFTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVT 1969

Query: 920  DPDSGVNSRVTFTLLAGGG-GAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPR 978
            D D G+NS++T+++ +G   G FTVD   G +++++ L       + L ++  D    P 
Sbjct: 1970 DADDGINSQLTYSIASGDSLGQFTVDKN-GVLKVLKALDRESQSFYNLVVQVHDLPQIPA 2028

Query: 979  ---TSHFRLRVVVQDVGTRGLAPRFNSP--TYRVDLPSGTTAGTQVLQVQAQAPDGGPIT 1033
               TS  ++ +++ DV      P F SP  TY   +P  T   T V + QA  PD GP +
Sbjct: 2029 SRFTSTAQVSIILLDVNDN--PPTFLSPKLTY---IPENTPIDTVVFKAQATDPDSGPNS 2083

Query: 1034 Y--HLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATV 1091
            Y  +       + F +    G + +   LDRE    Y L V+A    +  L   T    V
Sbjct: 2084 YIEYTLLNPLGNKFSIGTIDGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSST---EV 2140

Query: 1092 RVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDS 1151
             V +L+ N+++P  ++    + + EN   GT + +VFA D D G NG++ Y +      +
Sbjct: 2141 VVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVN-GNTN 2199

Query: 1152 KAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTF 1211
            + FRI   TG +T  + LDRE+  +Y L VQ  D GS PR+ T TV + +LD+ND  P F
Sbjct: 2200 QEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVF 2259

Query: 1212 LQASGAAGGGLPIQVPDRVPPGTLVTTLQ---AKDPDEGENGTILYTLTGPGSELFSLHP 1268
              +  +      + VP+ +  GTL  T+    A+D D G N  + Y L G   +      
Sbjct: 2260 ELSPYS------VNVPENL--GTLPRTILQVVARDDDRGSNSKLSYVLFGGNEDNAFTLS 2311

Query: 1269 HSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERD 1328
             SGEL     L R  +  +VL ++A D GSP  + +  + V V           D+ +  
Sbjct: 2312 ASGELGVTQSLDRETKERFVLMITATDSGSPALTGTGTINVIV----------DDVNDNV 2361

Query: 1329 PAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAASGRL 1388
            P        T T  E    G+ +  V A +          ++GG      F ++ ++G++
Sbjct: 2362 PTFASKAYFT-TIPEDAPTGTDVLLVNASDADASKNAVIRIIGG---NSQFTINPSTGQI 2417

Query: 1389 YLARPLDFEAGPPWRALTVRAE-GPGGAGARLLRVQVQVQDENEHAPAFARDPLALALPE 1447
              +  LD E    +  + V ++ G     +    V V V D N++ P F   P    +P 
Sbjct: 2418 ITSALLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPS 2477

Query: 1448 NPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTP 1507
               PG+ ++    +DAD  GPNS++ Y L  +        +D   GA+ A   L+  +  
Sbjct: 2478 PTLPGSFVFAVTVTDAD-IGPNSELHYSLSGRNSE--KFHIDPLRGAIMAAGPLNGASEV 2534

Query: 1508 ALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQPPGPAALHV 1567
               + V+        S  +    +  V   ++ D   V A       PE+QP       +
Sbjct: 2535 TFSVHVKD-----GGSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMFPENQPVSSLVTTI 2589

Query: 1568 VARDPDLGEAAR---VSYRLASGGDGH-FRLHSSTGALSVVRPLDREQRAEHVLTVVASD 1623
                   G + R   +SY +ASG  G+ F++   TG +S+ +PLD E+  ++V+ + A D
Sbjct: 2590 T------GSSLRGEPMSYYIASGNLGNTFQIDQLTGQVSISQPLDFEKIQKYVVWIEARD 2643

Query: 1624 HGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQ 1683
             G PP S+ + L ++V DVND AP F++  +   + EN  P   +LT+ A D D G NGQ
Sbjct: 2644 GGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSP-RKILTVSAMDKDSGPNGQ 2702

Query: 1684 VTY---GGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVA 1740
            + Y    G    SFS++  TG + ++R LDRE+     LT+ + D+GSP Q T V V + 
Sbjct: 2703 LDYEIVNGNMENSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMIN 2762

Query: 1741 VEDENDHAPTFG---SAHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILDGDPSGA 1797
            + DEND+AP F    SAH+    P G    T+T +  SD D+G N   +Y I+D   S  
Sbjct: 2763 ILDENDNAPRFSQIFSAHVPENSPLGY---TVTRVTTSDEDIGINAISRYSIMDA--SLP 2817

Query: 1798 FVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPV 1857
            F ++ ++G+    RPL+RE    +++R+ A D G    + +  +T+ V D ND+AP F  
Sbjct: 2818 FTINPSTGDIVISRPLNREDTDRYRIRVSAHDSGW---TVSTDVTIFVTDINDNAPRFSR 2874

Query: 1858 PAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGELRTAAAL 1917
             +Y ++ PE    G+ + Q+ A DPD G+NG V Y++ + +   F +  ++GE+     L
Sbjct: 2875 TSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKSQSE-YFRINATTGEIFNKQIL 2933

Query: 1918 DREQCPSYT--------FSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRL 1969
              +    ++        F V++ D      +S T +VTI + D ND+AP F  S     +
Sbjct: 2934 KYQNVTGFSNVNINRHSFIVTSSDRGKPSLISET-TVTINIVDSNDNAPQFLKSKYFTPV 2992

Query: 1970 PRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGT-TVDSYTGEIRVARSPVA 2028
             +   +    T  +     +D+D G N+ + Y ++     G   +D+ TG I VA S ++
Sbjct: 2993 TK---NVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLIS 3049

Query: 2029 LGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPI- 2087
               ++  + + A D G P  S+   + + +  E    P F ++   ATI E+   G+ + 
Sbjct: 3050 DLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVR 3109

Query: 2088 -VSPRAVHAGGTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQA 2146
             VS R   A   NG I YSI SGNE+G F+I  STG +T+  A+ LD+E+  +  + + A
Sbjct: 3110 TVSARDRDAA-MNGLIKYSISSGNEEGIFAINSSTGILTL--AKALDYELCQKHEMTISA 3166

Query: 2147 ESGGAFAFT---VLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSG 2203
              GG  A T    +T+ + D NDN+P FL   Y   + E+ P    ++ + A D D G+ 
Sbjct: 3167 IDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTN 3226

Query: 2204 GQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATL 2263
              I+Y++ +S     LF +DP TG ITT   LD E      L + A +         AT+
Sbjct: 3227 AVIAYTVQSSDS--DLFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATV 3284

Query: 2264 TVMVIDTNDNRPT-IPQPWELRVSEDALLGSEIAQVTGNDVDSGP--VLWYVLSPSGPQD 2320
             + +  TN+  P  + + +   +SE A  G+ + +V  +D D G    + Y++  +  + 
Sbjct: 3285 NIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKK 3344

Query: 2321 PFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHD-----GPHEGRANLTVLVEDVNDNAPA 2375
             F + +  G++ ++G LD E+ +R  L++LA +     G       + V V D ND  P 
Sbjct: 3345 GFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDAND-PPI 3403

Query: 2376 FSQSLYQVMLLEHTPPGSAILSVSATDRDSGAN-GHISYHLASPADG--FSVDPNNGTLF 2432
            F+ ++Y V + E  P G+ +  VSA D DS  +    SY + S  +   FS++P  G   
Sbjct: 3404 FTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQ-- 3461

Query: 2433 TIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVT 2492
             I  T  L  +     ++ + A D G P     A++ V L+D ND+ P  T+S   V   
Sbjct: 3462 -ITVTAELDRETLPIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPMLTVSEGEVM-- 3518

Query: 2493 EDLPPGSTLLTLEATDADGSRSHAAVDYSIIS-GNWGRVFQLEPRLAEAGESAGPGPRAL 2551
            E+  PG+ ++TL++TD D   +     Y ++S G     F L                  
Sbjct: 3519 ENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSLS---------------TA 3563

Query: 2552 GCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNP 2599
            G L     +D E +  + L+V   D G P  SS   V +TV+D NDNP
Sbjct: 3564 GVLSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDNP 3611



 Score =  808 bits (2087), Expect = 0.0
 Identities = 727/2483 (29%), Positives = 1158/2483 (46%), Gaps = 164/2483 (6%)

Query: 93   AIDEHSGVVRTARVLDREQRDRYRFTAVTPDGATVEVT------VRVADINDHAPAFPQA 146
            AID  SG V     LD E    Y       D  T+ +       + + D ND+ P+FP++
Sbjct: 1259 AIDSTSGQVTLIGKLDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKS 1318

Query: 147  RAALQVPEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPE 206
               + V E+   G       A D+D+G      Y+++G     TF +    G        
Sbjct: 1319 TLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTG-------S 1371

Query: 207  LVVTGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSE 266
            + +  +LD E +S Y L + A D G PPR +   + + + D ND+ P+F        + E
Sbjct: 1372 IFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVE 1431

Query: 267  SLAPGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRR 326
            ++  G+ V+ V A D DA +NG ++Y I ++   G+  F+ID   G +     +D E   
Sbjct: 1432 NIPIGTSVISVTAHDPDADINGQLSYTIIQQMPRGNH-FTIDEVKGTIYTNAEIDREFAN 1490

Query: 327  VHELVVQARDGGAHPEL---GSAFVTVHVRDANDNQPS-MTVIFLSADGSPQVSEAAPPG 382
            + EL V+A D     E        VT+ V D NDN P  ++   L+AD S  +      G
Sbjct: 1491 LFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPSAVI------G 1544

Query: 383  QLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRV 442
             ++  I  +DPD+G    +   +  G+    +  + S    V  A       +  YNL V
Sbjct: 1545 SVLTTIMAADPDEGANGEIEYEIINGDTDTFIVDRYSGDLRVASALV---PSQLIYNLIV 1601

Query: 443  TATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQ 502
            +ATD G  P R ++   L +     + P F +  Y    L E    G+ V+ + A  P +
Sbjct: 1602 SATDLG--PERRKSTTELTIILQGLDGPVFTQPKYITI-LKEGEPIGTNVISIEAASP-R 1657

Query: 503  GTNGQVTYSLAP-----GAHTHWFSIDPTSGIITTAASLDYELEPQPQLI-VVATDGGLP 556
            G+   V Y +             F+I   +GII TAA LD E      L+ V A +    
Sbjct: 1658 GSEAPVEYYIVSVRCEEKTVGRLFTIGRHTGIIQTAAILDREQGACLYLVDVYAIEKSTA 1717

Query: 557  -PLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSY 615
             P    A V + LQD+NDN P F     + ++ E    G+  +Q+TA DAD G   L++Y
Sbjct: 1718 FPRTQRAEVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTY 1777

Query: 616  SLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMVYVKVFL 675
            ++ +G   S    FRID  SGD+  TR LDR++  S +   V A D G   S + + + +
Sbjct: 1778 TIISGADDS----FRIDPESGDLIATRRLDRERR-SKYSLLVRA-DDGLQSSDMRINITV 1831

Query: 676  SDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTL 735
            SD ND+ P+F    Y+  I   + PG+ V  + A D D G +G ++Y +   +   +F L
Sbjct: 1832 SDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDEDGIFFL 1891

Query: 736  DEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQY 795
            +  +G+  +   L         L + AEDGGG     + RV  +I+     PPIF    Y
Sbjct: 1892 NPITGVFNLTRLLDYEVQQYYILTVRAEDGGGQFT--TIRVYFNILDVNDNPPIFSLNSY 1949

Query: 796  VFSVPEDVAPGTSVGIVQAHNPP-GRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDR 854
              S+ E++  G++V +    +   G  + +T S++ GD  G F++D  +G+L+ L+ LDR
Sbjct: 1950 STSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTVDK-NGVLKVLKALDR 2008

Query: 855  ELLGPV-LELEVRAGSGVPPA--FAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGT 911
            E      L ++V     +P +   + A+V ++L DVNDN P F +P+ T + P NT   T
Sbjct: 2009 ESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTYI-PENTPIDT 2067

Query: 912  PIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEAR 971
             ++  +A DPDSG NS + +TLL   G  F++    G VRL   L       + L + A 
Sbjct: 2068 VVFKAQATDPDSGPNSYIEYTLLNPLGNKFSIGTIDGEVRLTGELDREEVSNYTLTVVAT 2127

Query: 972  DGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPD--- 1028
            D G P  +S   + V+V D+      P F    Y+V++   T  GT ++QV A   D   
Sbjct: 2128 DKGQPSLSSSTEVVVMVLDINDNN--PIFAQALYKVEINENTLTGTDIIQVFAADGDEGT 2185

Query: 1029 GGPITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGT 1088
             G + Y +     +  F ++  +G + V   LDRE    Y L V A          +T T
Sbjct: 2186 NGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGSTP---RTDT 2242

Query: 1089 ATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGT---SVGRVFATDRDSGPNGRLTYSLQ 1145
            +TV + +L+ N+  P     P  + V EN   GT   ++ +V A D D G N +L+Y L 
Sbjct: 2243 STVSIVLLDINDFVPVFELSPYSVNVPENL--GTLPRTILQVVARDDDRGSNSKLSYVLF 2300

Query: 1146 QLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLN 1205
              +ED+ AF +   +GE+   Q+LDRE +  + L++   D GSP  + TGT++V V D+N
Sbjct: 2301 GGNEDN-AFTLSA-SGELGVTQSLDRETKERFVLMITATDSGSPALTGTGTINVIVDDVN 2358

Query: 1206 DNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFS 1265
            DN PTF      A       +P+  P GT V  + A D D  +N  I   + G G+  F+
Sbjct: 2359 DNVPTF------ASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVI--RIIG-GNSQFT 2409

Query: 1266 LHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSP-PRSASLQLLVQVLPSARLAEPPPDL 1324
            ++P +G+++T+A L R  + +Y L +   D GSP P S+S  +LV V     + + PP  
Sbjct: 2410 INPSTGQIITSALLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTD---VNDNPPRF 2466

Query: 1325 AERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGVGA---LTYTLVGGADPEGTFAL 1381
                    +P            PGS + +V   + A +G    L Y+L G    +  F +
Sbjct: 2467 QHHPYVTHIP--------SPTLPGSFVFAVTVTD-ADIGPNSELHYSLSGRNSEK--FHI 2515

Query: 1382 DAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENE-HAPAFARDP 1440
            D   G +  A PL+   G      +V  +  GG+  +     V V+  N+   P      
Sbjct: 2516 DPLRGAIMAAGPLN---GASEVTFSVHVKD-GGSFPKTDSTTVTVRFVNKADFPKVRAKE 2571

Query: 1441 LALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRG 1500
                 PEN    + + T   S   G   +  +    L         ++D  TG +S  + 
Sbjct: 2572 QTFMFPENQPVSSLVTTITGSSLRGEPMSYYIASGNLGN-----TFQIDQLTGQVSISQP 2626

Query: 1501 LDRETTPALLLLVEATDR--PANASRRRAARVSARVFVTDENDNAPVFAS-PSRVRLPED 1557
            LD E     ++ +EA D   P  +S  +       + V D NDNAP+F   P    + E+
Sbjct: 2627 LDFEKIQKYVVWIEARDGGFPPFSSYEKLD-----ITVLDVNDNAPIFKEDPFISEILEN 2681

Query: 1558 QPPGPAALHVVARDPDLGEAARVSYRLASGG-DGHFRLHSSTGALSVVRPLDREQRAEHV 1616
              P    L V A D D G   ++ Y + +G  +  F ++ +TG +  VRPLDRE+ + +V
Sbjct: 2682 LSPRKI-LTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRSVRPLDREKVSHYV 2740

Query: 1617 LTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDP 1676
            LT+ +SD GSP +S +  + +++ D ND AP F Q  +S  + EN+P G ++  +  +D 
Sbjct: 2741 LTIKSSDKGSPSQSTSVKVMINILDENDNAPRFSQI-FSAHVPENSPLGYTVTRVTTSDE 2799

Query: 1677 DVGANGQVTYGGV-SSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHV 1735
            D+G N    Y  + +S  F+++P TG +   R L+RE+ +   + V A D G        
Sbjct: 2800 DIGINAISRYSIMDASLPFTINPSTGDIVISRPLNREDTDRYRIRVSAHDSG---WTVST 2856

Query: 1736 TVRVAVEDENDHAPTFGSAHLSLEVPEGQD-PQTLTMLRASDPDVGANGQLQYRILDGDP 1794
             V + V D ND+AP F      L+ PE  +    +T + A+DPD G+NGQ+ Y I     
Sbjct: 2857 DVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKS--Q 2914

Query: 1795 SGAFVLDLASGEFGTMRPLDREVEPAFQ--------LRIEARDGGQPALSATLLLTVTVL 1846
            S  F ++  +GE    + L  +    F           + + D G+P+L +   +T+ ++
Sbjct: 2915 SEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIV 2974

Query: 1847 DANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQA-HDPDAGANGHVTYYLGAGT-AGAFLL 1904
            D+ND+AP F    Y   V ++V  GT L+++ A  D D G N  V Y++      G F L
Sbjct: 2975 DSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKL 3034

Query: 1905 EPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSP 1964
            +  +G +  A++L  +   ++  +V+A D     PLS+  +V ITV + N H P F  S 
Sbjct: 3035 DNDTGWISVASSLISDLNQNFFITVTAKDKGNP-PLSSQATVHITVTEENYHTPEFSQSH 3093

Query: 1965 LRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGT-TVDSYTGEIRVA 2023
            +   +P    S S  ++ + T+ A DRDA  N  I Y ++     G   ++S TG + +A
Sbjct: 3094 MSATIPE---SHSIGSI-VRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLA 3149

Query: 2024 RSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPP 2083
            ++      +   + I A D G  AR+    + V +    +  P F       T+ ENAP 
Sbjct: 3150 KALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPS 3209

Query: 2084 GTPIVSPRAVHA-GGTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRL 2142
            GT ++   A  A  GTN  I Y++ S ++   F I P+TG IT +    LDFE      L
Sbjct: 3210 GTTVIHLNATDADSGTNAVIAYTVQS-SDSDLFVIDPNTGVITTQGF--LDFETKQSYHL 3266

Query: 2143 VLQA---ESGGAFAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLD 2199
             ++A         +F  + + L+  N+  PRF+   Y   + E+ P    + +V A D D
Sbjct: 3267 TVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRD 3326

Query: 2200 QGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGS--PAL 2257
             G+ G++ Y +  +   +G F ++  TG I  + ILDRE      L ++A + GS   A 
Sbjct: 3327 LGTDGEVHYLIFGNSRKKG-FQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGAD 3385

Query: 2258 VGSATLTVMVIDTNDNRPTIPQPWELRVSEDALLGSEIAQVTGNDVDSGPVLW----YVL 2313
            +   T+ V V+D ND        + +++SE   +G+ +  V+  D DS P  W    Y +
Sbjct: 3386 IDEVTVNVTVLDANDPPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPS-WSRFSYFI 3444

Query: 2314 SPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDG---PHEGRANLTVLVEDVN 2370
                    FS+    G++++T  LD E    Y L +LA D       G A+L V +ED+N
Sbjct: 3445 GSGNENGAFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSATGSASLLVTLEDIN 3504

Query: 2371 DNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGAN-GHISYHLAS--PADGFSVDPN 2427
            DN P  + S  +VM  E+  PG+ ++++ +TD D   N G  +Y+L S  PA  +     
Sbjct: 3505 DNGPMLTVSEGEVM--ENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSLST 3562

Query: 2428 NGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHY 2487
             G L T   T  +  +      + +  +D G P  ++  TVH+ + DQND+         
Sbjct: 3563 AGVLST---TREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDNPSQSRTVEI 3619

Query: 2488 RVAVTEDLPPGSTLLTLEATDAD 2510
             V    +L PG  L +++  D D
Sbjct: 3620 FVNYYGNLFPGGILGSVKPQDPD 3642



 Score =  781 bits (2016), Expect = 0.0
 Identities = 703/2438 (28%), Positives = 1092/2438 (44%), Gaps = 177/2438 (7%)

Query: 46   SLDLQIDEEQPAGTLIGDISA-GLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTA 104
            +L + + E    G L+  ++A    +G  A L Y I+     G     +I  ++G +  A
Sbjct: 1319 TLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTNNHGT---FSISPNTGSIFLA 1375

Query: 105  RVLDREQRDRYRFTAVTPD------GATVEVTVRVADINDHAPAFPQARAALQVPEHTAF 158
            + LD E +  Y+      D       +T+ V + V D ND+ P+FP       + E+   
Sbjct: 1376 KKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPI 1435

Query: 159  GTRYPLEPARDADAGRLGTQGYALSGD-GAGETFRLETRPGPDGTPVPELVVTGELDREN 217
            GT      A D DA   G   Y +      G  F ++   G        +    E+DRE 
Sbjct: 1436 GTSVISVTAHDPDADINGQLSYTIIQQMPRGNHFTIDEVKGT-------IYTNAEIDREF 1488

Query: 218  RSHYMLQLEAYDGGSP-PRRAQALLDVTLL--DINDHAPAFNQSRYHAVVSESLAPGSPV 274
             + + L ++A D   P   R  AL +VT+L  D+ND+ P F  S+       S   GS +
Sbjct: 1489 ANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFI-SQNALAADPSAVIGSVL 1547

Query: 275  LQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQA 334
              + A+D D G NG + YEI    ++    F +D ++G L++   L    + ++ L+V A
Sbjct: 1548 TTIMAADPDEGANGEIEYEIINGDTD---TFIVDRYSGDLRVASAL-VPSQLIYNLIVSA 1603

Query: 335  RDGGAHPELGSAFVTVHVRDAND---NQPSMTVIFLSADGSPQVSEAAPPGQLVARISVS 391
             D G      +  +T+ ++  +     QP    I         + E  P G  V  I  +
Sbjct: 1604 TDLGPERRKSTTELTIILQGLDGPVFTQPKYITI---------LKEGEPIGTNVISIEAA 1654

Query: 392  DP--DDGDFAHVNVSLEGGEGH----FALSTQDSVIYLVCVARRLDREERDA-YNLRVTA 444
             P   +    +  VS+   E      F +     +I    +   LDRE+    Y + V A
Sbjct: 1655 SPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRHTGIIQTAAI---LDREQGACLYLVDVYA 1711

Query: 445  TDSGSPPLRAEAAFV-LHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQG 503
             +  +   R + A V + + D+NDN P F   +     + E    GS ++++TA D D+G
Sbjct: 1712 IEKSTAFPRTQRAEVEITLQDINDNPPVFPTDML-DLTVEENIGDGSKIMQLTAMDADEG 1770

Query: 504  TNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSAT 563
             N  VTY++  GA    F IDP SG +     LD E   +  L+V A DG     +S   
Sbjct: 1771 ANALVTYTIISGADDS-FRIDPESGDLIATRRLDRERRSKYSLLVRADDG---LQSSDMR 1826

Query: 564  VSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGS 623
            +++ + DVND+ P+F R  Y+  +PE T PG+    + ATD DSG  G ++Y +      
Sbjct: 1827 INITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNE---D 1883

Query: 624  SGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMVYVKVFLSDENDNPP 683
                 F ++  +G    TR LD +     +  TV A DGGG  + + V   + D NDNPP
Sbjct: 1884 DEDGIFFLNPITGVFNLTRLLDYEV-QQYYILTVRAEDGGGQFTTIRVYFNILDVNDNPP 1942

Query: 684  QFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLT 743
             F    Y+ S+    P G+ VL     D D G + +L+Y I +G+S   FT+D+ +G+L 
Sbjct: 1943 IFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTVDK-NGVLK 2001

Query: 744  VAWPLARRANSVVQLEIGAEDGGGLQAE---PSARVDISIVPGTPTPPIFEQLQYVFSVP 800
            V   L R + S   L +   D   + A     +A+V I ++     PP F   +  + +P
Sbjct: 2002 VLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTY-IP 2060

Query: 801  EDVAPGTSVGIVQAHNP---PGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELL 857
            E+    T V   QA +P   P      TL    G+    FS+  + G ++    LDRE +
Sbjct: 2061 ENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNK---FSIGTIDGEVRLTGELDREEV 2117

Query: 858  GPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLR 917
                   V    G P   +   V V++ D+NDN+P F      V +  NT  GT I  + 
Sbjct: 2118 SNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVF 2177

Query: 918  ALDPDSGVNSRVTFTLLAGGGGA-FTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSP 976
            A D D G N +V + ++ G     F +D  TG + + +PL     P + L ++A D GS 
Sbjct: 2178 AADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGST 2237

Query: 977  PRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGT-TAGTQVLQVQAQAPDGGP---I 1032
            PRT    + +V+ D+      P F    Y V++P    T    +LQV A+  D G    +
Sbjct: 2238 PRTDTSTVSIVLLDIND--FVPVFELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKL 2295

Query: 1033 TYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVR 1092
            +Y L      + F L   SG L V  +LDRE +E ++L + A       L   TGT T+ 
Sbjct: 2296 SYVLFGGNEDNAFTLSA-SGELGVTQSLDRETKERFVLMITATDSGSPAL---TGTGTIN 2351

Query: 1093 VSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSK 1152
            V + + N++ P  +    F  + E+ P GT V  V A+D D+  N  +     ++   + 
Sbjct: 2352 VIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVI-----RIIGGNS 2406

Query: 1153 AFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSP-PRSTTGTVHVAVLDLNDNSPTF 1211
             F I+P TG++ T   LDRE + +Y L+V   D GSP P S++ +V V V D+NDN P F
Sbjct: 2407 QFTINPSTGQIITSALLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRF 2466

Query: 1212 LQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHSG 1271
                          +P    PG+ V  +   D D G N  + Y+L+G  SE F + P  G
Sbjct: 2467 QHHPYVT------HIPSPTLPGSFVFAVTVTDADIGPNSELHYSLSGRNSEKFHIDPLRG 2520

Query: 1272 ELLTAAPLIRAERPHYVLTLSAH--DQGSPPRSASLQLLVQVL-----PSARLAEPPPDL 1324
             ++ A PL  A      +T S H  D GS P++ S  + V+ +     P  R  E     
Sbjct: 2521 AIMAAGPLNGASE----VTFSVHVKDGGSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMF 2576

Query: 1325 AERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAA 1384
             E  P + +   +T ++  G             EP     ++Y +  G +   TF +D  
Sbjct: 2577 PENQPVSSLVTTITGSSLRG-------------EP-----MSYYIASG-NLGNTFQIDQL 2617

Query: 1385 SGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDPLALA 1444
            +G++ +++PLDFE    +       +G     +   ++ + V D N++AP F  DP    
Sbjct: 2618 TGQVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISE 2677

Query: 1445 LPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRE 1504
            + EN  P   L T  A D D  GPN  + Y ++       +  ++  TG + + R LDRE
Sbjct: 2678 ILENLSPRKIL-TVSAMDKDS-GPNGQLDYEIVNGNME-NSFSINHATGEIRSVRPLDRE 2734

Query: 1505 TTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQPPGPAA 1564
                 +L ++++D+    S  ++  V   + + DENDNAP F+      +PE+ P G   
Sbjct: 2735 KVSHYVLTIKSSDK---GSPSQSTSVKVMINILDENDNAPRFSQIFSAHVPENSPLGYTV 2791

Query: 1565 LHVVARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDH 1624
              V   D D+G  A   Y +       F ++ STG + + RPL+RE    + + V A D 
Sbjct: 2792 TRVTTSDEDIGINAISRYSIMDASLP-FTINPSTGDIVISRPLNREDTDRYRIRVSAHDS 2850

Query: 1625 GSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQV 1684
            G    + +  +T+ V D+ND AP F +  Y +   E    G+ +  + ATDPD G+NGQV
Sbjct: 2851 GW---TVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQV 2907

Query: 1685 TYGGVS-SESFSLDPDTGVLTTLRALDREEQ---EEINLT-----VYAQDRGSPPQLTHV 1735
             Y   S SE F ++  TG +   + L  +       +N+      V + DRG P  ++  
Sbjct: 2908 FYFIKSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISET 2967

Query: 1736 TVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQT--LTMLRASDPDVGANGQLQYRILDGD 1793
            TV + + D ND+AP F  +     V +     T  + +    D D G N +++Y I + +
Sbjct: 2968 TVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDN 3027

Query: 1794 PSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAP 1853
              G F LD  +G       L  ++   F + + A+D G P LS+   + +TV + N H P
Sbjct: 3028 HLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTP 3087

Query: 1854 AFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTA-GAFLLEPSSGELR 1912
             F     S  +PE    G+++  + A D DA  NG + Y + +G   G F +  S+G L 
Sbjct: 3088 EFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILT 3147

Query: 1913 TAAALDREQCPSYTFSVSAVDGAAAGPLSTT--VSVTITVRDVNDHAPTFPTSPLRLRLP 1970
             A ALD E C  +  ++SA+DG   G ++ T   SVT+ V DVND++P F +      + 
Sbjct: 3148 LAKALDYELCQKHEMTISAIDG---GWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVL 3204

Query: 1971 RPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALG 2030
               PS +T    +  L A D D+G NA I Y +  +      +D  TG I          
Sbjct: 3205 ENAPSGTT----VIHLNATDADSGTNAVIAYTVQSSDSDLFVIDPNTGVITTQGFLDFET 3260

Query: 2031 PRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSP 2090
             +   L + A ++    R +   + + L+G  E  PRF        I E AP GT +   
Sbjct: 3261 KQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEV 3320

Query: 2091 RAVHAG-GTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESG 2149
             A     GT+G + Y I   + K  F I   TG I V     LD E   R+ L + A++ 
Sbjct: 3321 FASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGI--LDREKEERVSLKVLAKNF 3378

Query: 2150 GAFAFT-----VLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQ-GSG 2203
            G+          + +T+ DAND  P F    Y   + E  P+   +  V A D D   S 
Sbjct: 3379 GSIRGADIDEVTVNVTVLDAND-PPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSW 3437

Query: 2204 GQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATL 2263
             + SY + +     G F ++P TG IT TA LDRE      L ++A D G+P+  GSA+L
Sbjct: 3438 SRFSYFIGSGNE-NGAFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSATGSASL 3496

Query: 2264 TVMVIDTNDNRPTIPQPWELRVSEDALLGSEIAQVTGNDVD----SGPVLWYVLSPSGPQ 2319
             V + D NDN P +    E  V E+   G+ +  +   D D     GP  +Y+LS +GP 
Sbjct: 3497 LVTLEDINDNGPMLTVS-EGEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLS-TGPA 3554

Query: 2320 DPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDG-----PHEGRANLTVLVEDVNDNAP 2374
              +      G +S T  +D EQ   + L ++  D         G  ++TV+  D NDN  
Sbjct: 3555 TSYFSLSTAGVLSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVI--DQNDNPS 3612

Query: 2375 AFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHIS 2412
                    V    +  PG  + SV   D D   + H S
Sbjct: 3613 QSRTVEIFVNYYGNLFPGGILGSVKPQDPDVLDSFHCS 3650



 Score =  502 bits (1292), Expect = e-141
 Identities = 476/1669 (28%), Positives = 738/1669 (44%), Gaps = 105/1669 (6%)

Query: 88   VGTDLAIDEHSGVVRTARVLDREQRDRYRFTAVTPD------GATVEVTVRVADINDHAP 141
            +G   +I    G VR    LDRE+   Y  T V  D       ++ EV V V DIND+ P
Sbjct: 2093 LGNKFSIGTIDGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNP 2152

Query: 142  AFPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDG 201
             F QA   +++ E+T  GT      A D D G  G   Y +      + FR+++  G   
Sbjct: 2153 IFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGA-- 2210

Query: 202  TPVPELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYH 261
                 + V   LDRE    Y L ++A D GS PR   + + + LLDIND  P F  S Y 
Sbjct: 2211 -----ITVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFELSPYS 2265

Query: 262  AVVSESLAP-GSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPL 320
              V E+L      +LQV A D D G N  ++Y +       D  F++ A +G L + + L
Sbjct: 2266 VNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNE--DNAFTLSA-SGELGVTQSL 2322

Query: 321  DFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAP 380
            D E +    L++ A D G+    G+  + V V D NDN P+    F S      + E AP
Sbjct: 2323 DRETKERFVLMITATDSGSPALTGTGTINVIVDDVNDNVPT----FASKAYFTTIPEDAP 2378

Query: 381  PGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNL 440
             G  V  ++ SD D    A + +   GG   F ++     I    +   LDRE +D Y L
Sbjct: 2379 TGTDVLLVNASDADASKNAVIRII--GGNSQFTINPSTGQIITSAL---LDRETKDNYTL 2433

Query: 441  RVTATDSGSP-PLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARD 499
             V  +D+GSP PL +  + ++ VTDVNDN P F    Y    +P   LPGSFV  VT  D
Sbjct: 2434 VVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTH-IPSPTLPGSFVFAVTVTD 2492

Query: 500  PDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLA 559
             D G N ++ YSL+ G ++  F IDP  G I  A  L+   E      V   DGG  P  
Sbjct: 2493 ADIGPNSELHYSLS-GRNSEKFHIDPLRGAIMAAGPLNGASEVT--FSVHVKDGGSFPKT 2549

Query: 560  SSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGA 619
             S TV+V   +  D  P+ +        PE     +    +T +     P   +SY + +
Sbjct: 2550 DSTTVTVRFVNKADF-PKVRAKEQTFMFPENQPVSSLVTTITGSSLRGEP---MSYYIAS 2605

Query: 620  G-LGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMVYVKVFLS-- 676
            G LG++    F+ID  +G V  ++ LD ++    +   + A DGG      Y K+ ++  
Sbjct: 2606 GNLGNT----FQIDQLTGQVSISQPLDFEK-IQKYVVWIEARDGGFPPFSSYEKLDITVL 2660

Query: 677  DENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLD 736
            D NDN P F    + + I     P   +L + A D D G +G+L Y I+ GN    F+++
Sbjct: 2661 DVNDNAPIFKEDPFISEILENLSP-RKILTVSAMDKDSGPNGQLDYEIVNGNMENSFSIN 2719

Query: 737  EQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYV 796
              +G +    PL R   S   L I + D G      S +V I+I+      P F Q+ + 
Sbjct: 2720 HATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRFSQI-FS 2778

Query: 797  FSVPEDVAPGTSVGIVQAHNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDREL 856
              VPE+   G +V  V   +    +  ++   S  D    F+++  +G +   RPL+RE 
Sbjct: 2779 AHVPENSPLGYTVTRVTTSDEDIGINAIS-RYSIMDASLPFTINPSTGDIVISRPLNRE- 2836

Query: 857  LGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTL 916
                    +R  +          V + + D+NDN+P F      +  P  T  G+ +  +
Sbjct: 2837 --DTDRYRIRVSAHDSGWTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQV 2894

Query: 917  RALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHV---RLMRPLGPSGGP-----AHELEL 968
             A DPD G N +V F  +      F ++ TTG +   ++++    +G        H   +
Sbjct: 2895 FATDPDEGSNGQV-FYFIKSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIV 2953

Query: 969  EARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQA-QAP 1027
             + D G P   S     V +  V +   AP+F    Y   +      GT++++V A    
Sbjct: 2954 TSSDRGKPSLISE--TTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDK 3011

Query: 1028 DGG---PITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQ 1084
            D G    + Y ++ +     F L+  +GW+ V ++L  +  + + + V A       L  
Sbjct: 3012 DFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSS 3071

Query: 1085 QTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSL 1144
            Q   ATV +++  +N H+P  S+      + E+   G+ V  V A DRD+  NG + YS+
Sbjct: 3072 Q---ATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSI 3128

Query: 1145 QQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDL 1204
               +E+   F I+  TG +T  + LD E    +++ +   DGG   R+   +V V V+D+
Sbjct: 3129 SSGNEEG-IFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDV 3187

Query: 1205 NDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELF 1264
            NDNSP FL             V +  P GT V  L A D D G N  I YT+    S+LF
Sbjct: 3188 NDNSPVFLSDDYFP------TVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDLF 3241

Query: 1265 SLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDL 1324
             + P++G + T   L    +  Y LT+ A +     R +   + +Q+  +    E  P  
Sbjct: 3242 VIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTN---EYVPRF 3298

Query: 1325 AERDPAAPVPVVLTVTAAEGLRPGSLLGSV-AAPEPAGVGALTYTLVGGADPEGTFALDA 1383
              +        +     +E    G+++G V A+    G     + L+ G   +  F ++ 
Sbjct: 3299 VSK--------LYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINK 3350

Query: 1384 ASGRLYLARPLDFEAGPPWRALTVRAEGPG---GAGARLLRVQVQVQDENEHAPAFARDP 1440
             +G++Y++  LD E      +L V A+  G   GA    + V V V D N+  P F  + 
Sbjct: 3351 KTGQIYVSGILDREKEERV-SLKVLAKNFGSIRGADIDEVTVNVTVLDAND-PPIFTLNI 3408

Query: 1441 LALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRG 1500
             ++ + E    G  +    A D+D     S   Y  +       A  ++ +TG ++    
Sbjct: 3409 YSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSY-FIGSGNENGAFSINPQTGQITVTAE 3467

Query: 1501 LDRETTPALLLLVEATDRPANASRRRAARVSARVFVT--DENDNAPVFASPSRVRLPEDQ 1558
            LDRET P   L V A D     S   +A  SA + VT  D NDN P+  + S   + E++
Sbjct: 3468 LDRETLPIYNLSVLAVD-----SGTPSATGSASLLVTLEDINDNGPML-TVSEGEVMENK 3521

Query: 1559 PPGPAALHVVARDPDL--GEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHV 1616
             PG   + + + DPDL   +     Y L++G    +   S+ G LS  R +DREQ A+  
Sbjct: 3522 RPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSLSTAGVLSTTREIDREQIADFY 3581

Query: 1617 LTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDP 1676
            L+VV  D G P  S+T  + ++V D ND     +  E  V    N  PG  L +++  DP
Sbjct: 3582 LSVVTKDSGVPQMSSTGTVHITVIDQNDNPSQSRTVEIFVNYYGNLFPGGILGSVKPQDP 3641

Query: 1677 DVGANGQVTYGGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQD 1725
            DV  +   +     +  FS+    G    L +  R      +LTV + D
Sbjct: 3642 DVLDSFHCSLTSGVTSLFSI---PGGTCDLNSQPRSTDGTFDLTVLSND 3687



 Score =  172 bits (435), Expect = 6e-42
 Identities = 153/542 (28%), Positives = 237/542 (43%), Gaps = 58/542 (10%)

Query: 2385 LLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTLFTIVGTVALGHDG 2444
            +LE  PPG+ + ++             +Y L+     F+++ + G L+T   T+      
Sbjct: 51   VLEEQPPGTLVGTIQTRPG-------FTYRLSESHALFAINSSTGALYT-TSTIDRESLP 102

Query: 2445 SGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTL 2504
            S  +++V+ +     P       V V ++D ND+AP F      V   ED   G  ++  
Sbjct: 103  SDVINLVVLSSAPTYP-----TEVRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILD 157

Query: 2505 EATDAD-GSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFE 2563
             ATD+D GS       Y II GN    F+L+  L  +GE A         LV    LD E
Sbjct: 158  TATDSDIGSNGVDHRSYRIIRGNEAGRFRLDITLNPSGEGA------FLHLVSKGGLDRE 211

Query: 2564 SLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLH 2623
               QY L V   D+G+P +   + V VTV D+NDNPPVF  + Y+  VPED  VG+ +L 
Sbjct: 212  VTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQ 271

Query: 2624 VEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPA 2683
            V A+DAD G +  +R+ +   D    F++D  +G + +   LD E + ++ L VQA D  
Sbjct: 272  VAAADADEGTNADIRYRLQ--DEGTPFQMDPETGLITVREPLDFEARRQYSLTVQAMDRG 329

Query: 2684 GAHF-ALAPVTIEVQDVNDHGPA-----FPLNLLSTSVAENQPPGTLVTTLHAIDGDA-G 2736
                   A   I++ DVND+ P      FP      SV EN   GT+V  L   D D+  
Sbjct: 330  VPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPA 389

Query: 2737 AFGRLRYSLLEAGPGPEGREAFALNSS----TGELRARVPFDYEHTESFRLLVGAAD--- 2789
            A G +   +L    G   +  F + SS       ++     D E   S+ L V  +D   
Sbjct: 390  ANGNISVQIL----GGNEQRHFEVQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYG 445

Query: 2790 ------AGNLSASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGG 2843
                      S+  ++ + V   +++ PVF    +   + E A  G  +  + ATD D G
Sbjct: 446  APPGAAVQARSSVASLVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSG 505

Query: 2844 ADGLVLYSLATSSPYFGINQTTGALYLRVDSRAPGSGTATSGGGGRTRREAPRELRLEVI 2903
             +  + YS+ + +         G  +  +      SG  T+G  G   RE   ++ L + 
Sbjct: 506  LNANLRYSIVSGN---------GLGWFHISEH---SGLVTTGSSGGLDRELASQIVLNIS 553

Query: 2904 AR 2905
            AR
Sbjct: 554  AR 555



 Score = 35.8 bits (81), Expect = 0.72
 Identities = 36/141 (25%), Positives = 59/141 (41%), Gaps = 27/141 (19%)

Query: 23   LPLLLLLLLLLGAGVPGAWGQAGSL----------------DLQIDEEQPAGTLIGDISA 66
            LP+  L +L + +G P A G A  L                + ++ E +  GTL+  + +
Sbjct: 3473 LPIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPMLTVSEGEVMENKRPGTLVMTLQS 3532

Query: 67   GLP--AGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDREQRDRYRFTAVTPD- 123
              P       P  Y++ +   +G  T       +GV+ T R +DREQ   +  + VT D 
Sbjct: 3533 TDPDLPPNQGPFTYYLLS---TGPATSYFSLSTAGVLSTTREIDREQIADFYLSVVTKDS 3589

Query: 124  -----GATVEVTVRVADINDH 139
                  +T  V + V D ND+
Sbjct: 3590 GVPQMSSTGTVHITVIDQNDN 3610



 Score = 35.4 bits (80), Expect = 0.94
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 3159 GSYNWDYLLSWCPQFQPLASVFTEIARLKDEA 3190
            G++NWD LL+W P F     VF ++A L ++A
Sbjct: 4926 GTFNWDNLLNWGPGFGHYVDVFKDLASLPEKA 4957


>gi|189571674 cadherin-like 23 isoform 1 precursor [Homo sapiens]
          Length = 3354

 Score =  922 bits (2383), Expect = 0.0
 Identities = 832/2834 (29%), Positives = 1281/2834 (45%), Gaps = 228/2834 (8%)

Query: 150  LQVPEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVV 209
            L + E T  G+      A+D D   L    + +SG+ A   F +E   G      P    
Sbjct: 40   LLISEDTPVGSSVTQLLAQDMDNDPLV---FGVSGEEASRFFAVEPDTGVVWLRQP---- 92

Query: 210  TGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLA 269
               LDRE +S + ++    D      R    +++ + D+ND+AP F+   Y   + E+  
Sbjct: 93   ---LDRETKSEFTVEFSVSDHQGVITRK---VNIQVGDVNDNAPTFHNQPYSVRIPENTP 146

Query: 270  PGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHE 329
             G+P+  V A+D D G  G+V Y            F+ID+  G++ + R LD+E  + ++
Sbjct: 147  VGTPIFIVNATDPDLGAGGSVLYSFQPPSQF----FAIDSARGIVTVIRELDYETTQAYQ 202

Query: 330  LVVQARDGGAHPELGS-AFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARI 388
            L V A D      L + A + + + D  D  P    IF++   S  + E +PPG  V  I
Sbjct: 203  LTVNATDQDKTRPLSTLANLAIIITDVQDMDP----IFINLPYSTNIYEHSPPGTTVRII 258

Query: 389  SVSDPDDGDFAHVNVSLEGGEGH--FALSTQDSVIYLVCVARRLDREERDAYNLRVTATD 446
            +  D D G    +  ++  G  +  FAL     V+ L  +  R +      + L V  T+
Sbjct: 259  TAIDQDKGRPRGIGYTIVSGNTNSIFALDYISGVLTLNGLLDRENPLYSHGFILTVKGTE 318

Query: 447  SGSPPLRAEA----AFVLHVTDVNDNAPAFDRQLYRP--EPLPEVALPGSFVVRVTARDP 500
                   ++A     F + V D+NDNAP F+   Y      L +V       ++V  +D 
Sbjct: 319  LNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDE 378

Query: 501  DQGTNGQVTYSLAPGAHTHWFSIDPTSG------IITTAASLDYELEPQPQLIVVATDGG 554
            + G N      L  G ++H F I PTS        I  A  LDYE   +    + A +  
Sbjct: 379  NLGLNSMFEVYLV-GNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANE-S 436

Query: 555  LPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLS 614
            +P     A V + L + NDN P F +  YN SL E    GT  L V ATD D+G FG +S
Sbjct: 437  VPDHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVLTVLATDNDAGTFGEVS 496

Query: 615  YSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMVYVKVF 674
            Y       S     F +D  +G +     LD +     F  T+ A DGGG ++   V++ 
Sbjct: 497  YFF-----SDDPDRFSLDKDTGLIMLIARLDYEL-IQRFTLTIIARDGGGEETTGRVRIN 550

Query: 675  LSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLF- 733
            + D NDN P F    Y  ++    P  T ++RLRA D D   + +++Y I++ ++   + 
Sbjct: 551  VLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNQITYSIVSASAFGSYF 610

Query: 734  --TLDEQSGLLTVAWPL--ARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPI 789
              +L E  G+++V+ PL   + +N ++ L + A D G      +  V I +      PP 
Sbjct: 611  DISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIEVFDENDNPPT 670

Query: 790  FEQLQYVFSVPEDVAPGTSVGIVQA----HNPPGRLAPVTLSLSGGDPRGLFSLDAVSGL 845
            F +  Y  SV E++  G +V  + A     +       +  SL G      F ++A SG 
Sbjct: 671  FSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESIIYSLEGSTQ---FRINARSGE 727

Query: 846  LQTLRPLDRELLGPVLELEVRA---GSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVL 902
            + T   LDRE     + L VRA   G G      +A V + L D+NDN P +      + 
Sbjct: 728  ITTTSLLDRETKSEYI-LIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKDAPYYIN 786

Query: 903  LPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGP 962
            L   T P + + T+ A+DPD G N  + ++ +      ++++ TTG +R    +     P
Sbjct: 787  LVEMTPPDSDVTTVVAVDPDLGENGTLVYS-IQPPNKFYSLNSTTGKIRTTHAMLDRENP 845

Query: 963  -AHELEL------EARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTA 1015
              HE EL         D G PP  +     V V  +      P F +  +  ++  G  A
Sbjct: 846  DPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVLEGIPA 905

Query: 1016 GTQVLQVQAQAPD---GGPITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKV 1072
            G  + QV A   D    G ++Y +        F +   SG +     LDRE    Y L+V
Sbjct: 906  GVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSSGVVVTTTELDRERIAEYQLRV 965

Query: 1073 MAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDR 1132
            +A   S A    ++ T+T+ + +L+ N+ +P        ++V+E+ P    V  +  TD 
Sbjct: 966  VA---SDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDN 1022

Query: 1133 DSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRS 1192
            D G N  L+Y +   + D K F +  +   V T+  LDRE  ++Y L+++  D G   + 
Sbjct: 1023 DVGLNAELSYFITGGNVDGK-FSVGYRDAVVRTVVGLDRETTAAYMLILEAIDNGPVGKR 1081

Query: 1193 TTG--TVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENG 1250
             TG  TV V VLD+NDN P FLQ+S  A       VP+ +P G  +  L+A D DEGE G
Sbjct: 1082 HTGTATVFVTVLDVNDNRPIFLQSSYEA------SVPEDIPEGHSILQLKATDADEGEFG 1135

Query: 1251 TILY-TLTGPGSELFSLHPHSGELLTA-APLIRAERPHYVLTLSAHDQGSPPRSASLQLL 1308
             + Y  L G     F +H  +G L+    PL R     +VL + A++    P  +S++++
Sbjct: 1136 RVWYRILHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAYNHDLGPMRSSVRVI 1195

Query: 1309 VQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYT 1368
            V V     + +  P   ++  +      L +    G+    ++      +    G + Y 
Sbjct: 1196 VYV---EDINDEAPVFTQQQYSR-----LGLRETAGIGTSVIVVQATDRDSGDGGLVNYR 1247

Query: 1369 LVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQD 1428
            ++ GA  EG F +D ++G +     LD+E    +       +           V + + +
Sbjct: 1248 ILSGA--EGKFEIDESTGLIITVNYLDYETKTSYMMNVSATDQAPPFNQGFCSVYITLLN 1305

Query: 1429 ENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRL 1488
            E + A  F+      A+ EN   G  +   +A   D        R+            ++
Sbjct: 1306 ELDEAVQFSNASYEAAILENLALGTEIVRVQAYSIDNLN-QITYRFNAYTSTQAKALFKI 1364

Query: 1489 DARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAP--VF 1546
            DA TG ++    +DRE      L V A D       +  + V   + V DENDN+P   F
Sbjct: 1365 DAITGVITVQGLVDREKGDFYTLTVVADD----GGPKVDSTVKVYITVLDENDNSPRFDF 1420

Query: 1547 ASPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGG-DGHFRL---HSSTGALS 1602
             S S V +PED P G     V A DPD G   +V + LASG   G F +   + S G + 
Sbjct: 1421 TSDSAVSIPEDCPVGQRVATVKAWDPDAGSNGQVVFSLASGNIAGAFEIVTTNDSIGEVF 1480

Query: 1603 VVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQ-EYSVLLREN 1661
            V RPLDRE+   ++L VVASD G+PPR    +L V++ D+ND  P  +    Y+V + EN
Sbjct: 1481 VARPLDREELDHYILQVVASDRGTPPRKKDHILQVTILDINDNPPVIESPFGYNVSVNEN 1540

Query: 1662 NPPGTSLLTLRATDPDVGANGQVTY---GGVSSESFSLDPDTGVLTTLRA-LDREEQEEI 1717
               GT+++ +RATD D+G N  ++Y    G    +F +D  +G + T  A  DRE Q   
Sbjct: 1541 VGGGTAVVQVRATDRDIGINSVLSYYITEGNKDMAFRMDRISGEIATRPAPPDRERQSFY 1600

Query: 1718 NLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDP--QTLTMLRAS 1775
            +L    +D G+P       V V + DEND+AP F   H  + + EG D    +L  ++A 
Sbjct: 1601 HLVATVEDEGTPTLSATTHVYVTIVDENDNAPMFQQPHYEVLLDEGPDTLNTSLITIQAL 1660

Query: 1776 DPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPAL 1835
            D D G NG + Y I+ G+    F +D   G     + LD E+       I       P L
Sbjct: 1661 DLDEGPNGTVTYAIVAGNIVNTFRIDRHMGVITAAKELDYEISHGRYTLIVTATDQCPIL 1720

Query: 1836 SATLLLTVTVL----DANDHAPAFPVPAYS-VEVPEDVPAGTLLLQLQAHDPDAGANGHV 1890
            S  L  T TVL    D ND+ P FP       EV E  P G  +    AHD D+G NG V
Sbjct: 1721 SHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFEVTEGQP-GPRVWTFLAHDRDSGPNGQV 1779

Query: 1891 TYYLGAG-TAGAFLLEPSSGELRTA--AALDREQCPSYTFSVSAVDGAAAGPLSTTVSVT 1947
             Y +  G   G F++ P  G LR      LDRE    Y  ++ A D     PLS+T+ V 
Sbjct: 1780 EYSIMDGDPLGEFVISPVEGVLRVRKDVELDRETIAFYNLTICARD-RGMPPLSSTMLVG 1838

Query: 1948 ITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRL-AGT 2006
            I V D+ND+ P     P+ + +    P  S     +A + A D D+G NA + + + AG 
Sbjct: 1839 IRVLDINDNDPVLLNLPMNITISENSPVSS----FVAHVLASDADSGCNARLTFNITAGN 1894

Query: 2007 PPPGTTVDSYTGEIRVARSPVALGPRDRV----LFIVATD---LGRPARSATGVIIVGLQ 2059
                  +++ TG + V R P+    R+R+    L I   D     R AR    ++++ L 
Sbjct: 1895 RERAFFINATTGIVTVNR-PL---DRERIPEYKLTISVKDNPENPRIARRDYDLLLIFLS 1950

Query: 2060 GEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHAGGTNGPI-------------TYSI 2106
             E +  P F +++ +A + EN+P GTP+           NGPI             TY +
Sbjct: 1951 DENDNHPLFTKSTYQAEVMENSPAGTPLTV--------LNGPILALDADQDIYAVVTYQL 2002

Query: 2107 LSGNEKGTFSIQPSTGAITVRSAEGLDFEV--SPRLRLVLQAESGGAFAFTV-LTLTLQD 2163
            L G + G F I  STG +TVRS   +D E    P L L+L AE  G    T  L +T+ D
Sbjct: 2003 L-GAQSGLFDINSSTGVVTVRSGVIIDREAFSPPILELLLLAEDIGLLNSTAHLLITILD 2061

Query: 2164 ANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVD 2223
             NDN P F        L E+ P    +LQV A D D G  G++ Y + A    R L H+ 
Sbjct: 2062 DNDNRPTFSPATLTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQDRFLIHL- 2120

Query: 2224 PTTGTITT-TAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQPWE 2282
              TG I    A +DRE     RL ++ATDRG+  L G+A +T+++ D ND+RP    P +
Sbjct: 2121 -VTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEFLNPIQ 2179

Query: 2283 -LRVSEDALLGSEIAQVTGNDVDSGPVLWYVL-----------SPSGPQDPFSVGRYGGR 2330
             + V E A  G+ IA +T  D D  P L Y +                +D F+V    G 
Sbjct: 2180 TVSVLESAEPGTVIANITAIDHDLNPKLEYHIVGIVAKDDTDRLVPNQEDAFAVNINTGS 2239

Query: 2331 VSLTGPLDFEQCDRYQLQLLAHDGPHE--------GRANLTVLVEDVNDNAPAFSQ---S 2379
            V +  P++ E    Y++ L   D   +          A LTV V DVNDN P F     +
Sbjct: 2240 VMVKSPMNRELVATYEVTLSVIDNASDLPERSVSVPNAKLTVNVLDVNDNTPQFKPFGIT 2299

Query: 2380 LYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTLFTIVGTVA 2439
             Y   +LE   PG+ +++V+A D D G NG ++Y L        V   + +   ++    
Sbjct: 2300 YYMERILEGATPGTTLIAVAAVDPDKGLNGLVTYTLLDLVPPGYVQLEDSSAGKVIANRT 2359

Query: 2440 LGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGS 2499
            + ++    ++  + A D+G+P RAA   V++++ D ND+ P F    Y+ AV ED+P G+
Sbjct: 2360 VDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDVPVGT 2419

Query: 2500 TLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEP 2559
             +LT+ ATDAD S + A ++YS+  G+    F + P                G + +L  
Sbjct: 2420 IILTVTATDAD-SGNFALIEYSL--GDGESKFAINP--------------TTGDIYVLSS 2462

Query: 2560 LDFESLTQYNLTVAAADR----GQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDT 2615
            LD E    Y LT  A D         + + V V + VLDVND  P F++  +  +V E+ 
Sbjct: 2463 LDREKKDHYILTALAKDNPGDVASNRRENSVQVVIQVLDVNDCRPQFSKPQFSTSVYENE 2522

Query: 2616 PVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQL 2675
            P G  ++ + A+D D GP+G + +++  G     F +D  SG +     L  ++  +  L
Sbjct: 2523 PAGTSVITMMATDQDEGPNGELTYSL-EGPGVEAFHVDMDSGLVTTQRPL--QSYEKFSL 2579

Query: 2676 VVQAADPAGAH-FALAPVTIEVQDVNDHGPAF--PLNLLSTSVAENQPPGTLVTTLHAID 2732
             V A D      +    + +EV DVND+ P F  P N     + E  P  + V  ++A D
Sbjct: 2580 TVVATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIREEIPLRSNVYEVYATD 2639

Query: 2733 GDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAADAGN 2792
             D G  G +RYS L+   G    E F ++  +G ++     D E    + L++ A+D G 
Sbjct: 2640 KDEGLNGAVRYSFLKTA-GNRDWEFFIIDPISGLIQTAQRLDRESQAVYSLILVASDLGQ 2698

Query: 2793 ---LSASVTVSVLVTGEDEYDPVFLAP---AFHFQ---VPEGARRGHSLGHVQ-ATDEDG 2842
                     + V +   D+ +P+F+ P   +  +Q   VPE + RG  +G+V  A D D 
Sbjct: 2699 PVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADE 2758

Query: 2843 GADGLVLYSLATSS 2856
            G + +V Y +A  +
Sbjct: 2759 GPNAIVYYFIAAGN 2772



 Score =  831 bits (2147), Expect = 0.0
 Identities = 838/2969 (28%), Positives = 1298/2969 (43%), Gaps = 254/2969 (8%)

Query: 37   VPGAWGQAGSLD----------LQIDEEQPAGTLIGDISAGLPAGTAAPLMYFISAQEGS 86
            + G WGQ   L           L I E+ P G+ +  + A        PL++ +S +E S
Sbjct: 18   ISGCWGQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLAQDMDND--PLVFGVSGEEAS 75

Query: 87   GVGTDLAIDEHSGVVRTARVLDREQRDRY--RFTAVTPDGA-TVEVTVRVADINDHAPAF 143
                  A++  +GVV   + LDRE +  +   F+     G  T +V ++V D+ND+AP F
Sbjct: 76   RF---FAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTF 132

Query: 144  PQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTP 203
                 ++++PE+T  GT   +  A D D G  G+  Y  S     + F +++  G     
Sbjct: 133  HNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLY--SFQPPSQFFAIDSARG----- 185

Query: 204  VPELVVTGELDRENRSHYMLQLEAYD-GGSPPRRAQALLDVTLLDINDHAPAFNQSRYHA 262
               + V  ELD E    Y L + A D   + P    A L + + D+ D  P F    Y  
Sbjct: 186  --IVTVIRELDYETTQAYQLTVNATDQDKTRPLSTLANLAIIITDVQDMDPIFINLPYST 243

Query: 263  VVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDF 322
             + E   PG+ V  + A D D G    + Y I       +  F++D  +G+L L   LD 
Sbjct: 244  NIYEHSPPGTTVRIITAIDQDKGRPRGIGYTI--VSGNTNSIFALDYISGVLTLNGLLDR 301

Query: 323  EQRRVHE---LVVQARDGGAHPELGSAFVT----VHVRDANDNQPSMTVIFLSADGSPQV 375
            E         L V+  +         A VT    + V D NDN P     F S++ S  +
Sbjct: 302  ENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPE----FNSSEYSVAI 357

Query: 376  SEAAPPG-QLVARISVSDPDD--GDFAHVNVSLEGGEGHFAL----STQDSVIYLVCVAR 428
            +E A  G  L   I V D D+  G  +   V L G   H  +    S Q      + VA 
Sbjct: 358  TELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAI 417

Query: 429  RLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALP 488
             LD E  D Y+  + A +S  P     A   + + + NDN P F + LY    L E    
Sbjct: 418  PLDYETVDRYDFDLFANES-VPDHVGYAKVKITLINENDNRPIFSQPLYNIS-LYENVTV 475

Query: 489  GSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIV 548
            G+ V+ V A D D GT G+V+Y  +       FS+D  +G+I   A LDYEL  +  L +
Sbjct: 476  GTSVLTVLATDNDAGTFGEVSYFFSDDPDR--FSLDKDTGLIMLIARLDYELIQRFTLTI 533

Query: 549  VATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSG 608
            +A DGG     ++  V + + DVNDN P FQ+  Y  +L E     T  +++ ATD DS 
Sbjct: 534  IARDGG--GEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSP 591

Query: 609  PFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDF-TVTAVDGGG--L 665
            P   ++YS+ +           +    G +  +R LD +Q  +   + TV A+D G   L
Sbjct: 592  PNNQITYSIVSASAFGSYFDISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPL 651

Query: 666  KSMVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHIL 725
             S V V + + DENDNPP F    Y  S+      G  VL L A D D+         I 
Sbjct: 652  NSTVPVTIEVFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESIIY 711

Query: 726  AGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDG--GGLQAEPSARVDISIVPG 783
            +      F ++ +SG +T    L R   S   L + A DG  G  Q    A V+I+++  
Sbjct: 712  SLEGSTQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDI 771

Query: 784  TPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPP-GRLAPVTLSLSGGDPRGLFSLDAV 842
                P ++   Y  ++ E   P + V  V A +P  G    +  S+    P   +SL++ 
Sbjct: 772  NDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIQ--PPNKFYSLNST 829

Query: 843  SGLLQTLR---------PLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPA 893
            +G ++T           P + EL+  ++      G     A + A V V L D+NDN P 
Sbjct: 830  TGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPT 889

Query: 894  FPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGA-FTVDPTTGHVRL 952
            F        +      G  IY + A+D D G+N  V++ +  G     F ++ ++G V  
Sbjct: 890  FQNLPFVAEVLEGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSSGVVVT 949

Query: 953  MRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSG 1012
               L       ++L + A D G+P ++S   L + V DV      P F    Y V +   
Sbjct: 950  TTELDRERIAEYQLRVVASDAGTPTKSSTSTLTIHVLDVNDE--TPTFFPAVYNVSVSED 1007

Query: 1013 TTAGTQVLQVQAQAPDGG---PITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYI 1069
                 +V+ +     D G    ++Y +        F +  +   +     LDRE    Y+
Sbjct: 1008 VPREFRVVWLNCTDNDVGLNAELSYFITGGNVDGKFSVGYRDAVVRTVVGLDRETTAAYM 1067

Query: 1070 LKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFA 1129
            L + A+        + TGTATV V++L+ N++ P   +     +V E+ P G S+ ++ A
Sbjct: 1068 LILEAIDNGPVG-KRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSILQLKA 1126

Query: 1130 TDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTT-LQTLDREQQSSYQLLVQVQDGGS 1188
            TD D G  GR+ Y +         FRIH   G +    + LDRE+ SS+ L+V+  +   
Sbjct: 1127 TDADEGEFGRVWYRILH-GNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAYNHDL 1185

Query: 1189 PPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGE 1248
             P  ++  V V V D+ND +P F Q   +  G     + +    GT V  +QA D D G+
Sbjct: 1186 GPMRSSVRVIVYVEDINDEAPVFTQQQYSRLG-----LRETAGIGTSVIVVQATDRDSGD 1240

Query: 1249 NGTILYTLTGPGSELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLL 1308
             G + Y +       F +   +G ++T   L    +  Y++ +SA DQ  P       + 
Sbjct: 1241 GGLVNYRILSGAEGKFEIDESTGLIITVNYLDYETKTSYMMNVSATDQAPPFNQGFCSVY 1300

Query: 1309 VQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTY- 1367
            + +L          +  +   A+    +L     E L  G+ +  V A     +  +TY 
Sbjct: 1301 ITLLNEL------DEAVQFSNASYEAAIL-----ENLALGTEIVRVQAYSIDNLNQITYR 1349

Query: 1368 -TLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQV 1426
                     +  F +DA +G + +   +D E G  +  LTV A+  G      ++V + V
Sbjct: 1350 FNAYTSTQAKALFKIDAITGVITVQGLVDREKG-DFYTLTVVADDGGPKVDSTVKVYITV 1408

Query: 1427 QDENEHAPAF-ARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQE--PPV 1483
             DEN+++P F      A+++PE+   G  + T +A D D  G N  V + L         
Sbjct: 1409 LDENDNSPRFDFTSDSAVSIPEDCPVGQRVATVKAWDPDA-GSNGQVVFSLASGNIAGAF 1467

Query: 1484 PALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNA 1543
              +  +   G +   R LDRE     +L V A+DR    +  R      +V + D NDN 
Sbjct: 1468 EIVTTNDSIGEVFVARPLDREELDHYILQVVASDR---GTPPRKKDHILQVTILDINDNP 1524

Query: 1544 PVFASP--SRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGG-DGHFRLHSSTGA 1600
            PV  SP    V + E+   G A + V A D D+G  + +SY +  G  D  FR+   +G 
Sbjct: 1525 PVIESPFGYNVSVNENVGGGTAVVQVRATDRDIGINSVLSYYITEGNKDMAFRMDRISGE 1584

Query: 1601 LSV-VRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLR 1659
            ++    P DRE+++ + L     D G+P  SAT  + V++ D ND AP FQQ  Y VLL 
Sbjct: 1585 IATRPAPPDRERQSFYHLVATVEDEGTPTLSATTHVYVTIVDENDNAPMFQQPHYEVLLD 1644

Query: 1660 EN-NPPGTSLLTLRATDPDVGANGQVTYGGVSS---ESFSLDPDTGVLTTLRALDRE-EQ 1714
            E  +   TSL+T++A D D G NG VTY  V+     +F +D   GV+T  + LD E   
Sbjct: 1645 EGPDTLNTSLITIQALDLDEGPNGTVTYAIVAGNIVNTFRIDRHMGVITAAKELDYEISH 1704

Query: 1715 EEINLTVYAQDRGSPPQLTH-----VTVRVAVEDENDHAPTFGSAHLS-LEVPEGQDPQT 1768
                L V A D+   P L+H      TV V V D ND+ PTF   +    EV EGQ    
Sbjct: 1705 GRYTLIVTATDQ--CPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFEVTEGQPGPR 1762

Query: 1769 LTMLRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMR--PLDREVEPAFQLRIE 1826
            +    A D D G NGQ++Y I+DGDP G FV+    G     +   LDRE    + L I 
Sbjct: 1763 VWTFLAHDRDSGPNGQVEYSIMDGDPLGEFVISPVEGVLRVRKDVELDRETIAFYNLTIC 1822

Query: 1827 ARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGA 1886
            ARD G P LS+T+L+ + VLD ND+ P       ++ + E+ P  + +  + A D D+G 
Sbjct: 1823 ARDRGMPPLSSTMLVGIRVLDINDNDPVLLNLPMNITISENSPVSSFVAHVLASDADSGC 1882

Query: 1887 NGHVTYYLGAGT-AGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTT-- 1943
            N  +T+ + AG    AF +  ++G +     LDRE+ P Y  ++S  D      ++    
Sbjct: 1883 NARLTFNITAGNRERAFFINATTGIVTVNRPLDRERIPEYKLTISVKDNPENPRIARRDY 1942

Query: 1944 VSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRL 2003
              + I + D ND+ P F  S  +  +    P+ +  T+    + A D D    A + Y+L
Sbjct: 1943 DLLLIFLSDENDNHPLFTKSTYQAEVMENSPAGTPLTVLNGPILALDADQDIYAVVTYQL 2002

Query: 2004 AGTPPPGTTVDSYTGEIRVARSPV----ALGPRDRVLFIVATDLGRPARSATGVIIVGLQ 2059
             G       ++S TG + V    +    A  P    L ++A D+G    ++T  +++ + 
Sbjct: 2003 LGAQSGLFDINSSTGVVTVRSGVIIDREAFSPPILELLLLAEDIG--LLNSTAHLLITIL 2060

Query: 2060 GEAERGPRFPRASSEATIRENAPPGTPIVSPRAV-HAGGTNGPITYSILSGNEKGTFSIQ 2118
             + +  P F  A+    + EN PPG  ++   A     G NG + Y I +G  +  F I 
Sbjct: 2061 DDNDNRPTFSPATLTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAG-AQDRFLIH 2119

Query: 2119 PSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFT---VLTLTLQDANDNAPRFLRPH 2175
              TG I V +A  +D E     RL + A   G    +   ++T+ + D ND+ P FL P 
Sbjct: 2120 LVTGVIRVGNAT-IDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEFLNPI 2178

Query: 2176 YVAFLPESRPLEGPLLQVEADDLDQGSGGQISY---SLAASQPARGL-------FHVDPT 2225
                + ES      +  + A  +D     ++ Y    + A      L       F V+  
Sbjct: 2179 QTVSVLESAEPGTVIANITA--IDHDLNPKLEYHIVGIVAKDDTDRLVPNQEDAFAVNIN 2236

Query: 2226 TGTITTTAILDREIWAETRLVLMATDRGS-----PALVGSATLTVMVIDTNDNRPTIPQP 2280
            TG++   + ++RE+ A   + L   D  S        V +A LTV V+D NDN P   +P
Sbjct: 2237 TGSVMVKSPMNRELVATYEVTLSVIDNASDLPERSVSVPNAKLTVNVLDVNDNTPQF-KP 2295

Query: 2281 WEL-----RVSEDALLGSEIAQVTGNDVD---SGPVLWYVLSPSGPQDPFSVGRYGGRVS 2332
            + +     R+ E A  G+ +  V   D D   +G V + +L    P          G+V 
Sbjct: 2296 FGITYYMERILEGATPGTTLIAVAAVDPDKGLNGLVTYTLLDLVPPGYVQLEDSSAGKVI 2355

Query: 2333 LTGPLDFEQCDRYQLQLLAHD-GPHEGRANLTVLVE--DVNDNAPAFSQSLYQVMLLEHT 2389
                +D+E+       + A D G     A + V +E  D+NDN P F Q  YQ  + E  
Sbjct: 2356 ANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDV 2415

Query: 2390 PPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTLFTIVG----------TVA 2439
            P G+ IL+V+ATD DSG    I Y L      F+++P  G ++ +              A
Sbjct: 2416 PVGTIILTVTATDADSGNFALIEYSLGDGESKFAINPTTGDIYVLSSLDREKKDHYILTA 2475

Query: 2440 LGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGS 2499
            L  D  G  DV    R++          V +Q+ D ND  P F+   +  +V E+ P G+
Sbjct: 2476 LAKDNPG--DVASNRRENS-------VQVVIQVLDVNDCRPQFSKPQFSTSVYENEPAGT 2526

Query: 2500 TLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRAL------GC 2553
            +++T+ ATD D    +  + YS+                      GPG  A       G 
Sbjct: 2527 SVITMMATDQD-EGPNGELTYSL---------------------EGPGVEAFHVDMDSGL 2564

Query: 2554 LVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRA--SYRVTV 2611
            +    PL  +S  +++LTV A D G+PP      + V V+DVNDN PVF R      + +
Sbjct: 2565 VTTQRPL--QSYEKFSLTVVATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHI 2622

Query: 2612 PEDTPVGAELLHVEASDADPGPHGLVRFT---VSSGDPSGLFELDESSGTLRLAHALDCE 2668
             E+ P+ + +  V A+D D G +G VR++    +       F +D  SG ++ A  LD E
Sbjct: 2623 REEIPLRSNVYEVYATDKDEGLNGAVRYSFLKTAGNRDWEFFIIDPISGLIQTAQRLDRE 2682

Query: 2669 TQARHQLVVQAAD--PAGAHFALAPVTIEVQDVNDHGPAF-------PLNLLSTSVAENQ 2719
            +QA + L++ A+D      +  + P+ + ++D++D+ P F       P   L T V E+ 
Sbjct: 2683 SQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLT-VPEHS 2741

Query: 2720 PPGTLV-TTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHT 2778
            P GTLV     A+D D G    + Y  + AG      + F L    G L      D E  
Sbjct: 2742 PRGTLVGNVTGAVDADEGP-NAIVYYFIAAG---NEEKNFHLQPD-GCLLVLRDLDRERE 2796

Query: 2779 ESFRLLV------------GAADAGNLSASVT---VSVLVTGEDEYDPVFLAPAFHFQVP 2823
              F  +V            G +   +L A +T   V V++   ++  P F    +   V 
Sbjct: 2797 AIFSFIVKASSNRSWTPPRGPSPTLDLVADLTLQEVRVVLEDINDQPPRFTKAEYTAGVA 2856

Query: 2824 EGARRGHSLGHVQATDEDGGADGLVLYSL 2852
              A+ G  L  V A D D G + LV YS+
Sbjct: 2857 TDAKVGSELIQVLALDADIGNNSLVFYSI 2885



 Score =  816 bits (2107), Expect = 0.0
 Identities = 810/2783 (29%), Positives = 1226/2783 (44%), Gaps = 285/2783 (10%)

Query: 51   IDEEQPAGTLIGDISA-----GLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTAR 105
            I E  P GT +  I+A     G P G    ++            +  A+D  SGV+    
Sbjct: 245  IYEHSPPGTTVRIITAIDQDKGRPRGIGYTIV-------SGNTNSIFALDYISGVLTLNG 297

Query: 106  VLDREQRDRYRFTAV------------TPDGATVEVT--VRVADINDHAPAFPQARAALQ 151
            +LDRE    Y    +            TP  ATV  T  + V DIND+AP F  +  ++ 
Sbjct: 298  LLDREN-PLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVA 356

Query: 152  VPEHTAFGTRYPL---EPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELV 208
            + E    G   PL      +D + G        L G+ +       T     G     + 
Sbjct: 357  ITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHHFIISPT--SVQGKADIRIR 414

Query: 209  VTGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESL 268
            V   LD E    Y   L A +   P     A + +TL++ ND+ P F+Q  Y+  + E++
Sbjct: 415  VAIPLDYETVDRYDFDLFANES-VPDHVGYAKVKITLINENDNRPIFSQPLYNISLYENV 473

Query: 269  APGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVH 328
              G+ VL V A+D DAG  G V+Y      S+    FS+D  TGL+ L   LD+E  +  
Sbjct: 474  TVGTSVLTVLATDNDAGTFGEVSYFF----SDDPDRFSLDKDTGLIMLIARLDYELIQRF 529

Query: 329  ELVVQARDGGAHPELGSAFVTVHVRDANDNQPSM---TVIFLSADGSPQVSEAAPPGQLV 385
             L + ARDGG     G   V ++V D NDN P+      +    +  P V++       +
Sbjct: 530  TLTIIARDGGGEETTGR--VRINVLDVNDNVPTFQKDAYVGALRENEPSVTQ-------L 580

Query: 386  ARISVSD---PDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREE--RDAYNL 440
             R+  +D   P +    +  VS      +F +S  +    ++ V+R LD E+       L
Sbjct: 581  VRLRATDEDSPPNNQITYSIVSASAFGSYFDISLYEGY-GVISVSRPLDYEQISNGLIYL 639

Query: 441  RVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDP 500
             V A D+G+PPL +     + V D NDN P F +  Y    +  + + G+ V+ + A D 
Sbjct: 640  TVMAMDAGNPPLNSTVPVTIEVFDENDNPPTFSKPAYFVSVVENI-MAGATVLFLNATDL 698

Query: 501  DQGTN-GQ--VTYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPP 557
            D+    GQ  + YSL        F I+  SG ITT + LD E + +  LIV A DGG+  
Sbjct: 699  DRSREYGQESIIYSLEGSTQ---FRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGH 755

Query: 558  LASS--ATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSY 615
               +  ATV++ L D+NDN P ++   Y  +L E T P +    V A D D G  G L Y
Sbjct: 756  NQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVY 815

Query: 616  SLGAGLGSSGSPP---FRIDAHSGDVCTTRTLDRDQGPSSFD------FTVTAVDGGG-- 664
            S+         PP   + +++ +G + TT  +   + P   +        V+  D G   
Sbjct: 816  SI--------QPPNKFYSLNSTTGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPP 867

Query: 665  LKSMVYVKVFLS--DENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSY 722
            LK+     VF++  D NDN P F    + A +    P G ++ ++ A D D+G +G +SY
Sbjct: 868  LKATSSATVFVNLLDLNDNDPTFQNLPFVAEVLEGIPAGVSIYQVVAIDLDEGLNGLVSY 927

Query: 723  HILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVP 782
             +  G     F ++  SG++     L R   +  QL + A D G      ++ + I ++ 
Sbjct: 928  RMPVGMPRMDFLINSSSGVVVTTTELDRERIAEYQLRVVASDAGTPTKSSTSTLTIHVLD 987

Query: 783  GTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQA-HNPPGRLAPVTLSLSGGDPRGLFSLDA 841
                 P F    Y  SV EDV     V  +    N  G  A ++  ++GG+  G FS+  
Sbjct: 988  VNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITGGNVDGKFSVGY 1047

Query: 842  VSGLLQTLRPLDRELLGP-VLELEVRAGSGVPPAFA-VARVRVLLDDVNDNSPAFPAPED 899
               +++T+  LDRE     +L LE      V       A V V + DVNDN P F     
Sbjct: 1048 RDAVVRTVVGLDRETTAAYMLILEAIDNGPVGKRHTGTATVFVTVLDVNDNRPIFLQSSY 1107

Query: 900  TVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGG-GGAFTVDPTTGHV-RLMRPLG 957
               +P +   G  I  L+A D D G   RV + +L G  G  F +  + G + R  RPL 
Sbjct: 1108 EASVPEDIPEGHSILQLKATDADEGEFGRVWYRILHGNHGNNFRIHVSNGLLMRGPRPLD 1167

Query: 958  PSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTY-RVDLPSGTTAG 1016
                 +H L +EA +    P  S  R+ V V+D+     AP F    Y R+ L      G
Sbjct: 1168 RERNSSHVLIVEAYNHDLGPMRSSVRVIVYVEDINDE--APVFTQQQYSRLGLRETAGIG 1225

Query: 1017 TQVLQVQA---QAPDGGPITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVM 1073
            T V+ VQA    + DGG + Y + + GA   F ++  +G +     LD E +  Y++ V 
Sbjct: 1226 TSVIVVQATDRDSGDGGLVNYRILS-GAEGKFEIDESTGLIITVNYLDYETKTSYMMNVS 1284

Query: 1074 AVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRD 1133
            A   +        G  +V +++LN+ + + + S      A+ EN   GT + RV A   D
Sbjct: 1285 ATDQAPPF---NQGFCSVYITLLNELDEAVQFSNASYEAAILENLALGTEIVRVQAYSID 1341

Query: 1134 SGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRST 1193
            +       ++    ++    F+I   TG +T    +DRE+   Y L V   DGG P   +
Sbjct: 1342 NLNQITYRFNAYTSTQAKALFKIDAITGVITVQGLVDREKGDFYTLTVVADDGG-PKVDS 1400

Query: 1194 TGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTIL 1253
            T  V++ VLD NDNSP F   S +A     + +P+  P G  V T++A DPD G NG ++
Sbjct: 1401 TVKVYITVLDENDNSPRFDFTSDSA-----VSIPEDCPVGQRVATVKAWDPDAGSNGQVV 1455

Query: 1254 YTLTGPGS----ELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLV 1309
            ++L         E+ + +   GE+  A PL R E  HY+L + A D+G+PPR     L V
Sbjct: 1456 FSLASGNIAGAFEIVTTNDSIGEVFVARPLDREELDHYILQVVASDRGTPPRKKDHILQV 1515

Query: 1310 QVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPE-PAGVGALTYT 1368
             +L          D+ +  P    P    V+  E +  G+ +  V A +   G+ ++   
Sbjct: 1516 TIL----------DINDNPPVIESPFGYNVSVNENVGGGTAVVQVRATDRDIGINSVLSY 1565

Query: 1369 LVGGADPEGTFALDAASGRLYLARPLDFEAGPPWR--------ALTVRAEGPGGAGARLL 1420
             +   + +  F +D  SG +   RP      PP R          TV  EG     A   
Sbjct: 1566 YITEGNKDMAFRMDRISGEI-ATRP-----APPDRERQSFYHLVATVEDEGTPTLSATT- 1618

Query: 1421 RVQVQVQDENEHAPAFARDPLALALPENPEP-GAALYTFRASDADGPGPNSDVRYRLLRQ 1479
             V V + DEN++AP F +    + L E P+    +L T +A D D  GPN  V Y ++  
Sbjct: 1619 HVYVTIVDENDNAPMFQQPHYEVLLDEGPDTLNTSLITIQALDLD-EGPNGTVTYAIVAG 1677

Query: 1480 EPPVPALRLDARTGALSAPRGLDRETTPA-LLLLVEATDRPANASRRRAARVSARVFVTD 1538
               V   R+D   G ++A + LD E +     L+V ATD+    S R  +  +  V V D
Sbjct: 1678 NI-VNTFRIDRHMGVITAAKELDYEISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVND 1736

Query: 1539 ENDNAPVFASPSR--VRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGD-GHFRLH 1595
             NDN P F         + E QP GP     +A D D G   +V Y +  G   G F + 
Sbjct: 1737 INDNVPTFPRDYEGPFEVTEGQP-GPRVWTFLAHDRDSGPNGQVEYSIMDGDPLGEFVIS 1795

Query: 1596 SSTGALSVVRP--LDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQE 1653
               G L V +   LDRE  A + LT+ A D G PP S+T ++ + V D+ND  P      
Sbjct: 1796 PVEGVLRVRKDVELDRETIAFYNLTICARDRGMPPLSSTMLVGIRVLDINDNDPVLLNLP 1855

Query: 1654 YSVLLRENNPPGTSLLTLRATDPDVGANGQVTYG---GVSSESFSLDPDTGVLTTLRALD 1710
             ++ + EN+P  + +  + A+D D G N ++T+    G    +F ++  TG++T  R LD
Sbjct: 1856 MNITISENSPVSSFVAHVLASDADSGCNARLTFNITAGNRERAFFINATTGIVTVNRPLD 1915

Query: 1711 REEQEEINLTVYAQDRGSPPQLT---HVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQ 1767
            RE   E  LT+  +D    P++    +  + + + DEND+ P F  +    EV E     
Sbjct: 1916 RERIPEYKLTISVKDNPENPRIARRDYDLLLIFLSDENDNHPLFTKSTYQAEVMENSPAG 1975

Query: 1768 T-LTMLR----ASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRP---LDREV-- 1817
            T LT+L     A D D      + Y++L G  SG F ++ ++G   T+R    +DRE   
Sbjct: 1976 TPLTVLNGPILALDADQDIYAVVTYQLL-GAQSGLFDINSSTGVV-TVRSGVIIDREAFS 2033

Query: 1818 EPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQL 1877
             P  +L + A D G   L++T  L +T+LD ND+ P F     +V + E+ P G  +LQ+
Sbjct: 2034 PPILELLLLAEDIG--LLNSTAHLLITILDDNDNRPTFSPATLTVHLLENCPPGFSVLQV 2091

Query: 1878 QAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGELRTA-AALDREQCPSYTFSVSAVDGAA 1936
             A D D+G NG + Y + AG    FL+   +G +R   A +DRE+  SY  +V A D   
Sbjct: 2092 TATDEDSGLNGELVYRIEAGAQDRFLIHLVTGVIRVGNATIDREEQESYRLTVVATDRGT 2151

Query: 1937 AGPLSTTVSVTITVRDVNDHAPTFPTSPLR----LRLPRPGPSFSTPTLALATLRAEDRD 1992
              PLS T  VTI + D+ND  P F  +P++    L    PG         +A + A D D
Sbjct: 2152 V-PLSGTAIVTILIDDINDSRPEF-LNPIQTVSVLESAEPGT-------VIANITAIDHD 2202

Query: 1993 AGANASILYRLAGTPPPGTT------------VDSYTGEIRVARSPV---ALGPRDRVLF 2037
               N  + Y + G      T            V+  TG + V +SP+    +   +  L 
Sbjct: 2203 L--NPKLEYHIVGIVAKDDTDRLVPNQEDAFAVNINTGSVMV-KSPMNRELVATYEVTLS 2259

Query: 2038 IVATDLGRPARSAT---GVIIVGLQGEAERGPRFPRASSE---ATIRENAPPGTPIVSPR 2091
            ++      P RS +     + V +    +  P+F           I E A PGT +++  
Sbjct: 2260 VIDNASDLPERSVSVPNAKLTVNVLDVNDNTPQFKPFGITYYMERILEGATPGTTLIAVA 2319

Query: 2092 AVHAG-GTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGG 2150
            AV    G NG +TY++L     G   ++ S+    + +   +D+E    L   ++A   G
Sbjct: 2320 AVDPDKGLNGLVTYTLLDLVPPGYVQLEDSSAGKVIANRT-VDYEEVHWLNFTVRASDNG 2378

Query: 2151 A---FAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQIS 2207
            +    A   + L + D NDN P F +P Y   + E  P+   +L V A D D G+   I 
Sbjct: 2379 SPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDVPVGTIILTVTATDADSGNFALIE 2438

Query: 2208 YSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGS------A 2261
            YSL   +     F ++PTTG I   + LDRE   +   +L A  + +P  V S       
Sbjct: 2439 YSLGDGESK---FAINPTTGDIYVLSSLDRE--KKDHYILTALAKDNPGDVASNRRENSV 2493

Query: 2262 TLTVMVIDTNDNRPTIPQP-WELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQ- 2319
             + + V+D ND RP   +P +   V E+   G+ +  +   D D GP      S  GP  
Sbjct: 2494 QVVIQVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMMATDQDEGPNGELTYSLEGPGV 2553

Query: 2320 DPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDG---PHEGRANLTVLVEDVNDNAPAF 2376
            + F V    G V+   PL  +  +++ L ++A DG   P  G   L V V DVNDN P F
Sbjct: 2554 EAFHVDMDSGLVTTQRPL--QSYEKFSLTVVATDGGEPPLWGTTMLLVEVIDVNDNRPVF 2611

Query: 2377 SQSLYQVML--LEHTPPGSAILSVSATDRDSGANGHISYHLASPADG-----FSVDPNNG 2429
             +     +L   E  P  S +  V ATD+D G NG + Y     A       F +DP +G
Sbjct: 2612 VRPPNGTILHIREEIPLRSNVYEVYATDKDEGLNGAVRYSFLKTAGNRDWEFFIIDPISG 2671

Query: 2430 TLFTIVGTVALGHDGSGAVDVVLEARDHGAP-GRAARATVHVQLQDQNDHAPSFTLS--- 2485
             + T      L  +      ++L A D G P        + V L+D +D+ P F      
Sbjct: 2672 LIQT---AQRLDRESQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKG 2728

Query: 2486 --HYRVAVTEDLPPGSTLL--TLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAG 2541
               Y++    +  P  TL+     A DAD    +A V Y I +GN  + F L+P      
Sbjct: 2729 SPQYQLLTVPEHSPRGTLVGNVTGAVDADEG-PNAIVYYFIAAGNEEKNFHLQPD----- 2782

Query: 2542 ESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAAD-------RGQPPQSSVVP------V 2588
                      GCL++L  LD E    ++  V A+        RG  P   +V       V
Sbjct: 2783 ----------GCLLVLRDLDREREAIFSFIVKASSNRSWTPPRGPSPTLDLVADLTLQEV 2832

Query: 2589 TVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTV------- 2641
             V + D+ND PP FT+A Y   V  D  VG+EL+ V A DAD G + LV +++       
Sbjct: 2833 RVVLEDINDQPPRFTKAEYTAGVATDAKVGSELIQVLALDADIGNNSLVFYSILAIHYFR 2892

Query: 2642 ----SSGDPSGLFELDESSGTLR 2660
                 S D   +F +    G LR
Sbjct: 2893 ALANDSEDVGQVFTMGSMDGILR 2915



 Score =  796 bits (2057), Expect = 0.0
 Identities = 739/2516 (29%), Positives = 1151/2516 (45%), Gaps = 209/2516 (8%)

Query: 472  FDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIIT 531
            FD  L   E  P     GS V ++ A+D D   N  + + ++    + +F+++P +G++ 
Sbjct: 36   FDTYLLISEDTPV----GSSVTQLLAQDMD---NDPLVFGVSGEEASRFFAVEPDTGVVW 88

Query: 532  TAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGT 591
                LD E + +  +    +D        +  V++ + DVNDN P F    Y+  +PE T
Sbjct: 89   LRQPLDRETKSEFTVEFSVSDH---QGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENT 145

Query: 592  QPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPP---FRIDAHSGDVCTTRTLDRDQ 648
              GT    V ATD D G  G + YS          PP   F ID+  G V   R LD + 
Sbjct: 146  PVGTPIFIVNATDPDLGAGGSVLYSF--------QPPSQFFAIDSARGIVTVIRELDYET 197

Query: 649  GPSSFDFTVTAVDGGG---LKSMVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVL 705
               ++  TV A D      L ++  + + ++D  D  P F    Y+ +I   SPPGT V 
Sbjct: 198  -TQAYQLTVNATDQDKTRPLSTLANLAIIITDVQDMDPIFINLPYSTNIYEHSPPGTTVR 256

Query: 706  RLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARR----ANSVVQLEIG 761
             + A D D+G    + Y I++GN+  +F LD  SG+LT+   L R     ++  +    G
Sbjct: 257  IITAIDQDKGRPRGIGYTIVSGNTNSIFALDYISGVLTLNGLLDRENPLYSHGFILTVKG 316

Query: 762  AE---DGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTS----VGIVQA 814
             E   D     A  +   +I ++      P F   +Y  ++ E    G +    + +V  
Sbjct: 317  TELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDK 376

Query: 815  HNPPGRLAPVTLSLSGGDPRG-LFSLDAVSG----LLQTLRPLDRELLGPVLELEVRAGS 869
                G  +   + L G +    + S  +V G     ++   PLD E +    + ++ A  
Sbjct: 377  DENLGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDR-YDFDLFANE 435

Query: 870  GVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRV 929
             VP     A+V++ L + NDN P F  P   + L  N   GT + T+ A D D+G    V
Sbjct: 436  SVPDHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVLTVLATDNDAGTFGEV 495

Query: 930  TFTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQ 989
            ++   +     F++D  TG + L+  L         L + ARDGG    T   R+R+ V 
Sbjct: 496  SY-FFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTIIARDGGGEETTG--RVRINVL 552

Query: 990  DVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGP---ITYHLAAEGA-SSPF 1045
            DV      P F    Y   L     + TQ+++++A   D  P   ITY + +  A  S F
Sbjct: 553  DVNDN--VPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNQITYSIVSASAFGSYF 610

Query: 1046 GLEPQSGW--LWVRAALDRE--AQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEH 1101
             +    G+  + V   LD E  +  L  L VMA+      L     T  V + + ++N++
Sbjct: 611  DISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPL---NSTVPVTIEVFDENDN 667

Query: 1102 SPRLSEDPTFLAVAENQPPGTSVGRVFATDRD-SGPNGR--LTYSLQQLSEDSKAFRIHP 1158
             P  S+   F++V EN   G +V  + ATD D S   G+  + YSL    E S  FRI+ 
Sbjct: 668  PPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESIIYSL----EGSTQFRINA 723

Query: 1159 QTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTG--TVHVAVLDLNDNSPTFLQASG 1216
            ++GE+TT   LDRE +S Y L+V+  DGG      TG  TV++ +LD+NDN PT+  A  
Sbjct: 724  RSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKDAP- 782

Query: 1217 AAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHSGELLTA 1276
                   I + +  PP + VTT+ A DPD GENGT++Y++  P ++ +SL+  +G++ T 
Sbjct: 783  -----YYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIQ-PPNKFYSLNSTTGKIRTT 836

Query: 1277 APLIRAERPH-------YVLTLSAHDQGSPPRSA--SLQLLVQVLPSARLAEPPPDLAER 1327
              ++  E P          + +S  D G PP  A  S  + V +L          DL + 
Sbjct: 837  HAMLDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLL----------DLNDN 886

Query: 1328 DPA-APVPVVLTVTAAEGLRPG-SLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAAS 1385
            DP    +P V  V   EG+  G S+   VA     G+  L    +    P   F ++++S
Sbjct: 887  DPTFQNLPFVAEV--LEGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSS 944

Query: 1386 GRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDPLALAL 1445
            G +     LD E    ++   V ++      +    + + V D N+  P F      +++
Sbjct: 945  GVVVTTTELDRERIAEYQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSV 1004

Query: 1446 PENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRET 1505
             E+      +     +D D  G N+++ Y +           +  R   +    GLDRET
Sbjct: 1005 SEDVPREFRVVWLNCTDND-VGLNAELSYFITGGNVD-GKFSVGYRDAVVRTVVGLDRET 1062

Query: 1506 TPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPS-RVRLPEDQPPGPAA 1564
            T A +L++EA D      +R     +  V V D NDN P+F   S    +PED P G + 
Sbjct: 1063 TAAYMLILEAIDN-GPVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSI 1121

Query: 1565 LHVVARDPDLGEAARVSYRLASGGDG-HFRLHSSTGAL-SVVRPLDREQRAEHVLTVVAS 1622
            L + A D D GE  RV YR+  G  G +FR+H S G L    RPLDRE+ + HVL V A 
Sbjct: 1122 LQLKATDADEGEFGRVWYRILHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAY 1181

Query: 1623 DHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVL-LRENNPPGTSLLTLRATDPDVGAN 1681
            +H   P  ++  + V V D+NDEAP F QQ+YS L LRE    GTS++ ++ATD D G  
Sbjct: 1182 NHDLGPMRSSVRVIVYVEDINDEAPVFTQQQYSRLGLRETAGIGTSVIVVQATDRDSGDG 1241

Query: 1682 GQVTYGGVSSE--SFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRV 1739
            G V Y  +S     F +D  TG++ T+  LD E +    + V A D+  P      +V +
Sbjct: 1242 GLVNYRILSGAEGKFEIDESTGLIITVNYLDYETKTSYMMNVSATDQAPPFNQGFCSVYI 1301

Query: 1740 AVEDENDHAPTFGSAHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRI---LDGDPSG 1796
             + +E D A  F +A     + E     T  ++R     +    Q+ YR           
Sbjct: 1302 TLLNELDEAVQFSNASYEAAILENLALGT-EIVRVQAYSIDNLNQITYRFNAYTSTQAKA 1360

Query: 1797 AFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFP 1856
             F +D  +G       +DRE    + L + A DGG P + +T+ + +TVLD ND++P F 
Sbjct: 1361 LFKIDAITGVITVQGLVDREKGDFYTLTVVADDGG-PKVDSTVKVYITVLDENDNSPRFD 1419

Query: 1857 VPAYS-VEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGT-AGAFLL---EPSSGEL 1911
              + S V +PED P G  +  ++A DPDAG+NG V + L +G  AGAF +     S GE+
Sbjct: 1420 FTSDSAVSIPEDCPVGQRVATVKAWDPDAGSNGQVVFSLASGNIAGAFEIVTTNDSIGEV 1479

Query: 1912 RTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPR 1971
              A  LDRE+   Y   V A D     P      + +T+ D+ND+ P    SP    +  
Sbjct: 1480 FVARPLDREELDHYILQVVASD-RGTPPRKKDHILQVTILDINDNPPVI-ESPFGYNV-S 1536

Query: 1972 PGPSFSTPTLALATLRAEDRDAGANASILYRLA-GTPPPGTTVDSYTGEIRVARSPVALG 2030
               +    T A+  +RA DRD G N+ + Y +  G       +D  +GEI    +P    
Sbjct: 1537 VNENVGGGT-AVVQVRATDRDIGINSVLSYYITEGNKDMAFRMDRISGEIATRPAP---P 1592

Query: 2031 PRDRVLF--IVAT--DLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPP-GT 2085
             R+R  F  +VAT  D G P  SAT  + V +  E +  P F +   E  + E      T
Sbjct: 1593 DRERQSFYHLVATVEDEGTPTLSATTHVYVTIVDENDNAPMFQQPHYEVLLDEGPDTLNT 1652

Query: 2086 PIVSPRAVHAG-GTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVS-PRLRLV 2143
             +++ +A+    G NG +TY+I++GN   TF I    G IT  +A+ LD+E+S  R  L+
Sbjct: 1653 SLITIQALDLDEGPNGTVTYAIVAGNIVNTFRIDRHMGVIT--AAKELDYEISHGRYTLI 1710

Query: 2144 LQAE------SGGAFAFTVLTLTLQDANDNAPRFLRPHYVAF-LPESRPLEGP-LLQVEA 2195
            + A       S    + T + + + D NDN P F R +   F + E +P  GP +    A
Sbjct: 1711 VTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFEVTEGQP--GPRVWTFLA 1768

Query: 2196 DDLDQGSGGQISYSLAASQPARGLFHVDPTTGT--ITTTAILDREIWAETRLVLMATDRG 2253
             D D G  GQ+ YS+    P  G F + P  G   +     LDRE  A   L + A DRG
Sbjct: 1769 HDRDSGPNGQVEYSIMDGDPL-GEFVISPVEGVLRVRKDVELDRETIAFYNLTICARDRG 1827

Query: 2254 SPALVGSATLTVMVIDTNDNRPTIPQ-PWELRVSEDALLGSEIAQVTGNDVDSG--PVLW 2310
             P L  +  + + V+D NDN P +   P  + +SE++ + S +A V  +D DSG    L 
Sbjct: 1828 MPPLSSTMLVGIRVLDINDNDPVLLNLPMNITISENSPVSSFVAHVLASDADSGCNARLT 1887

Query: 2311 YVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRAN------LTV 2364
            + ++    +  F +    G V++  PLD E+   Y+L +   D P   R        L +
Sbjct: 1888 FNITAGNRERAFFINATTGIVTVNRPLDRERIPEYKLTISVKDNPENPRIARRDYDLLLI 1947

Query: 2365 LVEDVNDNAPAFSQSLYQVMLLEHTPPGSAIL----SVSATDRDSGANGHISYHLASPAD 2420
             + D NDN P F++S YQ  ++E++P G+ +      + A D D      ++Y L     
Sbjct: 1948 FLSDENDNHPLFTKSTYQAEVMENSPAGTPLTVLNGPILALDADQDIYAVVTYQLLGAQS 2007

Query: 2421 G-FSVDPNNGTLFTIVGTVALGHDGSG--AVDVVLEARDHGAPGRAARATVHVQLQDQND 2477
            G F ++ + G + T+   V +  +      ++++L A D G     A   + + + D ND
Sbjct: 2008 GLFDINSSTGVV-TVRSGVIIDREAFSPPILELLLLAEDIGLLNSTAH--LLITILDDND 2064

Query: 2478 HAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGR-VFQLEPR 2536
            + P+F+ +   V + E+ PPG ++L + ATD D   +   V Y I +G   R +  L   
Sbjct: 2065 NRPTFSPATLTVHLLENCPPGFSVLQVTATDEDSGLNGELV-YRIEAGAQDRFLIHLVTG 2123

Query: 2537 LAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVN 2596
            +   G +                +D E    Y LTV A DRG  P S    VT+ + D+N
Sbjct: 2124 VIRVGNAT---------------IDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDIN 2168

Query: 2597 DNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGP---HGLVRFTVSSGDPSGL---- 2649
            D+ P F      V+V E    G  + ++ A D D  P   + +V   V+  D   L    
Sbjct: 2169 DSRPEFLNPIQTVSVLESAEPGTVIANITAIDHDLNPKLEYHIVGI-VAKDDTDRLVPNQ 2227

Query: 2650 ---FELDESSGTLRLAHALDCETQARHQLVVQAADPA------GAHFALAPVTIEVQDVN 2700
               F ++ ++G++ +   ++ E  A +++ +   D A            A +T+ V DVN
Sbjct: 2228 EDAFAVNINTGSVMVKSPMNRELVATYEVTLSVIDNASDLPERSVSVPNAKLTVNVLDVN 2287

Query: 2701 DHGPAFP---LNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLE-AGPGPEGRE 2756
            D+ P F    +      + E   PGT +  + A+D D G  G + Y+LL+   PG    E
Sbjct: 2288 DNTPQFKPFGITYYMERILEGATPGTTLIAVAAVDPDKGLNGLVTYTLLDLVPPGYVQLE 2347

Query: 2757 AFALNSSTGELRARVPFDYEHTESFRLLVGAADAGN--LSASVTVSVLVTGEDEYDPVFL 2814
                +SS G++ A    DYE        V A+D G+   +A + V + +   ++ +P+F 
Sbjct: 2348 ----DSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFD 2403

Query: 2815 APAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSSPYFGINQTTGALYL 2870
             P++   V E    G  +  V ATD D G   L+ YSL      F IN TTG +Y+
Sbjct: 2404 QPSYQEAVFEDVPVGTIILTVTATDADSGNFALIEYSLGDGESKFAINPTTGDIYV 2459



 Score =  789 bits (2037), Expect = 0.0
 Identities = 801/2917 (27%), Positives = 1266/2917 (43%), Gaps = 257/2917 (8%)

Query: 49   LQIDEEQPAGTLIGDISAGLP-AGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVL 107
            ++I E  P GT I  ++A  P  G    ++Y  S Q  S      AID   G+V   R L
Sbjct: 139  VRIPENTPVGTPIFIVNATDPDLGAGGSVLY--SFQPPSQF---FAIDSARGIVTVIREL 193

Query: 108  DREQRDRYRFTAVTPD-------GATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGT 160
            D E    Y+ T    D            + + + D+ D  P F     +  + EH+  GT
Sbjct: 194  DYETTQAYQLTVNATDQDKTRPLSTLANLAIIITDVQDMDPIFINLPYSTNIYEHSPPGT 253

Query: 161  RYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENR-- 218
               +  A D D GR    GY +        F L+   G        L + G LDREN   
Sbjct: 254  TVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYISGV-------LTLNGLLDRENPLY 306

Query: 219  SH-YMLQLEAYDGGSPPRRAQALLDVT----LLDINDHAPAFNQSRYHAVVSESLAPGSP 273
            SH ++L ++  +       + A +  T    ++DIND+AP FN S Y   ++E    G  
Sbjct: 307  SHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFA 366

Query: 274  V---LQVFASDADAGVNGAVTYEINRRQSEGD--GPFSIDAHTGL-LQLERPLDFEQRRV 327
            +   +QV   D + G+N      +    S      P S+     + +++  PLD+E    
Sbjct: 367  LPLFIQVVDKDENLGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDR 426

Query: 328  HELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVAR 387
            ++  + A +      +G A V + + + NDN+P    IF     +  + E    G  V  
Sbjct: 427  YDFDLFANES-VPDHVGYAKVKITLINENDNRP----IFSQPLYNISLYENVTVGTSVLT 481

Query: 388  ISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDS 447
            +  +D D G F  V+         F+L     +I L+    RLD E    + L + A D 
Sbjct: 482  VLATDNDAGTFGEVSYFFSDDPDRFSLDKDTGLIMLIA---RLDYELIQRFTLTIIARDG 538

Query: 448  GSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQ 507
            G           ++V DVNDN P F +  Y    L E     + +VR+ A D D   N Q
Sbjct: 539  GGEETTGRVR--INVLDVNDNVPTFQKDAY-VGALRENEPSVTQLVRLRATDEDSPPNNQ 595

Query: 508  VTYSL-APGAHTHWFSIDPTSG--IITTAASLDYELEPQP--QLIVVATDGGLPPLASSA 562
            +TYS+ +  A   +F I    G  +I+ +  LDYE        L V+A D G PPL S+ 
Sbjct: 596  ITYSIVSASAFGSYFDISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTV 655

Query: 563  TVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDAD-SGPFGLLS--YSLGA 619
             V++ + D NDN P F +  Y  S+ E    G   L + ATD D S  +G  S  YSL  
Sbjct: 656  PVTIEVFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESIIYSL-- 713

Query: 620  GLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGG----GLKSMVYVKVFL 675
                 GS  FRI+A SG++ TT  LDR+   S +   V AVDGG        +  V + L
Sbjct: 714  ----EGSTQFRINARSGEITTTSLLDRET-KSEYILIVRAVDGGVGHNQKTGIATVNITL 768

Query: 676  SDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTL 735
             D NDN P +    Y  ++   +PP + V  + A DPD G +G L Y I   N    ++L
Sbjct: 769  LDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIQPPNK--FYSL 826

Query: 736  DEQSGLLTVAWPLARRANS-------VVQLEIGAEDGGG--LQAEPSARVDISIVPGTPT 786
            +  +G +     +  R N        + ++ +   D G   L+A  SA V ++++     
Sbjct: 827  NSTTGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDN 886

Query: 787  PPIFEQLQYVFSVPEDVAPGTSV-GIVQAHNPPGRLAPVTLSLSGGDPRGLFSLDAVSGL 845
             P F+ L +V  V E +  G S+  +V      G    V+  +  G PR  F +++ SG+
Sbjct: 887  DPTFQNLPFVAEVLEGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSSGV 946

Query: 846  LQTLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPP 905
            + T   LDRE +       V + +G P   + + + + + DVND +P F      V +  
Sbjct: 947  VVTTTELDRERIAEYQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSVSE 1006

Query: 906  NTAPGTPIYTLRALDPDSGVNSRVTFTLLAGG-GGAFTVDPTTGHVRLMRPLGPSGGPAH 964
            +      +  L   D D G+N+ +++ +  G   G F+V      VR +  L      A+
Sbjct: 1007 DVPREFRVVWLNCTDNDVGLNAELSYFITGGNVDGKFSVGYRDAVVRTVVGLDRETTAAY 1066

Query: 965  ELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQA 1024
             L LEA D G   +       V V  +      P F   +Y   +P     G  +LQ++A
Sbjct: 1067 MLILEAIDNGPVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSILQLKA 1126

Query: 1025 QAPDGGP---ITYHLAAEGASSPFGLEPQSGWLWVRAA-LDREAQELYILKVMAVSGSKA 1080
               D G    + Y +      + F +   +G L      LDRE    ++L V A +    
Sbjct: 1127 TDADEGEFGRVWYRILHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAYNH--- 1183

Query: 1081 ELGQQTGTATVRVSILNQNEHSPRLSEDP-TFLAVAENQPPGTSVGRVFATDRDSGPNGR 1139
            +LG    +  V V + + N+ +P  ++   + L + E    GTSV  V ATDRDSG  G 
Sbjct: 1184 DLGPMRSSVRVIVYVEDINDEAPVFTQQQYSRLGLRETAGIGTSVIVVQATDRDSGDGGL 1243

Query: 1140 LTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHV 1199
            + Y +  LS     F I   TG + T+  LD E ++SY + V   D   P      +V++
Sbjct: 1244 VNYRI--LSGAEGKFEIDESTGLIITVNYLDYETKTSYMMNVSATDQAPPFNQGFCSVYI 1301

Query: 1200 AVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTI---LYTL 1256
             +L+  D +  F  AS  A       + + +  GT +  +QA   D     T     YT 
Sbjct: 1302 TLLNELDEAVQFSNASYEAA------ILENLALGTEIVRVQAYSIDNLNQITYRFNAYTS 1355

Query: 1257 TGPGSELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSAR 1316
            T     LF +   +G +     + R +   Y LT+ A D G P   +++++ + VL    
Sbjct: 1356 T-QAKALFKIDAITGVITVQGLVDREKGDFYTLTVVA-DDGGPKVDSTVKVYITVL---- 1409

Query: 1317 LAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAA--PEPAGVGALTYTLVGGAD 1374
                  D  +  P         V+  E    G  + +V A  P+    G + ++L  G +
Sbjct: 1410 ------DENDNSPRFDFTSDSAVSIPEDCPVGQRVATVKAWDPDAGSNGQVVFSLASG-N 1462

Query: 1375 PEGTFALDAAS---GRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENE 1431
              G F +   +   G +++ARPLD E    +    V ++       +   +QV + D N+
Sbjct: 1463 IAGAFEIVTTNDSIGEVFVARPLDREELDHYILQVVASDRGTPPRKKDHILQVTILDIND 1522

Query: 1432 HAPAFARDPLA--LALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLD 1489
            + P     P    +++ EN   G A+   RA+D D  G NS + Y +      + A R+D
Sbjct: 1523 NPPVI-ESPFGYNVSVNENVGGGTAVVQVRATDRD-IGINSVLSYYITEGNKDM-AFRMD 1579

Query: 1490 ARTGALS---APRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVF 1546
              +G ++   AP   +R++   L+  VE    P       +A     V + DENDNAP+F
Sbjct: 1580 RISGEIATRPAPPDRERQSFYHLVATVEDEGTPT-----LSATTHVYVTIVDENDNAPMF 1634

Query: 1547 ASPSRVRLPEDQPP--GPAALHVVARDPDLGEAARVSYRLASGGDGH-FRLHSSTGALSV 1603
              P    L ++ P     + + + A D D G    V+Y + +G   + FR+    G ++ 
Sbjct: 1635 QQPHYEVLLDEGPDTLNTSLITIQALDLDEGPNGTVTYAIVAGNIVNTFRIDRHMGVITA 1694

Query: 1604 VRPLDRE-QRAEHVLTVVASDHG---SPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLR 1659
             + LD E     + L V A+D     S   ++T  + V+V D+ND  PTF +        
Sbjct: 1695 AKELDYEISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFEV 1754

Query: 1660 ENNPPGTSLLTLRATDPDVGANGQVTYGGVSSE---SFSLDPDTGVLTTLR--ALDREEQ 1714
                PG  + T  A D D G NGQV Y  +  +    F + P  GVL   +   LDRE  
Sbjct: 1755 TEGQPGPRVWTFLAHDRDSGPNGQVEYSIMDGDPLGEFVISPVEGVLRVRKDVELDRETI 1814

Query: 1715 EEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQTLTM-LR 1773
               NLT+ A+DRG PP  + + V + V D ND+ P   +  +++ + E     +    + 
Sbjct: 1815 AFYNLTICARDRGMPPLSSTMLVGIRVLDINDNDPVLLNLPMNITISENSPVSSFVAHVL 1874

Query: 1774 ASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQP 1833
            ASD D G N +L + I  G+   AF ++  +G     RPLDRE  P ++L I  +D  + 
Sbjct: 1875 ASDADSGCNARLTFNITAGNRERAFFINATTGIVTVNRPLDRERIPEYKLTISVKDNPEN 1934

Query: 1834 ALSATL---LLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQ----AHDPDAGA 1886
               A     LL + + D ND+ P F    Y  EV E+ PAGT L  L     A D D   
Sbjct: 1935 PRIARRDYDLLLIFLSDENDNHPLFTKSTYQAEVMENSPAGTPLTVLNGPILALDADQDI 1994

Query: 1887 NGHVTYYLGAGTAGAFLLEPSSG--ELRTAAALDREQC--PSYTFSVSAVDGAAAGPLST 1942
               VTY L    +G F +  S+G   +R+   +DRE    P     + A D    G L++
Sbjct: 1995 YAVVTYQLLGAQSGLFDINSSTGVVTVRSGVIIDREAFSPPILELLLLAED---IGLLNS 2051

Query: 1943 TVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYR 2002
            T  + IT+ D ND+ PTF  + L + L    P    P  ++  + A D D+G N  ++YR
Sbjct: 2052 TAHLLITILDDNDNRPTFSPATLTVHLLENCP----PGFSVLQVTATDEDSGLNGELVYR 2107

Query: 2003 LAGTPPPGTTVDSYTGEIRVARSPVALGPRDRV-LFIVATDLGRPARSATGVIIVGLQGE 2061
            +         +   TG IRV  + +    ++   L +VATD G    S T ++ + +   
Sbjct: 2108 IEAGAQDRFLIHLVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDI 2167

Query: 2062 AERGPRFPRASSEATIRENAPPGTPIVSPRAVHAGGTNGPITYSI-----------LSGN 2110
             +  P F       ++ E+A PGT I +  A+     N  + Y I           L  N
Sbjct: 2168 NDSRPEFLNPIQTVSVLESAEPGTVIANITAIDHD-LNPKLEYHIVGIVAKDDTDRLVPN 2226

Query: 2111 EKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVL------QAESGGAFAFTVLTLTLQDA 2164
            ++  F++  +TG++ V+S    +   +  + L +        E   +     LT+ + D 
Sbjct: 2227 QEDAFAVNINTGSVMVKSPMNRELVATYEVTLSVIDNASDLPERSVSVPNAKLTVNVLDV 2286

Query: 2165 NDNAPRFLRPHYVAFLPESRPLEGP-----LLQVEADDLDQGSGGQISYSLAASQPARGL 2219
            NDN P+F +P  + +  E R LEG      L+ V A D D+G  G ++Y+L    P   +
Sbjct: 2287 NDNTPQF-KPFGITYYME-RILEGATPGTTLIAVAAVDPDKGLNGLVTYTLLDLVPPGYV 2344

Query: 2220 FHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQ 2279
               D + G +     +D E        + A+D GSP       + + ++D NDN P   Q
Sbjct: 2345 QLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQ 2404

Query: 2280 P-WELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLD 2338
            P ++  V ED  +G+ I  VT  D DSG       S    +  F++    G + +   LD
Sbjct: 2405 PSYQEAVFEDVPVGTIILTVTATDADSGNFALIEYSLGDGESKFAINPTTGDIYVLSSLD 2464

Query: 2339 FEQCDRYQLQLLAHDGP-------HEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPP 2391
             E+ D Y L  LA D P        E    + + V DVND  P FS+  +   + E+ P 
Sbjct: 2465 REKKDHYILTALAKDNPGDVASNRRENSVQVVIQVLDVNDCRPQFSKPQFSTSVYENEPA 2524

Query: 2392 GSAILSVSATDRDSGANGHISYHLASPA-DGFSVDPNNGTLFTIVGTVALGHDGSGAVDV 2450
            G++++++ ATD+D G NG ++Y L  P  + F VD ++G +     T            +
Sbjct: 2525 GTSVITMMATDQDEGPNGELTYSLEGPGVEAFHVDMDSGLV-----TTQRPLQSYEKFSL 2579

Query: 2451 VLEARDHGAPGRAARATVHVQLQDQNDHAPSF------TLSHYRVAVTEDLPPGSTLLTL 2504
             + A D G P       + V++ D ND+ P F      T+ H R    E++P  S +  +
Sbjct: 2580 TVVATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIR----EEIPLRSNVYEV 2635

Query: 2505 EATDADGSRSHAAVDYSII--SGN--WGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPL 2560
             ATD D   +  AV YS +  +GN  W   F ++P                G +   + L
Sbjct: 2636 YATDKDEGLN-GAVRYSFLKTAGNRDW-EFFIIDP--------------ISGLIQTAQRL 2679

Query: 2561 DFESLTQYNLTVAAADRGQP-PQSSVVPVTVTVLDVNDNPPVFTRA-----SYRV-TVPE 2613
            D ES   Y+L + A+D GQP P  ++ P+ V + D++DN P+F R       Y++ TVPE
Sbjct: 2680 DRESQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPE 2739

Query: 2614 DTPVGAELLHVE-ASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQAR 2672
             +P G  + +V  A DAD GP+ +V + +++G+    F L +  G L +   LD E +A 
Sbjct: 2740 HSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGNEEKNFHL-QPDGCLLVLRDLDREREAI 2798

Query: 2673 HQLVVQAAD------PAG--------AHFALAPVTIEVQDVNDHGPAFPLNLLSTSVAEN 2718
               +V+A+       P G        A   L  V + ++D+ND  P F     +  VA +
Sbjct: 2799 FSFIVKASSNRSWTPPRGPSPTLDLVADLTLQEVRVVLEDINDQPPRFTKAEYTAGVATD 2858

Query: 2719 QPPGTLVTTLHAIDGDAGAFGRLRYSLLE-------AGPGPEGREAFALNSSTGELRARV 2771
               G+ +  + A+D D G    + YS+L        A    +  + F + S  G LR   
Sbjct: 2859 AKVGSELIQVLALDADIGNNSLVFYSILAIHYFRALANDSEDVGQVFTMGSMDGILRTFD 2918

Query: 2772 PFDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDE 2808
             F       F + + A D    + +  + + +  +D+
Sbjct: 2919 LFMAYSPGYFVVDIVARDLAGHNDTAIIGIYILRDDQ 2955



 Score =  664 bits (1712), Expect = 0.0
 Identities = 636/2215 (28%), Positives = 983/2215 (44%), Gaps = 183/2215 (8%)

Query: 799  VPEDVAPGTSVGIVQAHNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLG 858
            + ED   G+SV  + A +      P+   +SG +    F+++  +G++   +PLDRE   
Sbjct: 42   ISEDTPVGSSVTQLLAQDMDND--PLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKS 99

Query: 859  P-VLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLR 917
               +E  V    GV       +V + + DVNDN+P F     +V +P NT  GTPI+ + 
Sbjct: 100  EFTVEFSVSDHQGV----ITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVN 155

Query: 918  ALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSP- 976
            A DPD G    V ++        F +D   G V ++R L      A++L + A D     
Sbjct: 156  ATDPDLGAGGSVLYSFQPPSQ-FFAIDSARGIVTVIRELDYETTQAYQLTVNATDQDKTR 214

Query: 977  PRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGP---IT 1033
            P ++   L +++ DV  + + P F +  Y  ++   +  GT V  + A   D G    I 
Sbjct: 215  PLSTLANLAIIITDV--QDMDPIFINLPYSTNIYEHSPPGTTVRIITAIDQDKGRPRGIG 272

Query: 1034 YHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAE----LGQQTGTA 1089
            Y + +   +S F L+  SG L +   LDRE        ++ V G++          T T 
Sbjct: 273  YTIVSGNTNSIFALDYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTT 332

Query: 1090 TVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGR-VFATDRDSGPNGRLTYSLQQLS 1148
            T  + +++ N+++P  +     +A+ E    G ++   +   D+D        + +  + 
Sbjct: 333  TFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVG 392

Query: 1149 EDSKAFRIHPQTGE------VTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVL 1202
             +S  F I P + +      +     LD E    Y   +   +   P       V + ++
Sbjct: 393  NNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANES-VPDHVGYAKVKITLI 451

Query: 1203 DLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSE 1262
            + NDN P F Q          I + + V  GT V T+ A D D G  G + Y  +    +
Sbjct: 452  NENDNRPIFSQPL------YNISLYENVTVGTSVLTVLATDNDAGTFGEVSYFFSDD-PD 504

Query: 1263 LFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLV----QVLPSARLA 1318
             FSL   +G ++  A L       + LT+ A D G    +  +++ V      +P+ +  
Sbjct: 505  RFSLDKDTGLIMLIARLDYELIQRFTLTIIARDGGGEETTGRVRINVLDVNDNVPTFQKD 564

Query: 1319 EPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGT 1378
                 L E +P+    V L  T  +           + P       +TY++V  +     
Sbjct: 565  AYVGALRENEPSVTQLVRLRATDED-----------SPPN----NQITYSIVSASAFGSY 609

Query: 1379 F--ALDAASGRLYLARPLDFEA-GPPWRALTVRAEGPGGAGAR-LLRVQVQVQDENEHAP 1434
            F  +L    G + ++RPLD+E        LTV A   G       + V ++V DEN++ P
Sbjct: 610  FDISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIEVFDENDNPP 669

Query: 1435 AFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPAL------RL 1488
             F++    +++ EN   GA +    A+D D        R R   QE  + +L      R+
Sbjct: 670  TFSKPAYFVSVVENIMAGATVLFLNATDLD--------RSREYGQESIIYSLEGSTQFRI 721

Query: 1489 DARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFA- 1547
            +AR+G ++    LDRET    +L+V A D     +++     +  + + D NDN P +  
Sbjct: 722  NARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGI-ATVNITLLDINDNHPTWKD 780

Query: 1548 SPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRP- 1606
            +P  + L E  PP      VVA DPDLGE   + Y +       + L+S+TG +      
Sbjct: 781  APYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIQPPNK-FYSLNSTTGKIRTTHAM 839

Query: 1607 LDREQRAEHV------LTVVASDHGSPPRSATQVLTVSV--ADVNDEAPTFQQQEYSVLL 1658
            LDRE    H       + V  +D G PP  AT   TV V   D+ND  PTFQ   +   +
Sbjct: 840  LDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEV 899

Query: 1659 RENNPPGTSLLTLRATDPDVGANGQVTYG---GVSSESFSLDPDTGVLTTLRALDREEQE 1715
             E  P G S+  + A D D G NG V+Y    G+    F ++  +GV+ T   LDRE   
Sbjct: 900  LEGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSSGVVVTTTELDRERIA 959

Query: 1716 EINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQ-TLTMLRA 1774
            E  L V A D G+P + +  T+ + V D ND  PTF  A  ++ V E    +  +  L  
Sbjct: 960  EYQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNC 1019

Query: 1775 SDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPA 1834
            +D DVG N +L Y I  G+  G F +        T+  LDRE   A+ L +EA D G   
Sbjct: 1020 TDNDVGLNAELSYFITGGNVDGKFSVGYRDAVVRTVVGLDRETTAAYMLILEAIDNGPVG 1079

Query: 1835 L--SATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTY 1892
               + T  + VTVLD ND+ P F   +Y   VPED+P G  +LQL+A D D G  G V Y
Sbjct: 1080 KRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSILQLKATDADEGEFGRVWY 1139

Query: 1893 YLGAGTAGA-FLLEPSSGEL-RTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITV 1950
             +  G  G  F +  S+G L R    LDRE+  S+   V A +    GP+ ++V V + V
Sbjct: 1140 RILHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAYNHDL-GPMRSSVRVIVYV 1198

Query: 1951 RDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPG 2010
             D+ND AP F          R      T  + +   +A DRD+G    + YR+       
Sbjct: 1199 EDINDEAPVFTQQQYSRLGLRETAGIGTSVIVV---QATDRDSGDGGLVNYRILSGAEGK 1255

Query: 2011 TTVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRFPR 2070
              +D  TG I              ++ + ATD   P       + + L  E +   +F  
Sbjct: 1256 FEIDESTGLIITVNYLDYETKTSYMMNVSATDQAPPFNQGFCSVYITLLNELDEAVQFSN 1315

Query: 2071 ASSEATIRENAPPGTPIVSPRAVHAGGTNGPITY---SILSGNEKGTFSIQPSTGAITVR 2127
            AS EA I EN   GT IV  +A      N  ITY   +  S   K  F I   TG ITV+
Sbjct: 1316 ASYEAAILENLALGTEIVRVQAYSIDNLN-QITYRFNAYTSTQAKALFKIDAITGVITVQ 1374

Query: 2128 SAEGLDFEVSPRLRLVLQAESGGAFAFTVLT--LTLQDANDNAPRF-LRPHYVAFLPESR 2184
                +D E      L + A+ GG    + +   +T+ D NDN+PRF         +PE  
Sbjct: 1375 GL--VDREKGDFYTLTVVADDGGPKVDSTVKVYITVLDENDNSPRFDFTSDSAVSIPEDC 1432

Query: 2185 PLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAI---LDREIWA 2241
            P+   +  V+A D D GS GQ+ +SLA+   A G F +  T  +I    +   LDRE   
Sbjct: 1433 PVGQRVATVKAWDPDAGSNGQVVFSLASGNIA-GAFEIVTTNDSIGEVFVARPLDREELD 1491

Query: 2242 ETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP--WELRVSEDALLGSEIAQVT 2299
               L ++A+DRG+P       L V ++D NDN P I  P  + + V+E+   G+ + QV 
Sbjct: 1492 HYILQVVASDRGTPPRKKDHILQVTILDINDNPPVIESPFGYNVSVNENVGGGTAVVQVR 1551

Query: 2300 GNDVDSG--PVLWYVLSPSGPQDPFSVGRYGGRVSLT-GPLDFEQCDRYQLQLLAHDGPH 2356
              D D G   VL Y ++       F + R  G ++    P D E+   Y L     D   
Sbjct: 1552 ATDRDIGINSVLSYYITEGNKDMAFRMDRISGEIATRPAPPDRERQSFYHLVATVED--- 1608

Query: 2357 EGRANLT------VLVEDVNDNAPAFSQSLYQVMLLEHTPP-GSAILSVSATDRDSGANG 2409
            EG   L+      V + D NDNAP F Q  Y+V+L E      ++++++ A D D G NG
Sbjct: 1609 EGTPTLSATTHVYVTIVDENDNAPMFQQPHYEVLLDEGPDTLNTSLITIQALDLDEGPNG 1668

Query: 2410 HISYHLASP--ADGFSVDPNNGTLFTIVGTVALGHDGS-GAVDVVLEARDHG---APGRA 2463
             ++Y + +    + F +D + G    I     L ++ S G   +++ A D     +    
Sbjct: 1669 TVTYAIVAGNIVNTFRIDRHMGV---ITAAKELDYEISHGRYTLIVTATDQCPILSHRLT 1725

Query: 2464 ARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSII 2523
            +  TV V + D ND+ P+F   +       +  PG  + T  A D D S  +  V+YSI+
Sbjct: 1726 STTTVLVNVNDINDNVPTFPRDYEGPFEVTEGQPGPRVWTFLAHDRD-SGPNGQVEYSIM 1784

Query: 2524 SGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEP--LDFESLTQYNLTVAAADRGQPP 2581
             G+    F + P                G L + +   LD E++  YNLT+ A DRG PP
Sbjct: 1785 DGDPLGEFVISP--------------VEGVLRVRKDVELDRETIAFYNLTICARDRGMPP 1830

Query: 2582 QSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTV 2641
             SS + V + VLD+NDN PV       +T+ E++PV + + HV ASDAD G +  + F +
Sbjct: 1831 LSSTMLVGIRVLDINDNDPVLLNLPMNITISENSPVSSFVAHVLASDADSGCNARLTFNI 1890

Query: 2642 SSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAAD----PAGAHFALAPVTIEVQ 2697
            ++G+    F ++ ++G + +   LD E    ++L +   D    P  A      + I + 
Sbjct: 1891 TAGNRERAFFINATTGIVTVNRPLDRERIPEYKLTISVKDNPENPRIARRDYDLLLIFLS 1950

Query: 2698 DVNDHGPAFPLNLLSTSVAENQPPGTLVTTLH----AIDGDAGAFGRLRYSLLEAGPGPE 2753
            D ND+ P F  +     V EN P GT +T L+    A+D D   +  + Y LL A  G  
Sbjct: 1951 DENDNHPLFTKSTYQAEVMENSPAGTPLTVLNGPILALDADQDIYAVVTYQLLGAQSG-- 2008

Query: 2754 GREAFALNSSTG--ELRARVPFDYE--HTESFRLLVGAADAGNLSASVTVSVLVTGEDEY 2809
                F +NSSTG   +R+ V  D E        LL+ A D G L+++  + + +  +++ 
Sbjct: 2009 ---LFDINSSTGVVTVRSGVIIDREAFSPPILELLLLAEDIGLLNSTAHLLITILDDNDN 2065

Query: 2810 DPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSL-ATSSPYFGINQTTGAL 2868
             P F        + E    G S+  V ATDED G +G ++Y + A +   F I+  TG +
Sbjct: 2066 RPTFSPATLTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQDRFLIHLVTGVI 2125

Query: 2869 YLRVDSRAPGSGTATSGGGGRTRREAPRELRLEVIA--RGPLPGSRSATVPVTVD 2921
             +               G     RE     RL V+A  RG +P S +A V + +D
Sbjct: 2126 RV---------------GNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILID 2165


>gi|66346693 FAT tumor suppressor 1 precursor [Homo sapiens]
          Length = 4588

 Score =  922 bits (2383), Expect = 0.0
 Identities = 837/2881 (29%), Positives = 1308/2881 (45%), Gaps = 214/2881 (7%)

Query: 49   LQIDEEQPAGT-LIGDISAGLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVL 107
            +Q+ E QP G+ +I   S  L  G    L+Y +S   G    +   ID  +G+++    L
Sbjct: 724  IQVKENQPVGSSVIFMNSTDLDTGFNGKLVYAVS---GGNEDSCFMIDMETGMLKILSPL 780

Query: 108  DREQRDRYRFTAVTPD------GATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGTR 161
            DRE  D+Y       D       A   + V V D ND+ P F Q    ++V E     + 
Sbjct: 781  DRETTDKYTLNITVYDLGIPQKAAWRLLHVVVVDANDNPPEFLQESYFVEVSEDKEVHSE 840

Query: 162  YPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSHY 221
                 A D D G  G   Y++  D   +TF +++  G      P       LDRE +  +
Sbjct: 841  IIQVEATDKDLGPNGHVTYSIVTD--TDTFSIDSVTGVVNIARP-------LDRELQHEH 891

Query: 222  MLQLEAYDGG--SPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFA 279
             L++EA D     P   +  ++ V+L D+ND+ P F    Y   V E L  G+ ++ + A
Sbjct: 892  SLKIEARDQAREEPQLFSTVVVKVSLEDVNDNPPTFIPPNYRVKVREDLPEGTVIMWLEA 951

Query: 280  SDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGA 339
             D D G +G V Y +      G+G F +D  +G +++ + LDFE+++V+ L V+A+D G 
Sbjct: 952  HDPDLGQSGQVRYSL---LDHGEGNFDVDKLSGAVRIVQQLDFEKKQVYNLTVRAKDKGK 1008

Query: 340  HPELGS-AFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDF 398
               L S  +V V V D N+N      +F S      V E AP G LV  +S  D D    
Sbjct: 1009 PVSLSSTCYVEVEVVDVNEN--LHPPVFSSFVEKGTVKEDAPVGSLVMTVSAHDEDARRD 1066

Query: 399  AHVNVSLEGGE--GHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPLRAEA 456
              +  S+  G   G F +  +  VI     + RLDRE    Y L V ATD G  PL +  
Sbjct: 1067 GEIRYSIRDGSGVGVFKIGEETGVIE---TSDRLDRESTSHYWLTVFATDQGVVPLSSFI 1123

Query: 457  AFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPGA 516
               + V DVNDNAP     +Y PE + E +     VV++ A DPD  +N ++ Y +  G 
Sbjct: 1124 EIYIEVEDVNDNAPQTSEPVYYPE-IMENSPKDVSVVQIEAFDPDSSSNDKLMYKITSGN 1182

Query: 517  HTHWFSIDPTSGIITTAA-SLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNE 575
               +FSI P +G+ITT +  LD E + +  L V  TD G PP ++ A V V + D NDN+
Sbjct: 1183 PQGFFSIHPKTGLITTTSRKLDREQQDEHILEVTVTDNGSPPKSTIARVIVKILDENDNK 1242

Query: 576  PQFQRTFYNASLPEGTQPG-------TCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPP 628
            PQF + FY   LPE  +P             V ATD D GP   +SYS+  G   +    
Sbjct: 1243 PQFLQKFYKIRLPEREKPDRERNARREPLYHVIATDKDEGPNAEISYSIEDG---NEHGK 1299

Query: 629  FRIDAHSGDVCTTRTLDRDQGPSSFD-FTVTAVDGGGLKSMVYVKVFLSDENDNPPQFYP 687
            F I+  +G V + R          +D  ++ AVD G  +     ++ +   +   P   P
Sbjct: 1300 FFIEPKTGVVSSKRF----SAAGEYDILSIKAVDNGRPQKSSTTRLHIEWISKPKPSLEP 1355

Query: 688  REYAASISA----QSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLT 743
              +  S       +S P   ++ + + +P       L + I  GN    F +D+ +G + 
Sbjct: 1356 ISFEESFFTFTVMESDPVAHMIGVISVEPPGIP---LWFDITGGNYDSHFDVDKGTGTII 1412

Query: 744  VAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDV 803
            VA PL     S   L + A DG         +V I ++      P F   +Y   +PED 
Sbjct: 1413 VAKPLDAEQKSNYNLTVEATDG---TTTILTQVFIKVIDTNDHRPQFSTSKYEVVIPEDT 1469

Query: 804  APGTSVGIVQAHNPPGRLAPVTLSLSGGDPRGL--FSLDAVSGLLQTLRPLDRELLGPVL 861
            AP T +  + A +   +   +    S  DP  L  F LD  +G L T   LD E +    
Sbjct: 1470 APETEILQISAVDQDEKNKLIYTLQSSRDPLSLKKFRLDPATGSLYTSEKLDHEAVHQHT 1529

Query: 862  ELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDP 921
               +     VP     AR+ V + D ND++P F A      +  + A G+ +  + ALD 
Sbjct: 1530 LTVMVRDQDVPVKRNFARIVVNVSDTNDHAPWFTASSYKGRVYESAAVGSVVLQVTALDK 1589

Query: 922  DSGVNSRVTFTLLAGG-GGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTS 980
            D G N+ V +++ +G  G +F +DP  G ++  + L  S    ++L ++A D GSPP + 
Sbjct: 1590 DKGKNAEVLYSIESGNIGNSFMIDPVLGSIKTAKELDRSNQAEYDLMVKATDKGSPPMSE 1649

Query: 981  HFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGPITYHLAAEG 1040
               +R+ V        +P+F S  Y V+L    + G+ V  V A +     + Y +    
Sbjct: 1650 ITSVRIFVTIAD--NASPKFTSKEYSVELSETVSIGSFVGMVTAHSQSS--VVYEIKDGN 1705

Query: 1041 ASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNE 1100
                F + P SG +  + ALD E   +Y L +   + +    G  T T TV V + ++N+
Sbjct: 1706 TGDAFDINPHSGTIITQKALDFETLPIYTLIIQGTNMA----GLSTNT-TVLVHLQDEND 1760

Query: 1101 HSPRLSEDPTFLAVAENQPPGTSVGRVFATDR-----------DSGPNGRLTYSLQQLSE 1149
            ++P   +      ++E+     S+  V  TDR           D   N  L Y + + S 
Sbjct: 1761 NAPVFMQAEYTGLISES----ASINSVVLTDRNVPLVIRAADADKDSNALLVYHIVEPSV 1816

Query: 1150 DSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPP--RSTTGTVHVAVLDLNDN 1207
             +  F I   TG + T+ +LD E+ S +   VQV D G+P         V V V+D+ND 
Sbjct: 1817 HT-YFAIDSSTGAIHTVLSLDYEETSIFHFTVQVHDMGTPRLFAEYAANVTVHVIDINDC 1875

Query: 1208 SPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLT-GPGSELFSL 1266
             P F +    A   LP         G  V T+ A D D      ++Y++T G   E FS+
Sbjct: 1876 PPVFAKPLYEASLLLPTY------KGVKVITVNATDADSSAFSQLIYSITEGNIGEKFSM 1929

Query: 1267 HPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAE 1326
               +G L          R  Y LT+ A D G      S+++ V+    + L         
Sbjct: 1930 DYKTGAL--TVQNTTQLRSRYELTVRASD-GRFAGLTSVKINVKESKESHLK------FT 1980

Query: 1327 RDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAASG 1386
            +D  + V V    T AE L   + +G+    EP     L Y ++   +P+  F +   SG
Sbjct: 1981 QDVYSAV-VKENSTEAETLAVITAIGN-PINEP-----LFYHIL---NPDRRFKISRTSG 2030

Query: 1387 RL-YLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDPLALAL 1445
             L     P D E    +  +    E    +    + V+V V+D+N++AP F   P    +
Sbjct: 2031 VLSTTGTPFDREQQEAFDVVVEVTEEHKPSAVAHVVVKVIVEDQNDNAPVFVNLPYYAVV 2090

Query: 1446 PENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRET 1505
              + E G  +    A D D  G N +V Y L           L    G +S  +  + +T
Sbjct: 2091 KVDTEVGHVIRYVTAVDRDS-GRNGEVHYYLKEHHEHFQIGPL----GEISLKKQFELDT 2145

Query: 1506 -TPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASP-SRVRLPEDQPPGPA 1563
                 L+ V A D         A      V +T  N   PVF  P     + E       
Sbjct: 2146 LNKEYLVTVVAKD-----GGNPAFSAEVIVPITVMNKAMPVFEKPFYSAEIAESIQVHSP 2200

Query: 1564 ALHVVARDPDLGEAARVSYRLASGGD-GHFRLHSSTGALSVVRPLDREQRAEHVLTVVAS 1622
             +HV A  P   E  +V Y +  G     F ++ +TG ++V+ PLD E    + L++ A+
Sbjct: 2201 VVHVQANSP---EGLKVFYSITDGDPFSQFTINFNTGVINVIAPLDFEAHPAYKLSIRAT 2257

Query: 1623 DHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANG 1682
            D       A   + + V D+ND  P F QQ Y+V L E +  GTS++ +RATD D   N 
Sbjct: 2258 D-SLTGAHAEVFVDIIVDDINDNPPVFAQQSYAVTLSEASVIGTSVVQVRATDSDSEPNR 2316

Query: 1683 QVTY-----GGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTV 1737
             ++Y        S + F +D  TG+++ LR LD E+  +  + V A D G P   + V V
Sbjct: 2317 GISYQMFGNHSKSHDHFHVDSSTGLISLLRTLDYEQSRQHTIFVRAVDGGMPTLSSDVIV 2376

Query: 1738 RVAVEDENDHAPTFG----SAHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILDGD 1793
             V V D ND+ P F      A +S   P G     +T ++A D D     +LQY IL G+
Sbjct: 2377 TVDVTDLNDNPPLFEQQIYEARISEHAPHG---HFVTCVKAYDADSSDIDKLQYSILSGN 2433

Query: 1794 PSGAFVLDLASGEFGTMRPLDRE-VEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHA 1852
                FV+D A+G   T+  L R  ++P + L +   DG      ++  + VTV+  N H+
Sbjct: 2434 DHKHFVIDSATGII-TLSNLHRHALKPFYSLNLSVSDG---VFRSSTQVHVTVIGGNLHS 2489

Query: 1853 PAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGELR 1912
            PAF    Y VE+ E+ P  TL+++++  D D+G  GHVTY++    A         G++ 
Sbjct: 2490 PAFLQNEYEVELAENAPLHTLVMEVKTTDGDSGIYGHVTYHIVNDFAKDRFYINERGQIF 2549

Query: 1913 TAAALDREQCPSYTFSVSAVDGAAAGPLS-TTVSVTITVRDVNDHAPTFPTSPLRLRLPR 1971
            T   LDRE       SV  +   A G ++  TV+V +T  D ND+AP F  +   + +  
Sbjct: 2550 TLEKLDRETPAEKVISVRLMAKDAGGKVAFCTVNVILT--DDNDNAPQFRATKYEVNI-- 2605

Query: 1972 PGPSFSTPTLALATLRAEDRDAGANASILYRL---AGTPPPGTTVDSYTGEIRVARSPVA 2028
             G S +  T  +  L A D D G+NA I Y +   + +      ++  +G I    S + 
Sbjct: 2606 -GSSAAKGTSVVKVL-ASDADEGSNADITYAIEADSESVKENLEINKLSGVITTKESLIG 2663

Query: 2029 LGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIV 2088
            L       F+ A D G P++ +  ++ V +     + P+F       T+ E+ P GT I 
Sbjct: 2664 LENEFFTFFVRAVDNGSPSKESVVLVYVKILPPEMQLPKFSEPFYTFTVSEDVPIGTEID 2723

Query: 2089 SPRAVHAGGTNGPITYSILSG-----NEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLV 2143
              RA H    +G + YS++ G     N   +F I   +G + +   + LD E +   +  
Sbjct: 2724 LIRAEH----SGTVLYSLVKGNTPESNRDESFVIDRQSGRLKLE--KSLDHETTKWYQFS 2777

Query: 2144 LQA----ESGGAFAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLD 2199
            + A    +     A   +++ ++DANDN+P F    Y AF+ E+ P    ++Q+ A D D
Sbjct: 2778 ILARCTQDDHEMVASVDVSIQVKDANDNSPVFESSPYEAFIVENLPGGSRVIQIRASDAD 2837

Query: 2200 QGSGGQISYSLAASQPARGL--FHVDPTTGTITTTAILDREIWAETRLVLMATDRGSP-A 2256
             G+ GQ+ YSL  SQ    +  F ++  TG ITT   LD E     ++ ++A+D G    
Sbjct: 2838 SGTNGQVMYSLDQSQSVEVIESFAINMETGWITTLKELDHEKRDNYQIKVVASDHGEKIQ 2897

Query: 2257 LVGSATLTVMVIDTNDNRPTI-PQPWELRVSEDALLGSEIAQVTGNDVDSGPV---LWYV 2312
            L  +A + V V D ND+ P    + ++  VSED   G  IA ++  D DS  +   + Y 
Sbjct: 2898 LSSTAIVDVTVTDVNDSPPRFTAEIYKGTVSEDDPQGGVIAILSTTDADSEEINRQVTYF 2957

Query: 2313 LSPSGPQDPFSVGRYGG--RVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVLVEDVN 2370
            ++   P   F+V       +V +  PLD E+ D Y L + A DG    +A + V V D N
Sbjct: 2958 ITGGDPLGQFAVETIQNEWKVYVKKPLDREKRDNYLLTITATDGTFSSKAIVEVKVLDAN 3017

Query: 2371 DNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYH-LASPADGFSVDPNNG 2429
            DN+P   ++LY   + E   PG  I+ +SATD D  +N  I+Y  L S A+ F ++P+ G
Sbjct: 3018 DNSPVCEKTLYSDTIPEDVLPGKLIMQISATDADIRSNAEITYTLLGSGAEKFKLNPDTG 3077

Query: 2430 TLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRV 2489
             L T   +  L  +      +++ A D G  GR  +A++ + L+D ND+AP F+   Y +
Sbjct: 3078 ELKT---STPLDREEQAVYHLLVRATDGG--GRFCQASIVLTLEDVNDNAPEFSADPYAI 3132

Query: 2490 AVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPR 2549
             V E+  PG+ L  ++ATDAD   +   + YS+I    G+ F +                
Sbjct: 3133 TVFENTEPGTLLTRVQATDADAGLNRKIL-YSLIDSADGQ-FSIN--------------E 3176

Query: 2550 ALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQ-SSVVPVTVTVLDVNDNPPVFTRASYR 2608
              G + L +PLD E    Y L++ A D+G P + ++   V V+VLD+NDNPPVF    Y 
Sbjct: 3177 LSGIIQLEKPLDRELQAVYTLSLKAVDQGLPRRLTATGTVIVSVLDINDNPPVFEYREYG 3236

Query: 2609 VTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCE 2668
             TV ED  VG E+L V A+  D   +  + +++ SG+  G F +D  +G + +   LD E
Sbjct: 3237 ATVSEDILVGTEVLQVYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAVFIIENLDYE 3296

Query: 2669 TQARHQLVVQAADPAGAHFA-LAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTT 2727
            +   + L V+A D      + +A V + V D+ND+ P F  +  +T ++E+      V T
Sbjct: 3297 SSHEYYLTVEATDGGTPSLSDVATVNVNVTDINDNTPVFSQDTYTTVISEDAVLEQSVIT 3356

Query: 2728 LHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGA 2787
            + A D D  +   + YS+++   G     +F ++   GE++     D E    + L V A
Sbjct: 3357 VMADDADGPSNSHIHYSIIDGNQG----SSFTIDPVRGEVKVTKLLDRETISGYTLTVQA 3412

Query: 2788 ADAGNLSA--SVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGGAD 2845
            +D G+     + TV++ V+  ++  PVF    +   + E    G S+  +  TDED   +
Sbjct: 3413 SDNGSPPRVNTTTVNIDVSDVNDNAPVFSRGNYSVIIQENKPVGFSVLQLVVTDEDSSHN 3472

Query: 2846 G 2846
            G
Sbjct: 3473 G 3473



 Score =  810 bits (2093), Expect = 0.0
 Identities = 774/2796 (27%), Positives = 1236/2796 (44%), Gaps = 209/2796 (7%)

Query: 136  INDHAPAFPQAR-AALQVPEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLE 194
            +N H P F       +QV E+   G+      + D D G  G   YA+SG      F ++
Sbjct: 709  VNAHIPQFRSTLPTGIQVKENQPVGSSVIFMNSTDLDTGFNGKLVYAVSGGNEDSCFMID 768

Query: 195  TRPGPDGTPVPELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPA 254
               G        L +   LDRE    Y L +  YD G P + A  LL V ++D ND+ P 
Sbjct: 769  METGM-------LKILSPLDRETTDKYTLNITVYDLGIPQKAAWRLLHVVVVDANDNPPE 821

Query: 255  FNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLL 314
            F Q  Y   VSE     S ++QV A+D D G NG VTY I          FSID+ TG++
Sbjct: 822  FLQESYFVEVSEDKEVHSEIIQVEATDKDLGPNGHVTYSI----VTDTDTFSIDSVTGVV 877

Query: 315  QLERPLDFEQRRVHELVVQARDGGAH-PELGSAFVT-VHVRDANDNQPSMTVIFLSADGS 372
             + RPLD E +  H L ++ARD     P+L S  V  V + D NDN P+    F+  +  
Sbjct: 878  NIARPLDRELQHEHSLKIEARDQAREEPQLFSTVVVKVSLEDVNDNPPT----FIPPNYR 933

Query: 373  PQVSEAAPPGQLVARISVSDPDDGDFAHVNVSL-EGGEGHFALSTQDSVIYLVCVARRLD 431
             +V E  P G ++  +   DPD G    V  SL + GEG+F +   D +   V + ++LD
Sbjct: 934  VKVREDLPEGTVIMWLEAHDPDLGQSGQVRYSLLDHGEGNFDV---DKLSGAVRIVQQLD 990

Query: 432  REERDAYNLRVTATDSGSPPLRAEAAFV-LHVTDVNDNA-PAFDRQLYRPEPLPEVALPG 489
             E++  YNL V A D G P   +   +V + V DVN+N  P           + E A  G
Sbjct: 991  FEKKQVYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHPPVFSSFVEKGTVKEDAPVG 1050

Query: 490  SFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVV 549
            S V+ V+A D D   +G++ YS+  G+    F I   +G+I T+  LD E      L V 
Sbjct: 1051 SLVMTVSAHDEDARRDGEIRYSIRDGSGVGVFKIGEETGVIETSDRLDRESTSHYWLTVF 1110

Query: 550  ATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGP 609
            ATD G+ PL+S   + + ++DVNDN PQ     Y   + E +      +Q+ A D DS  
Sbjct: 1111 ATDQGVVPLSSFIEIYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPDSSS 1170

Query: 610  FGLLSYSLGAGLGSSGSPP--FRIDAHSGDVCTT-RTLDRDQGPSSFDFTVTAVDGGGLK 666
               L Y +     +SG+P   F I   +G + TT R LDR+Q        VT  D G   
Sbjct: 1171 NDKLMYKI-----TSGNPQGFFSIHPKTGLITTTSRKLDREQQDEHI-LEVTVTDNGSPP 1224

Query: 667  SMVYVKVFLS--DENDNPPQFYPREYAASISAQSPPG-------TAVLRLRAHDPDQGSH 717
                 +V +   DENDN PQF  + Y   +  +  P          +  + A D D+G +
Sbjct: 1225 KSTIARVIVKILDENDNKPQFLQKFYKIRLPEREKPDRERNARREPLYHVIATDKDEGPN 1284

Query: 718  GRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVD 777
              +SY I  GN    F ++ ++G+  V+      A     L I A D G  Q   + R+ 
Sbjct: 1285 AEISYSIEDGNEHGKFFIEPKTGV--VSSKRFSAAGEYDILSIKAVDNGRPQKSSTTRLH 1342

Query: 778  ISIV--PGTPTPPI-FEQLQYVFSVPEDVAPGTSVGIVQAHNPPGRLAPVTLSLSGGDPR 834
            I  +  P     PI FE+  + F+V E       +G++    PPG   P+   ++GG+  
Sbjct: 1343 IEWISKPKPSLEPISFEESFFTFTVMESDPVAHMIGVISV-EPPG--IPLWFDITGGNYD 1399

Query: 835  GLFSLDAVSGLLQTLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAF 894
              F +D  +G +   +PLD E       L V A  G         ++V+  D ND+ P F
Sbjct: 1400 SHFDVDKGTGTIIVAKPLDAEQKSN-YNLTVEATDGTTTILTQVFIKVI--DTNDHRPQF 1456

Query: 895  PAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGG----GAFTVDPTTGHV 950
               +  V++P +TAP T I  + A+D D    +++ +TL +         F +DP TG +
Sbjct: 1457 STSKYEVVIPEDTAPETEILQISAVDQDE--KNKLIYTLQSSRDPLSLKKFRLDPATGSL 1514

Query: 951  RLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLP 1010
                 L       H L +  RD   P + +  R+ V V D  T   AP F + +Y+  + 
Sbjct: 1515 YTSEKLDHEAVHQHTLTVMVRDQDVPVKRNFARIVVNVSD--TNDHAPWFTASSYKGRVY 1572

Query: 1011 SGTTAGTQVLQVQAQAPDGG---PITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQEL 1067
                 G+ VLQV A   D G    + Y + +    + F ++P  G +     LDR  Q  
Sbjct: 1573 ESAAVGSVVLQVTALDKDKGKNAEVLYSIESGNIGNSFMIDPVLGSIKTAKELDRSNQAE 1632

Query: 1068 YILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRV 1127
            Y L V A       + + T   +VR+ +   +  SP+ +     + ++E    G+ VG V
Sbjct: 1633 YDLMVKATDKGSPPMSEIT---SVRIFVTIADNASPKFTSKEYSVELSETVSIGSFVGMV 1689

Query: 1128 FATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGG 1187
             A  + S     + Y ++       AF I+P +G + T + LD E    Y L++Q  +  
Sbjct: 1690 TAHSQSS-----VVYEIKD-GNTGDAFDINPHSGTIITQKALDFETLPIYTLIIQGTNMA 1743

Query: 1188 SPPRSTTGTVHVAVLDLNDNSPTFLQA--SGAAGGGLPIQ---VPDRVPPGTLVTTLQAK 1242
                +TT  VH+   D NDN+P F+QA  +G       I    + DR  P      ++A 
Sbjct: 1744 GLSTNTTVLVHLQ--DENDNAPVFMQAEYTGLISESASINSVVLTDRNVP----LVIRAA 1797

Query: 1243 DPDEGENGTILYTLTGPG-SELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPR 1301
            D D+  N  ++Y +  P     F++   +G + T   L   E   +  T+  HD G+P  
Sbjct: 1798 DADKDSNALLVYHIVEPSVHTYFAIDSSTGAIHTVLSLDYEETSIFHFTVQVHDMGTPRL 1857

Query: 1302 SA--SLQLLVQVLP----SARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVA 1355
             A  +  + V V+         A+P  + +   P      V+TV A +            
Sbjct: 1858 FAEYAANVTVHVIDINDCPPVFAKPLYEASLLLPTYKGVKVITVNATDA----------- 1906

Query: 1356 APEPAGVGALTYTLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGA 1415
              + +    L Y++  G   E  F++D  +G L +       +      LTVRA    G 
Sbjct: 1907 --DSSAFSQLIYSITEGNIGE-KFSMDYKTGALTVQNTTQLRSR---YELTVRAS--DGR 1958

Query: 1416 GARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYR 1475
             A L  V++ V++  E    F +D  +  + EN      L    A    G   N  + Y 
Sbjct: 1959 FAGLTSVKINVKESKESHLKFTQDVYSAVVKENSTEAETLAVITAI---GNPINEPLFYH 2015

Query: 1476 LLRQEPPVPALRLDARTGALSAP-RGLDRETTPALLLLVEATDRPANASRRRAARVSARV 1534
            +L    P    ++   +G LS      DRE   A  ++VE T+    ++    A V  +V
Sbjct: 2016 ILN---PDRRFKISRTSGVLSTTGTPFDREQQEAFDVVVEVTEEHKPSA---VAHVVVKV 2069

Query: 1535 FVTDENDNAPVFAS-PSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGHFR 1593
             V D+NDNAPVF + P    +  D   G    +V A D D G    V Y L    + HF+
Sbjct: 2070 IVEDQNDNAPVFVNLPYYAVVKVDTEVGHVIRYVTAVDRDSGRNGEVHYYLKEHHE-HFQ 2128

Query: 1594 LHSSTGALSVVRPLDREQ-RAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQ 1652
            +    G +S+ +  + +    E+++TVVA D G+P  SA  ++ ++V  +N   P F++ 
Sbjct: 2129 I-GPLGEISLKKQFELDTLNKEYLVTVVAKDGGNPAFSAEVIVPITV--MNKAMPVFEKP 2185

Query: 1653 EYSVLLRENNPPGTSLLTLRATDPD-VGANGQVTYGGVSSESFSLDPDTGVLTTLRALDR 1711
             YS  + E+    + ++ ++A  P+ +     +T G   S+ F+++ +TGV+  +  LD 
Sbjct: 2186 FYSAEIAESIQVHSPVVHVQANSPEGLKVFYSITDGDPFSQ-FTINFNTGVINVIAPLDF 2244

Query: 1712 EEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQT-LT 1770
            E      L++ A D  +      V V + V+D ND+ P F     ++ + E     T + 
Sbjct: 2245 EAHPAYKLSIRATDSLTGAH-AEVFVDIIVDDINDNPPVFAQQSYAVTLSEASVIGTSVV 2303

Query: 1771 MLRASDPDVGANGQLQYRILDGDPSG--AFVLDLASGEFGTMRPLDREVEPAFQLRIEAR 1828
             +RA+D D   N  + Y++          F +D ++G    +R LD E      + + A 
Sbjct: 2304 QVRATDSDSEPNRGISYQMFGNHSKSHDHFHVDSSTGLISLLRTLDYEQSRQHTIFVRAV 2363

Query: 1829 DGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANG 1888
            DGG P LS+ +++TV V D ND+ P F    Y   + E  P G  +  ++A+D D+    
Sbjct: 2364 DGGMPTLSSDVIVTVDVTDLNDNPPLFEQQIYEARISEHAPHGHFVTCVKAYDADSSDID 2423

Query: 1889 HVTYYLGAGTAGAFLLEPSSGELRTAAALDREQC-PSYTFSVSAVDGAAAGPLSTTVSVT 1947
             + Y + +G      +  S+  + T + L R    P Y+ ++S  DG       ++  V 
Sbjct: 2424 KLQYSILSGNDHKHFVIDSATGIITLSNLHRHALKPFYSLNLSVSDGV----FRSSTQVH 2479

Query: 1948 ITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTP 2007
            +TV   N H+P F  +   + L    P  +     +  ++  D D+G    + Y +    
Sbjct: 2480 VTVIGGNLHSPAFLQNEYEVELAENAPLHT----LVMEVKTTDGDSGIYGHVTYHIVNDF 2535

Query: 2008 PPGTTVDSYTGEIRVARSPVALGPRDRVLFI--VATDLGRPARSATGVIIVGLQGEAERG 2065
                   +  G+I          P ++V+ +  +A D G      T  +I  L  + +  
Sbjct: 2536 AKDRFYINERGQIFTLEKLDRETPAEKVISVRLMAKDAGGKVAFCTVNVI--LTDDNDNA 2593

Query: 2066 PRFPRASSEATIRENAPPGTPIVSPRAVHAG-GTNGPITYSILSGNE--KGTFSIQPSTG 2122
            P+F     E  I  +A  GT +V   A  A  G+N  ITY+I + +E  K    I   +G
Sbjct: 2594 PQFRATKYEVNIGSSAAKGTSVVKVLASDADEGSNADITYAIEADSESVKENLEINKLSG 2653

Query: 2123 AITVR-SAEGLDFEVSPRLRLVLQAESGGAFAFTVLTLTLQDANDNAPRFLRPHYVAFLP 2181
             IT + S  GL+ E        +   S    +  ++ + +       P+F  P Y   + 
Sbjct: 2654 VITTKESLIGLENEFFTFFVRAVDNGSPSKESVVLVYVKILPPEMQLPKFSEPFYTFTVS 2713

Query: 2182 ESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARG----LFHVDPTTGTITTTAILDR 2237
            E  P     +  E D +     G + YSL             F +D  +G +     LD 
Sbjct: 2714 EDVP-----IGTEIDLIRAEHSGTVLYSLVKGNTPESNRDESFVIDRQSGRLKLEKSLDH 2768

Query: 2238 EI--WAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTI-PQPWELRVSEDALLGSE 2294
            E   W +  ++   T +    +V S  +++ V D NDN P     P+E  + E+   GS 
Sbjct: 2769 ETTKWYQFSILARCT-QDDHEMVASVDVSIQVKDANDNSPVFESSPYEAFIVENLPGGSR 2827

Query: 2295 IAQVTGNDVDSGP--VLWYVLSPSGPQ---DPFSVGRYGGRVSLTGPLDFEQCDRYQLQL 2349
            + Q+  +D DSG    + Y L  S      + F++    G ++    LD E+ D YQ+++
Sbjct: 2828 VIQIRASDADSGTNGQVMYSLDQSQSVEVIESFAINMETGWITTLKELDHEKRDNYQIKV 2887

Query: 2350 LAHDGPHEGRANLTVLVE----DVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDS 2405
            +A D   + + + T +V+    DVND+ P F+  +Y+  + E  P G  I  +S TD DS
Sbjct: 2888 VASDHGEKIQLSSTAIVDVTVTDVNDSPPRFTAEIYKGTVSEDDPQGGVIAILSTTDADS 2947

Query: 2406 -GANGHISYHL--ASPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGR 2462
               N  ++Y +    P   F+V+      + +     L  +      + + A D      
Sbjct: 2948 EEINRQVTYFITGGDPLGQFAVETIQNE-WKVYVKKPLDREKRDNYLLTITATDGTF--- 3003

Query: 2463 AARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSI 2522
            +++A V V++ D ND++P    + Y   + ED+ PG  ++ + ATDAD  RS+A + Y++
Sbjct: 3004 SSKAIVEVKVLDANDNSPVCEKTLYSDTIPEDVLPGKLIMQISATDAD-IRSNAEITYTL 3062

Query: 2523 ISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAAD-RGQPP 2581
            + G+    F+L P   E   S               PLD E    Y+L V A D  G+  
Sbjct: 3063 L-GSGAEKFKLNPDTGELKTST--------------PLDREEQAVYHLLVRATDGGGRFC 3107

Query: 2582 QSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFT- 2640
            Q+S+V   +T+ DVNDN P F+   Y +TV E+T  G  L  V+A+DAD G +  + ++ 
Sbjct: 3108 QASIV---LTLEDVNDNAPEFSADPYAITVFENTEPGTLLTRVQATDADAGLNRKILYSL 3164

Query: 2641 VSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAH--FALAPVTIEVQD 2698
            + S D  G F ++E SG ++L   LD E QA + L ++A D        A   V + V D
Sbjct: 3165 IDSAD--GQFSINELSGIIQLEKPLDRELQAVYTLSLKAVDQGLPRRLTATGTVIVSVLD 3222

Query: 2699 VNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAF 2758
            +ND+ P F       +V+E+   GT V  ++A   D  A   + YS++           F
Sbjct: 3223 INDNPPVFEYREYGATVSEDILVGTEVLQVYAASRDIEANAEITYSIISGNE----HGKF 3278

Query: 2759 ALNSSTGELRARVPFDYEHTESFRLLVGAADAG--NLSASVTVSVLVTGEDEYDPVFLAP 2816
            +++S TG +      DYE +  + L V A D G  +LS   TV+V VT  ++  PVF   
Sbjct: 3279 SIDSKTGAVFIIENLDYESSHEYYLTVEATDGGTPSLSDVATVNVNVTDINDNTPVFSQD 3338

Query: 2817 AFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSL 2852
             +   + E A    S+  V A D DG ++  + YS+
Sbjct: 3339 TYTTVISEDAVLEQSVITVMADDADGPSNSHIHYSI 3374



 Score =  757 bits (1954), Expect = 0.0
 Identities = 780/2892 (26%), Positives = 1244/2892 (43%), Gaps = 262/2892 (9%)

Query: 106  VLDREQRDRYRFTAV-----TPDGATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGT 160
            +L+RE +D Y          T   A  +V V+V D ND  P F     ++ +PE+TA  T
Sbjct: 107  ILNREVKDHYTLIVKALEKNTNVEARTKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRT 166

Query: 161  RYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSH 220
                  A DAD G  G   Y+       + F +    G        +V+TG LD      
Sbjct: 167  SIARVSATDADIGTNGEFYYSFK--DRTDMFAIHPTSG-------VIVLTGRLDYLETKL 217

Query: 221  YMLQLEAYDG-----GSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVL 275
            Y +++ A D      GS    + A L V +   N+ AP          +S S     P  
Sbjct: 218  YEMEILAADRGMKLYGSSGISSMAKLTVHIEQANECAPVITA----VTLSPSELDRDPAY 273

Query: 276  Q-VFASDADAGVNGAVT-----------YEINRRQSEGDGPFSIDAHTGLLQLERPLDFE 323
              V   D D G NG +                 R   G   + + A  G+     P  + 
Sbjct: 274  AIVTVDDCDQGANGDIASLSIVAGDLLQQFRTVRSFPGSKEYKVKAIGGIDWDSHPFGY- 332

Query: 324  QRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQ 383
                  L +QA+D G  P+  S  V +HV   +    +  V F       ++SE APP  
Sbjct: 333  -----NLTLQAKDKGTPPQFSSVKV-IHV--TSPQFKAGPVKFEKDVYRAEISEFAPPNT 384

Query: 384  LVARISVSDPDDGDFAHVNVSLEG--GEGHFALSTQDSVIYLVCVARRLDREERDAYNLR 441
             V  +         ++H+    +   G+  F+L+       L+ +   + R++   + L 
Sbjct: 385  PVVMVKAIPA----YSHLRYVFKSTPGKAKFSLNYNTG---LISILEPVKRQQAAHFELE 437

Query: 442  VTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPD 501
            VT +D      +A    ++ V   N N P F +  Y+      V + G+ V+ ++A DPD
Sbjct: 438  VTTSDR-----KASTKVLVKVLGANSNPPEFTQTAYKAAFDENVPI-GTTVMSLSAVDPD 491

Query: 502  QGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQP-QLIVVATDGGLPPLAS 560
            +G NG VTYS+A   H   F+ID  +G ++T+ +LDYEL P+   L + A+D GLP    
Sbjct: 492  EGENGYVTYSIANLNHVP-FAIDHFTGAVSTSENLDYELMPRVYTLRIRASDWGLPYRRE 550

Query: 561  -SATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGA 619
                 ++ L ++NDN P F++     ++P     G     V+A DAD     L+ Y + A
Sbjct: 551  VEVLATITLNNLNDNTPLFEKINCEGTIPRDLGVGEQITTVSAIDADE--LQLVQYQIEA 608

Query: 620  GLGSSGSPPFRIDAHSGDVCTTRTLDRDQGP--SSFDFTVTAVDGGGLKSMVYVKVFLS- 676
            G   +    F ++ +SG +   R+L    G   S     +TA DG    + +Y+ + ++ 
Sbjct: 609  G---NELDFFSLNPNSGVLSLKRSLMDGLGAKVSFHSLRITATDGENFATPLYINITVAA 665

Query: 677  ------------------------------------------DENDNPPQFYPR-EYAAS 693
                                                        N + PQF         
Sbjct: 666  SHKLVNLQCEETGVAKMLAEKLLQANKLHNQGEVEDIFFDSHSVNAHIPQFRSTLPTGIQ 725

Query: 694  ISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRAN 753
            +    P G++V+ + + D D G +G+L Y +  GN    F +D ++G+L +  PL R   
Sbjct: 726  VKENQPVGSSVIFMNSTDLDTGFNGKLVYAVSGGNEDSCFMIDMETGMLKILSPLDRETT 785

Query: 754  SVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQ 813
                L I   D G  Q      + + +V     PP F Q  Y   V ED    + +  V+
Sbjct: 786  DKYTLNITVYDLGIPQKAAWRLLHVVVVDANDNPPEFLQESYFVEVSEDKEVHSEIIQVE 845

Query: 814  AHNPP-GRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGP-VLELEVR-AGSG 870
            A +   G    VT S+        FS+D+V+G++   RPLDREL     L++E R     
Sbjct: 846  ATDKDLGPNGHVTYSIV--TDTDTFSIDSVTGVVNIARPLDRELQHEHSLKIEARDQARE 903

Query: 871  VPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVT 930
             P  F+   V+V L+DVNDN P F  P   V +  +   GT I  L A DPD G + +V 
Sbjct: 904  EPQLFSTVVVKVSLEDVNDNPPTFIPPNYRVKVREDLPEGTVIMWLEAHDPDLGQSGQVR 963

Query: 931  FTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSP-PRTSHFRLRVVVQ 989
            ++LL  G G F VD  +G VR+++ L       + L + A+D G P   +S   + V V 
Sbjct: 964  YSLLDHGEGNFDVDKLSGAVRIVQQLDFEKKQVYNLTVRAKDKGKPVSLSSTCYVEVEVV 1023

Query: 990  DVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDG---GPITYHLAAEGASSPFG 1046
            DV      P F+S   +  +      G+ V+ V A   D    G I Y +        F 
Sbjct: 1024 DVNENLHPPVFSSFVEKGTVKEDAPVGSLVMTVSAHDEDARRDGEIRYSIRDGSGVGVFK 1083

Query: 1047 LEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLS 1106
            +  ++G +     LDRE+   Y L V A       L   +    + + + + N+++P+ S
Sbjct: 1084 IGEETGVIETSDRLDRESTSHYWLTVFATDQGVVPL---SSFIEIYIEVEDVNDNAPQTS 1140

Query: 1107 EDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTL 1166
            E   +  + EN P   SV ++ A D DS  N +L Y +         F IHP+TG +TT 
Sbjct: 1141 EPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLMYKITS-GNPQGFFSIHPKTGLITTT 1199

Query: 1167 -QTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQ 1225
             + LDREQQ  + L V V D GSPP+ST   V V +LD NDN P FLQ          I+
Sbjct: 1200 SRKLDREQQDEHILEVTVTDNGSPPKSTIARVIVKILDENDNKPQFLQKF------YKIR 1253

Query: 1226 VPDRVPPGTLVTTLQ-------AKDPDEGENGTILYTL-TGPGSELFSLHPHSGELLTAA 1277
            +P+R  P       +       A D DEG N  I Y++  G     F + P +G  + ++
Sbjct: 1254 LPEREKPDRERNARREPLYHVIATDKDEGPNAEISYSIEDGNEHGKFFIEPKTG--VVSS 1311

Query: 1278 PLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVL 1337
                A   + +L++ A D G P +S++ +L ++      +++P P L   +P +      
Sbjct: 1312 KRFSAAGEYDILSIKAVDNGRPQKSSTTRLHIE-----WISKPKPSL---EPISFEESFF 1363

Query: 1338 TVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAASGRLYLARPLDFE 1397
            T T  E      ++G V + EP G+  L + + GG + +  F +D  +G + +A+PLD E
Sbjct: 1364 TFTVMESDPVAHMIG-VISVEPPGI-PLWFDITGG-NYDSHFDVDKGTGTIIVAKPLDAE 1420

Query: 1398 AGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYT 1457
                +  LTV  E   G    L +V ++V D N+H P F+     + +PE+  P   +  
Sbjct: 1421 QKSNYN-LTV--EATDGTTTILTQVFIKVIDTNDHRPQFSTSKYEVVIPEDTAPETEILQ 1477

Query: 1458 FRASDADGPGPNSDVRYRLLRQEPP--VPALRLDARTGALSAPRGLDRETTPALLLLVEA 1515
              A D D     + + Y L     P  +   RLD  TG+L     LD E      L V  
Sbjct: 1478 ISAVDQD---EKNKLIYTLQSSRDPLSLKKFRLDPATGSLYTSEKLDHEAVHQHTLTVMV 1534

Query: 1516 TDRPANASRRRAARVSARVFVTDENDNAPVF-ASPSRVRLPEDQPPGPAALHVVARDPDL 1574
             D+     R  A  V   V V+D ND+AP F AS  + R+ E    G   L V A D D 
Sbjct: 1535 RDQDVPVKRNFARIV---VNVSDTNDHAPWFTASSYKGRVYESAAVGSVVLQVTALDKDK 1591

Query: 1575 GEAARVSYRLASGGDGH-FRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQ 1633
            G+ A V Y + SG  G+ F +    G++   + LDR  +AE+ L V A+D GSPP S   
Sbjct: 1592 GKNAEVLYSIESGNIGNSFMIDPVLGSIKTAKELDRSNQAEYDLMVKATDKGSPPMSEIT 1651

Query: 1634 VLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTY---GGVS 1690
             + + V   ++ +P F  +EYSV L E    G+ +  + A      +   V Y    G +
Sbjct: 1652 SVRIFVTIADNASPKFTSKEYSVELSETVSIGSFVGMVTA-----HSQSSVVYEIKDGNT 1706

Query: 1691 SESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPT 1750
             ++F ++P +G + T +ALD E      L +  Q        T+ TV V ++DEND+AP 
Sbjct: 1707 GDAFDINPHSGTIITQKALDFETLPIYTLII--QGTNMAGLSTNTTVLVHLQDENDNAPV 1764

Query: 1751 FGSAHLSLEVPEG--------QDPQTLTMLRASDPDVGANGQLQYRILDGDPSGAFVLDL 1802
            F  A  +  + E          D     ++RA+D D  +N  L Y I++      F +D 
Sbjct: 1765 FMQAEYTGLISESASINSVVLTDRNVPLVIRAADADKDSNALLVYHIVEPSVHTYFAIDS 1824

Query: 1803 ASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLL--LTVTVLDANDHAPAFPVPAY 1860
            ++G   T+  LD E    F   ++  D G P L A     +TV V+D ND  P F  P Y
Sbjct: 1825 STGAIHTVLSLDYEETSIFHFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFAKPLY 1884

Query: 1861 SVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAG-AFLLEPSSGELRTAAALDR 1919
               +      G  ++ + A D D+ A   + Y +  G  G  F ++  +G L        
Sbjct: 1885 EASLLLPTYKGVKVITVNATDADSSAFSQLIYSITEGNIGEKFSMDYKTGALTVQNTTQL 1944

Query: 1920 EQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTP 1979
                 Y  +V A DG  AG      SV I V++  +    F T  +   + +   S    
Sbjct: 1945 RS--RYELTVRASDGRFAG----LTSVKINVKESKESHLKF-TQDVYSAVVKEN-STEAE 1996

Query: 1980 TLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLFIV 2039
            TLA+ T          N  + Y +   P     +   +G +    +P     ++    +V
Sbjct: 1997 TLAVITAIGNP----INEPLFYHIL-NPDRRFKISRTSGVLSTTGTPFDREQQEAFDVVV 2051

Query: 2040 -ATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAV-HAGG 2097
              T+  +P+  A  V+ V ++ + +  P F      A ++ +   G  I    AV    G
Sbjct: 2052 EVTEEHKPSAVAHVVVKVIVEDQNDNAPVFVNLPYYAVVKVDTEVGHVIRYVTAVDRDSG 2111

Query: 2098 TNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFTV- 2156
             NG + Y +   +E   F I P  G I+++    LD  ++    + + A+ GG  AF+  
Sbjct: 2112 RNGEVHYYLKEHHEH--FQIGP-LGEISLKKQFELD-TLNKEYLVTVVAKDGGNPAFSAE 2167

Query: 2157 LTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPA 2216
            + + +   N   P F +P Y A + ES  +  P++ V+A+  +   G ++ YS+    P 
Sbjct: 2168 VIVPITVMNKAMPVFEKPFYSAEIAESIQVHSPVVHVQANSPE---GLKVFYSITDGDPF 2224

Query: 2217 RGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPT 2276
               F ++  TG I   A LD E     +L + ATD  + A      + ++V D NDN P 
Sbjct: 2225 -SQFTINFNTGVINVIAPLDFEAHPAYKLSIRATDSLTGA-HAEVFVDIIVDDINDNPPV 2282

Query: 2277 I-PQPWELRVSEDALLGSEIAQVTGNDVDSGP--VLWYVL--SPSGPQDPFSVGRYGGRV 2331
               Q + + +SE +++G+ + QV   D DS P   + Y +  + S   D F V    G +
Sbjct: 2283 FAQQSYAVTLSEASVIGTSVVQVRATDSDSEPNRGISYQMFGNHSKSHDHFHVDSSTGLI 2342

Query: 2332 SLTGPLDFEQCDRYQLQLLAHDGPHEGRAN---LTVLVEDVNDNAPAFSQSLYQVMLLEH 2388
            SL   LD+EQ  ++ + + A DG     ++   +TV V D+NDN P F Q +Y+  + EH
Sbjct: 2343 SLLRTLDYEQSRQHTIFVRAVDGGMPTLSSDVIVTVDVTDLNDNPPLFEQQIYEARISEH 2402

Query: 2389 TPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSGAV 2448
             P G  +  V A D DS     + Y + S       D  +  + +  G + L +    A+
Sbjct: 2403 APHGHFVTCVKAYDADSSDIDKLQYSILS-----GNDHKHFVIDSATGIITLSNLHRHAL 2457

Query: 2449 DVVLEARDHGAPGRAARAT-VHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEAT 2507
                      + G    +T VHV +   N H+P+F  + Y V + E+ P  + ++ ++ T
Sbjct: 2458 KPFYSLNLSVSDGVFRSSTQVHVTVIGGNLHSPAFLQNEYEVELAENAPLHTLVMEVKTT 2517

Query: 2508 DADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQ 2567
            D D S  +  V Y I++      F +  R               G +  LE LD E+  +
Sbjct: 2518 DGD-SGIYGHVTYHIVNDFAKDRFYINER---------------GQIFTLEKLDRETPAE 2561

Query: 2568 YNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEAS 2627
              ++V    +    + +   V V + D NDN P F    Y V +      G  ++ V AS
Sbjct: 2562 KVISVRLMAKDAGGKVAFCTVNVILTDDNDNAPQFRATKYEVNIGSSAAKGTSVVKVLAS 2621

Query: 2628 DADPGPHGLVRFTVSSGDPS--GLFELDESSGTLRLAHALDCETQARHQLVVQAADPAG- 2684
            DAD G +  + + + +   S     E+++ SG +    +L           V+A D    
Sbjct: 2622 DADEGSNADITYAIEADSESVKENLEINKLSGVITTKESLIGLENEFFTFFVRAVDNGSP 2681

Query: 2685 AHFALAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYS 2744
            +  ++  V +++       P F     + +V+E+ P GT +  + A        G + YS
Sbjct: 2682 SKESVVLVYVKILPPEMQLPKFSEPFYTFTVSEDVPIGTEIDLIRAEHS-----GTVLYS 2736

Query: 2745 LLEAGPGPEGR--EAFALNSSTGELRARVPFDYEHTESFRLLVGA---ADAGNLSASVTV 2799
            L++ G  PE    E+F ++  +G L+     D+E T+ ++  + A    D   + ASV V
Sbjct: 2737 LVK-GNTPESNRDESFVIDRQSGRLKLEKSLDHETTKWYQFSILARCTQDDHEMVASVDV 2795

Query: 2800 SVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSSPY- 2858
            S+ V   ++  PVF +  +   + E    G  +  ++A+D D G +G V+YSL  S    
Sbjct: 2796 SIQVKDANDNSPVFESSPYEAFIVENLPGGSRVIQIRASDADSGTNGQVMYSLDQSQSVE 2855

Query: 2859 ----FGINQTTG 2866
                F IN  TG
Sbjct: 2856 VIESFAINMETG 2867



 Score =  724 bits (1868), Expect = 0.0
 Identities = 770/2874 (26%), Positives = 1235/2874 (42%), Gaps = 241/2874 (8%)

Query: 93   AIDEHSGVVRTARVLDREQRDRYRFTAVTPDGA--------TVEVTVRVADINDHAPAFP 144
            +ID  +GVV  AR LDRE +  +       D A        TV V V + D+ND+ P F 
Sbjct: 869  SIDSVTGVVNIARPLDRELQHEHSLKIEARDQAREEPQLFSTVVVKVSLEDVNDNPPTFI 928

Query: 145  QARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPV 204
                 ++V E    GT      A D D G+ G   Y+L   G G  F ++   G      
Sbjct: 929  PPNYRVKVREDLPEGTVIMWLEAHDPDLGQSGQVRYSLLDHGEGN-FDVDKLSGA----- 982

Query: 205  PELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQAL-LDVTLLDIND--HAPAFNQSRYH 261
              + +  +LD E +  Y L + A D G P   +    ++V ++D+N+  H P F+     
Sbjct: 983  --VRIVQQLDFEKKQVYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHPPVFSSFVEK 1040

Query: 262  AVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLD 321
              V E    GS V+ V A D DA  +G + Y I  R   G G F I   TG+++    LD
Sbjct: 1041 GTVKEDAPVGSLVMTVSAHDEDARRDGEIRYSI--RDGSGVGVFKIGEETGVIETSDRLD 1098

Query: 322  FEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQP--SMTVIFLSADGSPQVSEAA 379
             E    + L V A D G  P      + + V D NDN P  S  V +      P++ E +
Sbjct: 1099 RESTSHYWLTVFATDQGVVPLSSFIEIYIEVEDVNDNAPQTSEPVYY------PEIMENS 1152

Query: 380  PPGQLVARISVSDPDDGDFAHVNVSLEGG--EGHFALSTQDSVIYLVCVARRLDREERDA 437
            P    V +I   DPD      +   +  G  +G F++  +  +I     +R+LDRE++D 
Sbjct: 1153 PKDVSVVQIEAFDPDSSSNDKLMYKITSGNPQGFFSIHPKTGLI--TTTSRKLDREQQDE 1210

Query: 438  YNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSF------ 491
            + L VT TD+GSPP    A  ++ + D NDN P F ++ Y+   LPE   P         
Sbjct: 1211 HILEVTVTDNGSPPKSTIARVIVKILDENDNKPQFLQKFYKIR-LPEREKPDRERNARRE 1269

Query: 492  -VVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITT---AASLDYELEPQPQLI 547
             +  V A D D+G N +++YS+  G     F I+P +G++++   +A+ +Y++     L 
Sbjct: 1270 PLYHVIATDKDEGPNAEISYSIEDGNEHGKFFIEPKTGVVSSKRFSAAGEYDI-----LS 1324

Query: 548  VVATDGGLPPLASSATVSVALQDVNDNEPQ-----FQRTFYNASLPEGTQPGTCFLQVTA 602
            + A D G P    S+T  + ++ ++  +P      F+ +F+  ++ E + P    + V +
Sbjct: 1325 IKAVDNGRPQ--KSSTTRLHIEWISKPKPSLEPISFEESFFTFTVME-SDPVAHMIGVIS 1381

Query: 603  TDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDG 662
             +    P   L + +  G   S    F +D  +G +   + LD +Q  S+++ TV A DG
Sbjct: 1382 VEPPGIP---LWFDITGGNYDSH---FDVDKGTGTIIVAKPLDAEQ-KSNYNLTVEATDG 1434

Query: 663  GG-LKSMVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLS 721
               + + V++KV   D ND+ PQF   +Y   I   + P T +L++ A D D+ +  +L 
Sbjct: 1435 TTTILTQVFIKVI--DTNDHRPQFSTSKYEVVIPEDTAPETEILQISAVDQDEKN--KLI 1490

Query: 722  YHILAGNSP---PLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDI 778
            Y + +   P     F LD  +G L  +  L   A     L +   D         AR+ +
Sbjct: 1491 YTLQSSRDPLSLKKFRLDPATGSLYTSEKLDHEAVHQHTLTVMVRDQDVPVKRNFARIVV 1550

Query: 779  SIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQA-HNPPGRLAPVTLSLSGGDPRGLF 837
            ++       P F    Y   V E  A G+ V  V A     G+ A V  S+  G+    F
Sbjct: 1551 NVSDTNDHAPWFTASSYKGRVYESAAVGSVVLQVTALDKDKGKNAEVLYSIESGNIGNSF 1610

Query: 838  SLDAVSGLLQTLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAP 897
             +D V G ++T + LDR        +      G PP   +  VR+ +   ++ SP F + 
Sbjct: 1611 MIDPVLGSIKTAKELDRSNQAEYDLMVKATDKGSPPMSEITSVRIFVTIADNASPKFTSK 1670

Query: 898  EDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGG-GGAFTVDPTTGHVRLMRPL 956
            E +V L    + G+ +  + A    S     V + +  G  G AF ++P +G +   + L
Sbjct: 1671 EYSVELSETVSIGSFVGMVTAHSQSS-----VVYEIKDGNTGDAFDINPHSGTIITQKAL 1725

Query: 957  GPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAG 1016
                 P + L ++  +      +++  + V +QD      AP F    Y   +    +  
Sbjct: 1726 DFETLPIYTLIIQGTNMAG--LSTNTTVLVHLQDENDN--APVFMQAEYTGLISESASIN 1781

Query: 1017 TQVLQ----------VQAQAPDGGPITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQE 1066
            + VL             A       + YH+      + F ++  +G +    +LD E   
Sbjct: 1782 SVVLTDRNVPLVIRAADADKDSNALLVYHIVEPSVHTYFAIDSSTGAIHTVLSLDYEETS 1841

Query: 1067 LYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGR 1126
            ++   V         L  +   A V V +++ N+  P  ++     ++      G  V  
Sbjct: 1842 IFHFTVQVHDMGTPRLFAEYA-ANVTVHVIDINDCPPVFAKPLYEASLLLPTYKGVKVIT 1900

Query: 1127 VFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDG 1186
            V ATD DS    +L YS+ + +   K F +  +TG +T   T   + +S Y+L V+  DG
Sbjct: 1901 VNATDADSSAFSQLIYSITEGNIGEK-FSMDYKTGALTVQNTT--QLRSRYELTVRASDG 1957

Query: 1187 GSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDE 1246
                 ++   V + V +  ++   F Q   +A     +   +     TL       +P  
Sbjct: 1958 RFAGLTS---VKINVKESKESHLKFTQDVYSA-----VVKENSTEAETLAVITAIGNPI- 2008

Query: 1247 GENGTILYTLTGPGSELFSLHPHSGEL-LTAAPLIRAERPHYVLTLSAHDQGSPPRSASL 1305
              N  + Y +  P    F +   SG L  T  P  R ++  + + +   ++  P  SA  
Sbjct: 2009 --NEPLFYHILNPDRR-FKISRTSGVLSTTGTPFDREQQEAFDVVVEVTEEHKP--SAVA 2063

Query: 1306 QLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGL--RPGSLLGSVAAPE--PAG 1361
             ++V+V+           + +++  APV V L   A   +    G ++  V A +     
Sbjct: 2064 HVVVKVI-----------VEDQNDNAPVFVNLPYYAVVKVDTEVGHVIRYVTAVDRDSGR 2112

Query: 1362 VGALTYTLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLR 1421
             G + Y L    +    F +    G + L +  + +       +TV A+  GG  A    
Sbjct: 2113 NGEVHYYL---KEHHEHFQIGPL-GEISLKKQFELDTLNKEYLVTVVAKD-GGNPAFSAE 2167

Query: 1422 VQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEP 1481
            V V +   N+  P F +   +  + E+ +  + +   +A+  +G      V Y +   +P
Sbjct: 2168 VIVPITVMNKAMPVFEKPFYSAEIAESIQVHSPVVHVQANSPEG----LKVFYSITDGDP 2223

Query: 1482 PVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDEND 1541
                  ++  TG ++    LD E  PA  L + ATD    A     A V   + V D ND
Sbjct: 2224 -FSQFTINFNTGVINVIAPLDFEAHPAYKLSIRATDSLTGAH----AEVFVDIIVDDIND 2278

Query: 1542 NAPVFASPS-RVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLA---SGGDGHFRLHSS 1597
            N PVFA  S  V L E    G + + V A D D      +SY++    S    HF + SS
Sbjct: 2279 NPPVFAQQSYAVTLSEASVIGTSVVQVRATDSDSEPNRGISYQMFGNHSKSHDHFHVDSS 2338

Query: 1598 TGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVL 1657
            TG +S++R LD EQ  +H + V A D G P  S+  ++TV V D+ND  P F+QQ Y   
Sbjct: 2339 TGLISLLRTLDYEQSRQHTIFVRAVDGGMPTLSSDVIVTVDVTDLNDNPPLFEQQIYEAR 2398

Query: 1658 LRENNPPGTSLLTLRATDPDVGANGQVTYG---GVSSESFSLDPDTGVLTTLRALDREEQ 1714
            + E+ P G  +  ++A D D     ++ Y    G   + F +D  TG++T L  L R   
Sbjct: 2399 ISEHAPHGHFVTCVKAYDADSSDIDKLQYSILSGNDHKHFVIDSATGIIT-LSNLHRHAL 2457

Query: 1715 E---EINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQTLTM 1771
            +    +NL+V      S  Q     V V V   N H+P F      +E+ E     TL M
Sbjct: 2458 KPFYSLNLSVSDGVFRSSTQ-----VHVTVIGGNLHSPAFLQNEYEVELAENAPLHTLVM 2512

Query: 1772 -LRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREV--EPAFQLRIEAR 1828
             ++ +D D G  G + Y I++      F ++   G+  T+  LDRE   E    +R+ A+
Sbjct: 2513 EVKTTDGDSGIYGHVTYHIVNDFAKDRFYIN-ERGQIFTLEKLDRETPAEKVISVRLMAK 2571

Query: 1829 DGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANG 1888
            D G      T+ + +T  D ND+AP F    Y V +      GT ++++ A D D G+N 
Sbjct: 2572 DAGGKVAFCTVNVILT--DDNDNAPQFRATKYEVNIGSSAAKGTSVVKVLASDADEGSNA 2629

Query: 1889 HVTYYLGAGTAGA---FLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVS 1945
             +TY + A +        +   SG + T  +L   +   +TF V AVD  +    S    
Sbjct: 2630 DITYAIEADSESVKENLEINKLSGVITTKESLIGLENEFFTFFVRAVDNGSPSKESV--- 2686

Query: 1946 VTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRD---AGANASILYR 2002
            V + V+ +          P  ++LP+    F T T++       + D   A  + ++LY 
Sbjct: 2687 VLVYVKIL----------PPEMQLPKFSEPFYTFTVSEDVPIGTEIDLIRAEHSGTVLYS 2736

Query: 2003 LA-GTPPPGT-----TVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGV-II 2055
            L  G  P         +D  +G +++ +S      +     I+A            V + 
Sbjct: 2737 LVKGNTPESNRDESFVIDRQSGRLKLEKSLDHETTKWYQFSILARCTQDDHEMVASVDVS 2796

Query: 2056 VGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHA-GGTNGPITYSILSGNEKG- 2113
            + ++   +  P F  +  EA I EN P G+ ++  RA  A  GTNG + YS+        
Sbjct: 2797 IQVKDANDNSPVFESSPYEAFIVENLPGGSRVIQIRASDADSGTNGQVMYSLDQSQSVEV 2856

Query: 2114 --TFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGA----FAFTVLTLTLQDANDN 2167
              +F+I   TG IT  + + LD E     ++ + A   G      +  ++ +T+ D ND+
Sbjct: 2857 IESFAINMETGWIT--TLKELDHEKRDNYQIKVVASDHGEKIQLSSTAIVDVTVTDVNDS 2914

Query: 2168 APRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGS-GGQISYSLAASQPARGLFHVDPTT 2226
             PRF    Y   + E  P  G +  +   D D      Q++Y +    P  G F V+   
Sbjct: 2915 PPRFTAEIYKGTVSEDDPQGGVIAILSTTDADSEEINRQVTYFITGGDPL-GQFAVETIQ 2973

Query: 2227 GT--ITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP-WEL 2283
                +     LDRE      L + ATD         A + V V+D NDN P   +  +  
Sbjct: 2974 NEWKVYVKKPLDREKRDNYLLTITATDG---TFSSKAIVEVKVLDANDNSPVCEKTLYSD 3030

Query: 2284 RVSEDALLGSEIAQVTGNDVD--SGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQ 2341
             + ED L G  I Q++  D D  S   + Y L  SG +  F +    G +  + PLD E+
Sbjct: 3031 TIPEDVLPGKLIMQISATDADIRSNAEITYTLLGSGAEK-FKLNPDTGELKTSTPLDREE 3089

Query: 2342 CDRYQLQLLAHDGPHEG-RANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSA 2400
               Y L + A DG     +A++ + +EDVNDNAP FS   Y + + E+T PG+ +  V A
Sbjct: 3090 QAVYHLLVRATDGGGRFCQASIVLTLEDVNDNAPEFSADPYAITVFENTEPGTLLTRVQA 3149

Query: 2401 TDRDSGANGHISYHLASPADG-FSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGA 2459
            TD D+G N  I Y L   ADG FS++  +G +        L  +      + L+A D G 
Sbjct: 3150 TDADAGLNRKILYSLIDSADGQFSINELSGIIQL---EKPLDRELQAVYTLSLKAVDQGL 3206

Query: 2460 PGR-AARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAV 2518
            P R  A  TV V + D ND+ P F    Y   V+ED+  G+ +L + A   D   ++A +
Sbjct: 3207 PRRLTATGTVIVSVLDINDNPPVFEYREYGATVSEDILVGTEVLQVYAASRD-IEANAEI 3265

Query: 2519 DYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRG 2578
             YSIISGN    F ++ +               G + ++E LD+ES  +Y LTV A D G
Sbjct: 3266 TYSIISGNEHGKFSIDSKT--------------GAVFIIENLDYESSHEYYLTVEATDGG 3311

Query: 2579 QPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVR 2638
             P  S V  V V V D+NDN PVF++ +Y   + ED  +   ++ V A DAD   +  + 
Sbjct: 3312 TPSLSDVATVNVNVTDINDNTPVFSQDTYTTVISEDAVLEQSVITVMADDADGPSNSHIH 3371

Query: 2639 FTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPAG-AHFALAPVTIEVQ 2697
            +++  G+    F +D   G +++   LD ET + + L VQA+D           V I+V 
Sbjct: 3372 YSIIDGNQGSSFTIDPVRGEVKVTKLLDRETISGYTLTVQASDNGSPPRVNTTTVNIDVS 3431

Query: 2698 DVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREA 2757
            DVND+ P F     S  + EN+P G  V  L   D D+   G   +  +  G      +A
Sbjct: 3432 DVNDNAPVFSRGNYSVIIQENKPVGFSVLQLVVTDEDSSHNGPPFFFTIVTG---NDEKA 3488

Query: 2758 FALNSSTGELRARVPFDYEHTESFRLLVGAADAG--NLSASVTVSVLVTGEDEYDPVFLA 2815
            F +N   G L        +  + + L V  AD G   LS+   + + V  E  Y P  L 
Sbjct: 3489 FEVNPQ-GVLLTSSAIKRKEKDHYLLQVKVADNGKPQLSSLTYIDIRVIEESIYPPAILP 3547

Query: 2816 PAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSL-ATSSPYFGINQTTGAL 2868
                         G  +G + ATD+D      + YSL       F ++ T G L
Sbjct: 3548 LEIFITSSGEEYSGGVIGKIHATDQD--VYDTLTYSLDPQMDNLFSVSSTGGKL 3599



 Score =  699 bits (1803), Expect = 0.0
 Identities = 725/2762 (26%), Positives = 1185/2762 (42%), Gaps = 248/2762 (8%)

Query: 210  TGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLA 269
            T  L+RE + HY L ++A +  +    A+  + V +LD ND  P F+ + Y   + E+ A
Sbjct: 105  TAILNREVKDHYTLIVKALEKNTNVE-ARTKVRVQVLDTNDLRPLFSPTSYSVSLPENTA 163

Query: 270  PGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHE 329
              + + +V A+DAD G NG   Y    R       F+I   +G++ L   LD+ + +++E
Sbjct: 164  IRTSIARVSATDADIGTNGEFYYSFKDRTD----MFAIHPTSGVIVLTGRLDYLETKLYE 219

Query: 330  LVVQARDGGAHPELGS-----AFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQL 384
            + + A D G      S     A +TVH+  AN+  P +T + L    SP   +  P   +
Sbjct: 220  MEILAADRGMKLYGSSGISSMAKLTVHIEQANECAPVITAVTL----SPSELDRDPAYAI 275

Query: 385  VARISVSDPDDGDFAHVNVSLEGGEGHF--ALSTQDSVIYLVCVARRLDREERD-AYNLR 441
            V         +GD A +++        F    S   S  Y V     +D +     YNL 
Sbjct: 276  VTVDDCDQGANGDIASLSIVAGDLLQQFRTVRSFPGSKEYKVKAIGGIDWDSHPFGYNLT 335

Query: 442  VTATDSGSPPLRAEAAFVLHVTDVNDNA--PAFDRQLYRPEPLPEVALPGSFVVRVTARD 499
            + A D G+PP +  +  V+HVT     A    F++ +YR E + E A P + VV V A  
Sbjct: 336  LQAKDKGTPP-QFSSVKVIHVTSPQFKAGPVKFEKDVYRAE-ISEFAPPNTPVVMVKA-- 391

Query: 500  PDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLA 559
                ++ +  +   PG     FS++  +G+I+    +  +     +L V  +D       
Sbjct: 392  IPAYSHLRYVFKSTPGKAK--FSLNYNTGLISILEPVKRQQAAHFELEVTTSD-----RK 444

Query: 560  SSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGA 619
            +S  V V +   N N P+F +T Y A+  E    GT  + ++A D D G  G ++YS   
Sbjct: 445  ASTKVLVKVLGANSNPPEFTQTAYKAAFDENVPIGTTVMSLSAVDPDEGENGYVTYS--- 501

Query: 620  GLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGG---GLKSMVYVKVFLS 676
             + +    PF ID  +G V T+  LD +  P  +   + A D G     +  V   + L+
Sbjct: 502  -IANLNHVPFAIDHFTGAVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLN 560

Query: 677  DENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLD 736
            + NDN P F       +I      G  +  + A D D+     + Y I AGN    F+L+
Sbjct: 561  NLNDNTPLFEKINCEGTIPRDLGVGEQITTVSAIDADELQ--LVQYQIEAGNELDFFSLN 618

Query: 737  EQSGLLTVAWPLARRANSVV---QLEIGAEDGG-------------------GLQAEPSA 774
              SG+L++   L     + V    L I A DG                     LQ E + 
Sbjct: 619  PNSGVLSLKRSLMDGLGAKVSFHSLRITATDGENFATPLYINITVAASHKLVNLQCEETG 678

Query: 775  RVDI-----------------------SIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGI 811
               +                       S       P     L     V E+   G+SV  
Sbjct: 679  VAKMLAEKLLQANKLHNQGEVEDIFFDSHSVNAHIPQFRSTLPTGIQVKENQPVGSSVIF 738

Query: 812  VQAHN-PPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGPVLELEVRAGSG 870
            + + +   G    +  ++SGG+    F +D  +G+L+ L PLDRE              G
Sbjct: 739  MNSTDLDTGFNGKLVYAVSGGNEDSCFMIDMETGMLKILSPLDRETTDKYTLNITVYDLG 798

Query: 871  VPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVT 930
            +P   A   + V++ D NDN P F      V +  +    + I  + A D D G N  VT
Sbjct: 799  IPQKAAWRLLHVVVVDANDNPPEFLQESYFVEVSEDKEVHSEIIQVEATDKDLGPNGHVT 858

Query: 931  FTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGG--SPPRTSHFRLRVVV 988
            ++++      F++D  TG V + RPL       H L++EARD     P   S   ++V +
Sbjct: 859  YSIVT-DTDTFSIDSVTGVVNIARPLDRELQHEHSLKIEARDQAREEPQLFSTVVVKVSL 917

Query: 989  QDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPD---GGPITYHLAAEGASSPF 1045
            +DV      P F  P YRV +      GT ++ ++A  PD    G + Y L   G  + F
Sbjct: 918  EDVNDN--PPTFIPPNYRVKVREDLPEGTVIMWLEAHDPDLGQSGQVRYSLLDHGEGN-F 974

Query: 1046 GLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRL 1105
             ++  SG + +   LD E +++Y L V A    K      T    V V  +N+N H P  
Sbjct: 975  DVDKLSGAVRIVQQLDFEKKQVYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHPPVF 1034

Query: 1106 SEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTT 1165
            S       V E+ P G+ V  V A D D+  +G + YS++        F+I  +TG + T
Sbjct: 1035 SSFVEKGTVKEDAPVGSLVMTVSAHDEDARRDGEIRYSIRD-GSGVGVFKIGEETGVIET 1093

Query: 1166 LQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQ 1225
               LDRE  S Y L V   D G  P S+   +++ V D+NDN+P   +         P+ 
Sbjct: 1094 SDRLDRESTSHYWLTVFATDQGVVPLSSFIEIYIEVEDVNDNAPQTSE---------PVY 1144

Query: 1226 VP---DRVPPGTLVTTLQAKDPDEGENGTILYTLT-GPGSELFSLHPHSGELLTAA-PLI 1280
             P   +  P    V  ++A DPD   N  ++Y +T G     FS+HP +G + T +  L 
Sbjct: 1145 YPEIMENSPKDVSVVQIEAFDPDSSSNDKLMYKITSGNPQGFFSIHPKTGLITTTSRKLD 1204

Query: 1281 RAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVT 1340
            R ++  ++L ++  D GSPP+S   +++V++L      +  P   ++     +P      
Sbjct: 1205 REQQDEHILEVTVTDNGSPPKSTIARVIVKILDE---NDNKPQFLQKFYKIRLPEREKPD 1261

Query: 1341 AAEGLRPGSLLGSVAAPEPAGVGA-LTYTLVGGADPEGTFALDAASGRLYLARPLDFEAG 1399
                 R   L   +A  +  G  A ++Y++  G +  G F ++  +G +   R   F A 
Sbjct: 1262 RERNARREPLYHVIATDKDEGPNAEISYSIEDG-NEHGKFFIEPKTGVVSSKR---FSAA 1317

Query: 1400 PPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFR 1459
              +  L+++A    G   +    ++ ++  ++  P+   +P++           + +TF 
Sbjct: 1318 GEYDILSIKAV-DNGRPQKSSTTRLHIEWISKPKPSL--EPISFE--------ESFFTFT 1366

Query: 1460 ASDADGPGPNSDVRYRLLRQEPPVPA------------LRLDARTGALSAPRGLDRETTP 1507
              ++D   P + +   +  + P +P               +D  TG +   + LD E   
Sbjct: 1367 VMESD---PVAHMIGVISVEPPGIPLWFDITGGNYDSHFDVDKGTGTIIVAKPLDAEQKS 1423

Query: 1508 ALLLLVEATDRPANASRRRAARVSARVF--VTDENDNAPVFA-SPSRVRLPEDQPPGPAA 1564
               L VEATD            +  +VF  V D ND+ P F+ S   V +PED  P    
Sbjct: 1424 NYNLTVEATD--------GTTTILTQVFIKVIDTNDHRPQFSTSKYEVVIPEDTAPETEI 1475

Query: 1565 LHVVARDPDLGEAARVSYRLASGGD----GHFRLHSSTGALSVVRPLDREQRAEHVLTVV 1620
            L + A D D  E  ++ Y L S  D      FRL  +TG+L     LD E   +H LTV+
Sbjct: 1476 LQISAVDQD--EKNKLIYTLQSSRDPLSLKKFRLDPATGSLYTSEKLDHEAVHQHTLTVM 1533

Query: 1621 ASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGA 1680
              D   P +     + V+V+D ND AP F    Y   + E+   G+ +L + A D D G 
Sbjct: 1534 VRDQDVPVKRNFARIVVNVSDTNDHAPWFTASSYKGRVYESAAVGSVVLQVTALDKDKGK 1593

Query: 1681 NGQVTY---GGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTV 1737
            N +V Y    G    SF +DP  G + T + LDR  Q E +L V A D+GSPP     +V
Sbjct: 1594 NAEVLYSIESGNIGNSFMIDPVLGSIKTAKELDRSNQAEYDLMVKATDKGSPPMSEITSV 1653

Query: 1738 RVAVEDENDHAPTFGSAHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILDGDPSGA 1797
            R+ V   ++ +P F S   S+E+ E     +   +  +     +   + Y I DG+   A
Sbjct: 1654 RIFVTIADNASPKFTSKEYSVELSETVSIGSFVGMVTAH----SQSSVVYEIKDGNTGDA 1709

Query: 1798 FVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPV 1857
            F ++  SG   T + LD E  P + L I+  +     LS    + V + D ND+AP F  
Sbjct: 1710 FDINPHSGTIITQKALDFETLPIYTLIIQGTN--MAGLSTNTTVLVHLQDENDNAPVFMQ 1767

Query: 1858 PAYSVEVPEDVPAGTLLLQ-------LQAHDPDAGANGHVTYYLGAGTAGA-FLLEPSSG 1909
              Y+  + E     +++L        ++A D D  +N  + Y++   +    F ++ S+G
Sbjct: 1768 AEYTGLISESASINSVVLTDRNVPLVIRAADADKDSNALLVYHIVEPSVHTYFAIDSSTG 1827

Query: 1910 ELRTAAALDREQCPSYTFSVSAVD-GAAAGPLSTTVSVTITVRDVNDHAPTF--PTSPLR 1966
             + T  +LD E+   + F+V   D G          +VT+ V D+ND  P F  P     
Sbjct: 1828 AIHTVLSLDYEETSIFHFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFAKPLYEAS 1887

Query: 1967 LRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLA-GTPPPGTTVDSYTGEIRVARS 2025
            L LP      +   + + T+ A D D+ A + ++Y +  G      ++D  TG + V  +
Sbjct: 1888 LLLP------TYKGVKVITVNATDADSSAFSQLIYSITEGNIGEKFSMDYKTGALTVQNT 1941

Query: 2026 PVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGT 2085
                  R R    V    GR A   +  + + ++   E   +F +    A ++EN+    
Sbjct: 1942 TQL---RSRYELTVRASDGRFAGLTS--VKINVKESKESHLKFTQDVYSAVVKENSTEAE 1996

Query: 2086 PIVSPRAVHAGGTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQ 2145
             +    A+     N P+ Y IL+ + +  F I  ++G ++  +    D E      +V++
Sbjct: 1997 TLAVITAI-GNPINEPLFYHILNPDRR--FKISRTSGVLST-TGTPFDREQQEAFDVVVE 2052

Query: 2146 A---ESGGAFAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGS 2202
                    A A  V+ + ++D NDNAP F+   Y A +     +   +  V A D D G 
Sbjct: 2053 VTEEHKPSAVAHVVVKVIVEDQNDNAPVFVNLPYYAVVKVDTEVGHVIRYVTAVDRDSGR 2112

Query: 2203 GGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLV-LMATDRGSPALVGSA 2261
             G++ Y L         F + P  G I+     + +   +  LV ++A D G+PA   SA
Sbjct: 2113 NGEVHYYLKEHHEH---FQIGP-LGEISLKKQFELDTLNKEYLVTVVAKDGGNPAF--SA 2166

Query: 2262 TLTVMVIDTNDNRPTIPQP-WELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQD 2320
             + V +   N   P   +P +   ++E   + S +  V  N  + G  ++Y ++   P  
Sbjct: 2167 EVIVPITVMNKAMPVFEKPFYSAEIAESIQVHSPVVHVQANSPE-GLKVFYSITDGDPFS 2225

Query: 2321 PFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHD---GPHEGRANLTVLVEDVNDNAPAFS 2377
             F++    G +++  PLDFE    Y+L + A D   G H     + ++V+D+NDN P F+
Sbjct: 2226 QFTINFNTGVINVIAPLDFEAHPAYKLSIRATDSLTGAH-AEVFVDIIVDDINDNPPVFA 2284

Query: 2378 QSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHL----ASPADGFSVDPNNGTLFT 2433
            Q  Y V L E +  G++++ V ATD DS  N  ISY +    +   D F VD + G L +
Sbjct: 2285 QQSYAVTLSEASVIGTSVVQVRATDSDSEPNRGISYQMFGNHSKSHDHFHVDSSTG-LIS 2343

Query: 2434 IVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTE 2493
            ++ T  L ++ S    + + A D G P  ++   V V + D ND+ P F    Y   ++E
Sbjct: 2344 LLRT--LDYEQSRQHTIFVRAVDGGMPTLSSDVIVTVDVTDLNDNPPLFEQQIYEARISE 2401

Query: 2494 DLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGC 2553
              P G  +  ++A DAD S     + YSI+SGN  + F ++               A G 
Sbjct: 2402 HAPHGHFVTCVKAYDADSS-DIDKLQYSILSGNDHKHFVID--------------SATGI 2446

Query: 2554 LVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPE 2613
            + L           Y+L ++ +D       S   V VTV+  N + P F +  Y V + E
Sbjct: 2447 ITLSNLHRHALKPFYSLNLSVSD---GVFRSSTQVHVTVIGGNLHSPAFLQNEYEVELAE 2503

Query: 2614 DTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARH 2673
            + P+   ++ V+ +D D G +G V + + +      F ++E  G +     LD ET A  
Sbjct: 2504 NAPLHTLVMEVKTTDGDSGIYGHVTYHIVNDFAKDRFYINE-RGQIFTLEKLDRETPAEK 2562

Query: 2674 QLVVQ-AADPAGAHFALAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAID 2732
             + V+  A  AG   A   V + + D ND+ P F       ++  +   GT V  + A D
Sbjct: 2563 VISVRLMAKDAGGKVAFCTVNVILTDDNDNAPQFRATKYEVNIGSSAAKGTSVVKVLASD 2622

Query: 2733 GDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAADAGN 2792
             D G+   + Y++         +E   +N  +G +  +        E F   V A D G+
Sbjct: 2623 ADEGSNADITYAI--EADSESVKENLEINKLSGVITTKESLIGLENEFFTFFVRAVDNGS 2680

Query: 2793 LS--ASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLY 2850
             S  + V V V +   +   P F  P + F V E    G  +  ++A        G VLY
Sbjct: 2681 PSKESVVLVYVKILPPEMQLPKFSEPFYTFTVSEDVPIGTEIDLIRAEH-----SGTVLY 2735

Query: 2851 SL 2852
            SL
Sbjct: 2736 SL 2737



 Score =  624 bits (1609), Expect = e-178
 Identities = 661/2374 (27%), Positives = 1013/2374 (42%), Gaps = 165/2374 (6%)

Query: 53   EEQPAGTLIGDISAGLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDREQR 112
            E  P   +IG IS   P     PL + I+   G    +   +D+ +G +  A+ LD EQ+
Sbjct: 1369 ESDPVAHMIGVISVEPPG---IPLWFDIT---GGNYDSHFDVDKGTGTIIVAKPLDAEQK 1422

Query: 113  DRYRFTAVTPDGAT---VEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPARD 169
              Y  T    DG T    +V ++V D NDH P F  ++  + +PE TA  T      A D
Sbjct: 1423 SNYNLTVEATDGTTTILTQVFIKVIDTNDHRPQFSTSKYEVVIPEDTAPETEILQISAVD 1482

Query: 170  ADAGRLGTQGYALSGDGAG-ETFRLETRPGPDGTPVPELVVTGELDRENRSHYMLQLEAY 228
             D           S D    + FRL+   G        L  + +LD E    + L +   
Sbjct: 1483 QDEKNKLIYTLQSSRDPLSLKKFRLDPATG-------SLYTSEKLDHEAVHQHTLTVMVR 1535

Query: 229  DGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNG 288
            D   P +R  A + V + D NDHAP F  S Y   V ES A GS VLQV A D D G N 
Sbjct: 1536 DQDVPVKRNFARIVVNVSDTNDHAPWFTASSYKGRVYESAAVGSVVLQVTALDKDKGKNA 1595

Query: 289  AVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFV 348
             V Y I          F ID   G ++  + LD   +  ++L+V+A D G+ P      V
Sbjct: 1596 EVLYSI--ESGNIGNSFMIDPVLGSIKTAKELDRSNQAEYDLMVKATDKGSPPMSEITSV 1653

Query: 349  TVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGG 408
             + V  A++  P     F S + S ++SE    G  V  ++         + V    +G 
Sbjct: 1654 RIFVTIADNASPK----FTSKEYSVELSETVSIGSFVGMVTAHSQS----SVVYEIKDGN 1705

Query: 409  EGH-FALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVND 467
             G  F ++     I      + LD E    Y L +  T+     L      ++H+ D ND
Sbjct: 1706 TGDAFDINPHSGTI---ITQKALDFETLPIYTLIIQGTNMAG--LSTNTTVLVHLQDEND 1760

Query: 468  NAPAFDRQLYRPEPLPEVALPGSFVVR-------VTARDPDQGTNGQVTYSLA-PGAHTH 519
            NAP F +  Y    + E A   S V+        + A D D+ +N  + Y +  P  HT 
Sbjct: 1761 NAPVFMQAEY-TGLISESASINSVVLTDRNVPLVIRAADADKDSNALLVYHIVEPSVHT- 1818

Query: 520  WFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLAS--SATVSVALQDVNDNEPQ 577
            +F+ID ++G I T  SLDYE        V   D G P L +  +A V+V + D+ND  P 
Sbjct: 1819 YFAIDSSTGAIHTVLSLDYEETSIFHFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPV 1878

Query: 578  FQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGD 637
            F +  Y ASL   T  G   + V ATDADS  F  L YS+  G   +    F +D  +G 
Sbjct: 1879 FAKPLYEASLLLPTYKGVKVITVNATDADSSAFSQLIYSITEG---NIGEKFSMDYKTGA 1935

Query: 638  VCTTRTLDRDQGPSSFDFTVTAVDG--GGLKSMVYVKVFLSDENDNPPQFYPREYAASIS 695
            +    T    Q  S ++ TV A DG   GL S   VK+ + +  ++  +F    Y+A + 
Sbjct: 1936 LTVQNT---TQLRSRYELTVRASDGRFAGLTS---VKINVKESKESHLKFTQDVYSAVVK 1989

Query: 696  AQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLL-TVAWPLARRANS 754
              S     +  + A       +  L YHIL  N    F +   SG+L T   P  R    
Sbjct: 1990 ENSTEAETLAVITA--IGNPINEPLFYHIL--NPDRRFKISRTSGVLSTTGTPFDREQQE 2045

Query: 755  VVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQA 814
               + +   +     A     V + +       P+F  L Y   V  D   G  +  V A
Sbjct: 2046 AFDVVVEVTEEHKPSAVAHVVVKVIVEDQNDNAPVFVNLPYYAVVKVDTEVGHVIRYVTA 2105

Query: 815  -HNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGPVLELEVRAGSGVPP 873
                 GR   V   L   +    F +  + G +   +  + + L     + V A  G  P
Sbjct: 2106 VDRDSGRNGEVHYYLK--EHHEHFQIGPL-GEISLKKQFELDTLNKEYLVTVVAKDGGNP 2162

Query: 874  AFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTL 933
            AF+ A V V +  +N   P F  P  +  +  +    +P+  ++A  P+     +V +++
Sbjct: 2163 AFS-AEVIVPITVMNKAMPVFEKPFYSAEIAESIQVHSPVVHVQANSPE---GLKVFYSI 2218

Query: 934  LAGGG-GAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVG 992
              G     FT++  TG + ++ PL     PA++L + A D  +      F + ++V D+ 
Sbjct: 2219 TDGDPFSQFTINFNTGVINVIAPLDFEAHPAYKLSIRATDSLTGAHAEVF-VDIIVDDIN 2277

Query: 993  TRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGP---ITYHLAAEGASS--PFGL 1047
                 P F   +Y V L   +  GT V+QV+A   D  P   I+Y +    + S   F +
Sbjct: 2278 DN--PPVFAQQSYAVTLSEASVIGTSVVQVRATDSDSEPNRGISYQMFGNHSKSHDHFHV 2335

Query: 1048 EPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSE 1107
            +  +G + +   LD E    + + V AV G    L       TV V+ LN N   P L E
Sbjct: 2336 DSSTGLISLLRTLDYEQSRQHTIFVRAVDGGMPTLSSDV-IVTVDVTDLNDN---PPLFE 2391

Query: 1108 DPTFLA-VAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTL 1166
               + A ++E+ P G  V  V A D DS    +L YS+     D K F I   TG + TL
Sbjct: 2392 QQIYEARISEHAPHGHFVTCVKAYDADSSDIDKLQYSILS-GNDHKHFVIDSATG-IITL 2449

Query: 1167 QTLDREQ-QSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQ 1225
              L R   +  Y L + V DG    RS+T  VHV V+  N +SP FLQ          ++
Sbjct: 2450 SNLHRHALKPFYSLNLSVSDGVF--RSST-QVHVTVIGGNLHSPAFLQ------NEYEVE 2500

Query: 1226 VPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHSGELLTAAPLIRAERP 1285
            + +  P  TLV  ++  D D G  G + Y +    ++        G++ T   L R    
Sbjct: 2501 LAENAPLHTLVMEVKTTDGDSGIYGHVTYHIVNDFAKDRFYINERGQIFTLEKLDRETPA 2560

Query: 1286 HYVLT--LSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAE 1343
              V++  L A D G      ++ +++             D A +  A    V +  +AA+
Sbjct: 2561 EKVISVRLMAKDAGGKVAFCTVNVIL---------TDDNDNAPQFRATKYEVNIGSSAAK 2611

Query: 1344 GLRPGSLLGSVAAPEPAGVGALTYTLVGGADP-EGTFALDAASGRLYLARPLDFEAGPPW 1402
            G     +L S A  +      +TY +   ++  +    ++  SG +     L       +
Sbjct: 2612 GTSVVKVLASDA--DEGSNADITYAIEADSESVKENLEINKLSGVITTKESL-IGLENEF 2668

Query: 1403 RALTVRAEGPGGAGAR-LLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRAS 1461
                VRA   G      ++ V V++       P F+       + E+   G  +   RA 
Sbjct: 2669 FTFFVRAVDNGSPSKESVVLVYVKILPPEMQLPKFSEPFYTFTVSEDVPIGTEIDLIRAE 2728

Query: 1462 DADGPGPNSDVRYRLLRQEPPV----PALRLDARTGALSAPRGLDRETTPALLLLVEATD 1517
                   +  V Y L++   P      +  +D ++G L   + LD ETT      + A  
Sbjct: 2729 H------SGTVLYSLVKGNTPESNRDESFVIDRQSGRLKLEKSLDHETTKWYQFSILA-- 2780

Query: 1518 RPANASRRRAARVSARVFVTDENDNAPVF-ASPSRVRLPEDQPPGPAALHVVARDPDLGE 1576
            R         A V   + V D NDN+PVF +SP    + E+ P G   + + A D D G 
Sbjct: 2781 RCTQDDHEMVASVDVSIQVKDANDNSPVFESSPYEAFIVENLPGGSRVIQIRASDADSGT 2840

Query: 1577 AARVSYRLASGGD----GHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPR-SA 1631
              +V Y L           F ++  TG ++ ++ LD E+R  + + VVASDHG   + S+
Sbjct: 2841 NGQVMYSLDQSQSVEVIESFAINMETGWITTLKELDHEKRDNYQIKVVASDHGEKIQLSS 2900

Query: 1632 TQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPD-VGANGQVTY---G 1687
            T ++ V+V DVND  P F  + Y   + E++P G  +  L  TD D    N QVTY   G
Sbjct: 2901 TAIVDVTVTDVNDSPPRFTAEIYKGTVSEDDPQGGVIAILSTTDADSEEINRQVTYFITG 2960

Query: 1688 GVSSESFSLD--PDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDEN 1745
            G     F+++   +   +   + LDRE+++   LT+ A D       +   V V V D N
Sbjct: 2961 GDPLGQFAVETIQNEWKVYVKKPLDREKRDNYLLTITATDGTFS---SKAIVEVKVLDAN 3017

Query: 1746 DHAPTFGSAHLSLEVPEGQDPQTLTM-LRASDPDVGANGQLQYRILDGDPSGAFVLDLAS 1804
            D++P       S  +PE   P  L M + A+D D+ +N ++ Y +L G  +  F L+  +
Sbjct: 3018 DNSPVCEKTLYSDTIPEDVLPGKLIMQISATDADIRSNAEITYTLL-GSGAEKFKLNPDT 3076

Query: 1805 GEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEV 1864
            GE  T  PLDRE +  + L + A DGG     A+++LT+   D ND+AP F    Y++ V
Sbjct: 3077 GELKTSTPLDREEQAVYHLLVRATDGGGRFCQASIVLTLE--DVNDNAPEFSADPYAITV 3134

Query: 1865 PEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGELRTAAALDREQCPS 1924
             E+   GTLL ++QA D DAG N  + Y L     G F +   SG ++    LDRE    
Sbjct: 3135 FENTEPGTLLTRVQATDADAGLNRKILYSLIDSADGQFSINELSGIIQLEKPLDRELQAV 3194

Query: 1925 YTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLA-- 1982
            YT S+ AVD      L+ T +V ++V D+ND+ P F            G + S   L   
Sbjct: 3195 YTLSLKAVDQGLPRRLTATGTVIVSVLDINDNPPVF-------EYREYGATVSEDILVGT 3247

Query: 1983 -LATLRAEDRDAGANASILYR-LAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLFIVA 2040
             +  + A  RD  ANA I Y  ++G      ++DS TG + +  +       +  L + A
Sbjct: 3248 EVLQVYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAVFIIENLDYESSHEYYLTVEA 3307

Query: 2041 TDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHAGG-TN 2099
            TD G P+ S    + V +    +  P F + +    I E+A     +++  A  A G +N
Sbjct: 3308 TDGGTPSLSDVATVNVNVTDINDNTPVFSQDTYTTVISEDAVLEQSVITVMADDADGPSN 3367

Query: 2100 GPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGA---FAFTV 2156
              I YSI+ GN+  +F+I P  G + V     LD E      L +QA   G+      T 
Sbjct: 3368 SHIHYSIIDGNQGSSFTIDPVRGEVKVTKL--LDRETISGYTLTVQASDNGSPPRVNTTT 3425

Query: 2157 LTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPA 2216
            + + + D NDNAP F R +Y   + E++P+   +LQ+   D D    G   +    +   
Sbjct: 3426 VNIDVSDVNDNAPVFSRGNYSVIIQENKPVGFSVLQLVVTDEDSSHNGPPFFFTIVTGND 3485

Query: 2217 RGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPT 2276
               F V+P  G + T++ + R+      L +   D G P L     + + VI+ +   P 
Sbjct: 3486 EKAFEVNP-QGVLLTSSAIKRKEKDHYLLQVKVADNGKPQLSSLTYIDIRVIEESIYPPA 3544

Query: 2277 I-PQPWELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDPFSVGRYGGRVSLTG 2335
            I P    +  S +   G  I ++   D D    L Y L P    + FSV   GG++    
Sbjct: 3545 ILPLEIFITSSGEEYSGGVIGKIHATDQDVYDTLTYSLDPQ-MDNLFSVSSTGGKLIAHK 3603

Query: 2336 PLDFEQCDRYQLQLLAHDGPHEGRANLTVLVEDV 2369
             LD  Q   Y L +   DG     A++TV +  V
Sbjct: 3604 KLDIGQ---YLLNVSVTDGKFTTVADITVHIRQV 3634



 Score =  572 bits (1473), Expect = e-162
 Identities = 603/2209 (27%), Positives = 938/2209 (42%), Gaps = 242/2209 (10%)

Query: 786  TPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPPGRLAPVTLSLSGGDPRGLFSLDAVSGL 845
            TP  F  L+Y  +V E+ A  T VG            PV + +    P        VSG 
Sbjct: 30   TPLQFTHLEYNVTVQENSAAKTYVG-----------HPVKMGVYITHPAWEVRYKIVSGD 78

Query: 846  LQTLRPLDRELLGPVLELEVRAGSGVPPAF----------------------AVARVRVL 883
             + L   +  +LG    L +R   G                           A  +VRV 
Sbjct: 79   SENLFKAEEYILGDFCFLRIRTKGGNTAILNREVKDHYTLIVKALEKNTNVEARTKVRVQ 138

Query: 884  LDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGAFTV 943
            + D ND  P F     +V LP NTA  T I  + A D D G N    ++        F +
Sbjct: 139  VLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSF-KDRTDMFAI 197

Query: 944  DPTTGHVRLMRPLGPSGGPAHELELEARDGG-----SPPRTSHFRLRVVVQDVG------ 992
             PT+G + L   L       +E+E+ A D G     S   +S  +L V ++         
Sbjct: 198  HPTSGVIVLTGRLDYLETKLYEMEILAADRGMKLYGSSGISSMAKLTVHIEQANECAPVI 257

Query: 993  ---TRGLAPRFNSPTYRV------------DLPS-GTTAGTQVLQVQAQAPDGGPITYHL 1036
               T   +     P Y +            D+ S    AG  + Q +      G   Y +
Sbjct: 258  TAVTLSPSELDRDPAYAIVTVDDCDQGANGDIASLSIVAGDLLQQFRTVRSFPGSKEYKV 317

Query: 1037 AAEGA----SSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVR 1092
             A G     S PFG       L ++A       +   +KV+ V+  + + G         
Sbjct: 318  KAIGGIDWDSHPFGYN-----LTLQAKDKGTPPQFSSVKVIHVTSPQFKAGPV------- 365

Query: 1093 VSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSK 1152
                       +  +D     ++E  PP T V  V A    S     L Y  +     +K
Sbjct: 366  -----------KFEKDVYRAEISEFAPPNTPVVMVKAIPAYS----HLRYVFKSTPGKAK 410

Query: 1153 AFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFL 1212
             F ++  TG ++ L+ + R+Q + ++L V   D     R  +  V V VL  N N P F 
Sbjct: 411  -FSLNYNTGLISILEPVKRQQAAHFELEVTTSD-----RKASTKVLVKVLGANSNPPEFT 464

Query: 1213 QASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHSGE 1272
            Q +  A         + VP GT V +L A DPDEGENG + Y++       F++   +G 
Sbjct: 465  QTAYKAA------FDENVPIGTTVMSLSAVDPDEGENGYVTYSIANLNHVPFAIDHFTGA 518

Query: 1273 LLTAAPLIRAERPH-YVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAA 1331
            + T+  L     P  Y L + A D G P R     L    L +     P  +    +   
Sbjct: 519  VSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFEKINCEGTI 578

Query: 1332 PVPV-----VLTVTAAEG---------LRPGSLLGSVAAPEPAGVGALTYTLVGGADPEG 1377
            P  +     + TV+A +          +  G+ L   +    +GV +L  +L+ G   + 
Sbjct: 579  PRDLGVGEQITTVSAIDADELQLVQYQIEAGNELDFFSLNPNSGVLSLKRSLMDGLGAKV 638

Query: 1378 TF---ALDAASGRLYLARPL--DFEAGPPWRALTVRAEGPGGAG--------ARLLRVQV 1424
            +F    + A  G  + A PL  +       + + ++ E  G A         A  L  Q 
Sbjct: 639  SFHSLRITATDGENF-ATPLYINITVAASHKLVNLQCEETGVAKMLAEKLLQANKLHNQG 697

Query: 1425 QVQD-------ENEHAPAFARD-PLALALPENPEPGAALYTFRASDADGPGPNSDVRYRL 1476
            +V+D        N H P F    P  + + EN   G+++    ++D D  G N  + Y +
Sbjct: 698  EVEDIFFDSHSVNAHIPQFRSTLPTGIQVKENQPVGSSVIFMNSTDLD-TGFNGKLVYAV 756

Query: 1477 LRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFV 1536
                       +D  TG L     LDRETT    L +   D       ++AA     V V
Sbjct: 757  SGGNED-SCFMIDMETGMLKILSPLDRETTDKYTLNITVYDL---GIPQKAAWRLLHVVV 812

Query: 1537 TDENDNAPVFASPSR-VRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGHFRLH 1595
             D NDN P F   S  V + ED+      + V A D DLG    V+Y + +  D  F + 
Sbjct: 813  VDANDNPPEFLQESYFVEVSEDKEVHSEIIQVEATDKDLGPNGHVTYSIVTDTDT-FSID 871

Query: 1596 SSTGALSVVRPLDREQRAEHVLTVVASDHG--SPPRSATQVLTVSVADVNDEAPTFQQQE 1653
            S TG +++ RPLDRE + EH L + A D     P   +T V+ VS+ DVND  PTF    
Sbjct: 872  SVTGVVNIARPLDRELQHEHSLKIEARDQAREEPQLFSTVVVKVSLEDVNDNPPTFIPPN 931

Query: 1654 YSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVS--SESFSLDPDTGVLTTLRALDR 1711
            Y V +RE+ P GT ++ L A DPD+G +GQV Y  +     +F +D  +G +  ++ LD 
Sbjct: 932  YRVKVREDLPEGTVIMWLEAHDPDLGQSGQVRYSLLDHGEGNFDVDKLSGAVRIVQQLDF 991

Query: 1712 EEQEEINLTVYAQDRGSPPQLT---HVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQT 1768
            E+++  NLTV A+D+G P  L+   +V V V   +EN H P F S      V E     +
Sbjct: 992  EKKQVYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHPPVFSSFVEKGTVKEDAPVGS 1051

Query: 1769 LTM-LRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEA 1827
            L M + A D D   +G+++Y I DG   G F +   +G   T   LDRE    + L + A
Sbjct: 1052 LVMTVSAHDEDARRDGEIRYSIRDGSGVGVFKIGEETGVIETSDRLDRESTSHYWLTVFA 1111

Query: 1828 RDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGAN 1887
             D G   LS+ + + + V D ND+AP    P Y  E+ E+ P    ++Q++A DPD+ +N
Sbjct: 1112 TDQGVVPLSSFIEIYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPDSSSN 1171

Query: 1888 GHVTYYLGAGTA-GAFLLEPSSGELRTAAA-LDREQCPSYTFSVSAVDGAAAGPLSTTVS 1945
              + Y + +G   G F + P +G + T +  LDREQ   +   V+  D  +  P ST   
Sbjct: 1172 DKLMYKITSGNPQGFFSIHPKTGLITTTSRKLDREQQDEHILEVTVTDNGSP-PKSTIAR 1230

Query: 1946 VTITVRDVNDHAPTFPTSPLRLRLP---RPGPSFSTPTLALATLRAEDRDAGANASILYR 2002
            V + + D ND+ P F     ++RLP   +P    +     L  + A D+D G NA I Y 
Sbjct: 1231 VIVKILDENDNKPQFLQKFYKIRLPEREKPDRERNARREPLYHVIATDKDEGPNAEISYS 1290

Query: 2003 LAGTPPPGTT-VDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGE 2061
            +      G   ++  TG +   R   A G  D +L I A D GRP +S+T  + +    +
Sbjct: 1291 IEDGNEHGKFFIEPKTGVVSSKRFSAA-GEYD-ILSIKAVDNGRPQKSSTTRLHIEWISK 1348

Query: 2062 AERGPR---FPRASSEATIRENAPP----GTPIVSPRAVHAGGTNGPITYSILSGNEKGT 2114
             +       F  +    T+ E+ P     G   V P  +       P+ + I  GN    
Sbjct: 1349 PKPSLEPISFEESFFTFTVMESDPVAHMIGVISVEPPGI-------PLWFDITGGNYDSH 1401

Query: 2115 FSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFTVLTLTLQDANDNAPRFLRP 2174
            F +   TG I V  A+ LD E      L ++A  G     T + + + D ND+ P+F   
Sbjct: 1402 FDVDKGTGTIIV--AKPLDAEQKSNYNLTVEATDGTTTILTQVFIKVIDTNDHRPQFSTS 1459

Query: 2175 HYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGL--FHVDPTTGTITTT 2232
             Y   +PE    E  +LQ+ A  +DQ    ++ Y+L +S+    L  F +DP TG++ T+
Sbjct: 1460 KYEVVIPEDTAPETEILQISA--VDQDEKNKLIYTLQSSRDPLSLKKFRLDPATGSLYTS 1517

Query: 2233 AILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIP-QPWELRVSEDALL 2291
              LD E   +  L +M  D+  P     A + V V DTND+ P      ++ RV E A +
Sbjct: 1518 EKLDHEAVHQHTLTVMVRDQDVPVKRNFARIVVNVSDTNDHAPWFTASSYKGRVYESAAV 1577

Query: 2292 GSEIAQVTGNDVDSGP--VLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQL 2349
            GS + QVT  D D G    + Y +      + F +    G +     LD      Y L +
Sbjct: 1578 GSVVLQVTALDKDKGKNAEVLYSIESGNIGNSFMIDPVLGSIKTAKELDRSNQAEYDLMV 1637

Query: 2350 LAHDGPHEGRANLT---VLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSG 2406
             A D      + +T   + V   ++ +P F+   Y V L E    GS +  V+A  + S 
Sbjct: 1638 KATDKGSPPMSEITSVRIFVTIADNASPKFTSKEYSVELSETVSIGSFVGMVTAHSQSS- 1696

Query: 2407 ANGHISYHL--ASPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAA 2464
                + Y +   +  D F ++P++GT+ T     AL  +      ++++  +    G + 
Sbjct: 1697 ----VVYEIKDGNTGDAFDINPHSGTIIT---QKALDFETLPIYTLIIQGTNMA--GLST 1747

Query: 2465 RATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLT-------LEATDADGSRSHAA 2517
              TV V LQD+ND+AP F  + Y   ++E     S +LT       + A DAD   S+A 
Sbjct: 1748 NTTVLVHLQDENDNAPVFMQAEYTGLISESASINSVVLTDRNVPLVIRAADADKD-SNAL 1806

Query: 2518 VDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADR 2577
            + Y I+  +    F ++               + G +  +  LD+E  + ++ TV   D 
Sbjct: 1807 LVYHIVEPSVHTYFAIDS--------------STGAIHTVLSLDYEETSIFHFTVQVHDM 1852

Query: 2578 GQPPQSS--VVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHG 2635
            G P   +     VTV V+D+ND PPVF +  Y  ++   T  G +++ V A+DAD     
Sbjct: 1853 GTPRLFAEYAANVTVHVIDINDCPPVFAKPLYEASLLLPTYKGVKVITVNATDADSSAFS 1912

Query: 2636 LVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHFALAPVTIE 2695
             + ++++ G+    F +D  +G L + +    + ++R++L V+A+D  G    L  V I 
Sbjct: 1913 QLIYSITEGNIGEKFSMDYKTGALTVQNTT--QLRSRYELTVRASD--GRFAGLTSVKIN 1968

Query: 2696 VQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGR 2755
            V++  +    F  ++ S  V EN      +  + AI         L Y +L     P+ R
Sbjct: 1969 VKESKESHLKFTQDVYSAVVKENSTEAETLAVITAIGNPINE--PLFYHILN----PDRR 2022

Query: 2756 EAFALNSSTGELRAR-VPFDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYD--PV 2812
              F ++ ++G L     PFD E  E+F ++V   +    SA   V V V  ED+ D  PV
Sbjct: 2023 --FKISRTSGVLSTTGTPFDREQQEAFDVVVEVTEEHKPSAVAHVVVKVIVEDQNDNAPV 2080

Query: 2813 FLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSSPYFGI 2861
            F+   ++  V      GH + +V A D D G +G V Y L     +F I
Sbjct: 2081 FVNLPYYAVVKVDTEVGHVIRYVTAVDRDSGRNGEVHYYLKEHHEHFQI 2129



 Score =  459 bits (1181), Expect = e-128
 Identities = 481/1837 (26%), Positives = 779/1837 (42%), Gaps = 183/1837 (9%)

Query: 1134 SGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRST 1193
            SG +  L  + + +  D    RI  + G    L   +RE +  Y L+V+  +  +   + 
Sbjct: 76   SGDSENLFKAEEYILGDFCFLRIRTKGGNTAIL---NREVKDHYTLIVKALEKNTNVEAR 132

Query: 1194 TGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTIL 1253
            T  V V VLD ND  P F   S +      + +P+     T +  + A D D G NG   
Sbjct: 133  T-KVRVQVLDTNDLRPLFSPTSYS------VSLPENTAIRTSIARVSATDADIGTNGEFY 185

Query: 1254 YTLTGPGSELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQG-----SPPRSASLQLL 1308
            Y+     +++F++HP SG ++    L   E   Y + + A D+G     S   S+  +L 
Sbjct: 186  YSFKDR-TDMFAIHPTSGVIVLTGRLDYLETKLYEMEILAADRGMKLYGSSGISSMAKLT 244

Query: 1309 VQV------LPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGV 1362
            V +       P        P   +RDPA     ++TV   +    G +         AG 
Sbjct: 245  VHIEQANECAPVITAVTLSPSELDRDPAY---AIVTVDDCDQGANGDIASLSIV---AGD 298

Query: 1363 GALTYTLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAG--ARLL 1420
                +  V        + + A  G       +D+++ P    LT++A+  G     + + 
Sbjct: 299  LLQQFRTVRSFPGSKEYKVKAIGG-------IDWDSHPFGYNLTLQAKDKGTPPQFSSVK 351

Query: 1421 RVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQE 1480
             + V           F +D     + E   P   +   +A  A      S +RY + +  
Sbjct: 352  VIHVTSPQFKAGPVKFEKDVYRAEISEFAPPNTPVVMVKAIPA-----YSHLRY-VFKST 405

Query: 1481 PPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDEN 1540
            P      L+  TG +S    + R+      L V  +DR A+            V V   N
Sbjct: 406  PGKAKFSLNYNTGLISILEPVKRQQAAHFELEVTTSDRKASTK--------VLVKVLGAN 457

Query: 1541 DNAPVFASPS-RVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGHFRLHSSTG 1599
             N P F   + +    E+ P G   + + A DPD GE   V+Y +A+     F +   TG
Sbjct: 458  SNPPEFTQTAYKAAFDENVPIGTTVMSLSAVDPDEGENGYVTYSIANLNHVPFAIDHFTG 517

Query: 1600 ALSVVRPLDREQRAE-HVLTVVASDHGSPPRSATQVL-TVSVADVNDEAPTFQQQEYSVL 1657
            A+S    LD E     + L + ASD G P R   +VL T+++ ++ND  P F++      
Sbjct: 518  AVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFEKINCEGT 577

Query: 1658 LRENNPPGTSLLTLRATDPDVGANGQVTY-GGVSSESFSLDPDTGVLTTLRAL-----DR 1711
            +  +   G  + T+ A D D     Q     G   + FSL+P++GVL+  R+L      +
Sbjct: 578  IPRDLGVGEQITTVSAIDADELQLVQYQIEAGNELDFFSLNPNSGVLSLKRSLMDGLGAK 637

Query: 1712 EEQEEINLTVYAQDRGSPPQLTHVTVRVA------------------------------- 1740
                 + +T    +  + P   ++TV  +                               
Sbjct: 638  VSFHSLRITATDGENFATPLYINITVAASHKLVNLQCEETGVAKMLAEKLLQANKLHNQG 697

Query: 1741 -VED-------ENDHAPTFGSA-HLSLEVPEGQDP-QTLTMLRASDPDVGANGQLQYRIL 1790
             VED        N H P F S     ++V E Q    ++  + ++D D G NG+L Y + 
Sbjct: 698  EVEDIFFDSHSVNAHIPQFRSTLPTGIQVKENQPVGSSVIFMNSTDLDTGFNGKLVYAVS 757

Query: 1791 DGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDAND 1850
             G+    F++D+ +G    + PLDRE    + L I   D G P  +A  LL V V+DAND
Sbjct: 758  GGNEDSCFMIDMETGMLKILSPLDRETTDKYTLNITVYDLGIPQKAAWRLLHVVVVDAND 817

Query: 1851 HAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGE 1910
            + P F   +Y VEV ED    + ++Q++A D D G NGHVTY +   T   F ++  +G 
Sbjct: 818  NPPEFLQESYFVEVSEDKEVHSEIIQVEATDKDLGPNGHVTYSIVTDT-DTFSIDSVTGV 876

Query: 1911 LRTAAALDREQCPSYTFSVSAVDGAAAGP-LSTTVSVTITVRDVNDHAPTFPTSPLRLRL 1969
            +  A  LDRE    ++  + A D A   P L +TV V +++ DVND+ PTF     R+++
Sbjct: 877  VNIARPLDRELQHEHSLKIEARDQAREEPQLFSTVVVKVSLEDVNDNPPTFIPPNYRVKV 936

Query: 1970 PRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVAL 2029
                P  +     +  L A D D G +  + Y L         VD  +G +R+ +     
Sbjct: 937  REDLPEGT----VIMWLEAHDPDLGQSGQVRYSLLDHGEGNFDVDKLSGAVRIVQQLDFE 992

Query: 2030 GPRDRVLFIVATDLGRP-ARSATGVIIVGL--QGEAERGPRFPRASSEATIRENAPPGTP 2086
              +   L + A D G+P + S+T  + V +    E    P F     + T++E+AP G+ 
Sbjct: 993  KKQVYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHPPVFSSFVEKGTVKEDAPVGSL 1052

Query: 2087 IVSPRAVHAGG-TNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQ 2145
            +++  A       +G I YSI  G+  G F I   TG I   +++ LD E +    L + 
Sbjct: 1053 VMTVSAHDEDARRDGEIRYSIRDGSGVGVFKIGEETGVI--ETSDRLDRESTSHYWLTVF 1110

Query: 2146 AESGGAF---AFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGS 2202
            A   G     +F  + + ++D NDNAP+   P Y   + E+ P +  ++Q+EA D D  S
Sbjct: 1111 ATDQGVVPLSSFIEIYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPDSSS 1170

Query: 2203 GGQISYSLAASQPARGLFHVDPTTGTITTTA-ILDREIWAETRLVLMATDRGSPALVGSA 2261
              ++ Y + +  P +G F + P TG ITTT+  LDRE   E  L +  TD GSP     A
Sbjct: 1171 NDKLMYKITSGNP-QGFFSIHPKTGLITTTSRKLDREQQDEHILEVTVTDNGSPPKSTIA 1229

Query: 2262 TLTVMVIDTNDNRPTIPQP-WELRVSEDALLGSE-------IAQVTGNDVDSGP--VLWY 2311
             + V ++D NDN+P   Q  +++R+ E      E       +  V   D D GP   + Y
Sbjct: 1230 RVIVKILDENDNKPQFLQKFYKIRLPEREKPDRERNARREPLYHVIATDKDEGPNAEISY 1289

Query: 2312 VLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQ-LQLLAHDGPHEGRANLTVL-VEDV 2369
             +        F +    G VS      F     Y  L + A D     +++ T L +E +
Sbjct: 1290 SIEDGNEHGKFFIEPKTGVVS---SKRFSAAGEYDILSIKAVDNGRPQKSSTTRLHIEWI 1346

Query: 2370 NDNAP-----AFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSV 2424
            +   P     +F +S +   ++E  P    I  +S      G          +    F V
Sbjct: 1347 SKPKPSLEPISFEESFFTFTVMESDPVAHMIGVISV--EPPGIPLWFDITGGNYDSHFDV 1404

Query: 2425 DPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARAT-VHVQLQDQNDHAPSFT 2483
            D   G   TI+    L  +     ++ +EA D    G     T V +++ D NDH P F+
Sbjct: 1405 DKGTG---TIIVAKPLDAEQKSNYNLTVEATD----GTTTILTQVFIKVIDTNDHRPQFS 1457

Query: 2484 LSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGES 2543
             S Y V + ED  P + +L + A D D          S       + F+L+P        
Sbjct: 1458 TSKYEVVIPEDTAPETEILQISAVDQDEKNKLIYTLQSSRDPLSLKKFRLDP-------- 1509

Query: 2544 AGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFT 2603
                  A G L   E LD E++ Q+ LTV   D+  P + +   + V V D ND+ P FT
Sbjct: 1510 ------ATGSLYTSEKLDHEAVHQHTLTVMVRDQDVPVKRNFARIVVNVSDTNDHAPWFT 1563

Query: 2604 RASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAH 2663
             +SY+  V E   VG+ +L V A D D G +  V +++ SG+    F +D   G+++ A 
Sbjct: 1564 ASSYKGRVYESAAVGSVVLQVTALDKDKGKNAEVLYSIESGNIGNSFMIDPVLGSIKTAK 1623

Query: 2664 ALDCETQARHQLVVQAADPAGAHFA-LAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPG 2722
             LD   QA + L+V+A D      + +  V I V   ++  P F     S  ++E    G
Sbjct: 1624 ELDRSNQAEYDLMVKATDKGSPPMSEITSVRIFVTIADNASPKFTSKEYSVELSETVSIG 1683

Query: 2723 TLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFR 2782
            + V  +      A +   + Y + +   G    +AF +N  +G +  +   D+E    + 
Sbjct: 1684 SFVGMV-----TAHSQSSVVYEIKDGNTG----DAFDINPHSGTIITQKALDFETLPIYT 1734

Query: 2783 LLVGAADAGNLSASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGAR--------RGHSLGH 2834
            L++   +   LS + TV V +  E++  PVF+   +   + E A         R   L  
Sbjct: 1735 LIIQGTNMAGLSTNTTVLVHLQDENDNAPVFMQAEYTGLISESASINSVVLTDRNVPL-V 1793

Query: 2835 VQATDEDGGADGLVLYSLATSS--PYFGINQTTGALY 2869
            ++A D D  ++ L++Y +   S   YF I+ +TGA++
Sbjct: 1794 IRAADADKDSNALLVYHIVEPSVHTYFAIDSSTGAIH 1830



 Score =  303 bits (777), Expect = 1e-81
 Identities = 250/819 (30%), Positives = 379/819 (46%), Gaps = 46/819 (5%)

Query: 51   IDEEQPAGTLIGDISAG-LPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDR 109
            I E  P G+ +  I A    +GT   +MY +   +   V    AI+  +G + T + LD 
Sbjct: 2818 IVENLPGGSRVIQIRASDADSGTNGQVMYSLDQSQSVEVIESFAINMETGWITTLKELDH 2877

Query: 110  EQRDRYRFTAVTPD-------GATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRY 162
            E+RD Y+   V  D        +T  V V V D+ND  P F        V E    G   
Sbjct: 2878 EKRDNYQIKVVASDHGEKIQLSSTAIVDVTVTDVNDSPPRFTAEIYKGTVSEDDPQGGVI 2937

Query: 163  PLEPARDADAGRLGTQ-GYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSHY 221
             +    DAD+  +  Q  Y ++G      F +ET          ++ V   LDRE R +Y
Sbjct: 2938 AILSTTDADSEEINRQVTYFITGGDPLGQFAVETIQNE-----WKVYVKKPLDREKRDNY 2992

Query: 222  MLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASD 281
            +L + A DG      ++A+++V +LD ND++P   ++ Y   + E + PG  ++Q+ A+D
Sbjct: 2993 LLTITATDG---TFSSKAIVEVKVLDANDNSPVCEKTLYSDTIPEDVLPGKLIMQISATD 3049

Query: 282  ADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHP 341
            AD   N  +TY +      G   F ++  TG L+   PLD E++ V+ L+V+A DGG   
Sbjct: 3050 ADIRSNAEITYTL---LGSGAEKFKLNPDTGELKTSTPLDREEQAVYHLLVRATDGGG-- 3104

Query: 342  ELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHV 401
                A + + + D NDN P     F +   +  V E   PG L+ R+  +D D G    +
Sbjct: 3105 RFCQASIVLTLEDVNDNAPE----FSADPYAITVFENTEPGTLLTRVQATDADAGLNRKI 3160

Query: 402  NVSL-EGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSP-PLRAEAAFV 459
              SL +  +G F+++    +I L    + LDRE +  Y L + A D G P  L A    +
Sbjct: 3161 LYSLIDSADGQFSINELSGIIQL---EKPLDRELQAVYTLSLKAVDQGLPRRLTATGTVI 3217

Query: 460  LHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTH 519
            + V D+NDN P F+ + Y    + E  L G+ V++V A   D   N ++TYS+  G    
Sbjct: 3218 VSVLDINDNPPVFEYREY-GATVSEDILVGTEVLQVYAASRDIEANAEITYSIISGNEHG 3276

Query: 520  WFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQ 579
             FSID  +G +    +LDYE   +  L V ATDGG P L+  ATV+V + D+NDN P F 
Sbjct: 3277 KFSIDSKTGAVFIIENLDYESSHEYYLTVEATDGGTPSLSDVATVNVNVTDINDNTPVFS 3336

Query: 580  RTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVC 639
            +  Y   + E        + V A DAD      + YS+    G+ GS  F ID   G+V 
Sbjct: 3337 QDTYTTVISEDAVLEQSVITVMADDADGPSNSHIHYSIID--GNQGS-SFTIDPVRGEVK 3393

Query: 640  TTRTLDRDQGPSSFDFTVTAVDGGG--LKSMVYVKVFLSDENDNPPQFYPREYAASISAQ 697
             T+ LDR+   S +  TV A D G     +   V + +SD NDN P F    Y+  I   
Sbjct: 3394 VTKLLDRET-ISGYTLTVQASDNGSPPRVNTTTVNIDVSDVNDNAPVFSRGNYSVIIQEN 3452

Query: 698  SPPGTAVLRLRAHDPDQGSHG-RLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVV 756
             P G +VL+L   D D   +G    + I+ GN    F ++ Q  LLT +  + R+     
Sbjct: 3453 KPVGFSVLQLVVTDEDSSHNGPPFFFTIVTGNDEKAFEVNPQGVLLTSS-AIKRKEKDHY 3511

Query: 757  QLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHN 816
             L++   D G  Q      +DI ++  +  PP    L+   +   +   G  +G + A  
Sbjct: 3512 LLQVKVADNGKPQLSSLTYIDIRVIEESIYPPAILPLEIFITSSGEEYSGGVIGKIHA-T 3570

Query: 817  PPGRLAPVTLSLSGGDPR--GLFSLDAVSGLLQTLRPLD 853
                   +T SL   DP+   LFS+ +  G L   + LD
Sbjct: 3571 DQDVYDTLTYSL---DPQMDNLFSVSSTGGKLIAHKKLD 3606



 Score =  139 bits (349), Expect = 6e-32
 Identities = 149/556 (26%), Positives = 239/556 (42%), Gaps = 51/556 (9%)

Query: 2334 TGPLDFEQCDRYQL--QLLAHDGPHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPP 2391
            T  L+ E  D Y L  + L  +   E R  + V V D ND  P FS + Y V L E+T  
Sbjct: 105  TAILNREVKDHYTLIVKALEKNTNVEARTKVRVQVLDTNDLRPLFSPTSYSVSLPENTAI 164

Query: 2392 GSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVV 2451
             ++I  VSATD D G NG   Y      D F++ P +G    IV T  L +  +   ++ 
Sbjct: 165  RTSIARVSATDADIGTNGEFYYSFKDRTDMFAIHPTSG---VIVLTGRLDYLETKLYEME 221

Query: 2452 LEARD-----HGAPGRAARATVHVQLQDQNDHAP---SFTLSHYRVAVTEDLPPGSTLLT 2503
            + A D     +G+ G ++ A + V ++  N+ AP   + TLS   +    D  P   ++T
Sbjct: 222  ILAADRGMKLYGSSGISSMAKLTVHIEQANECAPVITAVTLSPSEL----DRDPAYAIVT 277

Query: 2504 LEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFE 2563
            ++  D D   +      SI++G+  + F+       + E      +A+G       +D++
Sbjct: 278  VD--DCDQGANGDIASLSIVAGDLLQQFRTVRSFPGSKEYK---VKAIG------GIDWD 326

Query: 2564 SLT-QYNLTVAAADRGQPPQ-SSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAEL 2621
            S    YNLT+ A D+G PPQ SSV  + VT       P  F +  YR  + E  P    +
Sbjct: 327  SHPFGYNLTLQAKDKGTPPQFSSVKVIHVTSPQFKAGPVKFEKDVYRAEISEFAPPNTPV 386

Query: 2622 LHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAAD 2681
            + V+A  A    +  +R+   S      F L+ ++G + +   +  +  A  +L V  +D
Sbjct: 387  VMVKAIPA----YSHLRYVFKSTPGKAKFSLNYNTGLISILEPVKRQQAAHFELEVTTSD 442

Query: 2682 PAGAHFALAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRL 2741
                  A   V ++V   N + P F       +  EN P GT V +L A+D D G  G +
Sbjct: 443  ----RKASTKVLVKVLGANSNPPEFTQTAYKAAFDENVPIGTTVMSLSAVDPDEGENGYV 498

Query: 2742 RYSLLEAGPGPEGREAFALNSSTGELRARVPFDYE-HTESFRLLVGAADAG---NLSASV 2797
             YS+      P     FA++  TG +      DYE     + L + A+D G        V
Sbjct: 499  TYSIANLNHVP-----FAIDHFTGAVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEV 553

Query: 2798 TVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSS- 2856
              ++ +   ++  P+F        +P     G  +  V A D D     LV Y +   + 
Sbjct: 554  LATITLNNLNDNTPLFEKINCEGTIPRDLGVGEQITTVSAIDAD--ELQLVQYQIEAGNE 611

Query: 2857 -PYFGINQTTGALYLR 2871
              +F +N  +G L L+
Sbjct: 612  LDFFSLNPNSGVLSLK 627



 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 70/270 (25%), Positives = 110/270 (40%), Gaps = 27/270 (10%)

Query: 2595 VNDNPPVFTRASYRVTVPEDTPVGAELLH-VEASDADPGPHGLVRFTVSSGDPSGLFELD 2653
            +   P  FT   Y VTV E++     + H V+       P   VR+ + SGD   LF+ +
Sbjct: 27   LEQTPLQFTHLEYNVTVQENSAAKTYVGHPVKMGVYITHPAWEVRYKIVSGDSENLFKAE 86

Query: 2654 E----SSGTLRL------AHALDCETQARHQLVVQAADPAGAHFALAPVTIEVQDVNDHG 2703
            E        LR+         L+ E +  + L+V+A +      A   V ++V D ND  
Sbjct: 87   EYILGDFCFLRIRTKGGNTAILNREVKDHYTLIVKALEKNTNVEARTKVRVQVLDTNDLR 146

Query: 2704 PAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSS 2763
            P F     S S+ EN    T +  + A D D G  G   YS        +  + FA++ +
Sbjct: 147  PLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSF------KDRTDMFAIHPT 200

Query: 2764 TGELRARVPFDYEHTESFRLLVGAADAG-------NLSASVTVSVLVTGEDEYDPVFLAP 2816
            +G +      DY  T+ + + + AAD G        +S+   ++V +   +E  PV  A 
Sbjct: 201  SGVIVLTGRLDYLETKLYEMEILAADRGMKLYGSSGISSMAKLTVHIEQANECAPVITAV 260

Query: 2817 AFHFQVPEGARRGHSLGHVQATDEDGGADG 2846
                  P    R  +   V   D D GA+G
Sbjct: 261  TLS---PSELDRDPAYAIVTVDDCDQGANG 287


>gi|148886692 FAT tumor suppressor homolog 3 [Homo sapiens]
          Length = 4557

 Score =  880 bits (2275), Expect = 0.0
 Identities = 814/2881 (28%), Positives = 1304/2881 (45%), Gaps = 215/2881 (7%)

Query: 48   DLQIDEEQPAGTLIGDISA-GLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARV 106
            D+ + E+ P G  I  I A    +G    +++ IS        +   ID  +G ++    
Sbjct: 732  DVAVKEDLPVGANILKIKAYDADSGFNGKVLFTIS---DGNTDSCFNIDMETGQLKVLMP 788

Query: 107  LDREQRDRYRFTAVTPDGATVE------VTVRVADINDHAPAFPQARAALQVPEHTAFGT 160
            +DRE  D Y       D    +      +T+ V D ND++P F Q   ++ + E +  GT
Sbjct: 789  MDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGT 848

Query: 161  RYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSH 220
                  ARD D G  G   Y++  D   + F + +  G        + V  +LDRE++++
Sbjct: 849  EIIQVEARDKDLGSNGEVTYSVLTDT--QQFAINSSTGI-------VYVADQLDRESKAN 899

Query: 221  YMLQLEAYDGGSPPRRAQAL--LDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVF 278
            Y L++EA D     ++  ++  L V L D+ND +PAF  S Y   V E L  G+ +  + 
Sbjct: 900  YSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLE 959

Query: 279  ASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGG 338
              D D G+ G V Y +    ++ +G F ID  +G ++L + LD+E+++ + L V+A+D G
Sbjct: 960  THDPDLGLGGQVRYSL---VNDYNGRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKG 1016

Query: 339  AHPELGS-AFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGD 397
                L S +FV V V D N+N  +      +  GS  V E +  G  V +++  D D G 
Sbjct: 1017 RPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGS--VKENSRIGTSVLQVTARDEDSGR 1074

Query: 398  FAHVNVSLEGGEG--HFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPLRAE 455
               +  S+  G G   F++  +  VI     A  LDRE   +Y L V ATD G  PL + 
Sbjct: 1075 DGEIQYSIRDGSGLGRFSIDDESGVI---TAADILDRETMGSYWLTVYATDRGVVPLYST 1131

Query: 456  AAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPG 515
                + V DVNDNAP     +Y P  +       S V+++ A DPD  +N ++TY +  G
Sbjct: 1132 IEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVS-VIQIQAEDPDSSSNEKLTYRITSG 1190

Query: 516  AHTHWFSIDPTSGIITTAA-SLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDN 574
               ++F+I+  +G+ITT +  LD E + +  L V  TDGG  P  S+  V V + D NDN
Sbjct: 1191 NPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDN 1250

Query: 575  EPQFQRTFYNASLPEGTQP--GTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRID 632
            +PQF    Y   LPE  +   G    +  A D D GP   +SYS+  G   +    F ID
Sbjct: 1251 KPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDG---NDDGKFFID 1307

Query: 633  AHSGDVCTTRTLDRDQGPSSFDF-TVTAVDGGGLKSMVYVKVFLSDENDNPPQFYPREYA 691
              +G V + +         S+D  T+ AVD G  +     ++ +      PP   P  + 
Sbjct: 1308 PKTGMVSSRKQFTA----GSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFD 1363

Query: 692  ASIS----AQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWP 747
                     +S   T ++ + +  P   ++  L + I+ GN    F  ++  G + +A P
Sbjct: 1364 EPFYNFTVMESDRVTEIVGVVSVQP---ANTPLWFDIVGGNFDSAFDAEKGVGTIVIAKP 1420

Query: 748  LARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGT 807
            L     S+  + +   DG  +      +V I ++      P F Q  Y  ++ EDV P T
Sbjct: 1421 LDAEQRSIYNMSVEVTDGTNVAV---TQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDT 1477

Query: 808  SVGIVQA--HNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGP-VLELE 864
             +  ++A   +   +L+    S         F +D  +G+L T   LD E     +L + 
Sbjct: 1478 EILQIEATDRDEKHKLSYTVHSSIDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIM 1537

Query: 865  VRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSG 924
            VR     P    +ARV V ++D ND+SP F  P     +  + A G+ +  + ALD D G
Sbjct: 1538 VR-DQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKG 1596

Query: 925  VNSRVTFTLLAGG-GGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPR--TSH 981
             N+ + +T+ AG  G  F ++P  G + + +    +      L ++  D GSPP   T+ 
Sbjct: 1597 ENAELIYTIEAGNTGNMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAI 1656

Query: 982  FRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGPITYHLAAEGA 1041
             R+ V + D       P+F    Y+ ++      GT V+ + A +     + Y +     
Sbjct: 1657 VRISVTMSD----NSHPKFIHKDYQAEVNENVDIGTSVILISAISQS--TLIYEVKDGDI 1710

Query: 1042 SSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEH 1101
            +  F + P SG +  + ALD E    Y L + A +     +      ATV + I+++N++
Sbjct: 1711 NGIFTINPYSGVITTQKALDYERTSSYQLIIQATN-----MAGMASNATVNIQIVDENDN 1765

Query: 1102 SPRLSEDPTFLAVAENQPPGTSVGR-------VFATDRDSGPNGRLTYSLQQLSEDSKAF 1154
            +P         +++E  P  + V         + ATD DS  N  L Y + + S   K F
Sbjct: 1766 APVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVE-STAKKFF 1824

Query: 1155 RIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHV--AVLDLNDNSPTFL 1212
             +   TG + T+  LD E  + +   V V+D GSP  +    V V   V D+NDN P F 
Sbjct: 1825 TVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFT 1884

Query: 1213 QASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHSGE 1272
            QA       LP  V      G  V  + A DPD      + Y+L     + F +  +SG 
Sbjct: 1885 QAVFETILLLPTYV------GVEVLKVSATDPDSEVPPELTYSLMEGSLDHFLIDSNSGV 1938

Query: 1273 LLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSA-RLAEPPPDLAERDPAA 1331
            L      +   + HY+L +   D      S    ++ + + S     +     +  +   
Sbjct: 1939 LTIKNNNL--SKDHYMLIVKVSDGKFYSTSMVTIMVKEAMDSGLHFTQSFYSTSISENNT 1996

Query: 1332 PVPVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAASGRLYLA 1391
             +  V  V A      G+ L      EP     L Y+++   +P   F + + SG +   
Sbjct: 1997 NITKVAIVNAV-----GNRLN-----EP-----LKYSIL---NPGNKFKIKSTSGVIQTT 2038

Query: 1392 R-PLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDPLALALPENPE 1450
              P D E    +  +   +          + V+V ++D N+++P F   P   A+  + E
Sbjct: 2039 GVPFDREEQELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVDAE 2098

Query: 1451 PGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTP--- 1507
            PG  +Y   A D D  GPN +V Y L   +       ++  +G +      + + +    
Sbjct: 2099 PGTLIYQVTAIDKD-KGPNGEVTYVL---QDDYGHFEINPNSGNVILKEAFNSDLSNIEY 2154

Query: 1508 ALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPS-RVRLPEDQPPGPAALH 1566
             + +L +   +P+ ++       S  + +T  N   PVF  P     + ED       L 
Sbjct: 2155 GVTILAKDGGKPSLST-------SVELPITIVNKAMPVFDKPFYTASVNEDIRMNTPILS 2207

Query: 1567 VVARDPDLGEAARVSYRLASGGD-GHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHG 1625
            + A  P   E   + Y +  G     F +   TG L VV PLD E  + + LT+ ASD  
Sbjct: 2208 INATSP---EGQGIIYIIIDGDPFKQFNIDFDTGVLKVVSPLDYEVTSAYKLTIRASDAL 2264

Query: 1626 SPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVT 1685
            +  R+   V  + V DVND  P F Q  Y+  L E +  GT +L + + D D   N  V 
Sbjct: 2265 TGARAEVTV-DLLVNDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVH 2323

Query: 1686 YGGV-----SSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVA 1740
            Y  V     S++ F +D  +G++ T R LD E  +   L V + D G P   + V V + 
Sbjct: 2324 YQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPSLSSEVLVHIY 2383

Query: 1741 VEDENDHAPTFGS----AHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILDGDPSG 1796
            + D ND+ P F      +++S   P G     +T ++ASD D     +L+Y IL G+   
Sbjct: 2384 ISDVNDNPPVFNQLIYESYVSELAPRGH---FVTCVQASDADSSDFDRLEYSILSGNDRT 2440

Query: 1797 AFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFP 1856
            +F++D  SG         + +EP + L +   DG     ++T  + + VL AN ++PAF 
Sbjct: 2441 SFLMDSKSGVITLSNHRKQRMEPLYSLNVSVSDG---LFTSTAQVHIRVLGANLYSPAFS 2497

Query: 1857 VPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGELRTAAA 1916
               Y  EV E+V AGT ++ ++A D D G  G ++Y +    A    L  S+G++ T   
Sbjct: 2498 QSTYVAEVRENVAAGTKVIHVRATDGDPGTYGQISYAIINDFAKDRFLIDSNGQVITTER 2557

Query: 1917 LDREQCPSYTFS--VSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGP 1974
            LDRE       S  V A+DG   G  +T  +V + V D ND+AP F T   R  +     
Sbjct: 2558 LDRENPLEGDVSIFVRALDG---GGRTTFCTVRVIVVDENDNAPQFMTVEYRASVRADVG 2614

Query: 1975 SFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTT----VDSYTGEIRVARSPVALG 2030
                 T     ++A D D GAN+ I Y L             +D   G +    +   L 
Sbjct: 2615 RGHLVT----QVQAIDPDDGANSRITYSLYSEASVSVADLLEIDPDNGWMVTKGNFNQLK 2670

Query: 2031 PRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSP 2090
                  F+ A D G P + +   + + +       P F ++    TI E+   G+ + + 
Sbjct: 2671 NTVLSFFVKAVDGGIPVKHSLIPVYIHVLPPETFLPSFTQSQYSFTIAEDTAIGSTVDTL 2730

Query: 2091 RAVHAGGTNGPITYSILSG-----NEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQ 2145
            R + +      + +S ++G     N+ G F I+  TG  T++  + LD E SP     + 
Sbjct: 2731 RILPSQN----VWFSTVNGERPENNKGGIFVIEQETG--TIKLDKRLDRETSPAFHFKVA 2784

Query: 2146 AE---SGGAFAFTV-LTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQG 2201
            A          FTV + + + D NDN P F    Y   + E  P+   L QV A D+D G
Sbjct: 2785 ATIPLDKVDIVFTVDVDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAIDMDWG 2844

Query: 2202 SGGQISYSLAA-SQPARGL--FHVDPTTGTITTTAILDREIWAETRLVLMATDRGSP-AL 2257
            + GQ++YSL + SQP + +  F++D  TG I+T   LD E        ++A+D G   +L
Sbjct: 2845 ANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLGEAFSL 2904

Query: 2258 VGSATLTVMVIDTNDNRPTIPQP-WELRVSEDALLGSEIAQVTGNDVDSGPV---LWYVL 2313
              +A ++V V D NDN P   Q  +   V E    G  +A ++  D D+  V   + Y +
Sbjct: 2905 SSTALVSVRVTDINDNAPVFAQEVYRGNVKESDPPGEVVAVLSTWDRDTSDVNRQVSYHI 2964

Query: 2314 SPSGPQDPFSVGRYGG--RVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVLVEDVND 2371
            +   P+  F++G      +V +  PLD E+ D Y L + A DG    +A + V V DVND
Sbjct: 2965 TGGNPRGRFALGLVQSEWKVYVKRPLDREEQDIYFLNITATDGLFVTQAMVEVSVSDVND 3024

Query: 2372 NAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADG-FSVDPNNGT 2430
            N+P   Q  Y  +L E  P    IL VSA D D G+NG+I Y L    +  F +DP +G 
Sbjct: 3025 NSPVCDQVAYTALLPEDIPSNKIILKVSAKDADIGSNGYIRYSLYGSGNSEFFLDPESGE 3084

Query: 2431 LFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVA 2490
            L T+     L  +      ++ +A D G  GR  ++ +H+ L+D ND+ P F+  HY   
Sbjct: 3085 LKTLA---LLDRERIPVYSLMAKATDGG--GRFCQSNIHLILEDVNDNPPVFSSDHYNTC 3139

Query: 2491 VTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRA 2550
            V E+    + L  ++A D D   +   V YS+ + + G VF ++               +
Sbjct: 3140 VYENTATKALLTRVQAVDPDIGINRKVV-YSL-ADSAGGVFSIDS--------------S 3183

Query: 2551 LGCLVLLEPLDFESLTQYNLTVAAADRGQPPQS--SVVPVTVTVLDVNDNPPVFTRASYR 2608
             G ++L +PLD E  + YN++V A D+  P QS  S+  VT+TVLD+NDNPPVF R  Y 
Sbjct: 3184 SGIIILEQPLDREQQSSYNISVRATDQS-PGQSLSSLTTVTITVLDINDNPPVFERRDYL 3242

Query: 2609 VTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCE 2668
            VTVPEDT  G ++L V A+  D G +  + + + SG+  G F+++  +G + ++  LD E
Sbjct: 3243 VTVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRSGNEQGKFKINPKTGGISVSEVLDYE 3302

Query: 2669 TQARHQLVVQAAD-PAGAHFALAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTT 2727
               R  LVV+A D    A  A+A V I + DVND+ P F  ++ S  ++E+   G  V  
Sbjct: 3303 LCKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDVYSAVISEDALVGDSVIL 3362

Query: 2728 LHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGA 2787
            L A D D+   G++ +S++      E    F ++   G ++ +   D E    + LLV A
Sbjct: 3363 LIAEDVDSQPNGQIHFSIVNGDRDNE----FTVDPVLGLVKVKKKLDRERVSGYSLLVQA 3418

Query: 2788 ADAG--NLSASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGGAD 2845
             D+G   +S++ TV++ ++  ++  PVF    +   + E    G S+  +  TD D   +
Sbjct: 3419 VDSGIPAMSSTATVNIDISDVNDNSPVFTPANYTAVIQENKPVGTSILQLVVTDRDSFHN 3478

Query: 2846 G 2846
            G
Sbjct: 3479 G 3479



 Score =  773 bits (1995), Expect = 0.0
 Identities = 771/2793 (27%), Positives = 1226/2793 (43%), Gaps = 206/2793 (7%)

Query: 136  INDHAPAFPQARAA-LQVPEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLE 194
            IN   P F ++  + + V E    G       A DAD+G  G   + +S       F ++
Sbjct: 718  INRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSCFNID 777

Query: 195  TRPGPDGTPVPELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPA 254
               G       +L V   +DRE+   Y+L +  YD G+P + +  LL + + D ND++P 
Sbjct: 778  METG-------QLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPV 830

Query: 255  FNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLL 314
            F Q  Y   + ES   G+ ++QV A D D G NG VTY +     +    F+I++ TG++
Sbjct: 831  FIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQ----FAINSSTGIV 886

Query: 315  QLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHV--RDANDNQPSMTVIFLSADGS 372
             +   LD E +  + L ++ARD     +   + VT+ V   D ND  P+    F+ +  S
Sbjct: 887  YVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPA----FIPSSYS 942

Query: 373  PQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGG-EGHFALSTQDSVIYLVCVARRLD 431
             +V E  P G ++A +   DPD G    V  SL     G F +      I L   ++ LD
Sbjct: 943  VKVLEDLPVGTVIAWLETHDPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRL---SKELD 999

Query: 432  REERDAYNLRVTATDSGSPPLRAEAAFV-LHVTDVNDNAPAFDRQLYRPEPLPEVALPGS 490
             E++  YNL V A D G P   +  +FV + V DVN+N       L+ P   P+ A+ GS
Sbjct: 1000 YEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNEN-------LHTPY-FPDFAVVGS 1051

Query: 491  F---------VVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYELE 541
                      V++VTARD D G +G++ YS+  G+    FSID  SG+IT A  LD E  
Sbjct: 1052 VKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFSIDDESGVITAADILDRETM 1111

Query: 542  PQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVT 601
                L V ATD G+ PL S+  V + ++DVNDN P      Y   + E +      +Q+ 
Sbjct: 1112 GSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQ 1171

Query: 602  ATDADSGPFGLLSYSLGAGLGSSGSPP--FRIDAHSGDVCTT-RTLDRDQGPSSFDFTVT 658
            A D DS     L+Y +     +SG+P   F I+  +G + TT R LDR+Q    F   VT
Sbjct: 1172 AEDPDSSSNEKLTYRI-----TSGNPQNFFAINIKTGLITTTSRKLDREQQAEHF-LEVT 1225

Query: 659  AVDGGGL--KSMVYVKVFLSDENDNPPQFYPREYAASISAQSPP--GTAVLRLRAHDPDQ 714
              DGG    +S ++V V + DENDN PQF  + Y   +  +     G  + R  A D D+
Sbjct: 1226 VTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDE 1285

Query: 715  GSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSA 774
            G +  +SY I+ GN    F +D ++G+++        A S   L I A D G  Q   +A
Sbjct: 1286 GPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQFT--AGSYDILTIKAVDNGRPQKSSTA 1343

Query: 775  RVDISIV---PGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPPGRLAPVTLSLSGG 831
            R+ I  +   P +P P  F++  Y F+V E       VG+V     P    P+   + GG
Sbjct: 1344 RLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEIVGVVSVQ--PAN-TPLWFDIVGG 1400

Query: 832  DPRGLFSLDAVSGLLQTLRPLDRELLGPV-LELEVRAGSGVPPAFAVARVRVLLDDVNDN 890
            +    F  +   G +   +PLD E      + +EV  G+ V    AV +V + + D NDN
Sbjct: 1401 NFDSAFDAEKGVGTIVIAKPLDAEQRSIYNMSVEVTDGTNV----AVTQVFIKVLDNNDN 1456

Query: 891  SPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGA----FTVDPT 946
             P F  P   V +  +  P T I  + A D D     ++++T+ +         F +DP+
Sbjct: 1457 GPEFSQPNYDVTISEDVLPDTEILQIEATDRDE--KHKLSYTVHSSIDSISMRKFRIDPS 1514

Query: 947  TGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYR 1006
            TG +     L       H L +  RD   P R +  R+ V V+D      +P F +P Y 
Sbjct: 1515 TGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDH--SPYFTNPLYE 1572

Query: 1007 VDLPSGTTAGTQVLQVQAQAPDGGP---ITYHLAAEGASSPFGLEPQSGWLWVRAALDRE 1063
              +      G+ VLQV A   D G    + Y + A    + F +EP  G + +    D  
Sbjct: 1573 ASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNMFKIEPVLGIITICKEPDMT 1632

Query: 1064 AQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTS 1123
                ++L +         +   + TA VR+S+   +   P+         V EN   GTS
Sbjct: 1633 TMGQFVLSIKVTDQGSPPM---SATAIVRISVTMSDNSHPKFIHKDYQAEVNENVDIGTS 1689

Query: 1124 VGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQV 1183
            V  + A  + +     L Y ++   + +  F I+P +G +TT + LD E+ SSYQL++Q 
Sbjct: 1690 VILISAISQST-----LIYEVKD-GDINGIFTINPYSGVITTQKALDYERTSSYQLIIQA 1743

Query: 1184 QDGGSPPRSTTGTVHVAVLDLNDNSPTFL--QASGAAGGGLPIQVPDRVPPGTLVTTLQA 1241
             +      ++  TV++ ++D NDN+P FL  Q SG+     PI    R    + +  ++A
Sbjct: 1744 TNMAG--MASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLV-IRA 1800

Query: 1242 KDPDEGENGTILYTLT-GPGSELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPP 1300
             D D   N  ++Y +      + F++   +G + T A L      H+   +   D GSP 
Sbjct: 1801 TDADSNRNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQ 1860

Query: 1301 RSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPA 1360
             +A   + V +     + + PP   +    A    +L +    G+    L  S   P+  
Sbjct: 1861 LTAESPVEVNI-EVTDVNDNPPVFTQ----AVFETILLLPTYVGVEV--LKVSATDPDSE 1913

Query: 1361 GVGALTYTLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLL 1420
                LTY+L+ G+     F +D+ SG L +              L V+     G      
Sbjct: 1914 VPPELTYSLMEGSLDH--FLIDSNSGVLTIKNN---NLSKDHYMLIVKVSD--GKFYSTS 1966

Query: 1421 RVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQE 1480
             V + V++  +    F +   + ++ EN      +      +A G   N  ++Y +L   
Sbjct: 1967 MVTIMVKEAMDSGLHFTQSFYSTSISEN---NTNITKVAIVNAVGNRLNEPLKYSILN-- 2021

Query: 1481 PPVPALRLDARTGALSAPR-GLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDE 1539
             P    ++ + +G +       DRE      L+VEA+         R ARV  RV + D 
Sbjct: 2022 -PGNKFKIKSTSGVIQTTGVPFDREEQELYELVVEAS---RELDHLRVARVVVRVNIEDI 2077

Query: 1540 NDNAPVFAS-PSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGHFRLHSST 1598
            NDN+PVF   P    +  D  PG     V A D D G    V+Y L     GHF ++ ++
Sbjct: 2078 NDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEVTYVLQDDY-GHFEINPNS 2136

Query: 1599 GALSVVRPLDRE-QRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVL 1657
            G + +    + +    E+ +T++A D G P  S +  L +++  VN   P F +  Y+  
Sbjct: 2137 GNVILKEAFNSDLSNIEYGVTILAKDGGKPSLSTSVELPITI--VNKAMPVFDKPFYTAS 2194

Query: 1658 LRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSESFSLDPDTGVLTTLRALDREEQEEI 1717
            + E+    T +L++ AT P+      +   G   + F++D DTGVL  +  LD E     
Sbjct: 2195 VNEDIRMNTPILSINATSPEGQGIIYIIIDGDPFKQFNIDFDTGVLKVVSPLDYEVTSAY 2254

Query: 1718 NLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQTLTMLRAS-D 1776
             LT+ A D  +  +   VTV + V D ND+ P F     +  + E     T  +   S D
Sbjct: 2255 KLTIRASDALTGAR-AEVTVDLLVNDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSID 2313

Query: 1777 PDVGANGQLQYRILDG--DPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPA 1834
             D   N  + Y+I+    + +  F +D +SG   T R LD E+     L++ + D G P+
Sbjct: 2314 ADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPS 2373

Query: 1835 LSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYL 1894
            LS+ +L+ + + D ND+ P F    Y   V E  P G  +  +QA D D+     + Y +
Sbjct: 2374 LSSEVLVHIYISDVNDNPPVFNQLIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSI 2433

Query: 1895 GAGT-AGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDV 1953
             +G    +FL++  SG +  +    +   P Y+ +VS  DG      ++T  V I V   
Sbjct: 2434 LSGNDRTSFLMDSKSGVITLSNHRKQRMEPLYSLNVSVSDGL----FTSTAQVHIRVLGA 2489

Query: 1954 NDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTTV 2013
            N ++P F  S     + R   +  T  + +   RA D D G    I Y +         +
Sbjct: 2490 NLYSPAFSQSTYVAEV-RENVAAGTKVIHV---RATDGDPGTYGQISYAIINDFAKDRFL 2545

Query: 2014 DSYTGEI----RVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRFP 2069
                G++    R+ R     G  D  +F+ A D G      T  +IV    E +  P+F 
Sbjct: 2546 IDSNGQVITTERLDRENPLEG--DVSIFVRALDGGGRTTFCTVRVIV--VDENDNAPQFM 2601

Query: 2070 RASSEATIRENAPPGTPIVSPRAVHAG-GTNGPITYSILSGNEKGT---FSIQPSTGAIT 2125
                 A++R +   G  +   +A+    G N  ITYS+ S           I P  G + 
Sbjct: 2602 TVEYRASVRADVGRGHLVTQVQAIDPDDGANSRITYSLYSEASVSVADLLEIDPDNGWMV 2661

Query: 2126 VRSAEGLDFEVSPRLRLVLQAESGGA---FAFTVLTLTLQDANDNAPRFLRPHYVAFLPE 2182
             +     +   +  L   ++A  GG     +   + + +       P F +  Y   + E
Sbjct: 2662 TKG--NFNQLKNTVLSFFVKAVDGGIPVKHSLIPVYIHVLPPETFLPSFTQSQYSFTIAE 2719

Query: 2183 SRPLEGPLLQVEADDLDQGSGGQISYSLAASQPAR----GLFHVDPTTGTITTTAILDRE 2238
               +   +     D L       + +S    +       G+F ++  TGTI     LDRE
Sbjct: 2720 DTAIGSTV-----DTLRILPSQNVWFSTVNGERPENNKGGIFVIEQETGTIKLDKRLDRE 2774

Query: 2239 IWAETRLVLMAT-DRGSPALVGSATLTVMVIDTNDNRPTIP-QPWELRVSEDALLGSEIA 2296
                    + AT       +V +  + + V+D NDN+P      ++  + E   +G+++ 
Sbjct: 2775 TSPAFHFKVAATIPLDKVDIVFTVDVDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLT 2834

Query: 2297 QVTGNDVD---SGPVLWYVLSPSGPQ---DPFSVGRYGGRVSLTGPLDFEQCDRYQLQLL 2350
            QV   D+D   +G V + + S S P+   + F++    G +S    LD E    +   ++
Sbjct: 2835 QVRAIDMDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVV 2894

Query: 2351 AHDGPH----EGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRD-S 2405
            A D          A ++V V D+NDNAP F+Q +Y+  + E  PPG  +  +S  DRD S
Sbjct: 2895 ASDLGEAFSLSSTALVSVRVTDINDNAPVFAQEVYRGNVKESDPPGEVVAVLSTWDRDTS 2954

Query: 2406 GANGHISYHLA--SPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRA 2463
              N  +SYH+   +P   F++          V    L  +      + + A D       
Sbjct: 2955 DVNRQVSYHITGGNPRGRFALGLVQSEWKVYVKR-PLDREEQDIYFLNITATDGLF---V 3010

Query: 2464 ARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSII 2523
             +A V V + D ND++P      Y   + ED+P    +L + A DAD   S+  + YS+ 
Sbjct: 3011 TQAMVEVSVSDVNDNSPVCDQVAYTALLPEDIPSNKIILKVSAKDADIG-SNGYIRYSLY 3069

Query: 2524 SGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQS 2583
             G+    F L+P   E+GE           L  L  LD E +  Y+L   A D G     
Sbjct: 3070 -GSGNSEFFLDP---ESGE-----------LKTLALLDRERIPVYSLMAKATDGGGRFCQ 3114

Query: 2584 SVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSS 2643
            S + + +   DVNDNPPVF+   Y   V E+T   A L  V+A D D G +  V ++++ 
Sbjct: 3115 SNIHLILE--DVNDNPPVFSSDHYNTCVYENTATKALLTRVQAVDPDIGINRKVVYSLAD 3172

Query: 2644 GDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAAD--PAGAHFALAPVTIEVQDVND 2701
                G+F +D SSG + L   LD E Q+ + + V+A D  P  +  +L  VTI V D+ND
Sbjct: 3173 S-AGGVFSIDSSSGIIILEQPLDREQQSSYNISVRATDQSPGQSLSSLTTVTITVLDIND 3231

Query: 2702 HGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALN 2761
            + P F       +V E+  PGT V  + A   D G    + Y L+ +G   +G+  F +N
Sbjct: 3232 NPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAEITY-LIRSG-NEQGK--FKIN 3287

Query: 2762 SSTGELRARVPFDYEHTESFRLLVGAADAGN--LSASVTVSVLVTGEDEYDPVFLAPAFH 2819
              TG +      DYE  + F L+V A D G   LSA  TV++ +T  ++  P F    + 
Sbjct: 3288 PKTGGISVSEVLDYELCKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDVYS 3347

Query: 2820 FQVPEGARRGHSLGHVQATDEDGGADGLVLYSL 2852
              + E A  G S+  + A D D   +G + +S+
Sbjct: 3348 AVISEDALVGDSVILLIAEDVDSQPNGQIHFSI 3380



 Score =  761 bits (1966), Expect = 0.0
 Identities = 792/2963 (26%), Positives = 1281/2963 (43%), Gaps = 289/2963 (9%)

Query: 48   DLQIDEEQPAGTLIGDISAG-LPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARV 106
            D  ++E  P GT +  +SA     G    + Y I++           I++ +GV+ T   
Sbjct: 478  DAYVNESVPVGTSVLTVSASDKDKGENGYITYSIASLNL----LPFVINQFTGVISTTEE 533

Query: 107  LDREQRDR-YRFTAVTPDGAT-------VEVTVRVADINDHAPAFPQARAALQVPEHTAF 158
            LD E     YRF     D  +       V VT+R+ ++ND++P F +      +      
Sbjct: 534  LDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPV 593

Query: 159  GTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENR 218
            G       A D D   L  +   +SG+  G  +       PD + V +L  +        
Sbjct: 594  GGHITAVSAIDIDELEL-VKYKIISGNELGFFYL-----NPD-SGVLQLKKSLTNSGIKN 646

Query: 219  SHYMLQLEAYDGGS------------------------PPRRAQALLDVTLL-------- 246
             ++ L++ A DG +                          R AQ L +  L+        
Sbjct: 647  GNFALRITATDGENLADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKL 706

Query: 247  ----------DINDHAPAFNQSRYHAV-VSESLAPGSPVLQVFASDADAGVNGAVTYEIN 295
                       IN   P F++S    V V E L  G+ +L++ A DAD+G NG V + I+
Sbjct: 707  NLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTIS 766

Query: 296  RRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDA 355
                  D  F+ID  TG L++  P+D E   ++ L +   D G   +     +T++V DA
Sbjct: 767  --DGNTDSCFNIDMETGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDA 824

Query: 356  NDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALS 415
            NDN P    +F+    S  + E++  G  + ++   D D G    V  S+      FA++
Sbjct: 825  NDNSP----VFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQFAIN 880

Query: 416  TQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHV--TDVNDNAPAFD 473
            +   ++Y   VA +LDRE +  Y+L++ A D      +  +   L V   DVND +PAF 
Sbjct: 881  SSTGIVY---VADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFI 937

Query: 474  RQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTA 533
               Y  + L ++ + G+ +  +   DPD G  GQV YSL    +   F ID  SG I  +
Sbjct: 938  PSSYSVKVLEDLPV-GTVIAWLETHDPDLGLGGQVRYSLV-NDYNGRFEIDKASGAIRLS 995

Query: 534  ASLDYELEPQPQLIVVATDGGLP-PLASSATVSVALQDVNDN--EPQFQRTFYNASLPEG 590
              LDYE +    L V A D G P  L+S + V V + DVN+N   P F       S+ E 
Sbjct: 996  KELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKEN 1055

Query: 591  TQPGTCFLQVTATDADSGPFGLLSYSL--GAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQ 648
            ++ GT  LQVTA D DSG  G + YS+  G+GLG      F ID  SG +     LDR+ 
Sbjct: 1056 SRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGR-----FSIDDESGVITAADILDRET 1110

Query: 649  GPSSFDFTVTAVDGG--GLKSMVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLR 706
               S+  TV A D G   L S + V + + D NDN P      Y   +   SP   +V++
Sbjct: 1111 -MGSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQ 1169

Query: 707  LRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTV-AWPLARRANSVVQLEIGAEDG 765
            ++A DPD  S+ +L+Y I +GN    F ++ ++GL+T  +  L R   +   LE+   DG
Sbjct: 1170 IQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDG 1229

Query: 766  GGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAH---NPPGRLA 822
            G    + +  V + ++      P F +  Y   +PE         I +A       G  A
Sbjct: 1230 GPSPKQSTIWVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNA 1289

Query: 823  PVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGPVLELEVRA-GSGVPPAFAVARVR 881
             ++ S+  G+  G F +D  +G++ + +       G    L ++A  +G P   + AR+ 
Sbjct: 1290 EISYSIVDGNDDGKFFIDPKTGMVSSRKQFTA---GSYDILTIKAVDNGRPQKSSTARLH 1346

Query: 882  VLLDDVNDNSPAFPAPEDTVLLPPNTAPGT---PIYTLRALDPDS-----GV------NS 927
            +               E     PP+  P T   P Y    ++ D      GV      N+
Sbjct: 1347 I---------------EWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEIVGVVSVQPANT 1391

Query: 928  RVTFTLLAGG-GGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRV 986
             + F ++ G    AF  +   G + + +PL       + + +E  DG +   T  F   +
Sbjct: 1392 PLWFDIVGGNFDSAFDAEKGVGTIVIAKPLDAEQRSIYNMSVEVTDGTNVAVTQVF---I 1448

Query: 987  VVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGG---PITYHLAAEGASS 1043
             V D    G  P F+ P Y V +       T++LQ++A   D       T H + +  S 
Sbjct: 1449 KVLDNNDNG--PEFSQPNYDVTISEDVLPDTEILQIEATDRDEKHKLSYTVHSSIDSISM 1506

Query: 1044 -PFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHS 1102
              F ++P +G L+    LD EAQ+ +IL +M       E   +   A V V++ + N+HS
Sbjct: 1507 RKFRIDPSTGVLYTAERLDHEAQDKHILNIMV---RDQEFPYRRNLARVIVNVEDANDHS 1563

Query: 1103 PRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGE 1162
            P  +      +V E+   G++V +V A D+D G N  L Y+++        F+I P  G 
Sbjct: 1564 PYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEA-GNTGNMFKIEPVLGI 1622

Query: 1163 VTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGL 1222
            +T  +  D      + L ++V D GSPP S T  V ++V   +++ P F+     A    
Sbjct: 1623 ITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKDYQA---- 1678

Query: 1223 PIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLT-GPGSELFSLHPHSGELLTAAPLIR 1281
              +V + V  GT V  + A         T++Y +  G  + +F+++P+SG + T   L  
Sbjct: 1679 --EVNENVDIGTSVILISAIS-----QSTLIYEVKDGDINGIFTINPYSGVITTQKALDY 1731

Query: 1282 AERPHYVLTLSAHDQGSPPRSASLQLLV----QVLPSARLAEPPPDLAERDPAAPV---- 1333
                 Y L + A +      +A++ + +       P    ++    L+E  P   +    
Sbjct: 1732 ERTSSYQLIIQATNMAGMASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSL 1791

Query: 1334 ---PVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAASGRLYL 1390
               P+V+  T A+  R   L+  +                  +  +  F +D+++G +  
Sbjct: 1792 DNSPLVIRATDADSNRNALLVYQIVE----------------STAKKFFTVDSSTGAIRT 1835

Query: 1391 ARPLDFEAGPPWRA-LTVRAEG-PGGAGARLLRVQVQVQDENEHAPAFARDPLALALPEN 1448
               LD E    +   + VR  G P       + V ++V D N++ P F +      L   
Sbjct: 1836 IANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLP 1895

Query: 1449 PEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPA 1508
               G  +    A+D D   P  ++ Y L+  E  +    +D+ +G L+     +  +   
Sbjct: 1896 TYVGVEVLKVSATDPDSEVP-PELTYSLM--EGSLDHFLIDSNSGVLTIKN--NNLSKDH 1950

Query: 1509 LLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFA-SPSRVRLPEDQPPGPAALHV 1567
             +L+V+ +D    ++          + V +  D+   F  S     + E+         V
Sbjct: 1951 YMLIVKVSDGKFYSTSM------VTIMVKEAMDSGLHFTQSFYSTSISENNTNITKVAIV 2004

Query: 1568 VARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVR-PLDREQRAEHVLTVVASDHGS 1626
             A    L E  +  Y + + G+  F++ S++G +     P DRE++  + L V AS    
Sbjct: 2005 NAVGNRLNEPLK--YSILNPGN-KFKIKSTSGVIQTTGVPFDREEQELYELVVEASRELD 2061

Query: 1627 PPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTY 1686
              R A  V+ V++ D+ND +P F    Y   ++ +  PGT +  + A D D G NG+VTY
Sbjct: 2062 HLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEVTY 2121

Query: 1687 GGVSSES-FSLDPDTGVLTTLRALDREEQE-EINLTVYAQDRGSPPQLTHVTVRVAVEDE 1744
                    F ++P++G +    A + +    E  +T+ A+D G P   T V + + +   
Sbjct: 2122 VLQDDYGHFEINPNSGNVILKEAFNSDLSNIEYGVTILAKDGGKPSLSTSVELPITIV-- 2179

Query: 1745 NDHAPTFGSAHLSLEVPEGQDPQT-LTMLRASDPDVGANGQ-LQYRILDGDPSGAFVLDL 1802
            N   P F     +  V E     T +  + A+ P+    GQ + Y I+DGDP   F +D 
Sbjct: 2180 NKAMPVFDKPFYTASVNEDIRMNTPILSINATSPE----GQGIIYIIIDGDPFKQFNIDF 2235

Query: 1803 ASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSV 1862
             +G    + PLD EV  A++L I A D    A  A + + + V D ND+ P F  P Y+ 
Sbjct: 2236 DTGVLKVVSPLDYEVTSAYKLTIRASDALTGA-RAEVTVDLLVNDVNDNPPIFDQPTYNT 2294

Query: 1863 EVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGA---FLLEPSSGELRTAAALDR 1919
             + E    GT +LQ+ + D D+  N  V Y +   T  +   F ++ SSG + TA  LD 
Sbjct: 2295 TLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDH 2354

Query: 1920 EQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTP 1979
            E     T  V ++D      LS+ V V I + DVND+ P F        +    P     
Sbjct: 2355 ELVQHCTLKVRSIDSGFPS-LSSEVLVHIYISDVNDNPPVFNQLIYESYVSELAPRGHFV 2413

Query: 1980 TLALATLRAEDRDAGANASILYR-LAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLFI 2038
            T     ++A D D+     + Y  L+G       +DS +G I ++        R   L+ 
Sbjct: 2414 TC----VQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGVITLSNHRKQ---RMEPLYS 2466

Query: 2039 VATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHAG-G 2097
            +   +     ++T  + + + G     P F +++  A +REN   GT ++  RA     G
Sbjct: 2467 LNVSVSDGLFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVRATDGDPG 2526

Query: 2098 TNGPITYSILSGNEKGTFSIQPSTGAITVRSAEG---LDFEVSPRLRLVLQAESGGAFAF 2154
            T G I+Y+I++   K  F I  +   IT    +    L+ +VS  +R +   + GG   F
Sbjct: 2527 TYGQISYAIINDFAKDRFLIDSNGQVITTERLDRENPLEGDVSIFVRAL---DGGGRTTF 2583

Query: 2155 TVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSL--AA 2212
              + + + D NDNAP+F+   Y A +         + QV+A D D G+  +I+YSL   A
Sbjct: 2584 CTVRVIVVDENDNAPQFMTVEYRASVRADVGRGHLVTQVQAIDPDDGANSRITYSLYSEA 2643

Query: 2213 SQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTND 2272
            S     L  +DP  G + T    ++         + A D G P       + + V+    
Sbjct: 2644 SVSVADLLEIDPDNGWMVTKGNFNQLKNTVLSFFVKAVDGGIPVKHSLIPVYIHVLPPET 2703

Query: 2273 NRPTIPQP-WELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDP----FSVGRY 2327
              P+  Q  +   ++ED  +GS +   T   + S  V +  ++   P++     F + + 
Sbjct: 2704 FLPSFTQSQYSFTIAEDTAIGSTVD--TLRILPSQNVWFSTVNGERPENNKGGIFVIEQE 2761

Query: 2328 GGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVLVE----DVNDNAPAFSQSLYQV 2383
             G + L   LD E    +  ++ A     +     TV V+    D+NDN P F  S Y  
Sbjct: 2762 TGTIKLDKRLDRETSPAFHFKVAATIPLDKVDIVFTVDVDIKVLDLNDNKPVFETSSYDT 2821

Query: 2384 MLLEHTPPGSAILSVSATDRDSGANGHISYHLASPA------DGFSVDPNNGTLFTIVGT 2437
            +++E  P G+ +  V A D D GANG ++Y L S +      + F++D N G + T+   
Sbjct: 2822 IIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKD- 2880

Query: 2438 VALGHDGSGAVDVVLEARDHG-APGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLP 2496
              L H+        + A D G A   ++ A V V++ D ND+AP F    YR  V E  P
Sbjct: 2881 --LDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAQEVYRGNVKESDP 2938

Query: 2497 PGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCL-- 2554
            PG  +  L   D D S  +  V Y I  GN        PR          G  ALG +  
Sbjct: 2939 PGEVVAVLSTWDRDTSDVNRQVSYHITGGN--------PR----------GRFALGLVQS 2980

Query: 2555 ----VLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVT 2610
                 +  PLD E    Y L + A D     Q+ V    V+V DVNDN PV  + +Y   
Sbjct: 2981 EWKVYVKRPLDREEQDIYFLNITATDGLFVTQAMV---EVSVSDVNDNSPVCDQVAYTAL 3037

Query: 2611 VPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQ 2670
            +PED P    +L V A DAD G +G +R+++     S  F LD  SG L+    LD E  
Sbjct: 3038 LPEDIPSNKIILKVSAKDADIGSNGYIRYSLYGSGNSEFF-LDPESGELKTLALLDRERI 3096

Query: 2671 ARHQLVVQAADPAGAHFALAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHA 2730
              + L+ +A D  G  F  + + + ++DVND+ P F  +  +T V EN     L+T + A
Sbjct: 3097 PVYSLMAKATD-GGGRFCQSNIHLILEDVNDNPPVFSSDHYNTCVYENTATKALLTRVQA 3155

Query: 2731 IDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAADA 2790
            +D D G   ++ YSL ++  G      F+++SS+G +    P D E   S+ + V A D 
Sbjct: 3156 VDPDIGINRKVVYSLADSAGG-----VFSIDSSSGIIILEQPLDREQQSSYNISVRATDQ 3210

Query: 2791 G---NLSASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGL 2847
                +LS+  TV++ V   ++  PVF    +   VPE    G  +  V AT +D G +  
Sbjct: 3211 SPGQSLSSLTTVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAE 3270

Query: 2848 VLYSLATSSPY--FGINQTTGAL 2868
            + Y + + +    F IN  TG +
Sbjct: 3271 ITYLIRSGNEQGKFKINPKTGGI 3293



 Score =  731 bits (1886), Expect = 0.0
 Identities = 732/2687 (27%), Positives = 1193/2687 (44%), Gaps = 197/2687 (7%)

Query: 51   IDEEQPAGTLIGDISA-GLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDR 109
            + E    GT +  ++A    +G    + Y  S ++GSG+G   +ID+ SGV+  A +LDR
Sbjct: 1052 VKENSRIGTSVLQVTARDEDSGRDGEIQY--SIRDGSGLGR-FSIDDESGVITAADILDR 1108

Query: 110  EQRDRYRFTA------VTPDGATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYP 163
            E    Y  T       V P  +T+EV + V D+ND+AP   +      V E++       
Sbjct: 1109 ETMGSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVI 1168

Query: 164  LEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSHYML 223
               A D D+       Y ++       F +  + G   T       + +LDRE ++ + L
Sbjct: 1169 QIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITT------TSRKLDREQQAEHFL 1222

Query: 224  QLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSES--LAPGSPVLQVFASD 281
            ++   DGG  P+++   + V +LD ND+ P F +  Y   + E      G P+ + FA D
Sbjct: 1223 EVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFD 1282

Query: 282  ADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHP 341
             D G N  ++Y I       DG F ID  TG++   +   F       L ++A D G   
Sbjct: 1283 RDEGPNAEISYSIV--DGNDDGKFFIDPKTGMVSSRK--QFTAGSYDILTIKAVDNGRPQ 1338

Query: 342  ELGSAFVTVHVRDANDNQPS-MTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAH 400
            +  +A   +H+       PS + + F     +  V E+    ++V  +SV   +      
Sbjct: 1339 KSSTA--RLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEIVGVVSVQPAN----TP 1392

Query: 401  VNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVL 460
            +   + GG    A   +  V  +V +A+ LD E+R  YN+ V  TD  +    A     +
Sbjct: 1393 LWFDIVGGNFDSAFDAEKGVGTIV-IAKPLDAEQRSIYNMSVEVTDGTNV---AVTQVFI 1448

Query: 461  HVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVT-YSLAPGAHTH 519
             V D NDN P F +  Y    + E  LP + ++++ A D D+      T +S        
Sbjct: 1449 KVLDNNDNGPEFSQPNY-DVTISEDVLPDTEILQIEATDRDEKHKLSYTVHSSIDSISMR 1507

Query: 520  WFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQ 579
             F IDP++G++ TA  LD+E + +  L ++  D   P   + A V V ++D ND+ P F 
Sbjct: 1508 KFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFT 1567

Query: 580  RTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVC 639
               Y AS+ E    G+  LQVTA D D G    L Y++ AG  ++G+  F+I+   G + 
Sbjct: 1568 NPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAG--NTGNM-FKIEPVLGIIT 1624

Query: 640  TTRTLDRDQGPSSFDFTVTAVDGGG--LKSMVYVKVFLSDENDNPPQFYPREYAASISAQ 697
              +  D       F  ++   D G   + +   V++ ++  +++ P+F  ++Y A ++  
Sbjct: 1625 ICKEPDMTT-MGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKDYQAEVNEN 1683

Query: 698  SPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQ 757
               GT+V+ + A      S   L Y +  G+   +FT++  SG++T    L     S  Q
Sbjct: 1684 VDIGTSVILISAI-----SQSTLIYEVKDGDINGIFTINPYSGVITTQKALDYERTSSYQ 1738

Query: 758  LEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNP 817
            L I A +  G+ +  +A V+I IV      P+F   QY  S+ E  AP  S+ +    N 
Sbjct: 1739 LIIQATNMAGMAS--NATVNIQIVDENDNAPVFLFSQYSGSLSE-AAPINSI-VRSLDNS 1794

Query: 818  P----------GRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGPV-LELEVR 866
            P           R A +   +     +  F++D+ +G ++T+  LD E +      + VR
Sbjct: 1795 PLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVR 1854

Query: 867  AGSGVPPAFAVARVRVLLD--DVNDNSPAFP-APEDTVLLPPNTAPGTPIYTLRALDPDS 923
              SG P   A + V V ++  DVNDN P F  A  +T+LL P T  G  +  + A DPDS
Sbjct: 1855 -DSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLP-TYVGVEVLKVSATDPDS 1912

Query: 924  GVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFR 983
             V   +T++L+ G    F +D  +G + +      +    H + +     G    TS   
Sbjct: 1913 EVPPELTYSLMEGSLDHFLIDSNSGVLTIKNN---NLSKDHYMLIVKVSDGKFYSTS--M 1967

Query: 984  LRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPD-GGPITYHLAAEGAS 1042
            + ++V++    GL   F    Y   +    T  T+V  V A       P+ Y +   G  
Sbjct: 1968 VTIMVKEAMDSGL--HFTQSFYSTSISENNTNITKVAIVNAVGNRLNEPLKYSILNPG-- 2023

Query: 1043 SPFGLEPQSGWLWVRAA-LDREAQELYILKVMAVSGSKAELGQ-QTGTATVRVSILNQNE 1100
            + F ++  SG +       DRE QELY L V A      EL   +     VRV+I + N+
Sbjct: 2024 NKFKIKSTSGVIQTTGVPFDREEQELYELVVEA----SRELDHLRVARVVVRVNIEDIND 2079

Query: 1101 HSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQT 1160
            +SP     P + AV  +  PGT + +V A D+D GPNG +TY LQ   +D   F I+P +
Sbjct: 2080 NSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEVTYVLQ---DDYGHFEINPNS 2136

Query: 1161 GEVTTLQTLDREQQS-SYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAG 1219
            G V   +  + +  +  Y + +  +DGG P  ST+  V + +  +N   P F +    A 
Sbjct: 2137 GNVILKEAFNSDLSNIEYGVTILAKDGGKPSLSTS--VELPITIVNKAMPVFDKPFYTAS 2194

Query: 1220 GGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHSGELLTAAPL 1279
                  V + +   T + ++ A  P EG+ G I   + G   + F++   +G L   +PL
Sbjct: 2195 ------VNEDIRMNTPILSINATSP-EGQ-GIIYIIIDGDPFKQFNIDFDTGVLKVVSPL 2246

Query: 1280 IRAERPHYVLTLSAHDQGSPPRS-ASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLT 1338
                   Y LT+ A D  +  R+  ++ LLV             D+ +  P    P   T
Sbjct: 2247 DYEVTSAYKLTIRASDALTGARAEVTVDLLVN------------DVNDNPPIFDQPTYNT 2294

Query: 1339 VTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGT--FALDAASGRLYLARPLDF 1396
              +   L    +L  V+    +    + +  +       T  F +D++SG +  AR LD 
Sbjct: 2295 TLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDH 2354

Query: 1397 EAGPPWRALTVRAEGPGGAG-ARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAAL 1455
            E       L VR+   G    +  + V + + D N++ P F +      + E    G  +
Sbjct: 2355 ELVQHC-TLKVRSIDSGFPSLSSEVLVHIYISDVNDNPPVFNQLIYESYVSELAPRGHFV 2413

Query: 1456 YTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEA 1515
               +ASDAD    +  + Y +L        L +D+++G ++      +   P   L V  
Sbjct: 2414 TCVQASDADSSDFDR-LEYSILSGNDRTSFL-MDSKSGVITLSNHRKQRMEPLYSLNVSV 2471

Query: 1516 TDRPANASRRRAARVSARVFVTDENDNAPVFASPSRV-RLPEDQPPGPAALHVVARDPDL 1574
            +D    ++    A+V  RV     N  +P F+  + V  + E+   G   +HV A D D 
Sbjct: 2472 SDGLFTST----AQVHIRVL--GANLYSPAFSQSTYVAEVRENVAAGTKVIHVRATDGDP 2525

Query: 1575 GEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQV 1634
            G   ++SY + +       L  S G +     LDRE   E  +++         R+    
Sbjct: 2526 GTYGQISYAIINDFAKDRFLIDSNGQVITTERLDRENPLEGDVSIFVRALDGGGRTTFCT 2585

Query: 1635 LTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSESF 1694
            + V V D ND AP F   EY   +R +   G  +  ++A DPD GAN ++TY   S  S 
Sbjct: 2586 VRVIVVDENDNAPQFMTVEYRASVRADVGRGHLVTQVQAIDPDDGANSRITYSLYSEASV 2645

Query: 1695 S------LDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHA 1748
            S      +DPD G + T    ++ +   ++  V A D G P + + + V + V       
Sbjct: 2646 SVADLLEIDPDNGWMVTKGNFNQLKNTVLSFFVKAVDGGIPVKHSLIPVYIHVLPPETFL 2705

Query: 1749 PTFGSAHLSLEVPE----GQDPQTLTMLRASDPDVGA-NGQLQYRILDGDPSGAFVLDLA 1803
            P+F  +  S  + E    G    TL +L + +      NG+      + +  G FV++  
Sbjct: 2706 PSFTQSQYSFTIAEDTAIGSTVDTLRILPSQNVWFSTVNGERP----ENNKGGIFVIEQE 2761

Query: 1804 SGEFGTMRPLDREVEPAFQLRIEARDG-GQPALSATLLLTVTVLDANDHAPAFPVPAYSV 1862
            +G     + LDRE  PAF  ++ A     +  +  T+ + + VLD ND+ P F   +Y  
Sbjct: 2762 TGTIKLDKRLDRETSPAFHFKVAATIPLDKVDIVFTVDVDIKVLDLNDNKPVFETSSYDT 2821

Query: 1863 EVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAG-----AFLLEPSSGELRTAAAL 1917
             + E +P GT L Q++A D D GANG VTY L + +       AF ++ ++G + T   L
Sbjct: 2822 IIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKDL 2881

Query: 1918 DREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFS 1977
            D E  P++TFSV A D   A  LS+T  V++ V D+ND+AP F     R  +    P   
Sbjct: 2882 DHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAQEVYRGNVKESDP--- 2938

Query: 1978 TPTLALATLRAEDRDAG-ANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDR-- 2034
             P   +A L   DRD    N  + Y + G  P G       G ++         P DR  
Sbjct: 2939 -PGEVVAVLSTWDRDTSDVNRQVSYHITGGNPRGRFA---LGLVQSEWKVYVKRPLDREE 2994

Query: 2035 ----VLFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSP 2090
                 L I ATD G     A  ++ V +    +  P   + +  A + E+ P    I+  
Sbjct: 2995 QDIYFLNITATD-GLFVTQA--MVEVSVSDVNDNSPVCDQVAYTALLPEDIPSNKIILKV 3051

Query: 2091 RAVHAG-GTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQA-ES 2148
             A  A  G+NG I YS L G+    F + P +G +   +   LD E  P   L+ +A + 
Sbjct: 3052 SAKDADIGSNGYIRYS-LYGSGNSEFFLDPESGELKTLAL--LDRERIPVYSLMAKATDG 3108

Query: 2149 GGAFAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISY 2208
            GG F  + + L L+D NDN P F   HY   + E+   +  L +V+A D D G   ++ Y
Sbjct: 3109 GGRFCQSNIHLILEDVNDNPPVFSSDHYNTCVYENTATKALLTRVQAVDPDIGINRKVVY 3168

Query: 2209 SLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRG-SPALVGSATLTVMV 2267
            SLA S  A G+F +D ++G I     LDRE  +   + + ATD+    +L    T+T+ V
Sbjct: 3169 SLADS--AGGVFSIDSSSGIIILEQPLDREQQSSYNISVRATDQSPGQSLSSLTTVTITV 3226

Query: 2268 IDTNDNRPTIPQ-PWELRVSEDALLGSEIAQV--TGNDVDSGPVLWYVLSPSGPQDPFSV 2324
            +D NDN P   +  + + V ED   G+++  V  T  D+ +   + Y++     Q  F +
Sbjct: 3227 LDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRSGNEQGKFKI 3286

Query: 2325 GRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGR---ANLTVLVEDVNDNAPAFSQSLY 2381
                G +S++  LD+E C R+ L + A DG        A + + + DVNDN P FSQ +Y
Sbjct: 3287 NPKTGGISVSEVLDYELCKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDVY 3346

Query: 2382 QVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPA--DGFSVDPNNGTLFTIVGTVA 2439
              ++ E    G +++ + A D DS  NG I + + +    + F+VDP    L  +     
Sbjct: 3347 SAVISEDALVGDSVILLIAEDVDSQPNGQIHFSIVNGDRDNEFTVDP---VLGLVKVKKK 3403

Query: 2440 LGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGS 2499
            L  +      ++++A D G P  ++ ATV++ + D ND++P FT ++Y   + E+ P G+
Sbjct: 3404 LDRERVSGYSLLVQAVDSGIPAMSSTATVNIDISDVNDNSPVFTPANYTAVIQENKPVGT 3463

Query: 2500 TLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEP 2559
            ++L L  TD D   +     +SI+SGN    F L+P                G L     
Sbjct: 3464 SILQLVVTDRDSFHNGPPFSFSILSGNEEEEFVLDPH---------------GILRSAVV 3508

Query: 2560 LDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGA 2619
                   +Y L V A D G+P Q S   + V V++ + + P        +   ED   G 
Sbjct: 3509 FQHTESLEYVLCVQAKDSGKPQQVSHTYIRVRVIEESTHKPTAIPLEIFIVTMEDDFPGG 3568

Query: 2620 ELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALD 2666
             +  + A+D D   + ++ F + S +   LF+++   G +     LD
Sbjct: 3569 VIGKIHATDQD--MYDVLTFALKS-EQKSLFKVNSHDGKIIALGGLD 3612



 Score =  724 bits (1868), Expect = 0.0
 Identities = 777/2937 (26%), Positives = 1245/2937 (42%), Gaps = 243/2937 (8%)

Query: 48   DLQIDEEQPAGTLIGDISAGLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVL 107
            D+ I E  P G ++  +     +     + Y +S  E +       I+  SG++ TAR L
Sbjct: 382  DVSISEFSPPGVVVAIVKL---SPEPIDVEYKLSPGEDA---VYFKINPRSGLIVTARPL 435

Query: 108  DREQRDRYRFTAVTPDG-ATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEP 166
            +  +++ Y+      +G    +VT+ + D NDH P F Q      V E    GT      
Sbjct: 436  NTVKKEVYKLEVTNKEGDLKAQVTISIEDANDHTPEFQQPLYDAYVNESVPVGTSVLTVS 495

Query: 167  ARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSH-YMLQL 225
            A D D G  G   Y+++         L   P         +  T ELD E+    Y   +
Sbjct: 496  ASDKDKGENGYITYSIAS--------LNLLPFVINQFTGVISTTEELDFESSPEIYRFIV 547

Query: 226  EAYDGGSPPRR-AQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADA 284
             A D GSP R  ++  + + + ++ND++P F +     V+S     G  +  V A D D 
Sbjct: 548  RASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGHITAVSAIDIDE 607

Query: 285  GVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFE--QRRVHELVVQARDGG---- 338
                 V Y+I      G   F ++  +G+LQL++ L     +     L + A DG     
Sbjct: 608  --LELVKYKIISGNELGF--FYLNPDSGVLQLKKSLTNSGIKNGNFALRITATDGENLAD 663

Query: 339  --------AHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQ---------------- 374
                     H ++ S   +              +I   A+G                   
Sbjct: 664  PMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINRQGP 723

Query: 375  -----------VSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYL 423
                       V E  P G  + +I   D D G    V  ++  G      +  D     
Sbjct: 724  YFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSCFNI-DMETGQ 782

Query: 424  VCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLP 483
            + V   +DRE  D Y L +T  D G+P   +     ++V D NDN+P F +  Y    L 
Sbjct: 783  LKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILE 842

Query: 484  EVALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQ 543
               + G+ +++V ARD D G+NG+VTYS+     T  F+I+ ++GI+  A  LD E +  
Sbjct: 843  SSGI-GTEIIQVEARDKDLGSNGEVTYSVL--TDTQQFAINSSTGIVYVADQLDRESKAN 899

Query: 544  PQLIVVATDGGLP--PLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVT 601
              L + A D       L S  T+ V L DVND  P F  + Y+  + E    GT    + 
Sbjct: 900  YSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLE 959

Query: 602  ATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVD 661
              D D G  G + YSL           F ID  SG +  ++ LD ++    ++ TV A D
Sbjct: 960  THDPDLGLGGQVRYSLVNDYNGR----FEIDKASGAIRLSKELDYEK-QQFYNLTVRAKD 1014

Query: 662  GG---GLKSMVYVKVFLSDENDN--PPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGS 716
             G    L S+ +V+V + D N+N   P F       S+   S  GT+VL++ A D D G 
Sbjct: 1015 KGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGR 1074

Query: 717  HGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARV 776
             G + Y I  G+    F++D++SG++T A  L R       L + A D G +    +  V
Sbjct: 1075 DGEIQYSIRDGSGLGRFSIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLYSTIEV 1134

Query: 777  DISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPPGRL-APVTLSLSGGDPRG 835
             I +       P+  +  Y   V E+     SV  +QA +P       +T  ++ G+P+ 
Sbjct: 1135 YIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQN 1194

Query: 836  LFSLDAVSGLLQTL-RPLDRELLGP-VLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPA 893
             F+++  +GL+ T  R LDRE      LE+ V  G   P    +  V  +LD+ NDN P 
Sbjct: 1195 FFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDE-NDNKPQ 1253

Query: 894  FPAPEDTVLLPPNTAP--GTPIYTLRALDPDSGVNSRVTFTLLAGGG-GAFTVDPTTGHV 950
            FP     + LP       G PIY   A D D G N+ ++++++ G   G F +DP TG V
Sbjct: 1254 FPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMV 1313

Query: 951  RLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVV-VQDVGTRGLAPRFNSPTYRVDL 1009
               +    + G    L ++A D G P ++S  RL +  ++      +   F+ P Y   +
Sbjct: 1314 SSRKQF--TAGSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFYNFTV 1371

Query: 1010 PSGTTAGTQVLQVQAQAPDGGPITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYI 1069
                   T+++ V +  P   P+ + +      S F  E   G + +   LD E + +Y 
Sbjct: 1372 MESDRV-TEIVGVVSVQPANTPLWFDIVGGNFDSAFDAEKGVGTIVIAKPLDAEQRSIYN 1430

Query: 1070 LKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFA 1129
            + V    G+   + Q      V + +L+ N++ P  S+    + ++E+  P T + ++ A
Sbjct: 1431 MSVEVTDGTNVAVTQ------VFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIEA 1484

Query: 1130 TDRDSGPNGRLTYSLQQL--SEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGG 1187
            TDRD     +L+Y++     S   + FRI P TG + T + LD E Q  + L + V+D  
Sbjct: 1485 TDRDE--KHKLSYTVHSSIDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQE 1542

Query: 1188 SPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEG 1247
             P R     V V V D ND+SP F      A       V +    G+ V  + A D D+G
Sbjct: 1543 FPYRRNLARVIVNVEDANDHSPYFTNPLYEAS------VFESAALGSAVLQVTALDKDKG 1596

Query: 1248 ENGTILYTL-TGPGSELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQ 1306
            EN  ++YT+  G    +F + P  G +             +VL++   DQGSPP SA+  
Sbjct: 1597 ENAELIYTIEAGNTGNMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAI 1656

Query: 1307 LLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALT 1366
            + + V  S       P    +D  A V         E +  G+   SV          L 
Sbjct: 1657 VRISVTMSDN---SHPKFIHKDYQAEVN--------ENVDIGT---SVILISAISQSTLI 1702

Query: 1367 YTLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQV 1426
            Y +  G D  G F ++  SG +   + LD+E    ++ L ++A    G  +    V +Q+
Sbjct: 1703 YEVKDG-DINGIFTINPYSGVITTQKALDYERTSSYQ-LIIQATNMAGMASNAT-VNIQI 1759

Query: 1427 QDENEHAPAFARDPLALALPENPEPGAALYTF-------RASDADGPGPNSDVRYRLLRQ 1479
             DEN++AP F     + +L E     + + +        RA+DAD    N+ + Y+++ +
Sbjct: 1760 VDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADS-NRNALLVYQIV-E 1817

Query: 1480 EPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDE 1539
                    +D+ TGA+     LD ET       V   D   +      + V   + VTD 
Sbjct: 1818 STAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDS-GSPQLTAESPVEVNIEVTDV 1876

Query: 1540 NDNAPVFASP---SRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGHFRLHS 1596
            NDN PVF      + + LP     G   L V A DPD      ++Y L  G   HF + S
Sbjct: 1877 NDNPPVFTQAVFETILLLPTYV--GVEVLKVSATDPDSEVPPELTYSLMEGSLDHFLIDS 1934

Query: 1597 STGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSV 1656
            ++G L++    +     +H + +V    G     +T ++T+ V +  D    F Q  YS 
Sbjct: 1935 NSGVLTIK---NNNLSKDHYMLIVKVSDGK--FYSTSMVTIMVKEAMDSGLHFTQSFYST 1989

Query: 1657 LLRENNPPGTSLLTLRATDPDVGANGQVTYGGVS-SESFSLDPDTGVL-TTLRALDREEQ 1714
             + ENN   T +  + A    +  N  + Y  ++    F +   +GV+ TT    DREEQ
Sbjct: 1990 SISENNTNITKVAIVNAVGNRL--NEPLKYSILNPGNKFKIKSTSGVIQTTGVPFDREEQ 2047

Query: 1715 EEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQTLT-MLR 1773
            E   L V A       ++  V VRV +ED ND++P F        V    +P TL   + 
Sbjct: 2048 ELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVDAEPGTLIYQVT 2107

Query: 1774 ASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPA-FQLRIEARDGGQ 1832
            A D D G NG++ Y + D    G F ++  SG        + ++    + + I A+DGG+
Sbjct: 2108 AIDKDKGPNGEVTYVLQDD--YGHFEINPNSGNVILKEAFNSDLSNIEYGVTILAKDGGK 2165

Query: 1833 PALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTY 1892
            P+LS ++ L +T++  N   P F  P Y+  V ED+   T +L + A  P+    G +  
Sbjct: 2166 PSLSTSVELPITIV--NKAMPVFDKPFYTASVNEDIRMNTPILSINATSPEG--QGIIYI 2221

Query: 1893 YLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRD 1952
             +       F ++  +G L+  + LD E   +Y  ++ A D         TV   + V D
Sbjct: 2222 IIDGDPFKQFNIDFDTGVLKVVSPLDYEVTSAYKLTIRASDALTGARAEVTVD--LLVND 2279

Query: 1953 VNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTT 2012
            VND+ P F        L        TP L + ++   D D+  N  + Y++       T 
Sbjct: 2280 VNDNPPIFDQPTYNTTLSEAS-LIGTPVLQVVSI---DADSENNKMVHYQIVQDTYNSTD 2335

Query: 2013 ---VDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRFP 2069
               +DS +G I  AR       +   L + + D G P+ S+  ++ + +    +  P F 
Sbjct: 2336 YFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPSLSSEVLVHIYISDVNDNPPVFN 2395

Query: 2070 RASSEATIRENAPPGTPIVSPRAVHAGGTN-GPITYSILSGNEKGTFSIQPSTGAITVRS 2128
            +   E+ + E AP G  +   +A  A  ++   + YSILSGN++ +F +   +G IT+ +
Sbjct: 2396 QLIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGVITLSN 2455

Query: 2129 AEGLDFEVSPRLRLVLQAESGGAFAFTV-LTLTLQDANDNAPRFLRPHYVAFLPESRPLE 2187
                  E    L + +   S G F  T  + + +  AN  +P F +  YVA + E+    
Sbjct: 2456 HRKQRMEPLYSLNVSV---SDGLFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENVAAG 2512

Query: 2188 GPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDRE--IWAETRL 2245
              ++ V A D D G+ GQISY++  +  A+  F +D + G + TT  LDRE  +  +  +
Sbjct: 2513 TKVIHVRATDGDPGTYGQISYAII-NDFAKDRFLID-SNGQVITTERLDRENPLEGDVSI 2570

Query: 2246 VLMATDRGSPALVGSATLTVMVIDTNDNRPT-IPQPWELRVSEDALLGSEIAQVTGNDVD 2304
             + A D G        T+ V+V+D NDN P  +   +   V  D   G  + QV   D D
Sbjct: 2571 FVRALDGGGRTTF--CTVRVIVVDENDNAPQFMTVEYRASVRADVGRGHLVTQVQAIDPD 2628

Query: 2305 SGP---VLWYVLSPSGPQ--DPFSVGRYGGRVSLTGPLDFEQCDRYQLQLL--AHDGPHE 2357
             G    + + + S +     D   +    G +   G  +F Q     L     A DG   
Sbjct: 2629 DGANSRITYSLYSEASVSVADLLEIDPDNGWMVTKG--NFNQLKNTVLSFFVKAVDGGIP 2686

Query: 2358 GRANLTVLVEDV---NDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYH 2414
             + +L  +   V       P+F+QS Y   + E T  GS + ++      +         
Sbjct: 2687 VKHSLIPVYIHVLPPETFLPSFTQSQYSFTIAEDTAIGSTVDTLRILPSQNV-------- 2738

Query: 2415 LASPADGFSVDPNNGTLFTI---VGTVALGHDGSGAVDVVLEARDHGAPGRAARAT---- 2467
              S  +G   + N G +F I    GT+ L        D  L+     A      AT    
Sbjct: 2739 WFSTVNGERPENNKGGIFVIEQETGTIKL--------DKRLDRETSPAFHFKVAATIPLD 2790

Query: 2468 ---------VHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAV 2518
                     V +++ D ND+ P F  S Y   + E +P G+ L  + A D D   ++  V
Sbjct: 2791 KVDIVFTVDVDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAIDMDWG-ANGQV 2849

Query: 2519 DYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRG 2578
             YS+ S +       +P       +        G +  L+ LD E+   +  +V A+D G
Sbjct: 2850 TYSLHSDS-------QPEKVMEAFNIDSNT---GWISTLKDLDHETDPTFTFSVVASDLG 2899

Query: 2579 QP-PQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGP-HGL 2636
            +    SS   V+V V D+NDN PVF +  YR  V E  P G  +  +   D D    +  
Sbjct: 2900 EAFSLSSTALVSVRVTDINDNAPVFAQEVYRGNVKESDPPGEVVAVLSTWDRDTSDVNRQ 2959

Query: 2637 VRFTVSSGDPSGLFELD--ESSGTLRLAHALDCETQARHQLVVQAADPAGAHFALAPVTI 2694
            V + ++ G+P G F L   +S   + +   LD E Q  + L + A D  G     A V +
Sbjct: 2960 VSYHITGGNPRGRFALGLVQSEWKVYVKRPLDREEQDIYFLNITATD--GLFVTQAMVEV 3017

Query: 2695 EVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEG 2754
             V DVND+ P       +  + E+ P   ++  + A D D G+ G +RYSL  +G     
Sbjct: 3018 SVSDVNDNSPVCDQVAYTALLPEDIPSNKIILKVSAKDADIGSNGYIRYSLYGSG----- 3072

Query: 2755 REAFALNSSTGELRARVPFDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYDPVFL 2814
               F L+  +GEL+     D E    + L+  A D G       + +++   ++  PVF 
Sbjct: 3073 NSEFFLDPESGELKTLALLDRERIPVYSLMAKATDGGGRFCQSNIHLILEDVNDNPPVFS 3132

Query: 2815 APAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSS-PYFGINQTTGALYL 2870
            +  ++  V E       L  VQA D D G +  V+YSLA S+   F I+ ++G + L
Sbjct: 3133 SDHYNTCVYENTATKALLTRVQAVDPDIGINRKVVYSLADSAGGVFSIDSSSGIIIL 3189



 Score =  721 bits (1860), Expect = 0.0
 Identities = 751/2893 (25%), Positives = 1251/2893 (43%), Gaps = 267/2893 (9%)

Query: 106  VLDREQRDRYRFT---AVTPDG--ATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGT 160
            +L+RE +D Y      +V  +   A  +V ++V D+ND  P F     ++ + E T   T
Sbjct: 116  ILNREIQDNYLLIVKGSVRGEDLEAWTKVNIQVLDMNDLRPLFSPTTYSVTIAESTPLRT 175

Query: 161  RYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSH 220
                  A DAD G  G   Y        + F +    G        + ++G L+ + ++ 
Sbjct: 176  SVAQVTATDADIGSNGEFYYYFKNKV--DLFSVHPTSGV-------ISLSGRLNYDEKNR 226

Query: 221  YMLQLEAYDGG-----SPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVL 275
            Y L++ A D G     +    + A L V +  IN+HAP  +   +   V  SL       
Sbjct: 227  YDLEILAVDRGMKLYGNNGVSSTAKLYVHIERINEHAPTIHVVTH---VPFSLEKEPTYA 283

Query: 276  QVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGL----LQLERPLDFEQRRV-HEL 330
             V   D D G NG +           D  F       L    ++  + +D+E     + L
Sbjct: 284  VVTVDDLDDGANGEIESVSIVAGDPLDQFFLAKEGKWLNEYKIKERKQIDWESFPYGYNL 343

Query: 331  VVQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISV 390
             +QA+D G+ P+  SA   V++   N  + ++ + F        +SE +PPG +VA + +
Sbjct: 344  TLQAKDKGS-PQKCSALKAVYI--GNPTRDTVPIRFEKEVYDVSISEFSPPGVVVAIVKL 400

Query: 391  SDPDDGDFAHVNVSLEGGEG--HFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSG 448
            S P+  D   V   L  GE   +F ++ +     L+  AR L+  +++ Y L VT  +  
Sbjct: 401  S-PEPID---VEYKLSPGEDAVYFKINPRSG---LIVTARPLNTVKKEVYKLEVTNKEGD 453

Query: 449  SPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQV 508
                  +A   + + D ND+ P F + LY       V + G+ V+ V+A D D+G NG +
Sbjct: 454  -----LKAQVTISIEDANDHTPEFQQPLYDAYVNESVPV-GTSVLTVSASDKDKGENGYI 507

Query: 509  TYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQP-QLIVVATDGGLPPL-ASSATVSV 566
            TYS+A   +   F I+  +G+I+T   LD+E  P+  + IV A+D G P    S   V++
Sbjct: 508  TYSIA-SLNLLPFVINQFTGVISTTEELDFESSPEIYRFIVRASDWGSPYRHESEVNVTI 566

Query: 567  ALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAG--LGSS 624
             + +VNDN P F++      +      G     V+A D D     L+ Y + +G  LG  
Sbjct: 567  RIGNVNDNSPLFEKVACQGVISYDFPVGGHITAVSAIDIDE--LELVKYKIISGNELGF- 623

Query: 625  GSPPFRIDAHSGDVCTTRTLDRDQGPS-SFDFTVTAVDGGGLKSMVYVKV---------- 673
                F ++  SG +   ++L      + +F   +TA DG  L   + + +          
Sbjct: 624  ----FYLNPDSGVLQLKKSLTNSGIKNGNFALRITATDGENLADPMSINISVLHGKVSSK 679

Query: 674  -----------------------------------FLSDENDNPPQFYPREYAASISAQS 698
                                               F S     P  ++ + + + ++ + 
Sbjct: 680  SFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINRQGP--YFDKSFPSDVAVKE 737

Query: 699  --PPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVV 756
              P G  +L+++A+D D G +G++ + I  GN+   F +D ++G L V  P+ R    + 
Sbjct: 738  DLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMETGQLKVLMPMDREHTDLY 797

Query: 757  QLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHN 816
             L I   D G  Q      + I++       P+F Q  Y  ++ E    GT +  V+A +
Sbjct: 798  LLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARD 857

Query: 817  PP-GRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGPV-LELEVR--AGSGVP 872
               G    VT S+     +  F++++ +G++     LDRE      L++E R  A SG  
Sbjct: 858  KDLGSNGEVTYSVLTDTQQ--FAINSSTGIVYVADQLDRESKANYSLKIEARDKAESG-Q 914

Query: 873  PAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFT 932
              F+V  ++V LDDVND SPAF     +V +  +   GT I  L   DPD G+  +V ++
Sbjct: 915  QLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETHDPDLGLGGQVRYS 974

Query: 933  LLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFR-LRVVVQDV 991
            L+    G F +D  +G +RL + L       + L + A+D G P   S    + V V DV
Sbjct: 975  LVNDYNGRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDV 1034

Query: 992  GTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGG---PITYHLAAEGASSPFGLE 1048
                  P F        +   +  GT VLQV A+  D G    I Y +        F ++
Sbjct: 1035 NENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFSID 1094

Query: 1049 PQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSED 1108
             +SG +     LDRE    Y L V A       L     T  V + + + N+++P  SE 
Sbjct: 1095 DESGVITAADILDRETMGSYWLTVYATDRGVVPL---YSTIEVYIEVEDVNDNAPLTSEP 1151

Query: 1109 PTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTL-Q 1167
              +  V EN P   SV ++ A D DS  N +LTY +         F I+ +TG +TT  +
Sbjct: 1152 IYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITS-GNPQNFFAINIKTGLITTTSR 1210

Query: 1168 TLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVP 1227
             LDREQQ+ + L V V DGG  P+ +T  V V VLD NDN P F +          I++P
Sbjct: 1211 KLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKV------YQIKLP 1264

Query: 1228 --DRVPPGTLVTTLQAKDPDEGENGTILYTLT-GPGSELFSLHPHSGELLTAAPLIRAER 1284
              DR   G  +    A D DEG N  I Y++  G     F + P +G + +         
Sbjct: 1265 ERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQFTAGS- 1323

Query: 1285 PHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVL-----TV 1339
             + +LT+ A D G P +S++ +L ++ +      +PPP        +P+P+         
Sbjct: 1324 -YDILTIKAVDNGRPQKSSTARLHIEWIK-----KPPP--------SPIPLTFDEPFYNF 1369

Query: 1340 TAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAASGRLYLARPLDFEAG 1399
            T  E  R   ++G V+  +PA    L + +VGG + +  F  +   G + +A+PLD E  
Sbjct: 1370 TVMESDRVTEIVGVVSV-QPANT-PLWFDIVGG-NFDSAFDAEKGVGTIVIAKPLDAEQR 1426

Query: 1400 PPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFR 1459
              +    +  E   G    + +V ++V D N++ P F++    + + E+  P   +    
Sbjct: 1427 SIYN---MSVEVTDGTNVAVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIE 1483

Query: 1460 ASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRP 1519
            A+D D     S   +  +     +   R+D  TG L     LD E     +L +   D+ 
Sbjct: 1484 ATDRDEKHKLSYTVHSSI-DSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQE 1542

Query: 1520 ANASRRRAARVSARVFVTDENDNAPVFASPS-RVRLPEDQPPGPAALHVVARDPDLGEAA 1578
                RR  ARV   V V D ND++P F +P     + E    G A L V A D D GE A
Sbjct: 1543 F-PYRRNLARVI--VNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENA 1599

Query: 1579 RVSYRLASGGDGH-FRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTV 1637
             + Y + +G  G+ F++    G +++ +  D     + VL++  +D GSPP SAT ++ +
Sbjct: 1600 ELIYTIEAGNTGNMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRI 1659

Query: 1638 SVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSESFSLD 1697
            SV   ++  P F  ++Y   + EN   GTS++ + A         +V  G ++   F+++
Sbjct: 1660 SVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAISQSTLIY-EVKDGDING-IFTIN 1717

Query: 1698 PDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLS 1757
            P +GV+TT +ALD E      L + A +       ++ TV + + DEND+AP F  +  S
Sbjct: 1718 PYSGVITTQKALDYERTSSYQLIIQATNMAG--MASNATVNIQIVDENDNAPVFLFSQYS 1775

Query: 1758 LEVPEGQDPQTLT--------MLRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGT 1809
              + E     ++         ++RA+D D   N  L Y+I++      F +D ++G   T
Sbjct: 1776 GSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAIRT 1835

Query: 1810 MRPLDREVEPAFQLRIEARDGGQPALSAT--LLLTVTVLDANDHAPAFPVPAYSVEVPED 1867
            +  LD E    F   +  RD G P L+A   + + + V D ND+ P F    +   +   
Sbjct: 1836 IANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLP 1895

Query: 1868 VPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGELRTAAA-LDREQCPSYT 1926
               G  +L++ A DPD+     +TY L  G+   FL++ +SG L      L ++    Y 
Sbjct: 1896 TYVGVEVLKVSATDPDSEVPPELTYSLMEGSLDHFLIDSNSGVLTIKNNNLSKDH---YM 1952

Query: 1927 FSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATL 1986
              V   DG       +T  VTI V++  D    F  S     +     + +   +  A  
Sbjct: 1953 LIVKVSDGK----FYSTSMVTIMVKEAMDSGLHFTQSFYSTSISENNTNITKVAIVNAVG 2008

Query: 1987 RAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRP 2046
                     N  + Y +   P     + S +G I+    P      ++ L+ +  +  R 
Sbjct: 2009 NR------LNEPLKYSILN-PGNKFKIKSTSGVIQTTGVP--FDREEQELYELVVEASRE 2059

Query: 2047 A---RSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHAG-GTNGPI 2102
                R A  V+ V ++   +  P F      A ++ +A PGT I    A+    G NG +
Sbjct: 2060 LDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEV 2119

Query: 2103 TYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFTVLTLTLQ 2162
            TY +   ++ G F I P++G + ++ A   D         +L  + G     T + L + 
Sbjct: 2120 TYVLQ--DDYGHFEINPNSGNVILKEAFNSDLSNIEYGVTILAKDGGKPSLSTSVELPIT 2177

Query: 2163 DANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHV 2222
              N   P F +P Y A + E   +  P+L + A    +G G  I Y +    P +  F++
Sbjct: 2178 IVNKAMPVFDKPFYTASVNEDIRMNTPILSINATS-PEGQG--IIYIIIDGDPFKQ-FNI 2233

Query: 2223 DPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGS---ATLTVMVIDTNDNRPTIPQ 2279
            D  TG +   + LD E+ +  +L + A+D    AL G+    T+ ++V D NDN P   Q
Sbjct: 2234 DFDTGVLKVVSPLDYEVTSAYKLTIRASD----ALTGARAEVTVDLLVNDVNDNPPIFDQ 2289

Query: 2280 P-WELRVSEDALLGSEIAQVTGNDVDS--GPVLWY--VLSPSGPQDPFSVGRYGGRVSLT 2334
            P +   +SE +L+G+ + QV   D DS    ++ Y  V       D F +    G +   
Sbjct: 2290 PTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTA 2349

Query: 2335 GPLDFEQCDRYQLQLLAHDGPHEGRAN---LTVLVEDVNDNAPAFSQSLYQVMLLEHTPP 2391
              LD E      L++ + D      ++   + + + DVNDN P F+Q +Y+  + E  P 
Sbjct: 2350 RMLDHELVQHCTLKVRSIDSGFPSLSSEVLVHIYISDVNDNPPVFNQLIYESYVSELAPR 2409

Query: 2392 GSAILSVSATDRDSGANGHISYHLASPAD--GFSVDPNNGTLFTIVGTVALGHDGSGAVD 2449
            G  +  V A+D DS     + Y + S  D   F +D  +G        + L +     ++
Sbjct: 2410 GHFVTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGV-------ITLSNHRKQRME 2462

Query: 2450 VVLEARDHGAPGR-AARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATD 2508
             +       + G   + A VH+++   N ++P+F+ S Y   V E++  G+ ++ + ATD
Sbjct: 2463 PLYSLNVSVSDGLFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVRATD 2522

Query: 2509 ADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQY 2568
             D   ++  + Y+II+      F  +  L ++           G ++  E LD E+  + 
Sbjct: 2523 GDPG-TYGQISYAIIND-----FAKDRFLIDSN----------GQVITTERLDRENPLEG 2566

Query: 2569 NLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASD 2628
            ++++         +++   V V V+D NDN P F    YR +V  D   G  +  V+A D
Sbjct: 2567 DVSIFVRALDGGGRTTFCTVRVIVVDENDNAPQFMTVEYRASVRADVGRGHLVTQVQAID 2626

Query: 2629 ADPGPHGLVRFTV---SSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPA-G 2684
             D G +  + +++   +S   + L E+D  +G +      +          V+A D    
Sbjct: 2627 PDDGANSRITYSLYSEASVSVADLLEIDPDNGWMVTKGNFNQLKNTVLSFFVKAVDGGIP 2686

Query: 2685 AHFALAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYS 2744
               +L PV I V       P+F  +  S ++AE+   G+ V TL  +      F  +   
Sbjct: 2687 VKHSLIPVYIHVLPPETFLPSFTQSQYSFTIAEDTAIGSTVDTLRILPSQNVWFSTVN-- 2744

Query: 2745 LLEAGPGPEGREA--FALNSSTGELRARVPFDYEHTESFRLLVGAA---DAGNLSASVTV 2799
                G  PE  +   F +   TG ++     D E + +F   V A    D  ++  +V V
Sbjct: 2745 ----GERPENNKGGIFVIEQETGTIKLDKRLDRETSPAFHFKVAATIPLDKVDIVFTVDV 2800

Query: 2800 SVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSS--- 2856
             + V   ++  PVF   ++   + EG   G  L  V+A D D GA+G V YSL + S   
Sbjct: 2801 DIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPE 2860

Query: 2857 ---PYFGINQTTG 2866
                 F I+  TG
Sbjct: 2861 KVMEAFNIDSNTG 2873



 Score =  671 bits (1731), Expect = 0.0
 Identities = 648/2424 (26%), Positives = 1076/2424 (44%), Gaps = 200/2424 (8%)

Query: 533  AASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQ 592
            +A L+ E++    LIV  +  G   L +   V++ + D+ND  P F  T Y+ ++ E T 
Sbjct: 114  SAILNREIQDNYLLIVKGSVRG-EDLEAWTKVNIQVLDMNDLRPLFSPTTYSVTIAESTP 172

Query: 593  PGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSS 652
              T   QVTATDAD G  G   Y        +    F +   SG +  +  L+ D+  + 
Sbjct: 173  LRTSVAQVTATDADIGSNGEFYYYF-----KNKVDLFSVHPTSGVISLSGRLNYDE-KNR 226

Query: 653  FDFTVTAVDGG-------GLKSMVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVL 705
            +D  + AVD G       G+ S   + V +   N++ P  +   +    S +  P  AV+
Sbjct: 227  YDLEILAVDRGMKLYGNNGVSSTAKLYVHIERINEHAPTIHVVTHVP-FSLEKEPTYAVV 285

Query: 706  RLRAHDPDQGSHGRL-SYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIG--- 761
             +   D D G++G + S  I+AG+    F L ++   L       R+         G   
Sbjct: 286  TV--DDLDDGANGEIESVSIVAGDPLDQFFLAKEGKWLNEYKIKERKQIDWESFPYGYNL 343

Query: 762  ---AEDGGGLQAEPSARVDISIVPGTPTPPI-FEQLQYVFSVPEDVAPGTSVGIVQAHNP 817
               A+D G  Q   + +      P   T PI FE+  Y  S+ E   PG  V IV+    
Sbjct: 344  TLQAKDKGSPQKCSALKAVYIGNPTRDTVPIRFEKEVYDVSISEFSPPGVVVAIVKLSPE 403

Query: 818  PGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGPVLELEVRAGSGVPPAFAV 877
            P     V   LS G+    F ++  SGL+ T RPL+  +   V +LEV    G       
Sbjct: 404  P---IDVEYKLSPGEDAVYFKINPRSGLIVTARPLNT-VKKEVYKLEVTNKEGD----LK 455

Query: 878  ARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGG 937
            A+V + ++D ND++P F  P     +  +   GT + T+ A D D G N  +T+++ +  
Sbjct: 456  AQVTISIEDANDHTPEFQQPLYDAYVNESVPVGTSVLTVSASDKDKGENGYITYSIASLN 515

Query: 938  GGAFTVDPTTGHVRLMRPLGPSGGP-AHELELEARDGGSPPRTSHFRLRVVVQDVGTRGL 996
               F ++  TG +     L     P  +   + A D GSP R     + V ++       
Sbjct: 516  LLPFVINQFTGVISTTEELDFESSPEIYRFIVRASDWGSPYR-HESEVNVTIRIGNVNDN 574

Query: 997  APRFNSPTYRVDLPSGTTAGTQVLQVQA-QAPDGGPITYHLAAEGASSPFGLEPQSGWLW 1055
            +P F     +  +      G  +  V A    +   + Y + +      F L P SG L 
Sbjct: 575  SPLFEKVACQGVISYDFPVGGHITAVSAIDIDELELVKYKIISGNELGFFYLNPDSGVLQ 634

Query: 1056 VRAALDREA--QELYILKVMAVSGS----------------------------------- 1078
            ++ +L         + L++ A  G                                    
Sbjct: 635  LKKSLTNSGIKNGNFALRITATDGENLADPMSINISVLHGKVSSKSFSCRETRVAQKLAE 694

Query: 1079 ----KAELGQQTGTATVRVSILNQNEHSPRLSED-PTFLAVAENQPPGTSVGRVFATDRD 1133
                KA+   +       +   + N   P   +  P+ +AV E+ P G ++ ++ A D D
Sbjct: 695  KLLIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDAD 754

Query: 1134 SGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRST 1193
            SG NG++ +++   + DS  F I  +TG++  L  +DRE    Y L + + D G+P +S+
Sbjct: 755  SGFNGKVLFTISDGNTDS-CFNIDMETGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSS 813

Query: 1194 TGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTIL 1253
               + + V D NDNSP F+Q S        + + +    GT +  ++A+D D G NG + 
Sbjct: 814  WRLLTINVEDANDNSPVFIQDS------YSVNILESSGIGTEIIQVEARDKDLGSNGEVT 867

Query: 1254 YTLTGPGSELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLP 1313
            Y++    ++ F+++  +G +  A  L R  + +Y L + A D     ++ S Q L  V+ 
Sbjct: 868  YSVL-TDTQQFAINSSTGIVYVADQLDRESKANYSLKIEARD-----KAESGQQLFSVVT 921

Query: 1314 SARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEP-AGVGA-LTYTLVG 1371
                 +   D+ +  PA  +P   +V   E L  G+++  +   +P  G+G  + Y+LV 
Sbjct: 922  LKVFLD---DVNDCSPAF-IPSSYSVKVLEDLPVGTVIAWLETHDPDLGLGGQVRYSLVN 977

Query: 1372 GADPEGTFALDAASGRLYLARPLDFEAGPPWRALTVRAEGPGG----AGARLLRVQVQVQ 1427
              D  G F +D ASG + L++ LD+E    +  LTVRA+  G     +    + V+V   
Sbjct: 978  --DYNGRFEIDKASGAIRLSKELDYEK-QQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDV 1034

Query: 1428 DENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALR 1487
            +EN H P F    +  ++ EN   G ++    A D D  G + +++Y  +R    +    
Sbjct: 1035 NENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDS-GRDGEIQYS-IRDGSGLGRFS 1092

Query: 1488 LDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFA 1547
            +D  +G ++A   LDRET  +  L V ATDR         + +   + V D NDNAP+ +
Sbjct: 1093 IDDESGVITAADILDRETMGSYWLTVYATDRGVVP---LYSTIEVYIEVEDVNDNAPLTS 1149

Query: 1548 SPSRVR-LPEDQPPGPAALHVVARDPDLGEAARVSYRLASGG-DGHFRLHSSTGALSVV- 1604
             P     + E+ P   + + + A DPD     +++YR+ SG     F ++  TG ++   
Sbjct: 1150 EPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTS 1209

Query: 1605 RPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLL--RENN 1662
            R LDREQ+AEH L V  +D G  P+ +T  + V V D ND  P F ++ Y + L  R+  
Sbjct: 1210 RKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKVYQIKLPERDRK 1269

Query: 1663 PPGTSLLTLRATDPDVGANGQVTYG---GVSSESFSLDPDTGVLTTLRALDREEQEEINL 1719
              G  +    A D D G N +++Y    G     F +DP TG++++ +       +   L
Sbjct: 1270 KRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQFTAGSYD--IL 1327

Query: 1720 TVYAQDRGSPPQLTHVTVRVAVEDENDHAP-----TFGSAHLSLEVPEGQDPQTLTMLRA 1774
            T+ A D G P + +  T R+ +E      P     TF     +  V E      +  + +
Sbjct: 1328 TIKAVDNGRPQKSS--TARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEIVGVVS 1385

Query: 1775 SDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPA 1834
              P   AN  L + I+ G+   AF  +   G     +PLD E    + + +E  DG   A
Sbjct: 1386 VQP---ANTPLWFDIVGGNFDSAFDAEKGVGTIVIAKPLDAEQRSIYNMSVEVTDGTNVA 1442

Query: 1835 LSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYY- 1893
            ++      + VLD ND+ P F  P Y V + EDV   T +LQ++A D D       T + 
Sbjct: 1443 VTQVF---IKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIEATDRDEKHKLSYTVHS 1499

Query: 1894 -LGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVS-VTITVR 1951
             + + +   F ++PS+G L TA  LD E    +  ++   D     P    ++ V + V 
Sbjct: 1500 SIDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRD--QEFPYRRNLARVIVNVE 1557

Query: 1952 DVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLR--AEDRDAGANASILYRL-AGTPP 2008
            D NDH+P F T+PL          F +  L  A L+  A D+D G NA ++Y + AG   
Sbjct: 1558 DANDHSPYF-TNPL-----YEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTG 1611

Query: 2009 PGTTVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRF 2068
                ++   G I + + P        VL I  TD G P  SAT ++ + +       P+F
Sbjct: 1612 NMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKF 1671

Query: 2069 PRASSEATIRENAPPGTPIVSPRAVHAGGTNGPITYSILSGNEKGTFSIQPSTGAITVRS 2128
                 +A + EN   GT ++   A+    +   + Y +  G+  G F+I P +G IT + 
Sbjct: 1672 IHKDYQAEVNENVDIGTSVILISAI----SQSTLIYEVKDGDINGIFTINPYSGVITTQK 1727

Query: 2129 AEGLDFEVSPRLRLVLQAES-GGAFAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRP-- 2185
            A  LD+E +   +L++QA +  G  +   + + + D NDNAP FL   Y   L E+ P  
Sbjct: 1728 A--LDYERTSSYQLIIQATNMAGMASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPIN 1785

Query: 2186 -----LEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIW 2240
                 L+   L + A D D      + Y +  S  A+  F VD +TG I T A LD E  
Sbjct: 1786 SIVRSLDNSPLVIRATDADSNRNALLVYQIVES-TAKKFFTVDSSTGAIRTIANLDHETI 1844

Query: 2241 AETRLVLMATDRGSPALVGSA--TLTVMVIDTNDNRPTIPQP-WELRVSEDALLGSEIAQ 2297
            A     +   D GSP L   +   + + V D NDN P   Q  +E  +     +G E+ +
Sbjct: 1845 AHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLK 1904

Query: 2298 VTGNDVDS--GPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGP 2355
            V+  D DS   P L Y L   G  D F +    G +++    +    D Y L +   DG 
Sbjct: 1905 VSATDPDSEVPPELTYSLM-EGSLDHFLIDSNSGVLTIKN--NNLSKDHYMLIVKVSDGK 1961

Query: 2356 HEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHL 2415
                + +T++V++  D+   F+QS Y   + E+    + +  V+A    +  N  + Y +
Sbjct: 1962 FYSTSMVTIMVKEAMDSGLHFTQSFYSTSISENNTNITKVAIVNAV--GNRLNEPLKYSI 2019

Query: 2416 ASPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQ 2475
             +P + F +   +G + T    V    +     ++V+EA       R AR  V V ++D 
Sbjct: 2020 LNPGNKFKIKSTSGVIQTT--GVPFDREEQELYELVVEASRELDHLRVARVVVRVNIEDI 2077

Query: 2476 NDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEP 2535
            ND++P F    Y  AV  D  PG+ +  + A D D    +  V Y ++  ++G  F++ P
Sbjct: 2078 NDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKD-KGPNGEVTY-VLQDDYGH-FEINP 2134

Query: 2536 RLAEAGESAGPGPRALGCLVLLEPLDFE-SLTQYNLTVAAADRGQPPQSSVVPVTVTVLD 2594
                            G ++L E  + + S  +Y +T+ A D G+P  S+ V + +T+  
Sbjct: 2135 N--------------SGNVILKEAFNSDLSNIEYGVTILAKDGGKPSLSTSVELPITI-- 2178

Query: 2595 VNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDE 2654
            VN   PVF +  Y  +V ED  +   +L + A+   P   G++ + +  GDP   F +D 
Sbjct: 2179 VNKAMPVFDKPFYTASVNEDIRMNTPILSINAT--SPEGQGII-YIIIDGDPFKQFNIDF 2235

Query: 2655 SSGTLRLAHALDCETQARHQLVVQAADPAGAHFALAPVTIEVQDVNDHGPAFPLNLLSTS 2714
             +G L++   LD E  + ++L ++A+D      A   V + V DVND+ P F     +T+
Sbjct: 2236 DTGVLKVVSPLDYEVTSAYKLTIRASDALTGARAEVTVDLLVNDVNDNPPIFDQPTYNTT 2295

Query: 2715 VAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFD 2774
            ++E    GT V  + +ID D+     + Y +++        + F ++SS+G +      D
Sbjct: 2296 LSEASLIGTPVLQVVSIDADSENNKMVHYQIVQ--DTYNSTDYFHIDSSSGLILTARMLD 2353

Query: 2775 YEHTESFRLLVGAADAG--NLSASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSL 2832
            +E  +   L V + D+G  +LS+ V V + ++  ++  PVF    +   V E A RGH +
Sbjct: 2354 HELVQHCTLKVRSIDSGFPSLSSEVLVHIYISDVNDNPPVFNQLIYESYVSELAPRGHFV 2413

Query: 2833 GHVQATDEDGGADGLVLYSLATSS 2856
              VQA+D D      + YS+ + +
Sbjct: 2414 TCVQASDADSSDFDRLEYSILSGN 2437



 Score =  562 bits (1448), Expect = e-159
 Identities = 582/2107 (27%), Positives = 931/2107 (44%), Gaps = 215/2107 (10%)

Query: 876  AVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLA 935
            A  +V + + D+ND  P F     +V +  +T   T +  + A D D G N    +    
Sbjct: 140  AWTKVNIQVLDMNDLRPLFSPTTYSVTIAESTPLRTSVAQVTATDADIGSNGEFYY-YFK 198

Query: 936  GGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGG-----SPPRTSHFRLRVVVQD 990
                 F+V PT+G + L   L       ++LE+ A D G     +   +S  +L V ++ 
Sbjct: 199  NKVDLFSVHPTSGVISLSGRLNYDEKNRYDLEILAVDRGMKLYGNNGVSSTAKLYVHIER 258

Query: 991  VGTRGLAPRFN-----------SPTYRV----DLPSGTTAGTQVLQVQAQAPDGGPIT-Y 1034
            +     AP  +            PTY V    DL  G     + + + A    G P+  +
Sbjct: 259  INEH--APTIHVVTHVPFSLEKEPTYAVVTVDDLDDGANGEIESVSIVA----GDPLDQF 312

Query: 1035 HLAAEGASSPFGLEPQSGWLWVRAALDREAQEL--------YILKVMAVSGSKAELGQQT 1086
             LA EG              W+     +E +++        Y L + A    K +   Q 
Sbjct: 313  FLAKEGK-------------WLNEYKIKERKQIDWESFPYGYNLTLQA----KDKGSPQK 355

Query: 1087 GTATVRVSILNQNEHSP--RLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSL 1144
             +A   V I N    +   R  ++   ++++E  PPG  V  V  +        +L+   
Sbjct: 356  CSALKAVYIGNPTRDTVPIRFEKEVYDVSISEFSPPGVVVAIVKLSPEPIDVEYKLSPG- 414

Query: 1145 QQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDL 1204
                ED+  F+I+P++G + T + L+  ++  Y+L V  ++G    + T     +++ D 
Sbjct: 415  ----EDAVYFKINPRSGLIVTARPLNTVKKEVYKLEVTNKEGDLKAQVT-----ISIEDA 465

Query: 1205 NDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELF 1264
            ND++P F Q    A       V + VP GT V T+ A D D+GENG I Y++       F
Sbjct: 466  NDHTPEFQQPLYDA------YVNESVPVGTSVLTVSASDKDKGENGYITYSIASLNLLPF 519

Query: 1265 SLHPHSGELLTAAPLIRAERPH-YVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPD 1323
             ++  +G + T   L     P  Y   + A D GSP R  S   +   + +     P   
Sbjct: 520  VINQFTGVISTTEELDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSP--- 576

Query: 1324 LAERDPAAPV-----PVVLTVTAAEGLR------------PGSLLGSVAAPEPAGVGALT 1366
            L E+     V     PV   +TA   +              G+ LG       +GV  L 
Sbjct: 577  LFEKVACQGVISYDFPVGGHITAVSAIDIDELELVKYKIISGNELGFFYLNPDSGVLQLK 636

Query: 1367 YTLVGGADPEGTFALD-AASGRLYLARPLDFEAGP-----PWRALTVRAEGPGGAGARLL 1420
             +L       G FAL   A+    LA P+             ++ + R        A  L
Sbjct: 637  KSLTNSGIKNGNFALRITATDGENLADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKL 696

Query: 1421 RVQVQVQDE-------------NEHAPAFARD-PLALALPENPEPGAALYTFRASDADGP 1466
             ++ +   +             N   P F +  P  +A+ E+   GA +   +A DAD  
Sbjct: 697  LIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADS- 755

Query: 1467 GPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATD--RPANASR 1524
            G N  V + +           +D  TG L     +DRE T   LL +   D   P  +S 
Sbjct: 756  GFNGKVLFTISDGNTD-SCFNIDMETGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSW 814

Query: 1525 RRAARVSARVFVTDENDNAPVFASPS-RVRLPEDQPPGPAALHVVARDPDLGEAARVSYR 1583
            R        + V D NDN+PVF   S  V + E    G   + V ARD DLG    V+Y 
Sbjct: 815  RLLT-----INVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYS 869

Query: 1584 LASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVA--D 1641
            + +     F ++SSTG + V   LDRE +A + L + A D     +    V+T+ V   D
Sbjct: 870  VLTDTQ-QFAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDD 928

Query: 1642 VNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSES--FSLDPD 1699
            VND +P F    YSV + E+ P GT +  L   DPD+G  GQV Y  V+  +  F +D  
Sbjct: 929  VNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETHDPDLGLGGQVRYSLVNDYNGRFEIDKA 988

Query: 1700 TGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVT---VRVAVEDENDHAPTFGSAHL 1756
            +G +   + LD E+Q+  NLTV A+D+G P  L+ V+   V V   +EN H P F    +
Sbjct: 989  SGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAV 1048

Query: 1757 SLEVPEGQDPQTLTM-LRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDR 1815
               V E     T  + + A D D G +G++QY I DG   G F +D  SG       LDR
Sbjct: 1049 VGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFSIDDESGVITAADILDR 1108

Query: 1816 EVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLL 1875
            E   ++ L + A D G   L +T+ + + V D ND+AP    P Y   V E+ P    ++
Sbjct: 1109 ETMGSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVI 1168

Query: 1876 QLQAHDPDAGANGHVTYYLGAGTA-GAFLLEPSSGELRTAAA-LDREQCPSYTFSVSAVD 1933
            Q+QA DPD+ +N  +TY + +G     F +   +G + T +  LDREQ   +   V+  D
Sbjct: 1169 QIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTD 1228

Query: 1934 GAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDA 1993
            G  + P  +T+ V + V D ND+ P FP    +++LP          +  A   A DRD 
Sbjct: 1229 GGPS-PKQSTIWVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAF--AFDRDE 1285

Query: 1994 GANASILYRLAGTPPPGTT-VDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATG 2052
            G NA I Y +      G   +D  TG +  +R     G  D +L I A D GRP +S+T 
Sbjct: 1286 GPNAEISYSIVDGNDDGKFFIDPKTGMVS-SRKQFTAGSYD-ILTIKAVDNGRPQKSSTA 1343

Query: 2053 VIIVGLQGEAERGP---RFPRASSEATIRENAPPGTPIVSPRAVHAGGTNGPITYSILSG 2109
             + +    +    P    F       T+ E+    T IV   +V    T  P+ + I+ G
Sbjct: 1344 RLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRV-TEIVGVVSVQPANT--PLWFDIVGG 1400

Query: 2110 NEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFTVLTLTLQDANDNAP 2169
            N    F  +   G I +  A+ LD E      + ++   G   A T + + + D NDN P
Sbjct: 1401 NFDSAFDAEKGVGTIVI--AKPLDAEQRSIYNMSVEVTDGTNVAVTQVFIKVLDNNDNGP 1458

Query: 2170 RFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGL--FHVDPTTG 2227
             F +P+Y   + E    +  +LQ+EA D D+    ++SY++ +S  +  +  F +DP+TG
Sbjct: 1459 EFSQPNYDVTISEDVLPDTEILQIEATDRDEKH--KLSYTVHSSIDSISMRKFRIDPSTG 1516

Query: 2228 TITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP-WELRVS 2286
             + T   LD E   +  L +M  D+  P     A + V V D ND+ P    P +E  V 
Sbjct: 1517 VLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVF 1576

Query: 2287 EDALLGSEIAQVTGNDVDSGP--VLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDR 2344
            E A LGS + QVT  D D G    L Y +      + F +    G +++    D     +
Sbjct: 1577 ESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNMFKIEPVLGIITICKEPDMTTMGQ 1636

Query: 2345 YQLQLLAHDG---PHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSAT 2401
            + L +   D    P    A + + V   +++ P F    YQ  + E+   G++++ +SA 
Sbjct: 1637 FVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAI 1696

Query: 2402 DRDSGANGHISYHLASPADG-----FSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARD 2456
             + +     + Y +    DG     F+++P +G + T     AL ++ + +  ++++A +
Sbjct: 1697 SQST-----LIYEVK---DGDINGIFTINPYSGVITT---QKALDYERTSSYQLIIQATN 1745

Query: 2457 HGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTL-------LTLEATDA 2509
                G A+ ATV++Q+ D+ND+AP F  S Y  +++E  P  S +       L + ATDA
Sbjct: 1746 MA--GMASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDA 1803

Query: 2510 DGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYN 2569
            D +R+ A + Y I+     + F ++               + G +  +  LD E++  ++
Sbjct: 1804 DSNRN-ALLVYQIVESTAKKFFTVDS--------------STGAIRTIANLDHETIAHFH 1848

Query: 2570 LTVAAADRGQPPQSSVVPVTVT--VLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEAS 2627
              V   D G P  ++  PV V   V DVNDNPPVFT+A +   +   T VG E+L V A+
Sbjct: 1849 FHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLKVSAT 1908

Query: 2628 DADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHF 2687
            D D      + +++  G     F +D +SG L + +  +  ++  + L+V+ +D  G  +
Sbjct: 1909 DPDSEVPPELTYSLMEGSLDH-FLIDSNSGVLTIKN--NNLSKDHYMLIVKVSD--GKFY 1963

Query: 2688 ALAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLE 2747
            + + VTI V++  D G  F  +  STS++EN    T V  ++A+         L+YS+L 
Sbjct: 1964 STSMVTIMVKEAMDSGLHFTQSFYSTSISENNTNITKVAIVNAVGNRLNE--PLKYSILN 2021

Query: 2748 AGPGPEGREAFALNSSTGELRAR-VPFDYEHTESFRLLVGAA-DAGNLS-ASVTVSVLVT 2804
             G        F + S++G ++   VPFD E  E + L+V A+ +  +L  A V V V + 
Sbjct: 2022 PG------NKFKIKSTSGVIQTTGVPFDREEQELYELVVEASRELDHLRVARVVVRVNIE 2075

Query: 2805 GEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSSPYFGINQT 2864
              ++  PVF+   ++  V   A  G  +  V A D+D G +G V Y L     +F IN  
Sbjct: 2076 DINDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEVTYVLQDDYGHFEINPN 2135

Query: 2865 TGALYLR 2871
            +G + L+
Sbjct: 2136 SGNVILK 2142



 Score =  541 bits (1394), Expect = e-153
 Identities = 521/1915 (27%), Positives = 846/1915 (44%), Gaps = 188/1915 (9%)

Query: 1058 AALDREAQELYILKVM-AVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAE 1116
            A L+RE Q+ Y+L V  +V G   E   +     V + +L+ N+  P  S     + +AE
Sbjct: 115  AILNREIQDNYLLIVKGSVRGEDLEAWTK-----VNIQVLDMNDLRPLFSPTTYSVTIAE 169

Query: 1117 NQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSS 1176
            + P  TSV +V ATD D G NG   Y  +   +    F +HP +G ++    L+ ++++ 
Sbjct: 170  STPLRTSVAQVTATDADIGSNGEFYYYFKNKVD---LFSVHPTSGVISLSGRLNYDEKNR 226

Query: 1177 YQLLVQVQDG-----GSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVP 1231
            Y L +   D      G+   S+T  ++V +  +N+++PT           +   VP  + 
Sbjct: 227  YDLEILAVDRGMKLYGNNGVSSTAKLYVHIERINEHAPTI---------HVVTHVPFSLE 277

Query: 1232 PGTLVTTLQAKDPDEGENGTI--LYTLTGPGSELFSLHPHSGELLTAAPLIRAER----- 1284
                   +   D D+G NG I  +  + G   + F L    G+ L    +   ++     
Sbjct: 278  KEPTYAVVTVDDLDDGANGEIESVSIVAGDPLDQFFL-AKEGKWLNEYKIKERKQIDWES 336

Query: 1285 -PH-YVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAA 1342
             P+ Y LTL A D+GSP + ++L+       +  +  P  D     P      V  V+ +
Sbjct: 337  FPYGYNLTLQAKDKGSPQKCSALK-------AVYIGNPTRDTV---PIRFEKEVYDVSIS 386

Query: 1343 EGLRPGSLLGSV-AAPEPAGVGALTYTLVGGADPEGTFALDAASGRLYLARPLDFEAGPP 1401
            E   PG ++  V  +PEP  V    Y L  G D    F ++  SG +  ARPL+      
Sbjct: 387  EFSPPGVVVAIVKLSPEPIDV---EYKLSPGEDAV-YFKINPRSGLIVTARPLNTVKKEV 442

Query: 1402 WRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRAS 1461
            ++      EG   A     +V + ++D N+H P F +      + E+   G ++ T  AS
Sbjct: 443  YKLEVTNKEGDLKA-----QVTISIEDANDHTPEFQQPLYDAYVNESVPVGTSVLTVSAS 497

Query: 1462 DADGPGPNSDVRYRL--LRQEPPVPALRLDARTGALSAPRGLDRETTPALL-LLVEATDR 1518
            D D  G N  + Y +  L   P V    ++  TG +S    LD E++P +   +V A+D 
Sbjct: 498  DKD-KGENGYITYSIASLNLLPFV----INQFTGVISTTEELDFESSPEIYRFIVRASD- 551

Query: 1519 PANASRRRAARVSARVFVTDENDNAPVFASPS-RVRLPEDQPPGPAALHVVARDPDLGEA 1577
               +  R  + V+  + + + NDN+P+F   + +  +  D P G     V A D D  E 
Sbjct: 552  -WGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGHITAVSAIDID--EL 608

Query: 1578 ARVSYRLASGGD-GHFRLHSSTGALSVVRPLDRE--QRAEHVLTVVASD----------- 1623
              V Y++ SG + G F L+  +G L + + L     +     L + A+D           
Sbjct: 609  ELVKYKIISGNELGFFYLNPDSGVLQLKKSLTNSGIKNGNFALRITATDGENLADPMSIN 668

Query: 1624 ----HGSPPRSATQVLTVSVA---------------------------DVNDEAPTFQQQ 1652
                HG     +       VA                            +N + P F + 
Sbjct: 669  ISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINRQGPYFDKS 728

Query: 1653 EYS-VLLRENNPPGTSLLTLRATDPDVGANGQVTY---GGVSSESFSLDPDTGVLTTLRA 1708
              S V ++E+ P G ++L ++A D D G NG+V +    G +   F++D +TG L  L  
Sbjct: 729  FPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMETGQLKVLMP 788

Query: 1709 LDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQT 1768
            +DRE  +   L +   D G+P + +   + + VED ND++P F     S+ + E     T
Sbjct: 789  MDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGT 848

Query: 1769 -LTMLRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEA 1827
             +  + A D D+G+NG++ Y +L    +  F ++ ++G       LDRE +  + L+IEA
Sbjct: 849  EIIQVEARDKDLGSNGEVTYSVL--TDTQQFAINSSTGIVYVADQLDRESKANYSLKIEA 906

Query: 1828 RDGGQPA--LSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAG 1885
            RD  +    L + + L V + D ND +PAF   +YSV+V ED+P GT++  L+ HDPD G
Sbjct: 907  RDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETHDPDLG 966

Query: 1886 ANGHVTYYLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVS 1945
              G V Y L     G F ++ +SG +R +  LD E+   Y  +V A D      LS+   
Sbjct: 967  LGGQVRYSLVNDYNGRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSLSSVSF 1026

Query: 1946 VTITVRDVND--HAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRL 2003
            V + V DVN+  H P FP   + +   +      T  L +    A D D+G +  I Y +
Sbjct: 1027 VEVEVVDVNENLHTPYFPDFAV-VGSVKENSRIGTSVLQVT---ARDEDSGRDGEIQYSI 1082

Query: 2004 A-GTPPPGTTVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEA 2062
              G+     ++D  +G I  A            L + ATD G     +T  + + ++   
Sbjct: 1083 RDGSGLGRFSIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVEDVN 1142

Query: 2063 ERGPRFPRASSEATIRENAPPGTPIVSPRAVHA-GGTNGPITYSILSGNEKGTFSIQPST 2121
            +  P          + EN+P    ++  +A      +N  +TY I SGN +  F+I   T
Sbjct: 1143 DNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKT 1202

Query: 2122 GAITVRSAEGLDFEVSPRLRLVLQAESGGAF---AFTVLTLTLQDANDNAPRFLRPHYVA 2178
            G IT  S + LD E      L +    GG     +   + + + D NDN P+F    Y  
Sbjct: 1203 GLITTTSRK-LDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKVYQI 1261

Query: 2179 FLPE-SRPLEG-PLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILD 2236
             LPE  R   G P+ +  A D D+G   +ISYS+       G F +DP TG +++     
Sbjct: 1262 KLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGND-DGKFFIDPKTGMVSSRKQFT 1320

Query: 2237 REIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRP---TIPQPWELRVSEDALLGS 2293
               +    L + A D G P    +A L +  I      P   T  +P+      ++   +
Sbjct: 1321 AGSY--DILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVT 1378

Query: 2294 EIAQVTGNDVDSGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHD 2353
            EI  V      + P LW+ +        F   +  G + +  PLD EQ   Y + +   D
Sbjct: 1379 EIVGVVSVQPANTP-LWFDIVGGNFDSAFDAEKGVGTIVIAKPLDAEQRSIYNMSVEVTD 1437

Query: 2354 GPHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISY 2413
            G +     + + V D NDN P FSQ  Y V + E   P + IL + ATDRD      +SY
Sbjct: 1438 GTNVAVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIEATDRDE--KHKLSY 1495

Query: 2414 HLASPADG-----FSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATV 2468
             + S  D      F +DP+ G L+T      L H+      + +  RD   P R   A V
Sbjct: 1496 TVHSSIDSISMRKFRIDPSTGVLYT---AERLDHEAQDKHILNIMVRDQEFPYRRNLARV 1552

Query: 2469 HVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWG 2528
             V ++D NDH+P FT   Y  +V E    GS +L + A D D    +A + Y+I +GN G
Sbjct: 1553 IVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKD-KGENAELIYTIEAGNTG 1611

Query: 2529 RVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPV 2588
             +F++EP               LG + + +  D  ++ Q+ L++   D+G PP S+   V
Sbjct: 1612 NMFKIEP--------------VLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIV 1657

Query: 2589 TVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSG 2648
             ++V   +++ P F    Y+  V E+  +G  ++ + A          + + V  GD +G
Sbjct: 1658 RISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAIS-----QSTLIYEVKDGDING 1712

Query: 2649 LFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHFALAPVTIEVQDVNDHGPAFPL 2708
            +F ++  SG +    ALD E  + +QL++QA + AG   + A V I++ D ND+ P F  
Sbjct: 1713 IFTINPYSGVITTQKALDYERTSSYQLIIQATNMAGM-ASNATVNIQIVDENDNAPVFLF 1771

Query: 2709 NLLSTSVAENQPPGTLVTTL-------HAIDGDAGAFGRLRYSLLEAGPGPEGREAFALN 2761
            +  S S++E  P  ++V +L        A D D+     L Y ++E+      ++ F ++
Sbjct: 1772 SQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVES----TAKKFFTVD 1827

Query: 2762 SSTGELRARVPFDYEHTESFRLLVGAADAGN----LSASVTVSVLVTGEDEYDPVFLAPA 2817
            SSTG +R     D+E    F   V   D+G+      + V V++ VT  ++  PVF    
Sbjct: 1828 SSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAV 1887

Query: 2818 FHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSS-PYFGINQTTGALYLR 2871
            F   +      G  +  V ATD D      + YSL   S  +F I+  +G L ++
Sbjct: 1888 FETILLLPTYVGVEVLKVSATDPDSEVPPELTYSLMEGSLDHFLIDSNSGVLTIK 1942



 Score =  453 bits (1166), Expect = e-126
 Identities = 478/1875 (25%), Positives = 817/1875 (43%), Gaps = 205/1875 (10%)

Query: 1169 LDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPD 1228
            L+RE Q +Y L+V+    G    + T  V++ VLD+ND  P F   + +      + + +
Sbjct: 117  LNREIQDNYLLIVKGSVRGEDLEAWT-KVNIQVLDMNDLRPLFSPTTYS------VTIAE 169

Query: 1229 RVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHSGELLTAAPLIRAERPHYV 1288
              P  T V  + A D D G NG   Y       +LFS+HP SG +  +  L   E+  Y 
Sbjct: 170  STPLRTSVAQVTATDADIGSNGEFYYYFKNK-VDLFSVHPTSGVISLSGRLNYDEKNRYD 228

Query: 1289 LTLSAHDQG-----SPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAE 1343
            L + A D+G     +   S++ +L V +    R+ E  P          + VV  V  + 
Sbjct: 229  LEILAVDRGMKLYGNNGVSSTAKLYVHI---ERINEHAPT---------IHVVTHVPFSL 276

Query: 1344 GLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAASGR------LYLARPLDFE 1397
               P   + +V   +    G +    +   DP   F L A  G+      +   + +D+E
Sbjct: 277  EKEPTYAVVTVDDLDDGANGEIESVSIVAGDPLDQFFL-AKEGKWLNEYKIKERKQIDWE 335

Query: 1398 AGPPWRALTVRAEGPGGAG--ARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAAL 1455
            + P    LT++A+  G     + L  V +     +     F ++   +++ E   PG  +
Sbjct: 336  SFPYGYNLTLQAKDKGSPQKCSALKAVYIGNPTRDTVPIRFEKEVYDVSISEFSPPGVVV 395

Query: 1456 YTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEA 1515
               + S    P P  DV Y+L   E  V   +++ R+G +   R L+  T    +  +E 
Sbjct: 396  AIVKLS----PEP-IDVEYKLSPGEDAV-YFKINPRSGLIVTARPLN--TVKKEVYKLEV 447

Query: 1516 TDRPANASRRRAARVSARVFVTDENDNAPVFASPSR-VRLPEDQPPGPAALHVVARDPDL 1574
            T++  +       +    + + D ND+ P F  P     + E  P G + L V A D D 
Sbjct: 448  TNKEGDL------KAQVTISIEDANDHTPEFQQPLYDAYVNESVPVGTSVLTVSASDKDK 501

Query: 1575 GEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVV-ASDHGSPPRSATQ 1633
            GE   ++Y +AS     F ++  TG +S    LD E   E    +V ASD GSP R  ++
Sbjct: 502  GENGYITYSIASLNLLPFVINQFTGVISTTEELDFESSPEIYRFIVRASDWGSPYRHESE 561

Query: 1634 V-LTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSE 1692
            V +T+ + +VND +P F++     ++  + P G  +  + A D D      V Y  +S  
Sbjct: 562  VNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGHITAVSAIDID--ELELVKYKIISGN 619

Query: 1693 S---FSLDPDTGVLTTLRALDREEQEEIN----LTVYAQDRGSPPQLTHVTV-------- 1737
                F L+PD+GVL   ++L     +  N    +T    +  + P   +++V        
Sbjct: 620  ELGFFYLNPDSGVLQLKKSLTNSGIKNGNFALRITATDGENLADPMSINISVLHGKVSSK 679

Query: 1738 -------RVA------------------VEDE-------NDHAPTFGSAHLS-----LEV 1760
                   RVA                  +ED        N   P F  +  S      ++
Sbjct: 680  SFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDL 739

Query: 1761 PEGQDPQTLTMLRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPA 1820
            P G +   +  ++A D D G NG++ + I DG+    F +D+ +G+   + P+DRE    
Sbjct: 740  PVGAN---ILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMETGQLKVLMPMDREHTDL 796

Query: 1821 FQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAH 1880
            + L I   D G P  S+  LLT+ V DAND++P F   +YSV + E    GT ++Q++A 
Sbjct: 797  YLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEAR 856

Query: 1881 DPDAGANGHVTYYLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAG-P 1939
            D D G+NG VTY +   T   F +  S+G +  A  LDRE   +Y+  + A D A +G  
Sbjct: 857  DKDLGSNGEVTYSVLTDTQ-QFAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQ 915

Query: 1940 LSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASI 1999
            L + V++ + + DVND +P F  S   +++    P  +     +A L   D D G    +
Sbjct: 916  LFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGT----VIAWLETHDPDLGLGGQV 971

Query: 2000 LYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQ 2059
             Y L         +D  +G IR+++       +   L + A D GRP  S + V  V ++
Sbjct: 972  RYSLVNDYNGRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPV-SLSSVSFVEVE 1030

Query: 2060 ----GEAERGPRFPRASSEATIRENAPPGTPIVSPRA-VHAGGTNGPITYSILSGNEKGT 2114
                 E    P FP  +   +++EN+  GT ++   A     G +G I YSI  G+  G 
Sbjct: 1031 VVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGR 1090

Query: 2115 FSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGA---FAFTVLTLTLQDANDNAPRF 2171
            FSI   +G IT  +A+ LD E      L + A   G    ++   + + ++D NDNAP  
Sbjct: 1091 FSIDDESGVIT--AADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPLT 1148

Query: 2172 LRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITT 2231
              P Y   + E+ P +  ++Q++A+D D  S  +++Y + +  P +  F ++  TG ITT
Sbjct: 1149 SEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNP-QNFFAINIKTGLITT 1207

Query: 2232 TA-ILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP-WELRVSE-- 2287
            T+  LDRE  AE  L +  TD G      +  + V V+D NDN+P  P+  +++++ E  
Sbjct: 1208 TSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKVYQIKLPERD 1267

Query: 2288 DALLGSEIAQVTGNDVDSGP--VLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRY 2345
                G  I +    D D GP   + Y +        F +    G VS          D  
Sbjct: 1268 RKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQFTAGSYDIL 1327

Query: 2346 QLQLLAHDGPHEGRANLTVLVEDVNDNAPA-----FSQSLYQVMLLEHTPPGSAILSVSA 2400
             ++ + +  P +  +   + +E +    P+     F +  Y   ++E       +  VS 
Sbjct: 1328 TIKAVDNGRPQKS-STARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEIVGVVSV 1386

Query: 2401 TDRDSGANGHISYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAP 2460
                  AN  + + +       + D   G + TIV    L  +     ++ +E  D    
Sbjct: 1387 ----QPANTPLWFDIVGGNFDSAFDAEKG-VGTIVIAKPLDAEQRSIYNMSVEVTD---G 1438

Query: 2461 GRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDY 2520
               A   V +++ D ND+ P F+  +Y V ++ED+ P + +L +EATD D     +   +
Sbjct: 1439 TNVAVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIEATDRDEKHKLSYTVH 1498

Query: 2521 SIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQP 2580
            S I     R F+++P              + G L   E LD E+  ++ L +   D+  P
Sbjct: 1499 SSIDSISMRKFRIDP--------------STGVLYTAERLDHEAQDKHILNIMVRDQEFP 1544

Query: 2581 PQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFT 2640
             + ++  V V V D ND+ P FT   Y  +V E   +G+ +L V A D D G +  + +T
Sbjct: 1545 YRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYT 1604

Query: 2641 VSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAAD---PAGAHFALAPVTIEVQ 2697
            + +G+   +F+++   G + +    D  T  +  L ++  D   P  +  A+  +++ + 
Sbjct: 1605 IEAGNTGNMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMS 1664

Query: 2698 DVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREA 2757
            D N H P F        V EN   GT V  + AI          + +L+      +    
Sbjct: 1665 D-NSH-PKFIHKDYQAEVNENVDIGTSVILISAIS---------QSTLIYEVKDGDINGI 1713

Query: 2758 FALNSSTGELRARVPFDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYDPVFLAPA 2817
            F +N  +G +  +   DYE T S++L++ A +   ++++ TV++ +  E++  PVFL   
Sbjct: 1714 FTINPYSGVITTQKALDYERTSSYQLIIQATNMAGMASNATVNIQIVDENDNAPVFLFSQ 1773

Query: 2818 FHFQVPEGARRG---HSLGH----VQATDEDGGADGLVLYSL--ATSSPYFGINQTTGAL 2868
            +   + E A       SL +    ++ATD D   + L++Y +  +T+  +F ++ +TGA+
Sbjct: 1774 YSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAI 1833

Query: 2869 --------------YLRVDSRAPGSGTATSGGGGRTRREAPRELRLEVIARGPLPGSRSA 2914
                          +  V  R  GS   T+        E+P E+ +EV      P   + 
Sbjct: 1834 RTIANLDHETIAHFHFHVHVRDSGSPQLTA--------ESPVEVNIEVTDVNDNPPVFTQ 1885

Query: 2915 TVPVTVDITHTALGL 2929
             V  T+ +  T +G+
Sbjct: 1886 AVFETILLLPTYVGV 1900



 Score =  343 bits (879), Expect = 2e-93
 Identities = 358/1360 (26%), Positives = 581/1360 (42%), Gaps = 158/1360 (11%)

Query: 1580 VSYRLASGGDGHF--------------RLHSSTGALSVVRPLDREQRAEHVLTVVASDHG 1625
            + YR+ SG +  F              R+ +  G  ++   L+RE +  ++L V  S  G
Sbjct: 79   IKYRIVSGDEEGFFKAEEVIIADFCFLRIRTKGGNSAI---LNREIQDNYLLIVKGSVRG 135

Query: 1626 SPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVT 1685
                + T+V  + V D+ND  P F    YSV + E+ P  TS+  + ATD D+G+NG+  
Sbjct: 136  EDLEAWTKV-NIQVLDMNDLRPLFSPTTYSVTIAESTPLRTSVAQVTATDADIGSNGEFY 194

Query: 1686 YGGVSS-ESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRG-----SPPQLTHVTVRV 1739
            Y   +  + FS+ P +GV++    L+ +E+   +L + A DRG     +    +   + V
Sbjct: 195  YYFKNKVDLFSVHPTSGVISLSGRLNYDEKNRYDLEILAVDRGMKLYGNNGVSSTAKLYV 254

Query: 1740 AVEDENDHAPTFGSAHLSLEVPEGQDPQ-TLTMLRASDPDVGANGQLQ-YRILDGDPSGA 1797
             +E  N+HAPT    H+   VP   + + T  ++   D D GANG+++   I+ GDP   
Sbjct: 255  HIERINEHAPTI---HVVTHVPFSLEKEPTYAVVTVDDLDDGANGEIESVSIVAGDPLDQ 311

Query: 1798 FVLD-----LASGEFGTMRPLDREVEP-AFQLRIEARDGGQPALSATLLLTVTVLDANDH 1851
            F L      L   +    + +D E  P  + L ++A+D G P   + L          D 
Sbjct: 312  FFLAKEGKWLNEYKIKERKQIDWESFPYGYNLTLQAKDKGSPQKCSALKAVYIGNPTRDT 371

Query: 1852 APA-FPVPAYSVEVPEDVPAGTL--LLQLQAHDPDAGANGHVTYYLGAGT-AGAFLLEPS 1907
             P  F    Y V + E  P G +  +++L     D      V Y L  G  A  F + P 
Sbjct: 372  VPIRFEKEVYDVSISEFSPPGVVVAIVKLSPEPID------VEYKLSPGEDAVYFKINPR 425

Query: 1908 SGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRL 1967
            SG + TA  L+  +   Y   V+  +G           VTI++ D NDH P F   PL  
Sbjct: 426  SGLIVTARPLNTVKKEVYKLEVTNKEG------DLKAQVTISIEDANDHTPEFQ-QPLYD 478

Query: 1968 RLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPV 2027
                      T  L   T+ A D+D G N  I Y +A        ++ +TG I       
Sbjct: 479  AYVNESVPVGTSVL---TVSASDKDKGENGYITYSIASLNLLPFVINQFTGVISTTEELD 535

Query: 2028 ALGPRDRVLFIV-ATDLGRPARSATGV-IIVGLQGEAERGPRFPRASSEATIRENAPPGT 2085
                 +   FIV A+D G P R  + V + + +    +  P F + + +  I  + P G 
Sbjct: 536  FESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGG 595

Query: 2086 PIVSPRAVHAGGTNGPITYSILSGNEKGTFSIQPSTGA--------------------IT 2125
             I +  A+        + Y I+SGNE G F + P +G                     IT
Sbjct: 596  HITAVSAIDIDELE-LVKYKIISGNELGFFYLNPDSGVLQLKKSLTNSGIKNGNFALRIT 654

Query: 2126 VRSAEGL-----------------------DFEVSPRL--RLVLQAESGGAFAFTVLTLT 2160
                E L                       +  V+ +L  +L+++A++ G        L 
Sbjct: 655  ATDGENLADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLD 714

Query: 2161 LQDANDNAPRFLR--PHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARG 2218
                N   P F +  P  VA + E  P+   +L+++A D D G  G++ ++++       
Sbjct: 715  FYSINRQGPYFDKSFPSDVA-VKEDLPVGANILKIKAYDADSGFNGKVLFTISDGN-TDS 772

Query: 2219 LFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPT-I 2277
             F++D  TG +     +DRE      L +   D G+P       LT+ V D NDN P  I
Sbjct: 773  CFNIDMETGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFI 832

Query: 2278 PQPWELRVSEDALLGSEIAQVTGNDVD---SGPVLWYVLSPSGPQDPFSVGRYGGRVSLT 2334
               + + + E + +G+EI QV   D D   +G V + VL+ +     F++    G V + 
Sbjct: 833  QDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDT---QQFAINSSTGIVYVA 889

Query: 2335 GPLDFEQCDRYQLQLLAHDGPHEGR-----ANLTVLVEDVNDNAPAFSQSLYQVMLLEHT 2389
              LD E    Y L++ A D    G+       L V ++DVND +PAF  S Y V +LE  
Sbjct: 890  DQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDL 949

Query: 2390 PPGSAILSVSATDRDSGANGHISYHLASPADG-FSVDPNNGTLFTIVGTVALGHDGSGAV 2448
            P G+ I  +   D D G  G + Y L +  +G F +D  +G +     +  L ++     
Sbjct: 950  PVGTVIAWLETHDPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRL---SKELDYEKQQFY 1006

Query: 2449 DVVLEARDHGAP-GRAARATVHVQLQDQND--HAPSFTLSHYRVAVTEDLPPGSTLLTLE 2505
            ++ + A+D G P   ++ + V V++ D N+  H P F       +V E+   G+++L + 
Sbjct: 1007 NLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVT 1066

Query: 2506 ATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESL 2565
            A D D  R    + YSI  G+    F ++                 G +   + LD E++
Sbjct: 1067 ARDEDSGRD-GEIQYSIRDGSGLGRFSIDDE--------------SGVITAADILDRETM 1111

Query: 2566 TQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVE 2625
              Y LTV A DRG  P  S + V + V DVNDN P+ +   Y   V E++P    ++ ++
Sbjct: 1112 GSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQ 1171

Query: 2626 ASDADPGPHGLVRFTVSSGDPSGLFELDESSGTL-RLAHALDCETQARHQLVVQAAD--P 2682
            A D D   +  + + ++SG+P   F ++  +G +   +  LD E QA H L V   D  P
Sbjct: 1172 AEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGP 1231

Query: 2683 AGAHFALAPVTIEVQDVNDHGPAFPLNLLSTSVAE--NQPPGTLVTTLHAIDGDAGAFGR 2740
            +     +  V ++V D ND+ P FP  +    + E   +  G  +    A D D G    
Sbjct: 1232 SPKQSTIW-VVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAE 1290

Query: 2741 LRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAADAGNLSASVTVS 2800
            + YS+++     +G+  F ++  TG + +R  F     +   L + A D G    S T  
Sbjct: 1291 ISYSIVDG--NDDGK--FFIDPKTGMVSSRKQFTAGSYDI--LTIKAVDNGRPQKSSTAR 1344

Query: 2801 VLVTGEDEYDP-----VFLAPAFHFQVPEGARRGHSLGHV 2835
            + +    +  P      F  P ++F V E  R    +G V
Sbjct: 1345 LHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEIVGVV 1384



 Score =  310 bits (795), Expect = 1e-83
 Identities = 267/880 (30%), Positives = 403/880 (45%), Gaps = 53/880 (6%)

Query: 43   QAGSLDLQIDEEQPAGTLIGDISA-GLPAGTAAPLMYFI-SAQEGSGVGTDLAIDEHSGV 100
            +  S D  I E  P GT +  + A  +  G    + Y + S  +   V     ID ++G 
Sbjct: 2815 ETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGW 2874

Query: 101  VRTARVLDREQRDRYRFTAVTPD-------GATVEVTVRVADINDHAPAFPQARAALQVP 153
            + T + LD E    + F+ V  D        +T  V+VRV DIND+AP F Q      V 
Sbjct: 2875 ISTLKDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAQEVYRGNVK 2934

Query: 154  EHTAFGTRYPLEPARDADAGRLGTQ-GYALSGDGAGETFRLETRPGPDGTPVPE--LVVT 210
            E    G    +    D D   +  Q  Y ++G      F L       G    E  + V 
Sbjct: 2935 ESDPPGEVVAVLSTWDRDTSDVNRQVSYHITGGNPRGRFAL-------GLVQSEWKVYVK 2987

Query: 211  GELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAP 270
              LDRE +  Y L + A DG       QA+++V++ D+ND++P  +Q  Y A++ E +  
Sbjct: 2988 RPLDREEQDIYFLNITATDGLFV---TQAMVEVSVSDVNDNSPVCDQVAYTALLPEDIPS 3044

Query: 271  GSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHEL 330
               +L+V A DAD G NG + Y +      G+  F +D  +G L+    LD E+  V+ L
Sbjct: 3045 NKIILKVSAKDADIGSNGYIRYSL---YGSGNSEFFLDPESGELKTLALLDRERIPVYSL 3101

Query: 331  VVQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISV 390
            + +A DGG       + + + + D NDN P    +F S   +  V E      L+ R+  
Sbjct: 3102 MAKATDGGGR--FCQSNIHLILEDVNDNPP----VFSSDHYNTCVYENTATKALLTRVQA 3155

Query: 391  SDPDDGDFAHVNVSL-EGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATD-SG 448
             DPD G    V  SL +   G F++ +   +I L    + LDRE++ +YN+ V ATD S 
Sbjct: 3156 VDPDIGINRKVVYSLADSAGGVFSIDSSSGIIIL---EQPLDREQQSSYNISVRATDQSP 3212

Query: 449  SPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQV 508
               L +     + V D+NDN P F+R+ Y    +PE   PG+ V+ V A   D GTN ++
Sbjct: 3213 GQSLSSLTTVTITVLDINDNPPVFERRDYLVT-VPEDTSPGTQVLAVFATSKDIGTNAEI 3271

Query: 509  TYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVAL 568
            TY +  G     F I+P +G I+ +  LDYEL  +  L+V A DGG P L++ ATV++ L
Sbjct: 3272 TYLIRSGNEQGKFKINPKTGGISVSEVLDYELCKRFYLVVEAKDGGTPALSAVATVNINL 3331

Query: 569  QDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPP 628
             DVNDN P+F +  Y+A + E    G   + + A D DS P G + +S+   +       
Sbjct: 3332 TDVNDNPPKFSQDVYSAVISEDALVGDSVILLIAEDVDSQPNGQIHFSI---VNGDRDNE 3388

Query: 629  FRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGG--GLKSMVYVKVFLSDENDNPPQFY 686
            F +D   G V   + LDR++  S +   V AVD G   + S   V + +SD NDN P F 
Sbjct: 3389 FTVDPVLGLVKVKKKLDRER-VSGYSLLVQAVDSGIPAMSSTATVNIDISDVNDNSPVFT 3447

Query: 687  PREYAASISAQSPPGTAVLRLRAHDPDQGSHG-RLSYHILAGNSPPLFTLDEQSGLLTVA 745
            P  Y A I    P GT++L+L   D D   +G   S+ IL+GN    F LD   G+L  A
Sbjct: 3448 PANYTAVIQENKPVGTSILQLVVTDRDSFHNGPPFSFSILSGNEEEEFVLDPH-GILRSA 3506

Query: 746  WPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAP 805
                   +    L + A+D G  Q      + + ++  +   P    L+      ED  P
Sbjct: 3507 VVFQHTESLEYVLCVQAKDSGKPQQVSHTYIRVRVIEESTHKPTAIPLEIFIVTMEDDFP 3566

Query: 806  GTSVGIVQAHNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGPVLELEV 865
            G  +G + A +    +  V       + + LF +++  G +  L  LD      VL + V
Sbjct: 3567 GGVIGKIHATDQD--MYDVLTFALKSEQKSLFKVNSHDGKIIALGGLDSGKY--VLNVSV 3622

Query: 866  RAGSGVPPAFAVARVRVLLDDVNDNSPAF----PAPEDTV 901
              G    P   V  V  L+ ++  N+        +PED V
Sbjct: 3623 SDGRFQVPIDVVVHVEQLVHEMLQNTVTIRFENVSPEDFV 3662



 Score =  215 bits (548), Expect = 5e-55
 Identities = 236/898 (26%), Positives = 383/898 (42%), Gaps = 125/898 (13%)

Query: 2057 GLQGEAERGPRFPRASSEATIRENAPPGTPIVSPR--AVHAGGTNGPITYSILSGNEKGT 2114
            GL G    G  F  +   AT+ EN+   T + S     +     +  I Y I+SG+E+G 
Sbjct: 32   GLPGTGPLGFHFTHSIYNATVYENSAARTYVNSQSRMGITLIDLSWDIKYRIVSGDEEGF 91

Query: 2115 FSIQPSTGA----ITVRSAEG----LDFEVSPRLRLVLQAESGGAF--AFTVLTLTLQDA 2164
            F  +    A    + +R+  G    L+ E+     L+++    G    A+T + + + D 
Sbjct: 92   FKAEEVIIADFCFLRIRTKGGNSAILNREIQDNYLLIVKGSVRGEDLEAWTKVNIQVLDM 151

Query: 2165 NDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDP 2224
            ND  P F    Y   + ES PL   + QV A D D GS G+  Y     +    LF V P
Sbjct: 152  NDLRPLFSPTTYSVTIAESTPLRTSVAQVTATDADIGSNGEFYYYF---KNKVDLFSVHP 208

Query: 2225 TTGTITTTAILDREIWAETRLVLMATDR-----GSPALVGSATLTVMVIDTNDNRPTIPQ 2279
            T+G I+ +  L+ +      L ++A DR     G+  +  +A L V +   N++ PTI  
Sbjct: 209  TSGVISLSGRLNYDEKNRYDLEILAVDRGMKLYGNNGVSSTAKLYVHIERINEHAPTIHV 268

Query: 2280 PWELRVSEDALLGSEIAQVTGNDVD---SGPVLWYVLSPSGPQDPFSVGRYGG-----RV 2331
               +  S +       A VT +D+D   +G +    +    P D F + + G      ++
Sbjct: 269  VTHVPFSLEK--EPTYAVVTVDDLDDGANGEIESVSIVAGDPLDQFFLAKEGKWLNEYKI 326

Query: 2332 SLTGPLDFEQCD-RYQLQLLAHD--GPHEGRANLTVLV-EDVNDNAP-AFSQSLYQVMLL 2386
                 +D+E     Y L L A D   P +  A   V +     D  P  F + +Y V + 
Sbjct: 327  KERKQIDWESFPYGYNLTLQAKDKGSPQKCSALKAVYIGNPTRDTVPIRFEKEVYDVSIS 386

Query: 2387 EHTPPGSAILSVSATDRDSGANGHISYHLASPADG--FSVDPNNGTLFTI--VGTVALGH 2442
            E +PPG  +  V  +         + Y L+   D   F ++P +G + T   + TV    
Sbjct: 387  EFSPPGVVVAIVKLSPEPI----DVEYKLSPGEDAVYFKINPRSGLIVTARPLNTV---K 439

Query: 2443 DGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLL 2502
                 ++V  +  D        +A V + ++D NDH P F    Y   V E +P G+++L
Sbjct: 440  KEVYKLEVTNKEGD-------LKAQVTISIEDANDHTPEFQQPLYDAYVNESVPVGTSVL 492

Query: 2503 TLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDF 2562
            T+ A+D D    +  + YSI S N      L P +           +  G +   E LDF
Sbjct: 493  TVSASDKD-KGENGYITYSIASLN------LLPFVIN---------QFTGVISTTEELDF 536

Query: 2563 ESLTQ-YNLTVAAADRGQP-PQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAE 2620
            ES  + Y   V A+D G P    S V VT+ + +VNDN P+F + + +  +  D PVG  
Sbjct: 537  ESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGH 596

Query: 2621 LLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHAL--------------- 2665
            +  V A D D     LV++ + SG+  G F L+  SG L+L  +L               
Sbjct: 597  ITAVSAIDID--ELELVKYKIISGNELGFFYLNPDSGVLQLKKSLTNSGIKNGNFALRIT 654

Query: 2666 ---------------------------DC-ETQARHQLVVQAADPAGAH--FALAPVTIE 2695
                                        C ET+   +L  +    A A+    L    ++
Sbjct: 655  ATDGENLADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLD 714

Query: 2696 VQDVNDHGPAFPLNLLS-TSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEG 2754
               +N  GP F  +  S  +V E+ P G  +  + A D D+G  G++ +++ +       
Sbjct: 715  FYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTD--- 771

Query: 2755 REAFALNSSTGELRARVPFDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYD--PV 2812
               F ++  TG+L+  +P D EHT+ + L +   D GN   S    + +  ED  D  PV
Sbjct: 772  -SCFNIDMETGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPV 830

Query: 2813 FLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSSPYFGINQTTGALYL 2870
            F+  ++   + E +  G  +  V+A D+D G++G V YS+ T +  F IN +TG +Y+
Sbjct: 831  FIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQFAINSSTGIVYV 888


>gi|216548385 dachsous 2 isoform 2 [Homo sapiens]
          Length = 1369

 Score =  807 bits (2085), Expect = 0.0
 Identities = 506/1305 (38%), Positives = 714/1305 (54%), Gaps = 85/1305 (6%)

Query: 25   LLLLLLLLLGAGVPGAWGQAGSLDLQIDEEQPAGTLIGDISAGLPAGTAAPLMYFISAQE 84
            LL LL+ +      G+  Q  +L L +DE  P  TL+GDI AGLPA        F  +++
Sbjct: 47   LLWLLVHVWLWAASGSSAQLFNLTLSVDEGLPPDTLVGDIRAGLPAAQQQEGSGFFLSED 106

Query: 85   G--SGVGTDLAIDEHSGVVRTARVLDREQRDRYRFTAVTPDGATVEVTVRVADINDHAPA 142
               S +  D  +   +G++RTAR LDRE+RD Y F A T  GA V+V +RV D+NDH+P 
Sbjct: 107  SDDSPLLDDFHVHPDTGIIRTARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPR 166

Query: 143  FPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGYAL------SGDGAGETFRLETR 196
            FP     L V E +  GT + L  A D DAG   TQGY L        D AG  F+L  R
Sbjct: 167  FPLDSLQLDVSELSPPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYR 226

Query: 197  -PGPDGTPVP----------ELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTL 245
             PGP  +P+           +LV+   LDRE  + + LQ+EA+DGG P R     +++ +
Sbjct: 227  TPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWDGGRPRRTGLLSVELRV 286

Query: 246  LDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGP- 304
            LD ND+ P F Q  Y A V E   PG+ V +V A+D D G NG V Y +  RQ  G G  
Sbjct: 287  LDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSG 346

Query: 305  ---------FSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDA 355
                     F+++  +G++++ RPLD E +  H+LVV+ARDGGA PE+ +  V++ V D 
Sbjct: 347  GGALGDAAYFAVEELSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDV 406

Query: 356  NDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDF----------------A 399
            NDN+P++ V+FL+  G  +VSE A PG  VAR+SVSD D GD+                 
Sbjct: 407  NDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDAD-GDWEKEDEATGELGVGLGDG 465

Query: 400  HVNVSLEGGEGHFALSTQDSV-IYLVCVARRLDREERDAYNLRVTATDSGSPPLRAEAAF 458
             +++SLEGGEG FAL       ++ +CV   LDRE RD Y L + ATD+GSPPL  E   
Sbjct: 466  SISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETL 525

Query: 459  VLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQ------VTYSL 512
            +L V D+ND  P F +Q Y+   + E A PG+ V+ V+A D D+  +        V    
Sbjct: 526  LLRVADLNDQPPLFSQQHYKAS-VSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLS 584

Query: 513  APG---------AHTHW----FSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLA 559
            AP           HT      F+ID  SG I+T  +LD E++   +L VVA D G PPL+
Sbjct: 585  APCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQDLGEPPLS 644

Query: 560  SSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGA 619
            ++  VS+ + DVNDNEP F R  YNA++ E    G CFLQVTA+DADSG +G + YSL  
Sbjct: 645  ATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQVTASDADSGLYGFIEYSLYD 704

Query: 620  GLGSSGSPP-FRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMVYVKVFLSDE 678
            G  S  +P  FRID H G +C ++ +DR++ P+++D  V A DGGGL +  +V+V L D 
Sbjct: 705  GFLSYEAPQAFRIDPHDGQICVSQDIDRERDPATYDLLVEAKDGGGLSAQAFVRVDLEDV 764

Query: 679  NDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQ 738
            NDN P F P  Y  SIS ++ PGT ++ + A D D G +G ++Y ++ GN   LFT+D  
Sbjct: 765  NDNHPVFNPSTYVTSISDETQPGTEIINVLATDQDSGIYGTVAYELIPGNVSSLFTIDST 824

Query: 739  SGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFS 798
            +G++ +  PL+   ++ + L + A+DGGGL A  +A V I I   T  P  FE+ +Y F 
Sbjct: 825  TGIIYLTLPLSHLESTTLSLMVSAQDGGGLTAVINADVTIHIFQTTLAPAEFERPKYTFL 884

Query: 799  VPEDVAPGTSVGIVQAHNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLG 858
            V EDV   + +G V+A  P     P+   +S GD  G FS+    G ++T +PLD E   
Sbjct: 885  VYEDVPEDSPIGTVKAREPLNSSEPIFYRISSGDLGGKFSIHPRLGTIRTRKPLDHE-TQ 943

Query: 859  PVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRA 918
            PV+ L V+A  G  PA +   V + + DVNDN PAF    D + +   T PGT +Y  RA
Sbjct: 944  PVVVLTVQAQLGSAPACSSTEVNITVMDVNDNHPAFLRTSDEIRISQTTPPGTALYLARA 1003

Query: 919  LDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPR 978
             D DSG N  + +++ +   G F +D   G + L   LG        L L A D G  P+
Sbjct: 1004 EDRDSGRNGLIRYSIASPQPGVFAIDRALGVLFLNGSLGAGEQRELTLTLRAEDQGVHPQ 1063

Query: 979  TSHFRLRVVVQDVGTRGLAP--RFNSPTYRVDLPSGTTAGTQVLQVQAQ--APD--GGPI 1032
             +   L VV++    R  +P   F    Y+V++    +  TQ+LQ QA    P     P+
Sbjct: 1064 AALLVLTVVIE---KREHSPSWTFEHLVYQVEVSESLSPMTQMLQTQAHPLGPQRAASPL 1120

Query: 1033 TYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVR 1092
             Y L     S+ FG+ P +GW+++R   D E+ + Y  +V A       L  Q  + TV 
Sbjct: 1121 RYSLEPSVDSAMFGIRPYTGWIYLRRQFDYESTQTYNFRVFAWIPEDGFL--QNVSTTVI 1178

Query: 1093 VSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSK 1152
            V + ++N++SP    D  FL V E+  P   +G++ A D DSG NG+L Y    L  D K
Sbjct: 1179 VRVWDENDNSPTFLHDVLFLKVEESPVPQGVIGKITAIDMDSGKNGQLLYF---LLSDGK 1235

Query: 1153 AFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFL 1212
             F+++P TGE+     LDRE +  +++ V V D GSPPR+ T  V+V+V D+NDN P F 
Sbjct: 1236 FFKMNPNTGELINWVALDREHRGHHEMTVLVTDRGSPPRNATMAVYVSVTDINDNRPFFP 1295

Query: 1213 QASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLT 1257
            Q     G  L ++V +  P   LVTT+ AKDPDEG N  + Y+++
Sbjct: 1296 QC--LPGKELHVKVLEGQPVNMLVTTVFAKDPDEGNNAEVTYSVS 1338



 Score =  428 bits (1100), Expect = e-119
 Identities = 392/1298 (30%), Positives = 567/1298 (43%), Gaps = 137/1298 (10%)

Query: 1337 LTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALD-----AASGRLYLA 1391
            LT++  EGL P +L+G + A  PA             D + +  LD       +G +  A
Sbjct: 69   LTLSVDEGLPPDTLVGDIRAGLPAAQQQEGSGFFLSEDSDDSPLLDDFHVHPDTGIIRTA 128

Query: 1392 RPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDPLALALPENPEP 1451
            R LD E    +  +     G       +++V+++V D N+H+P F  D L L + E   P
Sbjct: 129  RRLDRERRDHYSFVAATLLGA------VVQVEIRVNDVNDHSPRFPLDSLQLDVSELSPP 182

Query: 1452 GAALYTFRASDADGPGPNSDVRYRLLR-----QEPPVPALRLDART-GALSAP------- 1498
            G A     A D D  G  S   Y L++     ++P  P  +L  RT G L +P       
Sbjct: 183  GTAFRLPVAHDPDA-GLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSSS 241

Query: 1499 ----------RGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFAS 1548
                      R LDRE   A  L +EA D       RR   +S  + V DENDN PVF  
Sbjct: 242  PLEPLDLVLLRRLDREEAAAHRLQIEAWD---GGRPRRTGLLSVELRVLDENDNPPVFEQ 298

Query: 1549 PS-RVRLPEDQPPGPAALHVVARDPDLGEAARVSYRL-------------ASGGDGHFRL 1594
               R  + ED  PG     V A D DLG    V Y +             A G   +F +
Sbjct: 299  DEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAV 358

Query: 1595 HSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPT----FQ 1650
               +G + V RPLDRE +A H L V A D G+ P  AT  ++++V DVND  P     F 
Sbjct: 359  EELSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFL 418

Query: 1651 QQEYSVLLRENNPPGTSLLTLRATDPDVG------ANGQVTYG-GVSSESFSLDPDTGVL 1703
             +     + E   PG  +  +  +D D        A G++  G G  S S SL+   G  
Sbjct: 419  TEGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGELGVGLGDGSISLSLEGGEGDF 478

Query: 1704 TTLRA-------------LDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPT 1750
              L               LDRE ++   L + A D GSPP  T  T+ + V D ND  P 
Sbjct: 479  ALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPL 538

Query: 1751 FGSAHLSLEVPEGQDPQTLTM-LRASDPDVGAN------------------GQLQYRILD 1791
            F   H    V E   P T+ M + ASD D   +                  G LQ +++ 
Sbjct: 539  FSQQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVH 598

Query: 1792 GDPSG-AFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDAND 1850
                G +F +D  SG   T+R LDREV+ A +L++ A+D G+P LSAT L+++TV D ND
Sbjct: 599  TAECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQDLGEPPLSATCLVSITVDDVND 658

Query: 1851 HAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTY-----YLGAGTAGAFLLE 1905
            + P F    Y+  + E  P G   LQ+ A D D+G  G + Y     +L      AF ++
Sbjct: 659  NEPIFWRQVYNATIAEHAPVGHCFLQVTASDADSGLYGFIEYSLYDGFLSYEAPQAFRID 718

Query: 1906 PSSGELRTAAALDREQCP-SYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSP 1964
            P  G++  +  +DRE+ P +Y   V A DG   G LS    V + + DVND+ P F  S 
Sbjct: 719  PHDGQICVSQDIDRERDPATYDLLVEAKDG---GGLSAQAFVRVDLEDVNDNHPVFNPST 775

Query: 1965 LRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRL-AGTPPPGTTVDSYTGEIRVA 2023
                +       + P   +  + A D+D+G   ++ Y L  G      T+DS TG I + 
Sbjct: 776  YVTSI----SDETQPGTEIINVLATDQDSGIYGTVAYELIPGNVSSLFTIDSTTGIIYLT 831

Query: 2024 RSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPP 2083
                 L      L + A D G         + + +         F R      + E+ P 
Sbjct: 832  LPLSHLESTTLSLMVSAQDGGGLTAVINADVTIHIFQTTLAPAEFERPKYTFLVYEDVPE 891

Query: 2084 GTPIVSPRAVHAGGTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLV 2143
             +PI + +A     ++ PI Y I SG+  G FSI P  G  T+R+ + LD E  P + L 
Sbjct: 892  DSPIGTVKAREPLNSSEPIFYRISSGDLGGKFSIHPRLG--TIRTRKPLDHETQPVVVLT 949

Query: 2144 LQAESGGAFA--FTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQG 2201
            +QA+ G A A   T + +T+ D NDN P FLR      + ++ P    L    A+D D G
Sbjct: 950  VQAQLGSAPACSSTEVNITVMDVNDNHPAFLRTSDEIRISQTTPPGTALYLARAEDRDSG 1009

Query: 2202 SGGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSA 2261
              G I YS+A+ QP  G+F +D   G +     L      E  L L A D+G        
Sbjct: 1010 RNGLIRYSIASPQP--GVFAIDRALGVLFLNGSLGAGEQRELTLTLRAEDQGVHPQAALL 1067

Query: 2262 TLTVMVIDTNDNRPTIP---QPWELRVSEDALLGSEIAQVTGNDVD---SGPVLWYVLSP 2315
             LTV VI+  ++ P+       +++ VSE     +++ Q   + +    +   L Y L P
Sbjct: 1068 VLTV-VIEKREHSPSWTFEHLVYQVEVSESLSPMTQMLQTQAHPLGPQRAASPLRYSLEP 1126

Query: 2316 SGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEG---RANLTVLVE--DVN 2370
            S     F +  Y G + L    D+E    Y  ++ A   P +G     + TV+V   D N
Sbjct: 1127 SVDSAMFGIRPYTGWIYLRRQFDYESTQTYNFRVFAWI-PEDGFLQNVSTTVIVRVWDEN 1185

Query: 2371 DNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGT 2430
            DN+P F   +  + + E   P   I  ++A D DSG NG + Y L S    F ++PN G 
Sbjct: 1186 DNSPTFLHDVLFLKVEESPVPQGVIGKITAIDMDSGKNGQLLYFLLSDGKFFKMNPNTGE 1245

Query: 2431 LFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTL----SH 2486
            L   +  VAL  +  G  ++ +   D G+P R A   V+V + D ND+ P F        
Sbjct: 1246 L---INWVALDREHRGHHEMTVLVTDRGSPPRNATMAVYVSVTDINDNRPFFPQCLPGKE 1302

Query: 2487 YRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIIS 2524
              V V E  P    + T+ A D D   ++A V YS+ S
Sbjct: 1303 LHVKVLEGQPVNMLVTTVFAKDPD-EGNNAEVTYSVSS 1339



 Score =  369 bits (947), Expect = e-101
 Identities = 376/1275 (29%), Positives = 535/1275 (41%), Gaps = 139/1275 (10%)

Query: 1592 FRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQ 1651
            F +H  TG +   R LDRE+R +H   V A+  G     A   + + V DVND +P F  
Sbjct: 116  FHVHPDTGIIRTARRLDRERR-DHYSFVAATLLG-----AVVQVEIRVNDVNDHSPRFPL 169

Query: 1652 QEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSESFSLDP------------- 1698
                + + E +PPGT+     A DPD G      Y  V       DP             
Sbjct: 170  DSLQLDVSELSPPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPG 229

Query: 1699 --------------DTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDE 1744
                          +   L  LR LDREE     L + A D G P +   ++V + V DE
Sbjct: 230  PLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWDGGRPRRTGLLSVELRVLDE 289

Query: 1745 NDHAPTFGSAHLSLEVPEGQDPQT-LTMLRASDPDVGANGQLQYRILDGDPSGA------ 1797
            ND+ P F        V E   P   +  +RA+D D+G NG ++Y +      GA      
Sbjct: 290  NDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGA 349

Query: 1798 ------FVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDH 1851
                  F ++  SG     RPLDRE +   QL +EARDGG     AT+ +++ VLD ND+
Sbjct: 350  LGDAAYFAVEELSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDN 409

Query: 1852 APAFPVPAYS----VEVPEDVPAGTLLLQLQAHDPDAG------ANGHVTYYLGAGTA-- 1899
             PA  V   +      V E    G  + ++   D D        A G +   LG G+   
Sbjct: 410  RPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGELGVGLGDGSISL 469

Query: 1900 ------GAFLLEPSSGE----LRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTIT 1949
                  G F L P        L     LDRE    Y   + A D A + PLST  ++ + 
Sbjct: 470  SLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATD-AGSPPLSTEETLLLR 528

Query: 1950 VRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRD-AGAN------------ 1996
            V D+ND  P F     +  +       + P   +  + A D D AG++            
Sbjct: 529  VADLNDQPPLFSQQHYKASVSEA----AAPGTVVMWVSASDADEAGSDHAWLRYTVVQLS 584

Query: 1997 -----ASILYRLAGTPP--PGTTVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARS 2049
                  S+  ++  T    P   +DS +G I   R+          L +VA DLG P  S
Sbjct: 585  APCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQDLGEPPLS 644

Query: 2050 ATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHA-GGTNGPITYSILS 2108
            AT ++ + +    +  P F R    ATI E+AP G   +   A  A  G  G I YS+  
Sbjct: 645  ATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQVTASDADSGLYGFIEYSLYD 704

Query: 2109 G----NEKGTFSIQPSTGAITVRSAEGLDFEVSPRLR--LVLQAESGGAFAFTVLTLTLQ 2162
            G         F I P  G I V  ++ +D E  P     LV   + GG  A   + + L+
Sbjct: 705  GFLSYEAPQAFRIDPHDGQICV--SQDIDRERDPATYDLLVEAKDGGGLSAQAFVRVDLE 762

Query: 2163 DANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHV 2222
            D NDN P F    YV  + +       ++ V A D D G  G ++Y L     +  LF +
Sbjct: 763  DVNDNHPVFNPSTYVTSISDETQPGTEIINVLATDQDSGIYGTVAYELIPGNVS-SLFTI 821

Query: 2223 DPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP-W 2281
            D TTG I  T  L         L++ A D G    V +A +T+ +  T        +P +
Sbjct: 822  DSTTGIIYLTLPLSHLESTTLSLMVSAQDGGGLTAVINADVTIHIFQTTLAPAEFERPKY 881

Query: 2282 ELRVSEDALLGSEIAQVTGND-VDSGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFE 2340
               V ED    S I  V   + ++S   ++Y +S       FS+    G +    PLD E
Sbjct: 882  TFLVYEDVPEDSPIGTVKAREPLNSSEPIFYRISSGDLGGKFSIHPRLGTIRTRKPLDHE 941

Query: 2341 QCDRYQLQLLAHDG--PHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSV 2398
                  L + A  G  P      + + V DVNDN PAF ++  ++ + + TPPG+A+   
Sbjct: 942  TQPVVVLTVQAQLGSAPACSSTEVNITVMDVNDNHPAFLRTSDEIRISQTTPPGTALYLA 1001

Query: 2399 SATDRDSGANGHISYHLASPADG-FSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDH 2457
             A DRDSG NG I Y +ASP  G F++D   G LF      +LG      + + L A D 
Sbjct: 1002 RAEDRDSGRNGLIRYSIASPQPGVFAIDRALGVLFL---NGSLGAGEQRELTLTLRAEDQ 1058

Query: 2458 GAPGRAARATVHVQLQDQNDHAPSFTLSH--YRVAVTEDLPPGSTLLTLEATDADGSRSH 2515
            G   +AA   + V ++ + +H+PS+T  H  Y+V V+E L P + +L  +A      R+ 
Sbjct: 1059 GVHPQAALLVLTVVIE-KREHSPSWTFEHLVYQVEVSESLSPMTQMLQTQAHPLGPQRAA 1117

Query: 2516 AAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAA- 2574
            + + YS           LEP +  A     P     G + L    D+ES   YN  V A 
Sbjct: 1118 SPLRYS-----------LEPSVDSAMFGIRP---YTGWIYLRRQFDYESTQTYNFRVFAW 1163

Query: 2575 ADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPH 2634
                   Q+    V V V D NDN P F      + V E       +  + A D D G +
Sbjct: 1164 IPEDGFLQNVSTTVIVRVWDENDNSPTFLHDVLFLKVEESPVPQGVIGKITAIDMDSGKN 1223

Query: 2635 G-LVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGA-HFALAPV 2692
            G L+ F +S G     F+++ ++G L    ALD E +  H++ V   D       A   V
Sbjct: 1224 GQLLYFLLSDGK---FFKMNPNTGELINWVALDREHRGHHEMTVLVTDRGSPPRNATMAV 1280

Query: 2693 TIEVQDVNDHGPAFPLNL----LSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEA 2748
             + V D+ND+ P FP  L    L   V E QP   LVTT+ A D D G    + YS+  A
Sbjct: 1281 YVSVTDINDNRPFFPQCLPGKELHVKVLEGQPVNMLVTTVFAKDPDEGNNAEVTYSVSSA 1340

Query: 2749 GPGP-EGREAFALNS 2762
             P P +G+ AF   S
Sbjct: 1341 RPMPLKGKTAFGKQS 1355



 Score =  351 bits (900), Expect = 8e-96
 Identities = 386/1338 (28%), Positives = 548/1338 (40%), Gaps = 197/1338 (14%)

Query: 375  VSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYL----------- 423
            V E  PP  LV  I    P            + G G F     D    L           
Sbjct: 73   VDEGLPPDTLVGDIRAGLPA--------AQQQEGSGFFLSEDSDDSPLLDDFHVHPDTGI 124

Query: 424  VCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLP 483
            +  ARRLDRE RD Y+  V AT  G     A     + V DVND++P F     + + + 
Sbjct: 125  IRTARRLDRERRDHYSF-VAATLLG-----AVVQVEIRVNDVNDHSPRFPLDSLQLD-VS 177

Query: 484  EVALPGSFVVRVTARDPDQG-----------------------------TNGQVTYSLAP 514
            E++ PG+      A DPD G                             T G +   L P
Sbjct: 178  ELSPPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLP 237

Query: 515  GAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDN 574
            G+ +    +D     +     LD E     +L + A DGG P      +V + + D NDN
Sbjct: 238  GSSSPLEPLD-----LVLLRRLDREEAAAHRLQIEAWDGGRPRRTGLLSVELRVLDENDN 292

Query: 575  EPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGA----GLGSSG----- 625
             P F++  Y A++ E  QPG    +V ATD D GP G + YS+ A    G GS G     
Sbjct: 293  PPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGD 352

Query: 626  SPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMVYVKVFLS--DENDNPP 683
            +  F ++  SG V   R LDR+   +     V A DGG    +  V+V ++  D NDN P
Sbjct: 353  AAYFAVEELSGVVRVWRPLDRE-AQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRP 411

Query: 684  Q----FYPREYAASISAQSPPGTAVLRLRAHDPD-------------------------- 713
                 F      A +S  + PG  V R+   D D                          
Sbjct: 412  AIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGELGVGLGDGSISLSL 471

Query: 714  QGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPS 773
            +G  G   + +L G  P +F        L V  PL R +  + +L + A D G       
Sbjct: 472  EGGEG--DFALLPGGPPGVF-------FLCVEGPLDRESRDLYELLLVATDAGSPPLSTE 522

Query: 774  ARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPPG--------RLAPVT 825
              + + +      PP+F Q  Y  SV E  APGT V  V A +           R   V 
Sbjct: 523  ETLLLRVADLNDQPPLFSQQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQ 582

Query: 826  LS------------LSGGDPRGLFSLDAVSGLLQTLRPLDRELLGPVLELEVRAGSGVPP 873
            LS            +   +    F++D+ SG + T+R LDRE+   V    V    G PP
Sbjct: 583  LSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQDLGEPP 642

Query: 874  AFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTL 933
              A   V + +DDVNDN P F        +  +   G     + A D DSG+   + ++L
Sbjct: 643  LSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQVTASDADSGLYGFIEYSL 702

Query: 934  LAG-----GGGAFTVDPTTGHVRLMRPLGPSGGPA-HELELEARDGGSPPRTSHFRLRVV 987
              G        AF +DP  G + + + +     PA ++L +EA+DGG    ++   +RV 
Sbjct: 703  YDGFLSYEAPQAFRIDPHDGQICVSQDIDRERDPATYDLLVEAKDGGG--LSAQAFVRVD 760

Query: 988  VQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGG---PITYHLAAEGASSP 1044
            ++DV      P FN  TY   +   T  GT+++ V A   D G    + Y L     SS 
Sbjct: 761  LEDVNDNH--PVFNPSTYVTSISDETQPGTEIINVLATDQDSGIYGTVAYELIPGNVSSL 818

Query: 1045 FGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSI-LNQNEHSP 1103
            F ++  +G +++   L         L V A  G     G  T      V+I + Q   +P
Sbjct: 819  FTIDSTTGIIYLTLPLSHLESTTLSLMVSAQDG-----GGLTAVINADVTIHIFQTTLAP 873

Query: 1104 RLSEDP--TFLAVAENQPPGTSVGRVFATD--RDSGPNGRLTYSLQQLSEDSKAFRIHPQ 1159
               E P  TFL V E+ P  + +G V A +    S P   + Y +       K F IHP+
Sbjct: 874  AEFERPKYTFL-VYEDVPEDSPIGTVKAREPLNSSEP---IFYRISSGDLGGK-FSIHPR 928

Query: 1160 TGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAG 1219
             G + T + LD E Q    L VQ Q G +P  S+T  V++ V+D+NDN P FL+ S    
Sbjct: 929  LGTIRTRKPLDHETQPVVVLTVQAQLGSAPACSST-EVNITVMDVNDNHPAFLRTSDE-- 985

Query: 1220 GGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHSGELLTAAPL 1279
                I++    PPGT +   +A+D D G NG I Y++  P   +F++    G L     L
Sbjct: 986  ----IRISQTTPPGTALYLARAEDRDSGRNGLIRYSIASPQPGVFAIDRALGVLFLNGSL 1041

Query: 1280 IRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVP-VVLT 1338
               E+    LTL A DQG  P++A L L V +           +  E  P+     +V  
Sbjct: 1042 GAGEQRELTLTLRAEDQGVHPQAALLVLTVVI-----------EKREHSPSWTFEHLVYQ 1090

Query: 1339 VTAAEGLRP-GSLLGSVAAP--EPAGVGALTYTLVGGADPEGTFALDAASGRLYLARPLD 1395
            V  +E L P   +L + A P         L Y+L    D    F +   +G +YL R  D
Sbjct: 1091 VEVSESLSPMTQMLQTQAHPLGPQRAASPLRYSLEPSVD-SAMFGIRPYTGWIYLRRQFD 1149

Query: 1396 FEAGPPWRALTVRAEGP--GGAGARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGA 1453
            +E+   +    V A  P  G        V V+V DEN+++P F  D L L + E+P P  
Sbjct: 1150 YESTQTYN-FRVFAWIPEDGFLQNVSTTVIVRVWDENDNSPTFLHDVLFLKVEESPVPQG 1208

Query: 1454 ALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLV 1513
             +    A D D  G N  + Y LL         +++  TG L     LDRE      + V
Sbjct: 1209 VIGKITAIDMDS-GKNGQLLYFLLSDG---KFFKMNPNTGELINWVALDREHRGHHEMTV 1264

Query: 1514 EATDRPANASRRRAARVSARVFVTDENDNAPVF-----ASPSRVRLPEDQPPGPAALHVV 1568
              TDR    S  R A ++  V VTD NDN P F          V++ E QP       V 
Sbjct: 1265 LVTDR---GSPPRNATMAVYVSVTDINDNRPFFPQCLPGKELHVKVLEGQPVNMLVTTVF 1321

Query: 1569 ARDPDLGEAARVSYRLAS 1586
            A+DPD G  A V+Y ++S
Sbjct: 1322 AKDPDEGNNAEVTYSVSS 1339



 Score =  347 bits (891), Expect = 9e-95
 Identities = 391/1334 (29%), Positives = 573/1334 (42%), Gaps = 145/1334 (10%)

Query: 860  VLELEVRAGSGVPPAFAVARVRV-------------LLDDVNDNSPAFPAPEDTVLLPPN 906
            +  L +    G+PP   V  +R               L + +D+SP      D   + P+
Sbjct: 66   LFNLTLSVDEGLPPDTLVGDIRAGLPAAQQQEGSGFFLSEDSDDSPLL----DDFHVHPD 121

Query: 907  TAPGTPIYTLRALDPDSGVN-SRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHE 965
            T     I T R LD +   + S V  TLL   G    V+     V    P  P       
Sbjct: 122  TGI---IRTARRLDRERRDHYSFVAATLL---GAVVQVEIRVNDVNDHSPRFP----LDS 171

Query: 966  LELEARDGGSPPRTSHFRLRVVVQ-DVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQA 1024
            L+L+  +  SPP T+ FRL V    D G       F++  Y +  PS           Q 
Sbjct: 172  LQLDVSEL-SPPGTA-FRLPVAHDPDAGL------FSTQGYTLVQPSDLPKDPAGPFFQL 223

Query: 1025 QAPDGGPITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQ 1084
            +    GP+   L   G+SSP  LEP    L +   LDRE    + L++ A  G +    +
Sbjct: 224  RYRTPGPLPSPLLP-GSSSP--LEPLD--LVLLRRLDREEAAAHRLQIEAWDGGRP---R 275

Query: 1085 QTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSL 1144
            +TG  +V + +L++N++ P   +D    AV E+  PG  V RV ATDRD GPNG + YS+
Sbjct: 276  RTGLLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSV 335

Query: 1145 QQLSE-----------DSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRST 1193
            +               D+  F +   +G V   + LDRE Q+ +QL+V+ +DGG+ P   
Sbjct: 336  RARQVPGAGSGGGALGDAAYFAVEELSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVA 395

Query: 1194 TGTVHVAVLDLNDNSPT----FLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPD---- 1245
            T  V +AVLD+NDN P     FL   G A      +V +   PG  V  +   D D    
Sbjct: 396  TVRVSIAVLDVNDNRPAIHVLFLTEGGVA------RVSEGARPGDYVARVSVSDADGDWE 449

Query: 1246 -EGENGTILYTLTGPGSELFSLHPHSGE-------------LLTAAPLIRAERPHYVLTL 1291
             E E    L    G GS   SL    G+             L    PL R  R  Y L L
Sbjct: 450  KEDEATGELGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLL 509

Query: 1292 SAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAER-------DPAAPVPVVLTVTAAEG 1344
             A D GSPP S    LL++V   A L + PP  +++       + AAP  VV+ V+A++ 
Sbjct: 510  VATDAGSPPLSTEETLLLRV---ADLNDQPPLFSQQHYKASVSEAAAPGTVVMWVSASDA 566

Query: 1345 LRPGS-----LLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAASGRLYLARPLDFEAG 1399
               GS         V    P  +G+L   +V  A+   +FA+D+ SG +   R LD E  
Sbjct: 567  DEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQ 626

Query: 1400 PPWRALTVRAE-GPGGAGARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTF 1458
                   V  + G     A  L V + V D N++ P F R      + E+   G      
Sbjct: 627  EAVELKVVAQDLGEPPLSATCL-VSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQV 685

Query: 1459 RASDADGPGPNSDVRYRL----LRQEPPVPALRLDARTGALSAPRGLDRETTPALL-LLV 1513
             ASDAD  G    + Y L    L  E P  A R+D   G +   + +DRE  PA   LLV
Sbjct: 686  TASDADS-GLYGFIEYSLYDGFLSYEAP-QAFRIDPHDGQICVSQDIDRERDPATYDLLV 743

Query: 1514 EATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRV-RLPEDQPPGPAALHVVARDP 1572
            EA D         +A+   RV + D NDN PVF   + V  + ++  PG   ++V+A D 
Sbjct: 744  EAKD-----GGGLSAQAFVRVDLEDVNDNHPVFNPSTYVTSISDETQPGTEIINVLATDQ 798

Query: 1573 DLGEAARVSYRLASGG-DGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSA 1631
            D G    V+Y L  G     F + S+TG + +  PL   +     L V A D G      
Sbjct: 799  DSGIYGTVAYELIPGNVSSLFTIDSTTGIIYLTLPLSHLESTTLSLMVSAQDGGGLTAVI 858

Query: 1632 TQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTY---GG 1688
               +T+ +         F++ +Y+ L+ E+ P  + + T++A +P + ++  + Y    G
Sbjct: 859  NADVTIHIFQTTLAPAEFERPKYTFLVYEDVPEDSPIGTVKAREP-LNSSEPIFYRISSG 917

Query: 1689 VSSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHA 1748
                 FS+ P  G + T + LD E Q  + LTV AQ  GS P  +   V + V D ND+ 
Sbjct: 918  DLGGKFSIHPRLGTIRTRKPLDHETQPVVVLTVQAQ-LGSAPACSSTEVNITVMDVNDNH 976

Query: 1749 PTFGSAHLSLEVPEGQDPQT-LTMLRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEF 1807
            P F      + + +   P T L + RA D D G NG ++Y I    P G F +D A G  
Sbjct: 977  PAFLRTSDEIRISQTTPPGTALYLARAEDRDSGRNGLIRYSIASPQP-GVFAIDRALGVL 1035

Query: 1808 GTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPA--FPVPAYSVEVP 1865
                 L    +    L + A D G    +A L+LTV V++  +H+P+  F    Y VEV 
Sbjct: 1036 FLNGSLGAGEQRELTLTLRAEDQGVHPQAALLVLTV-VIEKREHSPSWTFEHLVYQVEVS 1094

Query: 1866 EDVPAGTLLLQLQAH--DPDAGANGHVTYYLGAGTAGA-FLLEPSSGELRTAAALDREQC 1922
            E +   T +LQ QAH   P   A+  + Y L      A F + P +G +      D E  
Sbjct: 1095 ESLSPMTQMLQTQAHPLGPQRAAS-PLRYSLEPSVDSAMFGIRPYTGWIYLRRQFDYEST 1153

Query: 1923 PSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLA 1982
             +Y F V A         + + +V + V D ND++PTF    L L++         P   
Sbjct: 1154 QTYNFRVFAWIPEDGFLQNVSTTVIVRVWDENDNSPTFLHDVLFLKVEES----PVPQGV 1209

Query: 1983 LATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDR---VLFIV 2039
            +  + A D D+G N  +LY L  +      ++  TGE+    + VAL    R    + ++
Sbjct: 1210 IGKITAIDMDSGKNGQLLYFLL-SDGKFFKMNPNTGEL---INWVALDREHRGHHEMTVL 1265

Query: 2040 ATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPI-VSPRAVHA--- 2095
             TD G P R+AT  + V +    +  P FP+      +      G P+ +    V A   
Sbjct: 1266 VTDRGSPPRNATMAVYVSVTDINDNRPFFPQCLPGKELHVKVLEGQPVNMLVTTVFAKDP 1325

Query: 2096 -GGTNGPITYSILS 2108
              G N  +TYS+ S
Sbjct: 1326 DEGNNAEVTYSVSS 1339



 Score =  346 bits (888), Expect = 2e-94
 Identities = 384/1343 (28%), Positives = 567/1343 (42%), Gaps = 182/1343 (13%)

Query: 1623 DHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANG 1682
            D G PP +        V D+    P  QQQE S      +   + LL             
Sbjct: 74   DEGLPPDTL-------VGDIRAGLPAAQQQEGSGFFLSEDSDDSPLL------------- 113

Query: 1683 QVTYGGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVE 1742
                     + F + PDTG++ T R LDRE ++  +  V A   G+  Q     V + V 
Sbjct: 114  ---------DDFHVHPDTGIIRTARRLDRERRDHYSF-VAATLLGAVVQ-----VEIRVN 158

Query: 1743 DENDHAPTFGSAHLSLEVPEGQDPQTLTMLR-ASDPDVGANGQLQYRI-----LDGDPSG 1796
            D NDH+P F    L L+V E   P T   L  A DPD G      Y +     L  DP+G
Sbjct: 159  DVNDHSPRFPLDSLQLDVSELSPPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAG 218

Query: 1797 AFVL-----------DLASGEFGTMRPLD--------REVEPAFQLRIEARDGGQPALSA 1837
             F              L  G    + PLD        RE   A +L+IEA DGG+P  + 
Sbjct: 219  PFFQLRYRTPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWDGGRPRRTG 278

Query: 1838 TLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYL--- 1894
             L + + VLD ND+ P F    Y   V ED   G  + +++A D D G NG V Y +   
Sbjct: 279  LLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRAR 338

Query: 1895 ---GAGTAGA-------FLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTV 1944
               GAG+ G        F +E  SG +R    LDRE    +   V A DG A  P   TV
Sbjct: 339  QVPGAGSGGGALGDAAYFAVEELSGVVRVWRPLDREAQAWHQLVVEARDGGAE-PEVATV 397

Query: 1945 SVTITVRDVNDHAPT----FPTSPLRLRLP---RPGPSFSTPTLALAT--LRAEDRDAG- 1994
             V+I V DVND+ P     F T     R+    RPG   +  +++ A      ED   G 
Sbjct: 398  RVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGE 457

Query: 1995 -----ANASILYRLAGTP---------PPGTTVDSYTGEIRVARSPVALGPRDRV-LFIV 2039
                  + SI   L G           PPG       G       P+    RD   L +V
Sbjct: 458  LGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEG-------PLDRESRDLYELLLV 510

Query: 2040 ATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIV---SPRAVHAG 2096
            ATD G P  S    +++ +    ++ P F +   +A++ E A PGT ++   +  A  AG
Sbjct: 511  ATDAGSPPLSTEETLLLRVADLNDQPPLFSQQHYKASVSEAAAPGTVVMWVSASDADEAG 570

Query: 2097 GTNGPITYSILSGN----------------EKG-TFSIQPSTGAI-TVRSAEGLDFEVSP 2138
              +  + Y+++  +                E G +F+I   +GAI T+R+   LD EV  
Sbjct: 571  SDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRT---LDREVQE 627

Query: 2139 RLRLVLQAESGGA---FAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEA 2195
             + L + A+  G     A  ++++T+ D NDN P F R  Y A + E  P+    LQV A
Sbjct: 628  AVELKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQVTA 687

Query: 2196 DDLDQGSGGQISYSLA---ASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDR 2252
             D D G  G I YSL     S  A   F +DP  G I  +  +DRE    T  +L+    
Sbjct: 688  SDADSGLYGFIEYSLYDGFLSYEAPQAFRIDPHDGQICVSQDIDRERDPATYDLLVEAKD 747

Query: 2253 GSPALVGSATLTVMVIDTNDNRPTI-PQPWELRVSEDALLGSEIAQVTGNDVDSG--PVL 2309
            G   L   A + V + D NDN P   P  +   +S++   G+EI  V   D DSG    +
Sbjct: 748  GG-GLSAQAFVRVDLEDVNDNHPVFNPSTYVTSISDETQPGTEIINVLATDQDSGIYGTV 806

Query: 2310 WYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEG---RANLTVLV 2366
             Y L P      F++    G + LT PL   +     L + A DG        A++T+ +
Sbjct: 807  AYELIPGNVSSLFTIDSTTGIIYLTLPLSHLESTTLSLMVSAQDGGGLTAVINADVTIHI 866

Query: 2367 EDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADG--FSV 2424
                     F +  Y  ++ E  P  S I +V A +    ++  I Y ++S   G  FS+
Sbjct: 867  FQTTLAPAEFERPKYTFLVYEDVPEDSPIGTVKARE-PLNSSEPIFYRISSGDLGGKFSI 925

Query: 2425 DPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTL 2484
             P  GT+ T      L H+    V + ++A+   AP   +   V++ + D ND+ P+F  
Sbjct: 926  HPRLGTIRT---RKPLDHETQPVVVLTVQAQLGSAPA-CSSTEVNITVMDVNDNHPAFLR 981

Query: 2485 SHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESA 2544
            +   + +++  PPG+ L    A D D  R+   + YSI S   G VF ++          
Sbjct: 982  TSDEIRISQTTPPGTALYLARAEDRDSGRN-GLIRYSIASPQPG-VFAID---------- 1029

Query: 2545 GPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPP-VFT 2603
                RALG L L   L      +  LT+ A D+G  PQ++++ +TV +     +P   F 
Sbjct: 1030 ----RALGVLFLNGSLGAGEQRELTLTLRAEDQGVHPQAALLVLTVVIEKREHSPSWTFE 1085

Query: 2604 RASYRVTVPEDTPVGAELLHVEASDADPGPHGL-VRFTVSSGDPSGLFELDESSGTLRLA 2662
               Y+V V E      ++L  +A    P      +R+++     S +F +   +G + L 
Sbjct: 1086 HLVYQVEVSESLSPMTQMLQTQAHPLGPQRAASPLRYSLEPSVDSAMFGIRPYTGWIYLR 1145

Query: 2663 HALDCETQARHQLVVQAADPAGAHFALAPVTIEVQ--DVNDHGPAFPLNLLSTSVAENQP 2720
               D E+   +   V A  P          T+ V+  D ND+ P F  ++L   V E+  
Sbjct: 1146 RQFDYESTQTYNFRVFAWIPEDGFLQNVSTTVIVRVWDENDNSPTFLHDVLFLKVEESPV 1205

Query: 2721 PGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTES 2780
            P  ++  + AID D+G  G+L Y LL  G      + F +N +TGEL   V  D EH   
Sbjct: 1206 PQGVIGKITAIDMDSGKNGQLLYFLLSDG------KFFKMNPNTGELINWVALDREHRGH 1259

Query: 2781 FRLLVGAADAGNLSASVTVSVLVTGEDEYD--PVF----LAPAFHFQVPEGARRGHSLGH 2834
              + V   D G+   + T++V V+  D  D  P F         H +V EG      +  
Sbjct: 1260 HEMTVLVTDRGSPPRNATMAVYVSVTDINDNRPFFPQCLPGKELHVKVLEGQPVNMLVTT 1319

Query: 2835 VQATDEDGGADGLVLYSLATSSP 2857
            V A D D G +  V YS++++ P
Sbjct: 1320 VFAKDPDEGNNAEVTYSVSSARP 1342



 Score =  337 bits (864), Expect = 1e-91
 Identities = 357/1279 (27%), Positives = 531/1279 (41%), Gaps = 171/1279 (13%)

Query: 1755 HLSLEVPEGQDPQTLTM-----LRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGT 1809
            +L+L V EG  P TL       L A+    G+   L     D      F +   +G   T
Sbjct: 68   NLTLSVDEGLPPDTLVGDIRAGLPAAQQQEGSGFFLSEDSDDSPLLDDFHVHPDTGIIRT 127

Query: 1810 MRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVP 1869
             R LDRE    +             L A + + + V D NDH+P FP+ +  ++V E  P
Sbjct: 128  ARRLDRERRDHYSFVAAT------LLGAVVQVEIRVNDVNDHSPRFPLDSLQLDVSELSP 181

Query: 1870 AGTLLLQLQAHDPDAGANGHVTYYLGAGT------AGAF--------------LLEPSSG 1909
             GT      AHDPDAG      Y L   +      AG F              LL  SS 
Sbjct: 182  PGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSSS 241

Query: 1910 ELRTA-----AALDREQCPSYTFSVSAVDGAAAGPLST-TVSVTITVRDVNDHAPTFPTS 1963
             L          LDRE+  ++   + A DG    P  T  +SV + V D ND+ P F   
Sbjct: 242  PLEPLDLVLLRRLDREEAAAHRLQIEAWDGGR--PRRTGLLSVELRVLDENDNPPVFEQD 299

Query: 1964 PLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGT------------ 2011
              R  +       + P   +  +RA DRD G N  + Y +     PG             
Sbjct: 300  EYRAAVRED----AQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAY 355

Query: 2012 -TVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPR--- 2067
              V+  +G +RV R           L + A D G     AT  + + +    +  P    
Sbjct: 356  FAVEELSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHV 415

Query: 2068 -FPRASSEATIRENAPPGTPIVSPRAVHAGGT----------------NGPITYSILSGN 2110
             F      A + E A PG  +       A G                 +G I+ S+  G 
Sbjct: 416  LFLTEGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGELGVGLGDGSISLSLEGG- 474

Query: 2111 EKGTFSIQPS--TGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFTV---LTLTLQDAN 2165
             +G F++ P    G   +     LD E      L+L A   G+   +    L L + D N
Sbjct: 475  -EGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLN 533

Query: 2166 DNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSG------------------GQIS 2207
            D  P F + HY A + E+      ++ V A D D+                     G + 
Sbjct: 534  DQPPLFSQQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQ 593

Query: 2208 YSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMV 2267
              +  +      F +D  +G I+T   LDRE+     L ++A D G P L  +  +++ V
Sbjct: 594  SKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQDLGEPPLSATCLVSITV 653

Query: 2268 IDTNDNRPTI-PQPWELRVSEDALLGSEIAQVTGNDVDSGPVLWY-------VLSPSGPQ 2319
             D NDN P    Q +   ++E A +G    QVT +D DSG   +         LS   PQ
Sbjct: 654  DDVNDNEPIFWRQVYNATIAEHAPVGHCFLQVTASDADSGLYGFIEYSLYDGFLSYEAPQ 713

Query: 2320 DPFSVGRYGGRVSLTGPLDFEQCDR-YQLQLLAHDGPH-EGRANLTVLVEDVNDNAPAFS 2377
              F +  + G++ ++  +D E+    Y L + A DG     +A + V +EDVNDN P F+
Sbjct: 714  -AFRIDPHDGQICVSQDIDRERDPATYDLLVEAKDGGGLSAQAFVRVDLEDVNDNHPVFN 772

Query: 2378 QSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHL--ASPADGFSVDPNNGTLFTIV 2435
             S Y   + + T PG+ I++V ATD+DSG  G ++Y L   + +  F++D   G ++   
Sbjct: 773  PSTYVTSISDETQPGTEIINVLATDQDSGIYGTVAYELIPGNVSSLFTIDSTTGIIYL-- 830

Query: 2436 GTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDL 2495
             T+ L H  S  + +++ A+D G       A V + +         F    Y   V ED+
Sbjct: 831  -TLPLSHLESTTLSLMVSAQDGGGLTAVINADVTIHIFQTTLAPAEFERPKYTFLVYEDV 889

Query: 2496 PPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLV 2555
            P  S + T++A +     S   + Y I SG+ G  F + PRL              G + 
Sbjct: 890  PEDSPIGTVKAREP--LNSSEPIFYRISSGDLGGKFSIHPRL--------------GTIR 933

Query: 2556 LLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDT 2615
              +PLD E+     LTV A   G  P  S   V +TV+DVNDN P F R S  + + + T
Sbjct: 934  TRKPLDHETQPVVVLTVQA-QLGSAPACSSTEVNITVMDVNDNHPAFLRTSDEIRISQTT 992

Query: 2616 PVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQL 2675
            P G  L    A D D G +GL+R++++S  P G+F +D + G L L  +L    Q    L
Sbjct: 993  PPGTALYLARAEDRDSGRNGLIRYSIASPQP-GVFAIDRALGVLFLNGSLGAGEQRELTL 1051

Query: 2676 VVQAADPAGAH--FALAPVTIEVQDVNDHGPAFPLNLL--STSVAENQPPGT--LVTTLH 2729
             ++A D  G H   AL  +T+ ++   +H P++    L     V+E+  P T  L T  H
Sbjct: 1052 TLRAEDQ-GVHPQAALLVLTVVIEK-REHSPSWTFEHLVYQVEVSESLSPMTQMLQTQAH 1109

Query: 2730 AIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTES--FRLLVGA 2787
             + G   A   LRYSL    P  +    F +   TG +  R  FDYE T++  FR+    
Sbjct: 1110 PL-GPQRAASPLRYSL---EPSVDSA-MFGIRPYTGWIYLRRQFDYESTQTYNFRVFAWI 1164

Query: 2788 ADAGNL-SASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGGADG 2846
             + G L + S TV V V  E++  P FL      +V E       +G + A D D G +G
Sbjct: 1165 PEDGFLQNVSTTVIVRVWDENDNSPTFLHDVLFLKVEESPVPQGVIGKITAIDMDSGKNG 1224

Query: 2847 LVLYSLATSSPYFGINQTTGAL--YLRVDSRAPGSGTATSGGGGRTRREAPRELRLEVIA 2904
             +LY L +   +F +N  TG L  ++ +D    G                  E+ + V  
Sbjct: 1225 QLLYFLLSDGKFFKMNPNTGELINWVALDREHRGH----------------HEMTVLVTD 1268

Query: 2905 RGPLPGSRSATVPVTVDIT 2923
            RG  P  R+AT+ V V +T
Sbjct: 1269 RGSPP--RNATMAVYVSVT 1285



 Score =  165 bits (418), Expect = 6e-40
 Identities = 178/660 (26%), Positives = 272/660 (41%), Gaps = 52/660 (7%)

Query: 94   IDEHSGVVRTARVLDREQRDR-YRFTAVTPDG----ATVEVTVRVADINDHAPAFPQARA 148
            ID H G +  ++ +DRE+    Y       DG    A   V V + D+ND+ P F  +  
Sbjct: 717  IDPHDGQICVSQDIDRERDPATYDLLVEAKDGGGLSAQAFVRVDLEDVNDNHPVFNPSTY 776

Query: 149  ALQVPEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELV 208
               + + T  GT      A D D+G  GT  Y L        F +++  G        + 
Sbjct: 777  VTSISDETQPGTEIINVLATDQDSGIYGTVAYELIPGNVSSLFTIDSTTGI-------IY 829

Query: 209  VTGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESL 268
            +T  L     +   L + A DGG       A + + +         F + +Y  +V E +
Sbjct: 830  LTLPLSHLESTTLSLMVSAQDGGGLTAVINADVTIHIFQTTLAPAEFERPKYTFLVYEDV 889

Query: 269  APGSPVLQVFASDADAGVNGAVTYEINRRQSEGD--GPFSIDAHTGLLQLERPLDFEQRR 326
               SP+  V A +     +  + Y I    S GD  G FSI    G ++  +PLD E + 
Sbjct: 890  PEDSPIGTVKAREP-LNSSEPIFYRI----SSGDLGGKFSIHPRLGTIRTRKPLDHETQP 944

Query: 327  VHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVA 386
            V  L VQA+ G A P   S  V + V D NDN P+    FL      ++S+  PPG  + 
Sbjct: 945  VVVLTVQAQLGSA-PACSSTEVNITVMDVNDNHPA----FLRTSDEIRISQTTPPGTALY 999

Query: 387  RISVSDPDDGDFAHVNVSLEGGE-GHFALSTQDSVIYLVCVARRLDREERDAYNLRVTAT 445
                 D D G    +  S+   + G FA+     V++L      L   E+    L + A 
Sbjct: 1000 LARAEDRDSGRNGLIRYSIASPQPGVFAIDRALGVLFL---NGSLGAGEQRELTLTLRAE 1056

Query: 446  DSGSPPLRAEAAFVLHVTDVNDNAPA--FDRQLYRPEPLPEVALPGSFVVRVTARD-PDQ 502
            D G  P  A     + V +  +++P+  F+  +Y+ E + E   P + +++  A     Q
Sbjct: 1057 DQGVHPQAALLVLTV-VIEKREHSPSWTFEHLVYQVE-VSESLSPMTQMLQTQAHPLGPQ 1114

Query: 503  GTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVA---TDGGLPPLA 559
                 + YSL P   +  F I P +G I      DYE        V A    DG L  + 
Sbjct: 1115 RAASPLRYSLEPSVDSAMFGIRPYTGWIYLRRQFDYESTQTYNFRVFAWIPEDGFLQNV- 1173

Query: 560  SSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGA 619
             S TV V + D NDN P F        + E   P     ++TA D DSG  G L Y L  
Sbjct: 1174 -STTVIVRVWDENDNSPTFLHDVLFLKVEESPVPQGVIGKITAIDMDSGKNGQLLYFL-- 1230

Query: 620  GLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMVYVKVFLS--D 677
                S    F+++ ++G++     LDR+      + TV   D G       + V++S  D
Sbjct: 1231 ---LSDGKFFKMNPNTGELINWVALDREHR-GHHEMTVLVTDRGSPPRNATMAVYVSVTD 1286

Query: 678  ENDNPPQFYP-----REYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPL 732
             NDN P F+P     +E    +    P    V  + A DPD+G++  ++Y + +    PL
Sbjct: 1287 INDNRP-FFPQCLPGKELHVKVLEGQPVNMLVTTVFAKDPDEGNNAEVTYSVSSARPMPL 1345



 Score = 32.3 bits (72), Expect = 8.0
 Identities = 39/154 (25%), Positives = 58/154 (37%), Gaps = 4/154 (2%)

Query: 2703 GPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNS 2762
            G +  L  L+ SV E  PP TLV  + A    A       + L E        + F ++ 
Sbjct: 61   GSSAQLFNLTLSVDEGLPPDTLVGDIRAGLPAAQQQEGSGFFLSEDSDDSPLLDDFHVHP 120

Query: 2763 STGELRARVPFDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYDPVFLAPAFHFQV 2822
             TG +R     D E  + +  +     A  L A V V + V   +++ P F   +    V
Sbjct: 121  DTGIIRTARRLDRERRDHYSFVA----ATLLGAVVQVEIRVNDVNDHSPRFPLDSLQLDV 176

Query: 2823 PEGARRGHSLGHVQATDEDGGADGLVLYSLATSS 2856
             E +  G +     A D D G      Y+L   S
Sbjct: 177  SELSPPGTAFRLPVAHDPDAGLFSTQGYTLVQPS 210


>gi|13787217 FAT tumor suppressor 2 precursor [Homo sapiens]
          Length = 4349

 Score =  802 bits (2072), Expect = 0.0
 Identities = 768/2772 (27%), Positives = 1204/2772 (43%), Gaps = 206/2772 (7%)

Query: 49   LQIDEEQPAGTLIGDISAGLP-AGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVL 107
            L++ E+ P GT++  + A  P  G A  + Y +      G      +D  +G +   R L
Sbjct: 932  LKVPEDLPPGTVLTFLDASDPDLGPAGEVRYVLM----DGAHGTFRVDLMTGALILEREL 987

Query: 108  DREQRDRYRFTAVTPDGAT-------VEVTVRVADIND--HAPAFPQARAALQVPEHTAF 158
            D E+R  Y  +    DG           V V V D+N+  H P F       QV E++  
Sbjct: 988  DFERRAGYNLSLWASDGGRPLARRTLCHVEVIVLDVNENLHPPHFASFVHQGQVQENSPS 1047

Query: 159  GTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENR 218
            GT+  +  A+D D+G  G   Y L        F +    G   T  P       LDRE  
Sbjct: 1048 GTQVIVVAAQDDDSGLDGELQYFLRAGTGLAAFSINQDTGMIQTLAP-------LDREFA 1100

Query: 219  SHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVF 278
            S+Y L + A D GS P  +   + + + D ND+ P  +Q+ ++  + E    G+ VLQ+ 
Sbjct: 1101 SYYWLTVLAVDRGSVPLSSVTEVYIEVTDANDNPPQMSQAVFYPSIQEDAPVGTSVLQLD 1160

Query: 279  ASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGG 338
            A D D+   G +T+ I      G   F I   TGLL   + LD E +  H L V   D G
Sbjct: 1161 AWDPDSSSKGKLTFNITSGNYMGF--FMIHPVTGLLSTAQQLDRENKDEHILEVTVLDNG 1218

Query: 339  AHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDF 398
                  ++ V V + D NDN P  +    +     ++S  +P    V R+  SD D+G  
Sbjct: 1219 EPSLKSTSRVVVGILDVNDNPPIFSHKLFNVRLPERLSPVSPGP--VYRLVASDLDEGLN 1276

Query: 399  AHVNVSLEGG-EGHFALSTQDSVIYLVCVARRLDREERDAYN-LRVTATDSGSPPLRAEA 456
              V  S+E   E  F++   D V  +V  +      E   YN L + ATDSG PPL A  
Sbjct: 1277 GRVTYSIEDSDEEAFSI---DLVTGVVSSSSTFTAGE---YNILTIKATDSGQPPLSASV 1330

Query: 457  AFVLHVTDVNDNAP-----AFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYS 511
               LH+  +    P     AFD   Y    +     P + +V V + +   G  G   ++
Sbjct: 1331 R--LHIEWIPWPRPSSIPLAFDETYYSFTVMETD--PVNHMVGVISVE---GRPGLFWFN 1383

Query: 512  LAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDV 571
            ++ G     F I+ T+G I  A  LD        L V  TDG    +A+   + + + ++
Sbjct: 1384 ISGGDKDMDFDIEKTTGSIVIARPLDTRRRSNYNLTVEVTDGSRT-IATQVHIFM-IANI 1441

Query: 572  NDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRI 631
            N + PQF  T Y   +P+ T PG   L+V A D D G    L Y++        +  F++
Sbjct: 1442 NHHRPQFLETRYEVRVPQDTVPGVELLRVQAIDQDKGKS--LIYTIHGSQDPGSASLFQL 1499

Query: 632  DAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGG--LKSMVYVKVFLSDENDNPPQFYPRE 689
            D  SG + T   LD   GPS    TV   D      ++ V+V + + D N +PP+F    
Sbjct: 1500 DPSSGVLVTVGKLDLGSGPSQHTLTVMVRDQEIPIKRNFVWVTIHVEDGNLHPPRFTQLH 1559

Query: 690  YAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLA 749
            Y AS+     PGT +L++RA D D+G +  + Y +L GNS   F ++   G++T+A  L 
Sbjct: 1560 YEASVPDTIAPGTELLQVRAMDADRGVNAEVHYSLLKGNSEGFFNINALLGIITLAQKLD 1619

Query: 750  RRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSV 809
            +  ++   L + AED G  Q    A V I + P   + PIF + +Y   +PE +  G+ +
Sbjct: 1620 QANHAPHTLTVKAEDQGSPQWHDLATVIIHVYPSDRSAPIFSKSEYFVEIPESIPVGSPI 1679

Query: 810  GIVQAHNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGPVLELEVRAGS 869
             +V A +P    + VT  L  G+  G+FS+++ SGL+ T + LD E +    +L++R GS
Sbjct: 1680 LLVSAMSP----SEVTYELREGNKDGVFSMNSYSGLISTQKKLDHEKISS-YQLKIR-GS 1733

Query: 870  GVPPAFAVARVRVLLDDVNDNSPAF-----------PAPEDTVLLPPNTAPGTPIYTLRA 918
             +  AF    V V + D NDN+P F            AP  ++++  N  P    + + A
Sbjct: 1734 NMAGAFTDVMVVVDIIDENDNAPMFLKSTFVGQISEAAPLYSMIMDKNNNP----FVIHA 1789

Query: 919  LDPDSGVNSRVTFTLLAGGG-GAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPP 977
             D D   NS + + +L       F +DP+ G + ++  +     P+ +  +   D GSP 
Sbjct: 1790 SDSDKEANSLLVYKILEPEALKFFKIDPSMGTLTIVSEMDYESMPSFQFCVYVHDQGSPV 1849

Query: 978  RTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGPITYHLA 1037
              +    +V++         PRF+   Y V +      G ++L V+A   D   + Y + 
Sbjct: 1850 LFAPRPAQVIIHVRDVNDSPPRFSEQIYEVAIVGPIHPGMELLMVRASDED-SEVNYSIK 1908

Query: 1038 AEGASSPFGLEPQSGWLWV-RAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSIL 1096
               A     + P +G + V   A    +++L I         +A  G    TA V++S+ 
Sbjct: 1909 TGNADEAVTIHPVTGSISVLNPAFLGLSRKLTI---------RASDGLYQDTALVKISLT 1959

Query: 1097 NQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRI 1156
               + S +  +D  + AV EN     ++  V    + +  N  L+Y    L   +  F +
Sbjct: 1960 QVLDKSLQFDQDVYWAAVKENLQDRKAL--VILGAQGNHLNDTLSYF---LLNGTDMFHM 2014

Query: 1157 HPQTGEVTTL-QTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQAS 1215
                G + T     DREQQ +++L V+V+D  +P R   G V V++ D+NDN P F    
Sbjct: 2015 VQSAGVLQTRGVAFDREQQDTHELAVEVRDNRTPQRVAQGLVRVSIEDVNDNPPKFKH-- 2072

Query: 1216 GAAGGGLPIQ--VPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHSGEL 1273
                  LP    + D   PG ++  + A D D G NG + Y         F + P+ G++
Sbjct: 2073 ------LPYYTIIQDGTEPGDVLFQVSATDEDLGTNGAVTYEF-AEDYTYFRIDPYLGDI 2125

Query: 1274 LTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDP---A 1330
                P        Y L + A D G+P   +  ++LV V   +      P    R P    
Sbjct: 2126 SLKKPFDYQALNKYHLKVIARDGGTPSLQSEEEVLVTVRNKSNPLFQSPYYKVRVPENIT 2185

Query: 1331 APVPVVLT-VTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAASGRLY 1389
               P++ T   + EGLR                  L Y +V   +P   F  D  +G L 
Sbjct: 2186 LYTPILHTQARSPEGLR------------------LIYNIV-EEEPLMLFTTDFKTGVLT 2226

Query: 1390 LARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDPLALALPENP 1449
            +  PLD+E+       TVRA            V+V V+D N++ P F++     ++ E  
Sbjct: 2227 VTGPLDYESKTK-HVFTVRATDTALGSFSEATVEVLVEDVNDNPPTFSQLVYTTSISEGL 2285

Query: 1450 EPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPA-LRLDARTGALSAPRGLDRETTPA 1508
                 +    ASD D  G N DV Y+++     V    +++  TG +S  + LD E    
Sbjct: 2286 PAQTPVIQLLASDQDS-GRNRDVSYQIVEDGSDVSKFFQINGSTGEMSTVQELDYEAQQH 2344

Query: 1509 LLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPS-RVRLPEDQPPGPAALHV 1567
              + V A D+               V V+D NDN P F  P     + E    G   L V
Sbjct: 2345 FHVKVRAMDK---GDPPLTGETLVVVNVSDINDNPPEFRQPQYEANVSELATCGHLVLKV 2401

Query: 1568 VARDPDLGEAARVSYRLASGG-DGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGS 1626
             A DPD  + +R+ Y + SG  D HF ++SS+G +S+     +   + + L V ASD   
Sbjct: 2402 QAIDPDSRDTSRLEYLILSGNQDRHFFINSSSGIISMFNLCKKHLDSSYNLRVGASD--- 2458

Query: 1627 PPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTY 1686
                AT  + ++  + N  +P FQQ  Y   L EN   GT ++ L A D D G  G + Y
Sbjct: 2459 GVFRATVPVYINTTNANKYSPEFQQHLYEAELAENAMVGTKVIDLLAIDKDSGPYGTIDY 2518

Query: 1687 ---GGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVED 1743
                 ++SE FS++P+ G + TL+ LDRE   E  + +    R    ++   TV++ + D
Sbjct: 2519 TIINKLASEKFSINPN-GQIATLQKLDRENSTERVIAIKVMARDGGGRVAFCTVKIILTD 2577

Query: 1744 ENDHAPTFGSAH--LSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILDGD-PSGAFVL 1800
            END+ P F ++   +S++    +D   + +L A D D G N  + Y +   D       +
Sbjct: 2578 ENDNPPQFKASEYTVSIQSNVSKDSPVIQVL-AYDADEGQNADVTYSVNPEDLVKDVIEI 2636

Query: 1801 DLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAY 1860
            +  +G       L           I+A+DGG P  ++ + + + V+      P F  P Y
Sbjct: 2637 NPVTGVVKVKDSLVGLENQTLDFFIKAQDGGPPHWNSLVPVRLQVVPKKVSLPKFSEPLY 2696

Query: 1861 SVEVPEDVPAGT---LLLQLQAHDPDAGANGHVTYYLGAGTA------GAFLLEPSSGEL 1911
            +   PED+P G+   ++  + A DP       V Y L  GT       G F L+P +G +
Sbjct: 2697 TFSAPEDLPEGSEIGIVKAVAAQDP-------VIYSLVRGTTPESNKDGVFSLDPDTGVI 2749

Query: 1912 RTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPR 1971
            +    +D E    Y   V A        + + VSV I V DVND+ P F   P +  L  
Sbjct: 2750 KVRKPMDHESTKLYQIDVMA-HCLQNTDVVSLVSVNIQVGDVNDNRPVFEADPYKAVLTE 2808

Query: 1972 PGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGT----TVDSYTGEIRVARSPV 2027
              P  +    ++  + A D+D G +  + YRL+  P         +DS +G I   +   
Sbjct: 2809 NMPVGT----SVIQVTAIDKDTGRDGQVSYRLSADPGSNVHELFAIDSESGWITTLQELD 2864

Query: 2028 ALGPRDRVLFIVATDLGRPAR-SATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTP 2086
                +     +VA D G+  + S+  ++ V +  E +  PRF       ++ EN+ PG  
Sbjct: 2865 CETCQTYHFHVVAYDHGQTIQLSSQALVQVSITDENDNAPRFASEEYRGSVVENSEPGEL 2924

Query: 2087 IVSPRAVHA--GGTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVL 2144
            + + + + A     N  +T  I  G+  G F I        + S + LD E + +  L +
Sbjct: 2925 VATLKTLDADISEQNRQVTCYITEGDPLGQFGISQVGDEWRISSRKTLDREHTAKYLLRV 2984

Query: 2145 QAESGGAFAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGG 2204
             A  G   A   + + + D NDN+P+  +  Y   + E       +L+V A DLD  +  
Sbjct: 2985 TASDGKFQASVTVEIFVLDVNDNSPQCSQLLYTGKVHEDVFPGHFILKVSATDLDTDTNA 3044

Query: 2205 QISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLT 2264
            QI+YSL    P    F +DP TG +TT   LDRE      LV  ATD G  +    A +T
Sbjct: 3045 QITYSLHG--PGAHEFKLDPHTGELTTLTALDRERKDVFNLVAKATDGGGRSC--QADIT 3100

Query: 2265 VMVIDTNDNRPT-IPQPWELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLS-PSGPQDPF 2322
            + V D NDN P   P    + V ++  + + +A V   D D G     V S P   +  F
Sbjct: 3101 LHVEDVNDNAPRFFPSHCAVAVFDNTTVKTPVAVVFARDPDQGANAQVVYSLPDSAEGHF 3160

Query: 2323 SVGRYGGRVSLTGPLDFEQCDRYQLQLLAHD----GPHEGRANLTVLVEDVNDNAPAFSQ 2378
            S+    G + L  PL        +L + A D     P      +TV V  + D  P F  
Sbjct: 3161 SIDATTGVIRLEKPLQVRPQAPLELTVRASDLGTPIPLSTLGTVTVSVVGLEDYLPVFLN 3220

Query: 2379 SLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTLFTIVGTV 2438
            + + V + E  PPG+ +L ++   R             +    F +D   G L+      
Sbjct: 3221 TEHSVQVPEDAPPGTEVLQLATLTRPGAEKTGYRVVSGNEQGRFRLDARTGILYV---NA 3277

Query: 2439 ALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPG 2498
            +L  + S    + +E     +   +   TV V + D N+H P F    Y   V E+   G
Sbjct: 3278 SLDFETSPKYFLSIECSRKSSSSLSDVTTVMVNITDVNEHRPQFPQDPYSTRVLENALVG 3337

Query: 2499 STLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLE 2558
              +LT+ ATD DG   ++ + YS+I GN    F + P+  E              L + +
Sbjct: 3338 DVILTVSATDEDGP-LNSDITYSLIGGNQLGHFTIHPKKGE--------------LQVAK 3382

Query: 2559 PLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVG 2618
             LD E  + Y+L + A D GQPP      + + V DVNDNPP F + +Y  TV E++P+G
Sbjct: 3383 ALDREQASSYSLKLRATDSGQPPLHEDTDIAIQVADVNDNPPRFFQLNYSTTVQENSPIG 3442

Query: 2619 AELLHVEASDADPGPHG-LVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVV 2677
            +++L +  SD D   +G    F ++ G+    F +    G L  A  L    Q  +QL +
Sbjct: 3443 SKVLQLILSDPDSPENGPPYSFRITKGNNGSAFRV-TPDGWLVTAEGLSRRAQEWYQLQI 3501

Query: 2678 QAADPAGAHF-ALAPVTIEVQDVNDHGP-AFPLNLLSTSVAENQPPGTLVTTLHAIDGDA 2735
            QA+D       +L  V + V + + + P A PL +  T V E++  G +V  +HA D D 
Sbjct: 3502 QASDSGIPPLSSLTSVRVHVTEQSHYAPSALPLEIFIT-VGEDEFQGGMVGKIHATDRDP 3560

Query: 2736 GAFGRLRYSLLE 2747
                 L YSL E
Sbjct: 3561 Q--DTLTYSLAE 3570



 Score =  775 bits (2001), Expect = 0.0
 Identities = 822/2986 (27%), Positives = 1295/2986 (43%), Gaps = 260/2986 (8%)

Query: 49   LQIDEEQPAGTLIGDISAGLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLD 108
            +Q+ E  P G+ +  +        A P + ++       VG  L  +  +G++ T +++D
Sbjct: 369  VQLSEFSPPGSRVVMVRVT----PAFPNLQYVLKPSSENVGFKL--NARTGLITTTKLMD 422

Query: 109  REQRDRYRFTAVTPDG-ATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPA 167
               R  Y+    T  G A+  V + + D N+HAP F ++     + E+   GT      A
Sbjct: 423  FHDRAHYQLHIRTSPGQASTVVVIDIVDCNNHAPLFNRSSYDGTLDENIPPGTSVLAVTA 482

Query: 168  RDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRE-NRSHYMLQLE 226
             D D G  G   Y+++G  A   F ++   G   T  P       +D E  +  Y  ++ 
Sbjct: 483  TDRDHGENGYVTYSIAGPKA-LPFSIDPYLGIISTSKP-------MDYELMKRIYTFRVR 534

Query: 227  AYDGGSPPRRAQAL-LDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAG 285
            A D GSP RR + + + + L ++ND+ P F +      + +    G  ++ + A D D  
Sbjct: 535  ASDWGSPFRREKEVSIFLQLRNLNDNQPMFEEVNCTGSIRQDWPVGKSIMTMSAIDVDEL 594

Query: 286  VNGAVTYEI-NRRQSEGDGPFSIDAHTGLLQLERP---LDFEQRRVHELVVQARDGGAHP 341
             N  + YEI +  + E    F ++  +G++ L+RP   L   Q   + L + A DG  + 
Sbjct: 595  QN--LKYEIVSGNELE---YFDLNHFSGVISLKRPFINLTAGQPTSYSLKITASDGKNYA 649

Query: 342  ELGSAFVTVHVRDAN--------------------------DNQPSMTVIFLS------- 368
               +  +TV V+D +                           NQ S    F S       
Sbjct: 650  SPTTLNITV-VKDPHFEVPVTCDKTGVLTQFTKTILHFIGLQNQESSDEEFTSLSTYQIN 708

Query: 369  ------ADGSPQ---VSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGG--EGHFALSTQ 417
                   D  PQ   V E+ P    +AR++ +DPD G    +   +  G  EG F +  +
Sbjct: 709  HYTPQFEDHFPQSIDVLESVPINTPLARLAATDPDAGFNGKLVYVIADGNEEGCFDIELE 768

Query: 418  DSVIYLVCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLY 477
                 L+ VA  LD E  + Y L VT  D G+P   +     ++V D NDNAP F    Y
Sbjct: 769  TG---LLTVAAPLDYEATNFYILNVTVYDLGTPQKSSWKLLTVNVKDWNDNAPRFPPGGY 825

Query: 478  RPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLD 537
            +   + E    G+ +  +T +D D   NG+V Y+L   + T  FS+ P +G +     LD
Sbjct: 826  Q-LTISEDTEVGTTIAELTTKDADSEDNGRVRYTLL--SPTEKFSLHPLTGELVVTGHLD 882

Query: 538  YELEPQPQLIVVATDGGLP--PLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGT 595
             E EP+  L V A D       L S   + + L+DVNDN PQ         +PE   PGT
Sbjct: 883  RESEPRYILKVEARDQPSKGHQLFSVTDLIITLEDVNDNSPQCITEHNRLKVPEDLPPGT 942

Query: 596  CFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDF 655
                + A+D D GP G + Y L  G   +    FR+D  +G +   R LD ++  + ++ 
Sbjct: 943  VLTFLDASDPDLGPAGEVRYVLMDGAHGT----FRVDLMTGALILERELDFER-RAGYNL 997

Query: 656  TVTAVDGG---GLKSMVYVKVFLSDENDN--PPQFYPREYAASISAQSPPGTAVLRLRAH 710
            ++ A DGG     +++ +V+V + D N+N  PP F    +   +   SP GT V+ + A 
Sbjct: 998  SLWASDGGRPLARRTLCHVEVIVLDVNENLHPPHFASFVHQGQVQENSPSGTQVIVVAAQ 1057

Query: 711  DPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQA 770
            D D G  G L Y + AG     F++++ +G++    PL R   S   L + A D G +  
Sbjct: 1058 DDDSGLDGELQYFLRAGTGLAAFSINQDTGMIQTLAPLDREFASYYWLTVLAVDRGSVPL 1117

Query: 771  EPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNP-PGRLAPVTLSLS 829
                 V I +      PP   Q  +  S+ ED   GTSV  + A +P       +T +++
Sbjct: 1118 SSVTEVYIEVTDANDNPPQMSQAVFYPSIQEDAPVGTSVLQLDAWDPDSSSKGKLTFNIT 1177

Query: 830  GGDPRGLFSLDAVSGLLQTLRPLDRELLGP-VLELEVRAGSGVPPAFAVARVRVLLDDVN 888
             G+  G F +  V+GLL T + LDRE     +LE+ V   +G P   + +RV V + DVN
Sbjct: 1178 SGNYMGFFMIHPVTGLLSTAQQLDRENKDEHILEVTV-LDNGEPSLKSTSRVVVGILDVN 1236

Query: 889  DNSPAFPAPEDTVLLPPNTAPGT--PIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDPT 946
            DN P F      V LP   +P +  P+Y L A D D G+N RVT+++      AF++D  
Sbjct: 1237 DNPPIFSHKLFNVRLPERLSPVSPGPVYRLVASDLDEGLNGRVTYSIEDSDEEAFSIDLV 1296

Query: 947  TGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYR 1006
            TG V        + G  + L ++A D G PP ++  RL +           P     TY 
Sbjct: 1297 TGVVSSSSTF--TAGEYNILTIKATDSGQPPLSASVRLHIEWIPWPRPSSIPLAFDETYY 1354

Query: 1007 VDLPSGTTAGTQVLQVQAQAPDGGPITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQE 1066
                  T     ++ V +     G   ++++       F +E  +G + +   LD   + 
Sbjct: 1355 SFTVMETDPVNHMVGVISVEGRPGLFWFNISGGDKDMDFDIEKTTGSIVIARPLDTRRRS 1414

Query: 1067 LYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGR 1126
             Y L V    GS+        T      I N N H P+  E    + V ++  PG  + R
Sbjct: 1415 NYNLTVEVTDGSRT-----IATQVHIFMIANINHHRPQFLETRYEVRVPQDTVPGVELLR 1469

Query: 1127 VFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLD-REQQSSYQLLVQVQD 1185
            V A D+D G +   T    Q    +  F++ P +G + T+  LD     S + L V V+D
Sbjct: 1470 VQAIDQDKGKSLIYTIHGSQDPGSASLFQLDPSSGVLVTVGKLDLGSGPSQHTLTVMVRD 1529

Query: 1186 GGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPD 1245
               P +     V + V D N + P F Q    A       VPD + PGT +  ++A D D
Sbjct: 1530 QEIPIKRNFVWVTIHVEDGNLHPPRFTQLHYEA------SVPDTIAPGTELLQVRAMDAD 1583

Query: 1246 EGENGTILYTLTGPGSE-LFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSAS 1304
             G N  + Y+L    SE  F+++   G +  A  L +A    + LT+ A DQGSP     
Sbjct: 1584 RGVNAEVHYSLLKGNSEGFFNINALLGIITLAQKLDQANHAPHTLTVKAEDQGSPQWHDL 1643

Query: 1305 LQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGVGA 1364
              +++ V PS R A   P  ++ +    +P        E +  GS +  V+A  P+ V  
Sbjct: 1644 ATVIIHVYPSDRSA---PIFSKSEYFVEIP--------ESIPVGSPILLVSAMSPSEV-- 1690

Query: 1365 LTYTLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQV 1424
             TY L  G + +G F++++ SG +   + LD E    ++ L +R     GA   ++ V V
Sbjct: 1691 -TYELREG-NKDGVFSMNSYSGLISTQKKLDHEKISSYQ-LKIRGSNMAGAFTDVM-VVV 1746

Query: 1425 QVQDENEHAPAFARD----------PL-ALALPENPEPGAALYTFRASDADGPGPNSDVR 1473
             + DEN++AP F +           PL ++ + +N  P    +   ASD+D    NS + 
Sbjct: 1747 DIIDENDNAPMFLKSTFVGQISEAAPLYSMIMDKNNNP----FVIHASDSDKEA-NSLLV 1801

Query: 1474 YRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDR--PANASRRRAARVS 1531
            Y++L  E  +   ++D   G L+    +D E+ P+    V   D+  P   + R A  + 
Sbjct: 1802 YKILEPE-ALKFFKIDPSMGTLTIVSEMDYESMPSFQFCVYVHDQGSPVLFAPRPAQVI- 1859

Query: 1532 ARVFVTDENDNAPVFASP-SRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASG-GD 1589
              + V D ND+ P F+     V +     PG   L V A D D    + V+Y + +G  D
Sbjct: 1860 --IHVRDVNDSPPRFSEQIYEVAIVGPIHPGMELLMVRASDED----SEVNYSIKTGNAD 1913

Query: 1590 GHFRLHSSTGALSVVRP----LDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDE 1645
                +H  TG++SV+ P    L R+      LT+ ASD        T ++ +S+  V D+
Sbjct: 1914 EAVTIHPVTGSISVLNPAFLGLSRK------LTIRASD---GLYQDTALVKISLTQVLDK 1964

Query: 1646 APTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVS-SESFSLDPDTGVLT 1704
            +  F Q  Y   ++EN     +L+ L A    +  N  ++Y  ++ ++ F +    GVL 
Sbjct: 1965 SLQFDQDVYWAAVKENLQDRKALVILGAQGNHL--NDTLSYFLLNGTDMFHMVQSAGVLQ 2022

Query: 1705 TLR-ALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEG 1763
            T   A DRE+Q+   L V  +D  +P ++    VRV++ED ND+ P F        + +G
Sbjct: 2023 TRGVAFDREQQDTHELAVEVRDNRTPQRVAQGLVRVSIEDVNDNPPKFKHLPYYTIIQDG 2082

Query: 1764 QDP-QTLTMLRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQ 1822
             +P   L  + A+D D+G NG + Y     +    F +D   G+    +P D +    + 
Sbjct: 2083 TEPGDVLFQVSATDEDLGTNGAVTYEF--AEDYTYFRIDPYLGDISLKKPFDYQALNKYH 2140

Query: 1823 LRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDP 1882
            L++ ARDGG P+L +   + VTV   N   P F  P Y V VPE++   T +L  QA  P
Sbjct: 2141 LKVIARDGGTPSLQSEEEVLVTV--RNKSNPLFQSPYYKVRVPENITLYTPILHTQARSP 2198

Query: 1883 DAGANGHVTYYLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLST 1942
            +      +   +       F  +  +G L     LD E    + F+V A D A       
Sbjct: 2199 E--GLRLIYNIVEEEPLMLFTTDFKTGVLTVTGPLDYESKTKHVFTVRATDTALGSFSEA 2256

Query: 1943 TVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYR 2002
            TV V   V DVND+ PTF        +    P+  TP + L    A D+D+G N  + Y+
Sbjct: 2257 TVEV--LVEDVNDNPPTFSQLVYTTSISEGLPA-QTPVIQLL---ASDQDSGRNRDVSYQ 2310

Query: 2003 LAGTPPPGTTVDSY------TGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIV 2056
            +      G+ V  +      TGE+   +       +   + + A D G P  +   +++V
Sbjct: 2311 IV---EDGSDVSKFFQINGSTGEMSTVQELDYEAQQHFHVKVRAMDKGDPPLTGETLVVV 2367

Query: 2057 GLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHAGGTN-GPITYSILSGNEKGTF 2115
             +    +  P F +   EA + E A  G  ++  +A+     +   + Y ILSGN+   F
Sbjct: 2368 NVSDINDNPPEFRQPQYEANVSELATCGHLVLKVQAIDPDSRDTSRLEYLILSGNQDRHF 2427

Query: 2116 SIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFTV-LTLTLQDANDNAPRFLRP 2174
             I  S+G I++ +      + S  LR+     S G F  TV + +   +AN  +P F + 
Sbjct: 2428 FINSSSGIISMFNLCKKHLDSSYNLRV---GASDGVFRATVPVYINTTNANKYSPEFQQH 2484

Query: 2175 HYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAI 2234
             Y A L E+  +   ++ + A D D G  G I Y++  ++ A   F ++P  G I T   
Sbjct: 2485 LYEAELAENAMVGTKVIDLLAIDKDSGPYGTIDYTI-INKLASEKFSINP-NGQIATLQK 2542

Query: 2235 LDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTI-PQPWELRVSEDALLGS 2293
            LDRE   E  + +    R     V   T+ +++ D NDN P      + + +  +    S
Sbjct: 2543 LDRENSTERVIAIKVMARDGGGRVAFCTVKIILTDENDNPPQFKASEYTVSIQSNVSKDS 2602

Query: 2294 EIAQVTGNDVDSG---PVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLL 2350
             + QV   D D G    V + V      +D   +    G V +   L   +       + 
Sbjct: 2603 PVIQVLAYDADEGQNADVTYSVNPEDLVKDVIEINPVTGVVKVKDSLVGLENQTLDFFIK 2662

Query: 2351 AHDG--PH-EGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGA 2407
            A DG  PH      + + V     + P FS+ LY     E  P GS I  V A      A
Sbjct: 2663 AQDGGPPHWNSLVPVRLQVVPKKVSLPKFSEPLYTFSAPEDLPEGSEIGIVKAV----AA 2718

Query: 2408 NGHISYHLA------SPADG-FSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAP 2460
               + Y L       S  DG FS+DP+ G    I     + H+ +    + + A      
Sbjct: 2719 QDPVIYSLVRGTTPESNKDGVFSLDPDTG---VIKVRKPMDHESTKLYQIDVMAHCLQNT 2775

Query: 2461 GRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDY 2520
               +  +V++Q+ D ND+ P F    Y+  +TE++P G++++ + A D D  R    V Y
Sbjct: 2776 DVVSLVSVNIQVGDVNDNRPVFEADPYKAVLTENMPVGTSVIQVTAIDKDTGRD-GQVSY 2834

Query: 2521 SIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQP 2580
             + +     V +L    A   ES        G +  L+ LD E+   Y+  V A D GQ 
Sbjct: 2835 RLSADPGSNVHEL---FAIDSES--------GWITTLQELDCETCQTYHFHVVAYDHGQT 2883

Query: 2581 PQ-SSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHG-LVR 2638
             Q SS   V V++ D NDN P F    YR +V E++  G  +  ++  DAD       V 
Sbjct: 2884 IQLSSQALVQVSITDENDNAPRFASEEYRGSVVENSEPGELVATLKTLDADISEQNRQVT 2943

Query: 2639 FTVSSGDPSGLFELDESSGTLRLA--HALDCETQARHQLVVQAADPAGAHFALAPVTIEV 2696
              ++ GDP G F + +     R++    LD E  A++ L V A+D  G   A   V I V
Sbjct: 2944 CYITEGDPLGQFGISQVGDEWRISSRKTLDREHTAKYLLRVTASD--GKFQASVTVEIFV 3001

Query: 2697 QDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGRE 2756
             DVND+ P     L +  V E+  PG  +  + A D D     ++ YSL   GP   G  
Sbjct: 3002 LDVNDNSPQCSQLLYTGKVHEDVFPGHFILKVSATDLDTDTNAQITYSL--HGP---GAH 3056

Query: 2757 AFALNSSTGELRARVPFDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYDPVFLAP 2816
             F L+  TGEL      D E  + F L+  A D G  S    +++ V   ++  P F   
Sbjct: 3057 EFKLDPHTGELTTLTALDRERKDVFNLVAKATDGGGRSCQADITLHVEDVNDNAPRFFPS 3116

Query: 2817 AFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSSP-YFGINQTTGALYLRVDSR 2875
                 V +       +  V A D D GA+  V+YSL  S+  +F I+ TTG + L     
Sbjct: 3117 HCAVAVFDNTTVKTPVAVVFARDPDQGANAQVVYSLPDSAEGHFSIDATTGVIRLEKPL- 3175

Query: 2876 APGSGTATSGGGGRTRREAPRELRLEVIARG-PLPGSRSATVPVTV 2920
                         + R +AP EL +     G P+P S   TV V+V
Sbjct: 3176 -------------QVRPQAPLELTVRASDLGTPIPLSTLGTVTVSV 3208



 Score =  770 bits (1989), Expect = 0.0
 Identities = 782/2837 (27%), Positives = 1230/2837 (43%), Gaps = 222/2837 (7%)

Query: 107  LDREQRDRYRFTAVTPDGATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEP 166
            L  ++     FT+++    T ++        DH   FPQ+   + V E     T      
Sbjct: 689  LQNQESSDEEFTSLS----TYQINHYTPQFEDH---FPQS---IDVLESVPINTPLARLA 738

Query: 167  ARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSHYMLQLE 226
            A D DAG  G   Y ++       F +E   G        L V   LD E  + Y+L + 
Sbjct: 739  ATDPDAGFNGKLVYVIADGNEEGCFDIELETGL-------LTVAAPLDYEATNFYILNVT 791

Query: 227  AYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGV 286
             YD G+P + +  LL V + D ND+AP F    Y   +SE    G+ + ++   DAD+  
Sbjct: 792  VYDLGTPQKSSWKLLTVNVKDWNDNAPRFPPGGYQLTISEDTEVGTTIAELTTKDADSED 851

Query: 287  NGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARD--GGAHPELG 344
            NG V Y +     +    FS+   TG L +   LD E    + L V+ARD     H    
Sbjct: 852  NGRVRYTLLSPTEK----FSLHPLTGELVVTGHLDRESEPRYILKVEARDQPSKGHQLFS 907

Query: 345  SAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVN-V 403
               + + + D NDN P      ++     +V E  PPG ++  +  SDPD G    V  V
Sbjct: 908  VTDLIITLEDVNDNSPQC----ITEHNRLKVPEDLPPGTVLTFLDASDPDLGPAGEVRYV 963

Query: 404  SLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFV-LHV 462
             ++G  G F +      + L    R LD E R  YNL + A+D G P  R     V + V
Sbjct: 964  LMDGAHGTFRVDLMTGALIL---ERELDFERRAGYNLSLWASDGGRPLARRTLCHVEVIV 1020

Query: 463  TDVNDNA-PAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWF 521
             DVN+N  P           + E +  G+ V+ V A+D D G +G++ Y L  G     F
Sbjct: 1021 LDVNENLHPPHFASFVHQGQVQENSPSGTQVIVVAAQDDDSGLDGELQYFLRAGTGLAAF 1080

Query: 522  SIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRT 581
            SI+  +G+I T A LD E      L V+A D G  PL+S   V + + D NDN PQ  + 
Sbjct: 1081 SINQDTGMIQTLAPLDREFASYYWLTVLAVDRGSVPLSSVTEVYIEVTDANDNPPQMSQA 1140

Query: 582  FYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTT 641
             +  S+ E    GT  LQ+ A D DS   G L++++ +G   +    F I   +G + T 
Sbjct: 1141 VFYPSIQEDAPVGTSVLQLDAWDPDSSSKGKLTFNITSG---NYMGFFMIHPVTGLLSTA 1197

Query: 642  RTLDRDQGPSSFDFTVTAVDGG--GLKSMVYVKVFLSDENDNPPQFYPREYAASISAQSP 699
            + LDR+         VT +D G   LKS   V V + D NDNPP F  + +   +  +  
Sbjct: 1198 QQLDRENKDEHI-LEVTVLDNGEPSLKSTSRVVVGILDVNDNPPIFSHKLFNVRLPERLS 1256

Query: 700  PGT--AVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQ 757
            P +   V RL A D D+G +GR++Y I   +    F++D  +G+++ +        ++  
Sbjct: 1257 PVSPGPVYRLVASDLDEGLNGRVTYSI-EDSDEEAFSIDLVTGVVSSSSTFTAGEYNI-- 1313

Query: 758  LEIGAEDGGGLQAEPSARVDISIVP---GTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQA 814
            L I A D G      S R+ I  +P    +  P  F++  Y F+V E       VG++  
Sbjct: 1314 LTIKATDSGQPPLSASVRLHIEWIPWPRPSSIPLAFDETYYSFTVMETDPVNHMVGVISV 1373

Query: 815  HNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLD-RELLGPVLELEVRAGSGVPP 873
               PG       ++SGGD    F ++  +G +   RPLD R      L +EV  GS    
Sbjct: 1374 EGRPGLF---WFNISGGDKDMDFDIEKTTGSIVIARPLDTRRRSNYNLTVEVTDGSRT-- 1428

Query: 874  AFAVARVRV-LLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTF- 931
                 +V + ++ ++N + P F      V +P +T PG  +  ++A+D D G +   T  
Sbjct: 1429 --IATQVHIFMIANINHHRPQFLETRYEVRVPQDTVPGVELLRVQAIDQDKGKSLIYTIH 1486

Query: 932  -TLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPA-HELELEARDGGSPPRTSHFRLRVVVQ 989
             +   G    F +DP++G +  +  L    GP+ H L +  RD   P + +   + + V+
Sbjct: 1487 GSQDPGSASLFQLDPSSGVLVTVGKLDLGSGPSQHTLTVMVRDQEIPIKRNFVWVTIHVE 1546

Query: 990  DVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGG---PITYHLAAEGASSPFG 1046
            D       PRF    Y   +P     GT++LQV+A   D G    + Y L    +   F 
Sbjct: 1547 DGNLH--PPRFTQLHYEASVPDTIAPGTELLQVRAMDADRGVNAEVHYSLLKGNSEGFFN 1604

Query: 1047 LEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLS 1106
            +    G + +   LD+     + L V A         Q    ATV + +   +  +P  S
Sbjct: 1605 INALLGIITLAQKLDQANHAPHTLTVKAEDQGSP---QWHDLATVIIHVYPSDRSAPIFS 1661

Query: 1107 EDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTL 1166
            +   F+ + E+ P G+ +  V A          +TY L++ ++D   F ++  +G ++T 
Sbjct: 1662 KSEYFVEIPESIPVGSPILLVSAMS-----PSEVTYELREGNKDG-VFSMNSYSGLISTQ 1715

Query: 1167 QTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQV 1226
            + LD E+ SSYQL  +++        T   V V ++D NDN+P FL+++         Q+
Sbjct: 1716 KKLDHEKISSYQL--KIRGSNMAGAFTDVMVVVDIIDENDNAPMFLKSTFVG------QI 1767

Query: 1227 PDRVPPGTLVT-------TLQAKDPDEGENGTILYTLTGPGS-ELFSLHPHSGELLTAAP 1278
             +  P  +++         + A D D+  N  ++Y +  P + + F + P  G L   + 
Sbjct: 1768 SEAAPLYSMIMDKNNNPFVIHASDSDKEANSLLVYKILEPEALKFFKIDPSMGTLTIVSE 1827

Query: 1279 LIRAERPHYVLTLSAHDQGSP----PRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVP 1334
            +     P +   +  HDQGSP    PR A  Q+++ V     + + PP  +E+       
Sbjct: 1828 MDYESMPSFQFCVYVHDQGSPVLFAPRPA--QVIIHV---RDVNDSPPRFSEQ------- 1875

Query: 1335 VVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTL-VGGADPEGTFALDAASGRLYLARP 1393
             +  V     + PG  L  V A +      + Y++  G AD   T  +   +G + +  P
Sbjct: 1876 -IYEVAIVGPIHPGMELLMVRASDED--SEVNYSIKTGNADEAVT--IHPVTGSISVLNP 1930

Query: 1394 LDFEAGPPWRALTVRAEGPGGAGARLLRVQV-QVQDENEHAPAFARDPLALALPENPEPG 1452
                     R LT+RA         L+++ + QV D++     F +D    A+ EN +  
Sbjct: 1931 AFLGLS---RKLTIRASDGLYQDTALVKISLTQVLDKSLQ---FDQDVYWAAVKENLQDR 1984

Query: 1453 AALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGL--DRETTPALL 1510
             AL       A G   N  + Y LL          +    G L   RG+  DRE      
Sbjct: 1985 KALVIL---GAQGNHLNDTLSYFLLN---GTDMFHMVQSAGVLQT-RGVAFDREQQDTHE 2037

Query: 1511 LLVEATDRPANASRRRAARVSARVFVTDENDNAPVFAS-PSRVRLPEDQPPGPAALHVVA 1569
            L VE  D   N + +R A+   RV + D NDN P F   P    + +   PG     V A
Sbjct: 2038 LAVEVRD---NRTPQRVAQGLVRVSIEDVNDNPPKFKHLPYYTIIQDGTEPGDVLFQVSA 2094

Query: 1570 RDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPR 1629
             D DLG    V+Y  A     +FR+    G +S+ +P D +   ++ L V+A D G+P  
Sbjct: 2095 TDEDLGTNGAVTYEFAEDYT-YFRIDPYLGDISLKKPFDYQALNKYHLKVIARDGGTPSL 2153

Query: 1630 SATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGV 1689
             + + + V+V   N   P FQ   Y V + EN    T +L  +A  P+     ++ Y  V
Sbjct: 2154 QSEEEVLVTVR--NKSNPLFQSPYYKVRVPENITLYTPILHTQARSPE---GLRLIYNIV 2208

Query: 1690 SSES---FSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDEND 1746
              E    F+ D  TGVLT    LD E + +   TV A D  +    +  TV V VED ND
Sbjct: 2209 EEEPLMLFTTDFKTGVLTVTGPLDYESKTKHVFTVRATDT-ALGSFSEATVEVLVEDVND 2267

Query: 1747 HAPTFGSAHLSLEVPEGQDPQT-LTMLRASDPDVGANGQLQYRILD--GDPSGAFVLDLA 1803
            + PTF     +  + EG   QT +  L ASD D G N  + Y+I++   D S  F ++ +
Sbjct: 2268 NPPTFSQLVYTTSISEGLPAQTPVIQLLASDQDSGRNRDVSYQIVEDGSDVSKFFQINGS 2327

Query: 1804 SGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVE 1863
            +GE  T++ LD E +  F +++ A D G P L+   L+ V V D ND+ P F  P Y   
Sbjct: 2328 TGEMSTVQELDYEAQQHFHVKVRAMDKGDPPLTGETLVVVNVSDINDNPPEFRQPQYEAN 2387

Query: 1864 VPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGA-FLLEPSSGELRTAAALDREQC 1922
            V E    G L+L++QA DPD+     + Y + +G     F +  SSG +       +   
Sbjct: 2388 VSELATCGHLVLKVQAIDPDSRDTSRLEYLILSGNQDRHFFINSSSGIISMFNLCKKHLD 2447

Query: 1923 PSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLA 1982
             SY   V A DG        TV V I   + N ++P F        L        T  + 
Sbjct: 2448 SSYNLRVGASDGV----FRATVPVYINTTNANKYSPEFQQHLYEAELAE-NAMVGTKVID 2502

Query: 1983 LATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLFIVATD 2042
            L  +   D+D+G   +I Y +           +  G+I   +        +RV+ I    
Sbjct: 2503 LLAI---DKDSGPYGTIDYTIINKLASEKFSINPNGQIATLQKLDRENSTERVIAIKVMA 2559

Query: 2043 LGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHAG-GTNGP 2101
                 R A   + + L  E +  P+F  +    +I+ N    +P++   A  A  G N  
Sbjct: 2560 RDGGGRVAFCTVKIILTDENDNPPQFKASEYTVSIQSNVSKDSPVIQVLAYDADEGQNAD 2619

Query: 2102 ITYSILSGN-EKGTFSIQPSTGAITVR-SAEGLDFEVSPRLRLVLQAESGGAFAFTVLT- 2158
            +TYS+   +  K    I P TG + V+ S  GL+   +  L   ++A+ GG   +  L  
Sbjct: 2620 VTYSVNPEDLVKDVIEINPVTGVVKVKDSLVGLE---NQTLDFFIKAQDGGPPHWNSLVP 2676

Query: 2159 --LTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPA 2216
              L +     + P+F  P Y    PE  P    +  V+A      +   + YSL      
Sbjct: 2677 VRLQVVPKKVSLPKFSEPLYTFSAPEDLPEGSEIGIVKA----VAAQDPVIYSLVRGTTP 2732

Query: 2217 R----GLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTND 2272
                 G+F +DP TG I     +D E     ++ +MA    +  +V   ++ + V D ND
Sbjct: 2733 ESNKDGVFSLDPDTGVIKVRKPMDHESTKLYQIDVMAHCLQNTDVVSLVSVNIQVGDVND 2792

Query: 2273 NRPTI-PQPWELRVSEDALLGSEIAQVTGNDVDSG--PVLWYVLSP---SGPQDPFSVGR 2326
            NRP     P++  ++E+  +G+ + QVT  D D+G    + Y LS    S   + F++  
Sbjct: 2793 NRPVFEADPYKAVLTENMPVGTSVIQVTAIDKDTGRDGQVSYRLSADPGSNVHELFAIDS 2852

Query: 2327 YGGRVSLTGPLDFEQCDRYQLQLLAHDGPH----EGRANLTVLVEDVNDNAPAFSQSLYQ 2382
              G ++    LD E C  Y   ++A+D         +A + V + D NDNAP F+   Y+
Sbjct: 2853 ESGWITTLQELDCETCQTYHFHVVAYDHGQTIQLSSQALVQVSITDENDNAPRFASEEYR 2912

Query: 2383 VMLLEHTPPGSAILSVSATDRD-SGANGHISYHL--ASPADGFSVDPNNGTLFTIVGTVA 2439
              ++E++ PG  + ++   D D S  N  ++ ++    P   F +    G  + I     
Sbjct: 2913 GSVVENSEPGELVATLKTLDADISEQNRQVTCYITEGDPLGQFGIS-QVGDEWRISSRKT 2971

Query: 2440 LGHDGSGAVDVVLEARDHGAPGR-AARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPG 2498
            L  + +    + + A D    G+  A  TV + + D ND++P  +   Y   V ED+ PG
Sbjct: 2972 LDREHTAKYLLRVTASD----GKFQASVTVEIFVLDVNDNSPQCSQLLYTGKVHEDVFPG 3027

Query: 2499 STLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLE 2558
              +L + ATD D + ++A + YS + G     F+L+P   E              L  L 
Sbjct: 3028 HFILKVSATDLD-TDTNAQITYS-LHGPGAHEFKLDPHTGE--------------LTTLT 3071

Query: 2559 PLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVG 2618
             LD E    +NL   A D G   +S    +T+ V DVNDN P F  +   V V ++T V 
Sbjct: 3072 ALDRERKDVFNLVAKATDGG--GRSCQADITLHVEDVNDNAPRFFPSHCAVAVFDNTTVK 3129

Query: 2619 AELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQ 2678
              +  V A D D G +  V +++      G F +D ++G +RL   L    QA  +L V+
Sbjct: 3130 TPVAVVFARDPDQGANAQVVYSLPD-SAEGHFSIDATTGVIRLEKPLQVRPQAPLELTVR 3188

Query: 2679 AADPAGAHF---ALAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDA 2735
            A+D  G       L  VT+ V  + D+ P F     S  V E+ PPGT V  L  +    
Sbjct: 3189 ASD-LGTPIPLSTLGTVTVSVVGLEDYLPVFLNTEHSVQVPEDAPPGTEVLQLATLTRP- 3246

Query: 2736 GAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAA--DAGNL 2793
               G  +          +GR  F L++ TG L      D+E +  + L +  +   + +L
Sbjct: 3247 ---GAEKTGYRVVSGNEQGR--FRLDARTGILYVNASLDFETSPKYFLSIECSRKSSSSL 3301

Query: 2794 SASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSLA 2853
            S   TV V +T  +E+ P F    +  +V E A  G  +  V ATDEDG  +  + YSL 
Sbjct: 3302 SDVTTVMVNITDVNEHRPQFPQDPYSTRVLENALVGDVILTVSATDEDGPLNSDITYSLI 3361

Query: 2854 TSSP--YFGINQTTGAL 2868
              +   +F I+   G L
Sbjct: 3362 GGNQLGHFTIHPKKGEL 3378



 Score =  725 bits (1871), Expect = 0.0
 Identities = 780/2866 (27%), Positives = 1244/2866 (43%), Gaps = 263/2866 (9%)

Query: 107  LDREQRDRYRFTAVTPDG--------ATVEVTVRVADINDHAPAFPQARAALQVPEHTAF 158
            LDRE   RY       D         +  ++ + + D+ND++P        L+VPE    
Sbjct: 881  LDRESEPRYILKVEARDQPSKGHQLFSVTDLIITLEDVNDNSPQCITEHNRLKVPEDLPP 940

Query: 159  GTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENR 218
            GT      A D D G  G   Y L  DGA  TFR++   G        L++  ELD E R
Sbjct: 941  GTVLTFLDASDPDLGPAGEVRYVLM-DGAHGTFRVDLMTGA-------LILERELDFERR 992

Query: 219  SHYMLQLEAYDGGSP-PRRAQALLDVTLLDIND--HAPAFNQSRYHAVVSESLAPGSPVL 275
            + Y L L A DGG P  RR    ++V +LD+N+  H P F    +   V E+   G+ V+
Sbjct: 993  AGYNLSLWASDGGRPLARRTLCHVEVIVLDVNENLHPPHFASFVHQGQVQENSPSGTQVI 1052

Query: 276  QVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQAR 335
             V A D D+G++G + Y +  R   G   FSI+  TG++Q   PLD E    + L V A 
Sbjct: 1053 VVAAQDDDSGLDGELQYFL--RAGTGLAAFSINQDTGMIQTLAPLDREFASYYWLTVLAV 1110

Query: 336  DGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDD 395
            D G+ P      V + V DANDN P M+     A   P + E AP G  V ++   DPD 
Sbjct: 1111 DRGSVPLSSVTEVYIEVTDANDNPPQMS----QAVFYPSIQEDAPVGTSVLQLDAWDPDS 1166

Query: 396  GDFAHVNVSLEGGE--GHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPLR 453
                 +  ++  G   G F +     V  L+  A++LDRE +D + L VT  D+G P L+
Sbjct: 1167 SSKGKLTFNITSGNYMGFFMIHP---VTGLLSTAQQLDRENKDEHILEVTVLDNGEPSLK 1223

Query: 454  AEAAFVLHVTDVNDNAPAFDRQLYR---PEPLPEVALPGSFVVRVTARDPDQGTNGQVTY 510
            + +  V+ + DVNDN P F  +L+    PE L  V+ PG  V R+ A D D+G NG+VTY
Sbjct: 1224 STSRVVVGILDVNDNPPIFSHKLFNVRLPERLSPVS-PGP-VYRLVASDLDEGLNGRVTY 1281

Query: 511  SLAPGAHTHWFSIDPTSGIITTAASL---DYELEPQPQLIVVATDGGLPPLASSATVSVA 567
            S+   +    FSID  +G+++++++    +Y +     L + ATD G PPL  SA+V + 
Sbjct: 1282 SIED-SDEEAFSIDLVTGVVSSSSTFTAGEYNI-----LTIKATDSGQPPL--SASVRLH 1333

Query: 568  LQDVNDNEPQ-----FQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLG 622
            ++ +    P      F  T+Y+ ++ E T P    + V + +   G  GL  +++  G  
Sbjct: 1334 IEWIPWPRPSSIPLAFDETYYSFTVME-TDPVNHMVGVISVE---GRPGLFWFNISGG-- 1387

Query: 623  SSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMVYVKVFLSDENDNP 682
                  F I+  +G +   R LD  +  S+++ TV   DG    +       +++ N + 
Sbjct: 1388 -DKDMDFDIEKTTGSIVIARPLDTRRR-SNYNLTVEVTDGSRTIATQVHIFMIANINHHR 1445

Query: 683  PQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSP---PLFTLDEQS 739
            PQF    Y   +   + PG  +LR++A D D+G    L Y I     P    LF LD  S
Sbjct: 1446 PQFLETRYEVRVPQDTVPGVELLRVQAIDQDKGKS--LIYTIHGSQDPGSASLFQLDPSS 1503

Query: 740  GLLTVAWPLARRAN-SVVQLEIGAEDGGGLQAEPSAR----VDISIVPGTPTPPIFEQLQ 794
            G+L     L   +  S   L +   D    Q  P  R    V I +  G   PP F QL 
Sbjct: 1504 GVLVTVGKLDLGSGPSQHTLTVMVRD----QEIPIKRNFVWVTIHVEDGNLHPPRFTQLH 1559

Query: 795  YVFSVPEDVAPGTSVGIVQAHNPP-GRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLD 853
            Y  SVP+ +APGT +  V+A +   G  A V  SL  G+  G F+++A+ G++   + LD
Sbjct: 1560 YEASVPDTIAPGTELLQVRAMDADRGVNAEVHYSLLKGNSEGFFNINALLGIITLAQKLD 1619

Query: 854  RELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPI 913
            +    P          G P    +A V + +   + ++P F   E  V +P +   G+PI
Sbjct: 1620 QANHAPHTLTVKAEDQGSPQWHDLATVIIHVYPSDRSAPIFSKSEYFVEIPESIPVGSPI 1679

Query: 914  YTLRALDPDSGVNSRVTFTLLAGG-GGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARD 972
              + A+ P     S VT+ L  G   G F+++  +G +   + L      +++L++    
Sbjct: 1680 LLVSAMSP-----SEVTYELREGNKDGVFSMNSYSGLISTQKKLDHEKISSYQLKIR--- 1731

Query: 973  GGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQ-------VQAQ 1025
             GS    +   + VVV  +     AP F   T+   +       + ++        + A 
Sbjct: 1732 -GSNMAGAFTDVMVVVDIIDENDNAPMFLKSTFVGQISEAAPLYSMIMDKNNNPFVIHAS 1790

Query: 1026 APD---GGPITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAEL 1082
              D      + Y +    A   F ++P  G L + + +D E+   +   V         L
Sbjct: 1791 DSDKEANSLLVYKILEPEALKFFKIDPSMGTLTIVSEMDYESMPSFQFCVYVHDQGSPVL 1850

Query: 1083 GQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTY 1142
                  A V + + + N+  PR SE    +A+     PG  +  V A+D DS  N    Y
Sbjct: 1851 FAPR-PAQVIIHVRDVNDSPPRFSEQIYEVAIVGPIHPGMELLMVRASDEDSEVN----Y 1905

Query: 1143 SLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVL 1202
            S++  + D +A  IHP TG ++ L         S +L ++  DG       T  V +++ 
Sbjct: 1906 SIKTGNAD-EAVTIHPVTGSISVLNPAFLGL--SRKLTIRASDG---LYQDTALVKISLT 1959

Query: 1203 DLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSE 1262
             + D S  F Q    A       V + +     +  L A+      N T+ Y L   G++
Sbjct: 1960 QVLDKSLQFDQDVYWAA------VKENLQDRKALVILGAQG--NHLNDTLSYFLLN-GTD 2010

Query: 1263 LFSLHPHSGELLTAAPLI-RAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPP 1321
            +F +   +G L T      R ++  + L +   D  +P R A   + V +          
Sbjct: 2011 MFHMVQSAGVLQTRGVAFDREQQDTHELAVEVRDNRTPQRVAQGLVRVSI---------- 2060

Query: 1322 PDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAP-EPAGV-GALTYTLVGGADPEGTF 1379
             D+ +  P        T+   +G  PG +L  V+A  E  G  GA+TY     A+    F
Sbjct: 2061 EDVNDNPPKFKHLPYYTIIQ-DGTEPGDVLFQVSATDEDLGTNGAVTYEF---AEDYTYF 2116

Query: 1380 ALDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARD 1439
             +D   G + L +P D++A   +    +  +G  G  +     +V V   N+  P F   
Sbjct: 2117 RIDPYLGDISLKKPFDYQALNKYHLKVIARDG--GTPSLQSEEEVLVTVRNKSNPLFQSP 2174

Query: 1440 PLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPR 1499
               + +PEN      +   +A   +G      + Y ++ +EP +     D +TG L+   
Sbjct: 2175 YYKVRVPENITLYTPILHTQARSPEG----LRLIYNIVEEEP-LMLFTTDFKTGVLTVTG 2229

Query: 1500 GLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFAS-PSRVRLPEDQ 1558
             LD E+    +  V ATD    +     +  +  V V D NDN P F+       + E  
Sbjct: 2230 PLDYESKTKHVFTVRATDTALGSF----SEATVEVLVEDVNDNPPTFSQLVYTTSISEGL 2285

Query: 1559 PPGPAALHVVARDPDLGEAARVSYRLASGGDG---HFRLHSSTGALSVVRPLDREQRAEH 1615
            P     + ++A D D G    VSY++   G      F+++ STG +S V+ LD E +   
Sbjct: 2286 PAQTPVIQLLASDQDSGRNRDVSYQIVEDGSDVSKFFQINGSTGEMSTVQELDYEAQQHF 2345

Query: 1616 VLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATD 1675
             + V A D G PP +   ++ V+V+D+ND  P F+Q +Y   + E    G  +L ++A D
Sbjct: 2346 HVKVRAMDKGDPPLTGETLVVVNVSDINDNPPEFRQPQYEANVSELATCGHLVLKVQAID 2405

Query: 1676 PDVGANGQVTY---GGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQD---RGSP 1729
            PD     ++ Y    G     F ++  +G+++      +      NL V A D   R + 
Sbjct: 2406 PDSRDTSRLEYLILSGNQDRHFFINSSSGIISMFNLCKKHLDSSYNLRVGASDGVFRATV 2465

Query: 1730 PQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQTLTM-LRASDPDVGANGQLQYR 1788
            P   + T      + N ++P F       E+ E     T  + L A D D G  G + Y 
Sbjct: 2466 PVYINTT------NANKYSPEFQQHLYEAELAENAMVGTKVIDLLAIDKDSGPYGTIDYT 2519

Query: 1789 ILDGDPSGAFVLDLASGEFGTMRPLDRE--VEPAFQLRIEARDGGQPALSATLLLTVTVL 1846
            I++   S  F ++  +G+  T++ LDRE   E    +++ ARDGG      T+ + +T  
Sbjct: 2520 IINKLASEKFSIN-PNGQIATLQKLDRENSTERVIAIKVMARDGGGRVAFCTVKIILT-- 2576

Query: 1847 DANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLE- 1905
            D ND+ P F    Y+V +  +V   + ++Q+ A+D D G N  VTY +        ++E 
Sbjct: 2577 DENDNPPQFKASEYTVSIQSNVSKDSPVIQVLAYDADEGQNADVTYSVNPEDLVKDVIEI 2636

Query: 1906 -PSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSP 1964
             P +G ++   +L   +  +  F + A DG   GP      V + ++ V          P
Sbjct: 2637 NPVTGVVKVKDSLVGLENQTLDFFIKAQDG---GPPHWNSLVPVRLQVV----------P 2683

Query: 1965 LRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPP------GTT------ 2012
             ++ LP+    FS P    +    ED   G+   I+  +A   P       GTT      
Sbjct: 2684 KKVSLPK----FSEPLYTFSA--PEDLPEGSEIGIVKAVAAQDPVIYSLVRGTTPESNKD 2737

Query: 2013 ----VDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQ-GEA-ERGP 2066
                +D  TG I+V +       +   + ++A  L         ++ V +Q G+  +  P
Sbjct: 2738 GVFSLDPDTGVIKVRKPMDHESTKLYQIDVMAHCLQNT--DVVSLVSVNIQVGDVNDNRP 2795

Query: 2067 RFPRASSEATIRENAPPGTPIVSPRAVHAG-GTNGPITYSILS---GNEKGTFSIQPSTG 2122
             F     +A + EN P GT ++   A+    G +G ++Y + +    N    F+I   +G
Sbjct: 2796 VFEADPYKAVLTENMPVGTSVIQVTAIDKDTGRDGQVSYRLSADPGSNVHELFAIDSESG 2855

Query: 2123 AITVRSAEGLDFEVSPRLRLVLQAESGGAF----AFTVLTLTLQDANDNAPRFLRPHYVA 2178
             IT  + + LD E        + A   G      +  ++ +++ D NDNAPRF    Y  
Sbjct: 2856 WIT--TLQELDCETCQTYHFHVVAYDHGQTIQLSSQALVQVSITDENDNAPRFASEEYRG 2913

Query: 2179 FLPE-SRP--LEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGT--ITTTA 2233
             + E S P  L   L  ++AD  +Q    Q++  +    P  G F +        I++  
Sbjct: 2914 SVVENSEPGELVATLKTLDADISEQNR--QVTCYITEGDPL-GQFGISQVGDEWRISSRK 2970

Query: 2234 ILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP-WELRVSEDALLG 2292
             LDRE  A+  L + A+D    A   S T+ + V+D NDN P   Q  +  +V ED   G
Sbjct: 2971 TLDREHTAKYLLRVTASDGKFQA---SVTVEIFVLDVNDNSPQCSQLLYTGKVHEDVFPG 3027

Query: 2293 SEIAQVTGNDVDSGPVLWYVLSPSGP-QDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLA 2351
              I +V+  D+D+        S  GP    F +  + G ++    LD E+ D + L   A
Sbjct: 3028 HFILKVSATDLDTDTNAQITYSLHGPGAHEFKLDPHTGELTTLTALDRERKDVFNLVAKA 3087

Query: 2352 HDGPHEG-RANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGH 2410
             DG     +A++T+ VEDVNDNAP F  S   V + ++T   + +  V A D D GAN  
Sbjct: 3088 TDGGGRSCQADITLHVEDVNDNAPRFFPSHCAVAVFDNTTVKTPVAVVFARDPDQGANAQ 3147

Query: 2411 ISYHLASPADG-FSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAP-GRAARATV 2468
            + Y L   A+G FS+D   G +        L       +++ + A D G P   +   TV
Sbjct: 3148 VVYSLPDSAEGHFSIDATTGVIRL---EKPLQVRPQAPLELTVRASDLGTPIPLSTLGTV 3204

Query: 2469 HVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWG 2528
             V +    D+ P F  + + V V ED PPG+ +L L      G+       Y ++SGN  
Sbjct: 3205 TVSVVGLEDYLPVFLNTEHSVQVPEDAPPGTEVLQLATLTRPGAEK---TGYRVVSGNEQ 3261

Query: 2529 RVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPV 2588
              F+L+ R               G L +   LDFE+  +Y L++  + +     S V  V
Sbjct: 3262 GRFRLDART--------------GILYVNASLDFETSPKYFLSIECSRKSSSSLSDVTTV 3307

Query: 2589 TVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSG 2648
             V + DVN++ P F +  Y   V E+  VG  +L V A+D D   +  + +++  G+  G
Sbjct: 3308 MVNITDVNEHRPQFPQDPYSTRVLENALVGDVILTVSATDEDGPLNSDITYSLIGGNQLG 3367

Query: 2649 LFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHFAL-APVTIEVQDVNDHGPAFP 2707
             F +    G L++A ALD E  + + L ++A D           + I+V DVND+ P F 
Sbjct: 3368 HFTIHPKKGELQVAKALDREQASSYSLKLRATDSGQPPLHEDTDIAIQVADVNDNPPRFF 3427

Query: 2708 LNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGEL 2767
                ST+V EN P G+ V  L   D D+   G      +  G       AF +    G L
Sbjct: 3428 QLNYSTTVQENSPIGSKVLQLILSDPDSPENGPPYSFRITKG---NNGSAFRVTPD-GWL 3483

Query: 2768 RARVPFDYEHTESFRLLVGAADAG--NLSASVTVSVLVTGEDEYDPVFLAPAFHFQVPEG 2825
                       E ++L + A+D+G   LS+  +V V VT +  Y P  L       V E 
Sbjct: 3484 VTAEGLSRRAQEWYQLQIQASDSGIPPLSSLTSVRVHVTEQSHYAPSALPLEIFITVGED 3543

Query: 2826 ARRGHSLGHVQATDEDGGADGLVLYSLA---TSSPYFGINQTTGAL 2868
              +G  +G + ATD D      + YSLA   T   +F +    G +
Sbjct: 3544 EFQGGMVGKIHATDRD--PQDTLTYSLAEEETLGRHFSVGAPDGKI 3587



 Score =  724 bits (1869), Expect = 0.0
 Identities = 771/2866 (26%), Positives = 1219/2866 (42%), Gaps = 280/2866 (9%)

Query: 180  YALSGDGAGETFRLETRPGPDGTPVPELVVTGEL-DRENRSHYMLQLEAYDGGSPPRRAQ 238
            Y L        F+L  R G        L+ T +L D  +R+HY L +      + P +A 
Sbjct: 395  YVLKPSSENVGFKLNARTG--------LITTTKLMDFHDRAHYQLHIR-----TSPGQAS 441

Query: 239  ALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQ 298
             ++ + ++D N+HAP FN+S Y   + E++ PG+ VL V A+D D G NG VTY I   +
Sbjct: 442  TVVVIDIVDCNNHAPLFNRSSYDGTLDENIPPGTSVLAVTATDRDHGENGYVTYSIAGPK 501

Query: 299  SEGDGPFSIDAHTGLLQLERPLDFE-QRRVHELVVQARDGGA-HPELGSAFVTVHVRDAN 356
            +    PFSID + G++   +P+D+E  +R++   V+A D G+         + + +R+ N
Sbjct: 502  AL---PFSIDPYLGIISTSKPMDYELMKRIYTFRVRASDWGSPFRREKEVSIFLQLRNLN 558

Query: 357  DNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALST 416
            DNQP    +F   + +  + +  P G+ +  +S  D D+       +       +F L+ 
Sbjct: 559  DNQP----MFEEVNCTGSIRQDWPVGKSIMTMSAIDVDELQNLKYEIVSGNELEYFDLNH 614

Query: 417  QDSVIYLVCVARRLDREERDAYNLRVTATDS---GSP---------------PLRAEAAF 458
               VI L      L   +  +Y+L++TA+D     SP               P+  +   
Sbjct: 615  FSGVISLKRPFINLTAGQPTSYSLKITASDGKNYASPTTLNITVVKDPHFEVPVTCDKTG 674

Query: 459  VL--------------------------HVTDVNDNAPAFDRQLYRPEPLPEVALPGSFV 492
            VL                              +N   P F+    +   + E     + +
Sbjct: 675  VLTQFTKTILHFIGLQNQESSDEEFTSLSTYQINHYTPQFEDHFPQSIDVLESVPINTPL 734

Query: 493  VRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATD 552
             R+ A DPD G NG++ Y +A G     F I+  +G++T AA LDYE      L V   D
Sbjct: 735  ARLAATDPDAGFNGKLVYVIADGNEEGCFDIELETGLLTVAAPLDYEATNFYILNVTVYD 794

Query: 553  GGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGL 612
             G P  +S   ++V ++D NDN P+F    Y  ++ E T+ GT   ++T  DADS   G 
Sbjct: 795  LGTPQKSSWKLLTVNVKDWNDNAPRFPPGGYQLTISEDTEVGTTIAELTTKDADSEDNGR 854

Query: 613  LSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVD----GGGLKSM 668
            + Y+L      S +  F +   +G++  T  LDR+  P  +   V A D    G  L S+
Sbjct: 855  VRYTL-----LSPTEKFSLHPLTGELVVTGHLDRESEP-RYILKVEARDQPSKGHQLFSV 908

Query: 669  VYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGN 728
              + + L D NDN PQ         +    PPGT +  L A DPD G  G + Y +L   
Sbjct: 909  TDLIITLEDVNDNSPQCITEHNRLKVPEDLPPGTVLTFLDASDPDLGPAGEVRY-VLMDG 967

Query: 729  SPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGG-GLQAEPSARVDISIVPGTPT- 786
            +   F +D  +G L +   L     +   L + A DGG  L       V++ ++      
Sbjct: 968  AHGTFRVDLMTGALILERELDFERRAGYNLSLWASDGGRPLARRTLCHVEVIVLDVNENL 1027

Query: 787  -PPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPPGRL-APVTLSLSGGDPRGLFSLDAVSG 844
             PP F    +   V E+   GT V +V A +    L   +   L  G     FS++  +G
Sbjct: 1028 HPPHFASFVHQGQVQENSPSGTQVIVVAAQDDDSGLDGELQYFLRAGTGLAAFSINQDTG 1087

Query: 845  LLQTLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLP 904
            ++QTL PLDRE         +    G  P  +V  V + + D NDN P          + 
Sbjct: 1088 MIQTLAPLDREFASYYWLTVLAVDRGSVPLSSVTEVYIEVTDANDNPPQMSQAVFYPSIQ 1147

Query: 905  PNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGG-GGAFTVDPTTGHVRLMRPLGPSGGPA 963
             +   GT +  L A DPDS    ++TF + +G   G F + P TG +   + L       
Sbjct: 1148 EDAPVGTSVLQLDAWDPDSSSKGKLTFNITSGNYMGFFMIHPVTGLLSTAQQLDRENKDE 1207

Query: 964  HELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLP---SGTTAGTQVL 1020
            H LE+   D G P   S  R+ V + DV      P F+   + V LP   S  + G    
Sbjct: 1208 HILEVTVLDNGEPSLKSTSRVVVGILDVNDN--PPIFSHKLFNVRLPERLSPVSPGPVYR 1265

Query: 1021 QVQAQAPDG--GPITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGS 1078
             V +   +G  G +TY +  +     F ++  +G   V ++    A E  IL + A    
Sbjct: 1266 LVASDLDEGLNGRVTYSI-EDSDEEAFSIDLVTG--VVSSSSTFTAGEYNILTIKA---- 1318

Query: 1079 KAELGQQTGTATVRVS---ILNQNEHSPRLSEDPTF--LAVAENQPPGTSVGRVFATDRD 1133
              + GQ   +A+VR+    I      S  L+ D T+    V E  P    VG +      
Sbjct: 1319 -TDSGQPPLSASVRLHIEWIPWPRPSSIPLAFDETYYSFTVMETDPVNHMVGVISV---- 1373

Query: 1134 SGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRST 1193
             G  G   +++    +D   F I   TG +   + LD  ++S+Y L V+V DG    R+ 
Sbjct: 1374 EGRPGLFWFNISGGDKDMD-FDIEKTTGSIVIARPLDTRRRSNYNLTVEVTDGS---RTI 1429

Query: 1194 TGTVHV-AVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTI 1252
               VH+  + ++N + P FL+          ++VP    PG  +  +QA D D+G+  ++
Sbjct: 1430 ATQVHIFMIANINHHRPQFLETR------YEVRVPQDTVPGVELLRVQAIDQDKGK--SL 1481

Query: 1253 LYTLTG---PGS-ELFSLHPHSGELLTAAPLIRAERP-HYVLTLSAHDQGSPPRSASLQL 1307
            +YT+ G   PGS  LF L P SG L+T   L     P  + LT+   DQ  P +   + +
Sbjct: 1482 IYTIHGSQDPGSASLFQLDPSSGVLVTVGKLDLGSGPSQHTLTVMVRDQEIPIKRNFVWV 1541

Query: 1308 LVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPE-PAGVGA-L 1365
             + V         PP   +    A VP        + + PG+ L  V A +   GV A +
Sbjct: 1542 TIHVEDGNL---HPPRFTQLHYEASVP--------DTIAPGTELLQVRAMDADRGVNAEV 1590

Query: 1366 TYTLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGAR-LLRVQV 1424
             Y+L+ G + EG F ++A  G + LA+ LD +A      LTV+AE  G      L  V +
Sbjct: 1591 HYSLLKG-NSEGFFNINALLGIITLAQKLD-QANHAPHTLTVKAEDQGSPQWHDLATVII 1648

Query: 1425 QVQDENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVP 1484
             V   +  AP F++    + +PE+   G+ +    A         S+V Y  LR+     
Sbjct: 1649 HVYPSDRSAPIFSKSEYFVEIPESIPVGSPILLVSAMSP------SEVTYE-LREGNKDG 1701

Query: 1485 ALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAP 1544
               +++ +G +S  + LD E   +  L +  ++            V   V + DENDNAP
Sbjct: 1702 VFSMNSYSGLISTQKKLDHEKISSYQLKIRGSNMAG-----AFTDVMVVVDIIDENDNAP 1756

Query: 1545 VFASPSRVRLPEDQPP----------GPAALHVVARDPDLGEAARVSYR-LASGGDGHFR 1593
            +F   + V    +  P           P  +H  A D D    + + Y+ L       F+
Sbjct: 1757 MFLKSTFVGQISEAAPLYSMIMDKNNNPFVIH--ASDSDKEANSLLVYKILEPEALKFFK 1814

Query: 1594 LHSSTGALSVVRPLDREQRAEHVLTVVASDHGSP----PRSATQVLTVSVADVNDEAPTF 1649
            +  S G L++V  +D E        V   D GSP    PR A  +  + V DVND  P F
Sbjct: 1815 IDPSMGTLTIVSEMDYESMPSFQFCVYVHDQGSPVLFAPRPAQVI--IHVRDVNDSPPRF 1872

Query: 1650 QQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSESFSLDPDTGVLTTLR-- 1707
             +Q Y V +     PG  LL +RA+D D   N  +  G  + E+ ++ P TG ++ L   
Sbjct: 1873 SEQIYEVAIVGPIHPGMELLMVRASDEDSEVNYSIKTGN-ADEAVTIHPVTGSISVLNPA 1931

Query: 1708 --ALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEG-Q 1764
               L R+      LT+ A D           V++++    D +  F        V E  Q
Sbjct: 1932 FLGLSRK------LTIRASD---GLYQDTALVKISLTQVLDKSLQFDQDVYWAAVKENLQ 1982

Query: 1765 DPQTLTMLRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMR-PLDREVEPAFQL 1823
            D + L +L A    +  N  L Y +L+G  +  F +  ++G   T     DRE +   +L
Sbjct: 1983 DRKALVILGAQGNHL--NDTLSYFLLNG--TDMFHMVQSAGVLQTRGVAFDREQQDTHEL 2038

Query: 1824 RIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPD 1883
             +E RD   P   A  L+ V++ D ND+ P F    Y   + +    G +L Q+ A D D
Sbjct: 2039 AVEVRDNRTPQRVAQGLVRVSIEDVNDNPPKFKHLPYYTIIQDGTEPGDVLFQVSATDED 2098

Query: 1884 AGANGHVTYYLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTT 1943
             G NG VTY   A     F ++P  G++      D +    Y   V A DG     L + 
Sbjct: 2099 LGTNGAVTYEF-AEDYTYFRIDPYLGDISLKKPFDYQALNKYHLKVIARDGGTPS-LQSE 2156

Query: 1944 VSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRL 2003
              V +TVR  N   P F +   ++R+P         TL    L  + R       I   +
Sbjct: 2157 EEVLVTVR--NKSNPLFQSPYYKVRVP------ENITLYTPILHTQARSPEGLRLIYNIV 2208

Query: 2004 AGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLFIV-ATDLGRPARSATGVIIVGLQGEA 2062
               P    T D  TG + V   P+    + + +F V ATD    + S   V ++ ++   
Sbjct: 2209 EEEPLMLFTTDFKTGVLTVT-GPLDYESKTKHVFTVRATDTALGSFSEATVEVL-VEDVN 2266

Query: 2063 ERGPRFPRASSEATIRENAPPGTPIVSPRAV-HAGGTNGPITYSILSGNEKGT--FSIQP 2119
            +  P F +     +I E  P  TP++   A     G N  ++Y I+      +  F I  
Sbjct: 2267 DNPPTFSQLVYTTSISEGLPAQTPVIQLLASDQDSGRNRDVSYQIVEDGSDVSKFFQING 2326

Query: 2120 STGAITVRSAEGLDFEVSPRLRLVLQAESGG---AFAFTVLTLTLQDANDNAPRFLRPHY 2176
            STG ++  + + LD+E      + ++A   G       T++ + + D NDN P F +P Y
Sbjct: 2327 STGEMS--TVQELDYEAQQHFHVKVRAMDKGDPPLTGETLVVVNVSDINDNPPEFRQPQY 2384

Query: 2177 VAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILD 2236
             A + E       +L+V+A D D     ++ Y + +    R  F ++ ++G I+   +  
Sbjct: 2385 EANVSELATCGHLVLKVQAIDPDSRDTSRLEYLILSGNQDRHFF-INSSSGIISMFNLCK 2443

Query: 2237 REIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNR--PTIPQP-WELRVSEDALLGS 2293
            + + +   L + A+D      V  AT+ V +  TN N+  P   Q  +E  ++E+A++G+
Sbjct: 2444 KHLDSSYNLRVGASDG-----VFRATVPVYINTTNANKYSPEFQQHLYEAELAENAMVGT 2498

Query: 2294 EIAQVTGNDVDSGP--VLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDR--YQLQL 2349
            ++  +   D DSGP   + Y +      + FS+    G+++    LD E        +++
Sbjct: 2499 KVIDLLAIDKDSGPYGTIDYTIINKLASEKFSINP-NGQIATLQKLDRENSTERVIAIKV 2557

Query: 2350 LAHDGPHEGR---ANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSG 2406
            +A DG   GR     + +++ D NDN P F  S Y V +  +    S ++ V A D D G
Sbjct: 2558 MARDG--GGRVAFCTVKIILTDENDNPPQFKASEYTVSIQSNVSKDSPVIQVLAYDADEG 2615

Query: 2407 ANGHISYHLASP---ADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRA 2463
             N  ++Y +       D   ++P  G +      V L +     +D  ++A+D G P   
Sbjct: 2616 QNADVTYSVNPEDLVKDVIEINPVTGVVKVKDSLVGLENQ---TLDFFIKAQDGGPPHWN 2672

Query: 2464 ARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSII 2523
            +   V +Q+  +    P F+   Y  +  EDLP GS +  ++A  A     ++ V  +  
Sbjct: 2673 SLVPVRLQVVPKKVSLPKFSEPLYTFSAPEDLPEGSEIGIVKAVAAQDPVIYSLVRGTTP 2732

Query: 2524 SGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQS 2583
              N   VF L+P                G + + +P+D ES   Y + V A         
Sbjct: 2733 ESNKDGVFSLDP--------------DTGVIKVRKPMDHESTKLYQIDVMAHCLQNTDVV 2778

Query: 2584 SVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSS 2643
            S+V V + V DVNDN PVF    Y+  + E+ PVG  ++ V A D D G  G V + +S+
Sbjct: 2779 SLVSVNIQVGDVNDNRPVFEADPYKAVLTENMPVGTSVIQVTAIDKDTGRDGQVSYRLSA 2838

Query: 2644 GDPSG----LFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHFAL---APVTIEV 2696
             DP      LF +D  SG +     LDCET   +   V A D  G    L   A V + +
Sbjct: 2839 -DPGSNVHELFAIDSESGWITTLQELDCETCQTYHFHVVAYD-HGQTIQLSSQALVQVSI 2896

Query: 2697 QDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGRE 2756
             D ND+ P F       SV EN  PG LV TL  +D D     R     +  G  P G+ 
Sbjct: 2897 TDENDNAPRFASEEYRGSVVENSEPGELVATLKTLDADISEQNRQVTCYITEG-DPLGQF 2955

Query: 2757 AFALNSSTGELRARVPFDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYDPVFLAP 2816
              +       + +R   D EHT  + L V A+D G   ASVTV + V   ++  P     
Sbjct: 2956 GISQVGDEWRISSRKTLDREHTAKYLLRVTASD-GKFQASVTVEIFVLDVNDNSPQCSQL 3014

Query: 2817 AFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSSPYFGINQTTGALYLRVDSRA 2876
             +  +V E    GH +  V ATD D   +  + YSL             GA   ++D   
Sbjct: 3015 LYTGKVHEDVFPGHFILKVSATDLDTDTNAQITYSL----------HGPGAHEFKLD--- 3061

Query: 2877 PGSGTATSGGGGRTRREAPRELRLEVIARGPLPGSRSATVPVTVDI 2922
            P +G  T+     T  +  R+    ++A+    G RS    +T+ +
Sbjct: 3062 PHTGELTT----LTALDRERKDVFNLVAKATDGGGRSCQADITLHV 3103



 Score =  710 bits (1833), Expect = 0.0
 Identities = 744/2782 (26%), Positives = 1172/2782 (42%), Gaps = 253/2782 (9%)

Query: 210  TGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLA 269
            T  L+RE R  Y L ++A +  +    A   + V +LD ND  P F+   Y   +SE + 
Sbjct: 104  TALLNREVRDSYTLIIQATEK-TLELEALTRVVVHILDQNDLKPLFSPPSYRVTISEDMP 162

Query: 270  PGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHE 329
              SP+ +V A+DAD G N    Y  N R       F+I   +G++ +   L+   R  HE
Sbjct: 163  LKSPICKVTATDADLGQNAEFYYAFNTRSEM----FAIHPTSGVVTVAGKLNVTWRGKHE 218

Query: 330  LVVQARDGGAHPELGSAF-----VTVHVRDANDNQPSMTVIFL----SADGSPQVS---E 377
            L V A D       G+ F     + VHV  A    P++  + +    S DG+   +   +
Sbjct: 219  LQVLAVDRMRKISEGNGFGSLAALVVHVEPALRKPPAIASVVVTPPDSNDGTTYATVLVD 278

Query: 378  AAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDA 437
            A   G  V  + V   D G       S       +A S + S   LV V      E    
Sbjct: 279  ANSSGAEVESVEVVGGDPGKHFKAIKS-------YARSNEFS---LVSVKDINWMEYLHG 328

Query: 438  YNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVV--RV 495
            +NL + A  SGS P         H+     ++  F++ +YR + L E + PGS VV  RV
Sbjct: 329  FNLSLQAR-SGSGPYFYSQIRGFHLPPSKLSSLKFEKAVYRVQ-LSEFSPPGSRVVMVRV 386

Query: 496  TARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGL 555
            T   P+      + Y L P +    F ++  +G+ITT   +D+      QL +  + G  
Sbjct: 387  TPAFPN------LQYVLKPSSENVGFKLNARTGLITTTKLMDFHDRAHYQLHIRTSPG-- 438

Query: 556  PPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSY 615
                +S  V + + D N++ P F R+ Y+ +L E   PGT  L VTATD D G  G ++Y
Sbjct: 439  ---QASTVVVIDIVDCNNHAPLFNRSSYDGTLDENIPPGTSVLAVTATDRDHGENGYVTY 495

Query: 616  SLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVD-GGGLKSMVYVKVF 674
            S    +    + PF ID + G + T++ +D +     + F V A D G   +    V +F
Sbjct: 496  S----IAGPKALPFSIDPYLGIISTSKPMDYELMKRIYTFRVRASDWGSPFRREKEVSIF 551

Query: 675  LS--DENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPL 732
            L   + NDN P F       SI    P G +++ + A D D+  +  L Y I++GN    
Sbjct: 552  LQLRNLNDNQPMFEEVNCTGSIRQDWPVGKSIMTMSAIDVDELQN--LKYEIVSGNELEY 609

Query: 733  FTLDEQSGLLTVAWP---LARRANSVVQLEIGAEDGG----------------------- 766
            F L+  SG++++  P   L     +   L+I A DG                        
Sbjct: 610  FDLNHFSGVISLKRPFINLTAGQPTSYSLKITASDGKNYASPTTLNITVVKDPHFEVPVT 669

Query: 767  ------------------GLQAEPSARVDISIVP----GTPTPPIFEQLQYVFSVPEDVA 804
                              GLQ + S+  + + +        TP   +       V E V 
Sbjct: 670  CDKTGVLTQFTKTILHFIGLQNQESSDEEFTSLSTYQINHYTPQFEDHFPQSIDVLESVP 729

Query: 805  PGTSVGIVQAHNP-PGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGPVLEL 863
              T +  + A +P  G    +   ++ G+  G F ++  +GLL    PLD E     +  
Sbjct: 730  INTPLARLAATDPDAGFNGKLVYVIADGNEEGCFDIELETGLLTVAAPLDYEATNFYILN 789

Query: 864  EVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDS 923
                  G P   +   + V + D NDN+P FP     + +  +T  GT I  L   D DS
Sbjct: 790  VTVYDLGTPQKSSWKLLTVNVKDWNDNAPRFPPGGYQLTISEDTEVGTTIAELTTKDADS 849

Query: 924  GVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRT--SH 981
              N RV +TLL+     F++ P TG + +   L     P + L++EARD  S      S 
Sbjct: 850  EDNGRVRYTLLS-PTEKFSLHPLTGELVVTGHLDRESEPRYILKVEARDQPSKGHQLFSV 908

Query: 982  FRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGPI--TYHLAAE 1039
              L + ++DV     +P+  +   R+ +P     GT +  + A  PD GP     ++  +
Sbjct: 909  TDLIITLEDVNDN--SPQCITEHNRLKVPEDLPPGTVLTFLDASDPDLGPAGEVRYVLMD 966

Query: 1040 GASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQN 1099
            GA   F ++  +G L +   LD E +  Y L + A  G +    +      V V  +N+N
Sbjct: 967  GAHGTFRVDLMTGALILERELDFERRAGYNLSLWASDGGRPLARRTLCHVEVIVLDVNEN 1026

Query: 1100 EHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQ 1159
             H P  +       V EN P GT V  V A D DSG +G L Y L +      AF I+  
Sbjct: 1027 LHPPHFASFVHQGQVQENSPSGTQVIVVAAQDDDSGLDGELQYFL-RAGTGLAAFSINQD 1085

Query: 1160 TGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAG 1219
            TG + TL  LDRE  S Y L V   D GS P S+   V++ V D NDN P   QA     
Sbjct: 1086 TGMIQTLAPLDREFASYYWLTVLAVDRGSVPLSSVTEVYIEVTDANDNPPQMSQAV---- 1141

Query: 1220 GGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLT-GPGSELFSLHPHSGELLTAAP 1278
                  + +  P GT V  L A DPD    G + + +T G     F +HP +G L TA  
Sbjct: 1142 --FYPSIQEDAPVGTSVLQLDAWDPDSSSKGKLTFNITSGNYMGFFMIHPVTGLLSTAQQ 1199

Query: 1279 LIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLT 1338
            L R  +  ++L ++  D G P   ++ +++V +L    + + PP  + +     +P  L+
Sbjct: 1200 LDRENKDEHILEVTVLDNGEPSLKSTSRVVVGILD---VNDNPPIFSHKLFNVRLPERLS 1256

Query: 1339 VTAAEGLRPGSLLGSVAAPEPAGV-GALTYTLVGGADPEGTFALDAASGRLYLARPLDFE 1397
              +     PG +   VA+    G+ G +TY++      E  F++D  +G   ++    F 
Sbjct: 1257 PVS-----PGPVYRLVASDLDEGLNGRVTYSIED--SDEEAFSIDLVTG--VVSSSSTFT 1307

Query: 1398 AGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYT 1457
            AG  +  LT++A     +G   L   V++  E    P  +  PLA             Y+
Sbjct: 1308 AG-EYNILTIKAT---DSGQPPLSASVRLHIEWIPWPRPSSIPLAF--------DETYYS 1355

Query: 1458 FRASDADGPGPNSDVRYRLLRQEPPV-----------PALRLDARTGALSAPRGLDRETT 1506
            F   + D    N  V    +   P +               ++  TG++   R LD    
Sbjct: 1356 FTVMETD--PVNHMVGVISVEGRPGLFWFNISGGDKDMDFDIEKTTGSIVIARPLDTRRR 1413

Query: 1507 PALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPS-RVRLPEDQPPGPAAL 1565
                L VE TD     SR  A +V     + + N + P F      VR+P+D  PG   L
Sbjct: 1414 SNYNLTVEVTD----GSRTIATQVHI-FMIANINHHRPQFLETRYEVRVPQDTVPGVELL 1468

Query: 1566 HVVARDPDLGEAARVSYRLAS--GGDGHFRLHSSTGALSVVRPLD-REQRAEHVLTVVAS 1622
             V A D D G++   +   +   G    F+L  S+G L  V  LD     ++H LTV+  
Sbjct: 1469 RVQAIDQDKGKSLIYTIHGSQDPGSASLFQLDPSSGVLVTVGKLDLGSGPSQHTLTVMVR 1528

Query: 1623 DHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANG 1682
            D   P +     +T+ V D N   P F Q  Y   + +   PGT LL +RA D D G N 
Sbjct: 1529 DQEIPIKRNFVWVTIHVEDGNLHPPRFTQLHYEASVPDTIAPGTELLQVRAMDADRGVNA 1588

Query: 1683 QVTYG---GVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRV 1739
            +V Y    G S   F+++   G++T  + LD+       LTV A+D+GSP      TV +
Sbjct: 1589 EVHYSLLKGNSEGFFNINALLGIITLAQKLDQANHAPHTLTVKAEDQGSPQWHDLATVII 1648

Query: 1740 AVEDENDHAPTFGSAHLSLEVPEG-QDPQTLTMLRASDPDVGANGQLQYRILDGDPSGAF 1798
             V   +  AP F  +   +E+PE       + ++ A  P      ++ Y + +G+  G F
Sbjct: 1649 HVYPSDRSAPIFSKSEYFVEIPESIPVGSPILLVSAMSP-----SEVTYELREGNKDGVF 1703

Query: 1799 VLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVP 1858
             ++  SG   T + LD E   ++QL+I  R          +++ V ++D ND+AP F   
Sbjct: 1704 SMNSYSGLISTQKKLDHEKISSYQLKI--RGSNMAGAFTDVMVVVDIIDENDNAPMFLKS 1761

Query: 1859 AYSVEVPEDVPAGTLLLQ-------LQAHDPDAGANGHVTY-YLGAGTAGAFLLEPSSGE 1910
             +  ++ E  P  ++++        + A D D  AN  + Y  L       F ++PS G 
Sbjct: 1762 TFVGQISEAAPLYSMIMDKNNNPFVIHASDSDKEANSLLVYKILEPEALKFFKIDPSMGT 1821

Query: 1911 LRTAAALDREQCPSYTFSVSAVD-GAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRL 1969
            L   + +D E  PS+ F V   D G+          V I VRDVND  P F      + +
Sbjct: 1822 LTIVSEMDYESMPSFQFCVYVHDQGSPVLFAPRPAQVIIHVRDVNDSPPRFSEQIYEVAI 1881

Query: 1970 PRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVAL 2029
              P      P + L  +RA D D+  N SI     G      T+   TG I V  +P  L
Sbjct: 1882 VGP----IHPGMELLMVRASDEDSEVNYSI---KTGNADEAVTIHPVTGSISVL-NPAFL 1933

Query: 2030 GPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVS 2089
            G   R L I A+D        T ++ + L    ++  +F +    A ++EN      +V 
Sbjct: 1934 G-LSRKLTIRASD---GLYQDTALVKISLTQVLDKSLQFDQDVYWAAVKENLQDRKALVI 1989

Query: 2090 PRAVHAGGTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESG 2149
              A      N  ++Y +L+G +   F +  S G +  R     D E      L ++    
Sbjct: 1990 LGA-QGNHLNDTLSYFLLNGTD--MFHMVQSAGVLQTRGV-AFDREQQDTHELAVEVRDN 2045

Query: 2150 GA---FAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQI 2206
                  A  ++ ++++D NDN P+F    Y   + +       L QV A D D G+ G +
Sbjct: 2046 RTPQRVAQGLVRVSIEDVNDNPPKFKHLPYYTIIQDGTEPGDVLFQVSATDEDLGTNGAV 2105

Query: 2207 SYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVM 2266
            +Y  A        F +DP  G I+     D +   +  L ++A D G+P+L     + V 
Sbjct: 2106 TYEFAEDYT---YFRIDPYLGDISLKKPFDYQALNKYHLKVIARDGGTPSLQSEEEVLVT 2162

Query: 2267 VIDTNDNRPTIPQP-WELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDPFSVG 2325
            V   N + P    P +++RV E+  L + I        + G  L Y +    P   F+  
Sbjct: 2163 V--RNKSNPLFQSPYYKVRVPENITLYTPILHTQARSPE-GLRLIYNIVEEEPLMLFTTD 2219

Query: 2326 RYGGRVSLTGPLDFEQCDRYQLQLLAHDGP--HEGRANLTVLVEDVNDNAPAFSQSLYQV 2383
               G +++TGPLD+E   ++   + A D        A + VLVEDVNDN P FSQ +Y  
Sbjct: 2220 FKTGVLTVTGPLDYESKTKHVFTVRATDTALGSFSEATVEVLVEDVNDNPPTFSQLVYTT 2279

Query: 2384 MLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADG----FSVDPNNGTLFTIVGTVA 2439
             + E  P  + ++ + A+D+DSG N  +SY +          F ++ + G + T+     
Sbjct: 2280 SISEGLPAQTPVIQLLASDQDSGRNRDVSYQIVEDGSDVSKFFQINGSTGEMSTV---QE 2336

Query: 2440 LGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGS 2499
            L ++      V + A D G P       V V + D ND+ P F    Y   V+E    G 
Sbjct: 2337 LDYEAQQHFHVKVRAMDKGDPPLTGETLVVVNVSDINDNPPEFRQPQYEANVSELATCGH 2396

Query: 2500 TLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEP 2559
             +L ++A D D SR  + ++Y I+SGN  R F +                + G + +   
Sbjct: 2397 LVLKVQAIDPD-SRDTSRLEYLILSGNQDRHFFIN--------------SSSGIISMFNL 2441

Query: 2560 LDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGA 2619
                  + YNL V A+D       + VPV +   + N   P F +  Y   + E+  VG 
Sbjct: 2442 CKKHLDSSYNLRVGASD---GVFRATVPVYINTTNANKYSPEFQQHLYEAELAENAMVGT 2498

Query: 2620 ELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQA 2679
            +++ + A D D GP+G + +T+ +   S  F ++  +G +     LD E      + ++ 
Sbjct: 2499 KVIDLLAIDKDSGPYGTIDYTIINKLASEKFSIN-PNGQIATLQKLDRENSTERVIAIKV 2557

Query: 2680 -ADPAGAHFALAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAF 2738
             A   G   A   V I + D ND+ P F  +  + S+  N    + V  + A D D G  
Sbjct: 2558 MARDGGGRVAFCTVKIILTDENDNPPQFKASEYTVSIQSNVSKDSPVIQVLAYDADEGQN 2617

Query: 2739 GRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAADAG--NLSAS 2796
              + YS+    P    ++   +N  TG ++ +        ++    + A D G  + ++ 
Sbjct: 2618 ADVTYSV---NPEDLVKDVIEINPVTGVVKVKDSLVGLENQTLDFFIKAQDGGPPHWNSL 2674

Query: 2797 VTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSL---- 2852
            V V + V  +    P F  P + F  PE    G  +G V+A      A   V+YSL    
Sbjct: 2675 VPVRLQVVPKKVSLPKFSEPLYTFSAPEDLPEGSEIGIVKAV----AAQDPVIYSLVRGT 2730

Query: 2853 ---ATSSPYFGINQTTGALYLR 2871
               +     F ++  TG + +R
Sbjct: 2731 TPESNKDGVFSLDPDTGVIKVR 2752



 Score =  649 bits (1675), Expect = 0.0
 Identities = 647/2266 (28%), Positives = 992/2266 (43%), Gaps = 227/2266 (10%)

Query: 76   LMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDREQR-DRYRFTAVTPDGAT------VE 128
            L+Y I   +  G  +   +D  SGV+ T   LD      ++  T +  D         V 
Sbjct: 1481 LIYTIHGSQDPGSASLFQLDPSSGVLVTVGKLDLGSGPSQHTLTVMVRDQEIPIKRNFVW 1540

Query: 129  VTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAG 188
            VT+ V D N H P F Q      VP+  A GT      A DAD G      Y+L    + 
Sbjct: 1541 VTIHVEDGNLHPPRFTQLHYEASVPDTIAPGTELLQVRAMDADRGVNAEVHYSLLKGNSE 1600

Query: 189  ETFRLETRPGPDGTPVPELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDI 248
              F +    G        + +  +LD+ N + + L ++A D GSP     A + + +   
Sbjct: 1601 GFFNINALLGI-------ITLAQKLDQANHAPHTLTVKAEDQGSPQWHDLATVIIHVYPS 1653

Query: 249  NDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSID 308
            +  AP F++S Y   + ES+  GSP+L V A          VTYE+  R+   DG FS++
Sbjct: 1654 DRSAPIFSKSEYFVEIPESIPVGSPILLVSAMSPSE-----VTYEL--REGNKDGVFSMN 1706

Query: 309  AHTGLLQLERPLDFEQRRVHELVVQARD-GGAHPELGSAFVTVHVRDANDNQPSMTVIFL 367
            +++GL+  ++ LD E+   ++L ++  +  GA  ++    V V + D NDN P    +FL
Sbjct: 1707 SYSGLISTQKKLDHEKISSYQLKIRGSNMAGAFTDV---MVVVDIIDENDNAP----MFL 1759

Query: 368  SADGSPQVSEAAPPGQLVAR-------ISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSV 420
             +    Q+SEAAP   ++         I  SD D    + +   +   E         S+
Sbjct: 1760 KSTFVGQISEAAPLYSMIMDKNNNPFVIHASDSDKEANSLLVYKILEPEALKFFKIDPSM 1819

Query: 421  IYLVCVARRLDREERDAYNLRVTATDSGSPPLRAE--AAFVLHVTDVNDNAPAFDRQLYR 478
              L  V+  +D E   ++   V   D GSP L A   A  ++HV DVND+ P F  Q+Y 
Sbjct: 1820 GTLTIVSE-MDYESMPSFQFCVYVHDQGSPVLFAPRPAQVIIHVRDVNDSPPRFSEQIY- 1877

Query: 479  PEPLPEVAL-----PGSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTA 533
                 EVA+     PG  ++ V A D D     +V YS+  G      +I P +G I+  
Sbjct: 1878 -----EVAIVGPIHPGMELLMVRASDEDS----EVNYSIKTGNADEAVTIHPVTGSISVL 1928

Query: 534  ASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQP 593
                  L  +  L + A+DG       +A V ++L  V D   QF +  Y A++ E  Q 
Sbjct: 1929 NPAFLGLSRK--LTIRASDG---LYQDTALVKISLTQVLDKSLQFDQDVYWAAVKENLQD 1983

Query: 594  GTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTR--TLDRDQGPS 651
                + + A          LSY L      +G+  F +   S  V  TR    DR+Q   
Sbjct: 1984 RKALVILGAQGNHLND--TLSYFL-----LNGTDMFHM-VQSAGVLQTRGVAFDREQ-QD 2034

Query: 652  SFDFTVTAVDGGGLKSMVY--VKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRA 709
            + +  V   D    + +    V+V + D NDNPP+F    Y   I   + PG  + ++ A
Sbjct: 2035 THELAVEVRDNRTPQRVAQGLVRVSIEDVNDNPPKFKHLPYYTIIQDGTEPGDVLFQVSA 2094

Query: 710  HDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGG--G 767
             D D G++G ++Y      +   F +D   G +++  P   +A +   L++ A DGG   
Sbjct: 2095 TDEDLGTNGAVTYEFAEDYT--YFRIDPYLGDISLKKPFDYQALNKYHLKVIARDGGTPS 2152

Query: 768  LQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPPGRLAPVTLS 827
            LQ+E    V +       + P+F+   Y   VPE++   T +   QA +P G    +  +
Sbjct: 2153 LQSEEEVLVTVR----NKSNPLFQSPYYKVRVPENITLYTPILHTQARSPEG--LRLIYN 2206

Query: 828  LSGGDPRGLFSLDAVSGLLQTLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDV 887
            +   +P  LF+ D  +G+L    PLD E     +   VRA      +F+ A V VL++DV
Sbjct: 2207 IVEEEPLMLFTTDFKTGVLTVTGPLDYESKTKHV-FTVRATDTALGSFSEATVEVLVEDV 2265

Query: 888  NDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGA---FTVD 944
            NDN P F     T  +       TP+  L A D DSG N  V++ ++  G      F ++
Sbjct: 2266 NDNPPTFSQLVYTTSISEGLPAQTPVIQLLASDQDSGRNRDVSYQIVEDGSDVSKFFQIN 2325

Query: 945  PTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPT 1004
             +TG +  ++ L         +++ A D G PP T    + V V D+      P F  P 
Sbjct: 2326 GSTGEMSTVQELDYEAQQHFHVKVRAMDKGDPPLTGETLVVVNVSDINDN--PPEFRQPQ 2383

Query: 1005 YRVDLPSGTTAGTQVLQVQAQAPDG---GPITYHLAAEGASSPFGLEPQSGWLWVRAALD 1061
            Y  ++    T G  VL+VQA  PD      + Y + +      F +   SG + +     
Sbjct: 2384 YEANVSELATCGHLVLKVQAIDPDSRDTSRLEYLILSGNQDRHFFINSSSGIISMFNLCK 2443

Query: 1062 REAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPG 1121
            +     Y L+V A  G          T  V ++  N N++SP   +      +AEN   G
Sbjct: 2444 KHLDSSYNLRVGASDGVFR------ATVPVYINTTNANKYSPEFQQHLYEAELAENAMVG 2497

Query: 1122 TSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLV 1181
            T V  + A D+DSGP G + Y++       K F I+P  G++ TLQ LDRE  +   + +
Sbjct: 2498 TKVIDLLAIDKDSGPYGTIDYTIINKLASEK-FSINPN-GQIATLQKLDRENSTERVIAI 2555

Query: 1182 QV--QDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTL 1239
            +V  +DGG   R    TV + + D NDN P F  +         + +   V   + V  +
Sbjct: 2556 KVMARDGGG--RVAFCTVKIILTDENDNPPQFKASE------YTVSIQSNVSKDSPVIQV 2607

Query: 1240 QAKDPDEGENGTILYTLTGPG--SELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQG 1297
             A D DEG+N  + Y++       ++  ++P +G +     L+  E       + A D G
Sbjct: 2608 LAYDADEGQNADVTYSVNPEDLVKDVIEINPVTGVVKVKDSLVGLENQTLDFFIKAQDGG 2667

Query: 1298 SPPRSASLQLLVQVLPSA----RLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLG- 1352
             P  ++ + + +QV+P      + +EP               + T +A E L  GS +G 
Sbjct: 2668 PPHWNSLVPVRLQVVPKKVSLPKFSEP---------------LYTFSAPEDLPEGSEIGI 2712

Query: 1353 --SVAAPEPAGVGALTYTLVGGADPE----GTFALDAASGRLYLARPLDFEAGPPWRALT 1406
              +VAA +P     + Y+LV G  PE    G F+LD  +G + + +P+D E+   ++   
Sbjct: 2713 VKAVAAQDP-----VIYSLVRGTTPESNKDGVFSLDPDTGVIKVRKPMDHESTKLYQIDV 2767

Query: 1407 VRAEGPGGAGARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRASDADGP 1466
            +           L+ V +QV D N++ P F  DP    L EN   G ++    A D D  
Sbjct: 2768 MAHCLQNTDVVSLVSVNIQVGDVNDNRPVFEADPYKAVLTENMPVGTSVIQVTAIDKD-T 2826

Query: 1467 GPNSDVRYRLLRQEPPV--PALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASR 1524
            G +  V YRL             +D+ +G ++  + LD ET       V A D       
Sbjct: 2827 GRDGQVSYRLSADPGSNVHELFAIDSESGWITTLQELDCETCQTYHFHVVAYDHGQTIQL 2886

Query: 1525 RRAARVSARVFVTDENDNAPVFASPS-RVRLPEDQPPGPAALHVVARDPDLGEAARVSYR 1583
               A V  +V +TDENDNAP FAS   R  + E+  PG     +   D D+ E  R    
Sbjct: 2887 SSQALV--QVSITDENDNAPRFASEEYRGSVVENSEPGELVATLKTLDADISEQNRQVTC 2944

Query: 1584 LASGGD--GHFRLHSSTG---ALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVS 1638
              + GD  G F + S  G    +S  + LDRE  A+++L V ASD G    S T  + + 
Sbjct: 2945 YITEGDPLGQFGI-SQVGDEWRISSRKTLDREHTAKYLLRVTASD-GKFQASVT--VEIF 3000

Query: 1639 VADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYG--GVSSESFSL 1696
            V DVND +P   Q  Y+  + E+  PG  +L + ATD D   N Q+TY   G  +  F L
Sbjct: 3001 VLDVNDNSPQCSQLLYTGKVHEDVFPGHFILKVSATDLDTDTNAQITYSLHGPGAHEFKL 3060

Query: 1697 DPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHL 1756
            DP TG LTTL ALDRE ++  NL   A D G       +T+ V  ED ND+AP F  +H 
Sbjct: 3061 DPHTGELTTLTALDRERKDVFNLVAKATDGGGRSCQADITLHV--EDVNDNAPRFFPSHC 3118

Query: 1757 SLEVPEGQDPQT-LTMLRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDR 1815
            ++ V +    +T + ++ A DPD GAN Q+ Y + D    G F +D  +G     +PL  
Sbjct: 3119 AVAVFDNTTVKTPVAVVFARDPDQGANAQVVYSLPDS-AEGHFSIDATTGVIRLEKPLQV 3177

Query: 1816 EVEPAFQLRIEARDGGQPALSATL-LLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLL 1874
              +   +L + A D G P   +TL  +TV+V+   D+ P F    +SV+VPED P GT +
Sbjct: 3178 RPQAPLELTVRASDLGTPIPLSTLGTVTVSVVGLEDYLPVFLNTEHSVQVPEDAPPGTEV 3237

Query: 1875 LQLQAHD-PDAGANGHVTYYLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVD 1933
            LQL     P A   G+    +     G F L+  +G L   A+LD E  P Y  S+    
Sbjct: 3238 LQLATLTRPGAEKTGYRV--VSGNEQGRFRLDARTGILYVNASLDFETSPKYFLSIEC-S 3294

Query: 1934 GAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDA 1993
              ++  LS   +V + + DVN+H P FP  P   R+             + T+ A D D 
Sbjct: 3295 RKSSSSLSDVTTVMVNITDVNEHRPQFPQDPYSTRVLENALVGDV----ILTVSATDEDG 3350

Query: 1994 GANASILYRLAGTPPPGT-TVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATG 2052
              N+ I Y L G    G  T+    GE++VA++          L + ATD G+P      
Sbjct: 3351 PLNSDITYSLIGGNQLGHFTIHPKKGELQVAKALDREQASSYSLKLRATDSGQPPLHEDT 3410

Query: 2053 VIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVS-----PRAVHAGGTNGPITYSIL 2107
             I + +    +  PRF + +   T++EN+P G+ ++      P +   G    P ++ I 
Sbjct: 3411 DIAIQVADVNDNPPRFFQLNYSTTVQENSPIGSKVLQLILSDPDSPENGP---PYSFRIT 3467

Query: 2108 SGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFTVLTLTLQDANDN 2167
             GN    F + P    +T   AEGL        +L +QA   G    + LT       + 
Sbjct: 3468 KGNNGSAFRVTPDGWLVT---AEGLSRRAQEWYQLQIQASDSGIPPLSSLTSVRVHVTEQ 3524

Query: 2168 APRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQI-----------SYSLAASQP- 2215
            +      HY    P + PLE   + V  D+   G  G+I           +YSLA  +  
Sbjct: 3525 S------HYA---PSALPLE-IFITVGEDEFQGGMVGKIHATDRDPQDTLTYSLAEEETL 3574

Query: 2216 ---------------ARGL------FHVDPTTGTITTTAILDREIW 2240
                           A+GL      F+V  + GT TTTA +   +W
Sbjct: 3575 GRHFSVGAPDGKIIAAQGLPRGHYSFNVTVSDGTFTTTAGVHVYVW 3620



 Score =  565 bits (1455), Expect = e-160
 Identities = 686/2589 (26%), Positives = 1097/2589 (42%), Gaps = 254/2589 (9%)

Query: 396  GDFAHVNVSLEGGEGHFA---LSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPL 452
            GD A+V  + E   G+F    + T+ S   L      L+RE RD+Y L + AT+  +  L
Sbjct: 76   GDVANVFKTEEYVVGNFCFLRIRTKSSNTAL------LNREVRDSYTLIIQATEK-TLEL 128

Query: 453  RAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSL 512
             A    V+H+ D ND  P F    YR     ++ L  S + +VTA D D G N +  Y+ 
Sbjct: 129  EALTRVVVHILDQNDLKPLFSPPSYRVTISEDMPLK-SPICKVTATDADLGQNAEFYYAF 187

Query: 513  APGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVN 572
                 +  F+I PTSG++T A  L+     + +L V+A D        +   S+A   V+
Sbjct: 188  --NTRSEMFAIHPTSGVVTVAGKLNVTWRGKHELQVLAVDRMRKISEGNGFGSLAALVVH 245

Query: 573  DNEPQFQRTFYNASL---PEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPF 629
              EP  ++    AS+   P  +  GT +  V   DA+S    + S  +  G         
Sbjct: 246  V-EPALRKPPAIASVVVTPPDSNDGTTYATVLV-DANSSGAEVESVEVVGGDPGKHFKAI 303

Query: 630  RIDAHSGD--VCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMVYVKVF-LSDENDNPPQFY 686
            +  A S +  + + + ++  +    F+ ++ A  G G      ++ F L     +  +F 
Sbjct: 304  KSYARSNEFSLVSVKDINWMEYLHGFNLSLQARSGSGPYFYSQIRGFHLPPSKLSSLKFE 363

Query: 687  PREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAW 746
               Y   +S  SPPG+ V+ +R       +   L Y +   +    F L+ ++GL+T   
Sbjct: 364  KAVYRVQLSEFSPPGSRVVMVRVTP----AFPNLQYVLKPSSENVGFKLNARTGLITTTK 419

Query: 747  PLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPG 806
             +     +  QL I    G     + S  V I IV      P+F +  Y  ++ E++ PG
Sbjct: 420  LMDFHDRAHYQLHIRTSPG-----QASTVVVIDIVDCNNHAPLFNRSSYDGTLDENIPPG 474

Query: 807  TSVGIVQAHNPP-GRLAPVTLSLSGGDPRGL-FSLDAVSGLLQTLRPLDRELLGPVLELE 864
            TSV  V A +   G    VT S++G  P+ L FS+D   G++ T +P+D EL+  +    
Sbjct: 475  TSVLAVTATDRDHGENGYVTYSIAG--PKALPFSIDPYLGIISTSKPMDYELMKRIYTFR 532

Query: 865  VRAGSGVPPAFAVARVRVLLD--DVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPD 922
            VRA     P      V + L   ++NDN P F     T  +  +   G  I T+ A+D D
Sbjct: 533  VRASDWGSPFRREKEVSIFLQLRNLNDNQPMFEEVNCTGSIRQDWPVGKSIMTMSAIDVD 592

Query: 923  SGVNSRVTFTLLAGGG-GAFTVDPTTGHVRLMRP---LGPSGGPAHELELEARDG---GS 975
               N  + + +++G     F ++  +G + L RP   L      ++ L++ A DG    S
Sbjct: 593  ELQN--LKYEIVSGNELEYFDLNHFSGVISLKRPFINLTAGQPTSYSLKITASDGKNYAS 650

Query: 976  PP-------RTSHFRLRVVVQDVGTR-----------GLAPRFNS-------PTYR---- 1006
            P        +  HF + V     G             GL  + +S        TY+    
Sbjct: 651  PTTLNITVVKDPHFEVPVTCDKTGVLTQFTKTILHFIGLQNQESSDEEFTSLSTYQINHY 710

Query: 1007 -----------VDLPSGTTAGTQVLQVQAQAPD---GGPITYHLAAEGASSPFGLEPQSG 1052
                       +D+       T + ++ A  PD    G + Y +A       F +E ++G
Sbjct: 711  TPQFEDHFPQSIDVLESVPINTPLARLAATDPDAGFNGKLVYVIADGNEEGCFDIELETG 770

Query: 1053 WLWVRAALDREAQELYILKVMAVSGSKAELG--QQTGTATVRVSILNQNEHSPRLSEDPT 1110
             L V A LD EA   YIL V        +LG  Q++    + V++ + N+++PR      
Sbjct: 771  LLTVAAPLDYEATNFYILNVTVY-----DLGTPQKSSWKLLTVNVKDWNDNAPRFPPGGY 825

Query: 1111 FLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLD 1170
             L ++E+   GT++  +   D DS  NGR+ Y+L   +E    F +HP TGE+     LD
Sbjct: 826  QLTISEDTEVGTTIAELTTKDADSEDNGRVRYTLLSPTE---KFSLHPLTGELVVTGHLD 882

Query: 1171 REQQSSYQLLVQVQDGGSPPR---STTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVP 1227
            RE +  Y L V+ +D  S      S T  + + + D+NDNSP  +           ++VP
Sbjct: 883  RESEPRYILKVEARDQPSKGHQLFSVTDLI-ITLEDVNDNSPQCITEHNR------LKVP 935

Query: 1228 DRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHSGELLTAAPLIRAERPHY 1287
            + +PPGT++T L A DPD G  G + Y L       F +   +G L+    L    R  Y
Sbjct: 936  EDLPPGTVLTFLDASDPDLGPAGEVRYVLMDGAHGTFRVDLMTGALILERELDFERRAGY 995

Query: 1288 VLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRP 1347
             L+L A D G P    +L  +  ++        PP  A          V      E    
Sbjct: 996  NLSLWASDGGRPLARRTLCHVEVIVLDVNENLHPPHFAS--------FVHQGQVQENSPS 1047

Query: 1348 GSLLGSVAA-PEPAGV-GALTYTLVGGADPEGTFALDAASGRLYLARPLDFE-AGPPWRA 1404
            G+ +  VAA  + +G+ G L Y L  G      F+++  +G +    PLD E A   W  
Sbjct: 1048 GTQVIVVAAQDDDSGLDGELQYFLRAGTG-LAAFSINQDTGMIQTLAPLDREFASYYW-- 1104

Query: 1405 LTVRAEGPGGAG-ARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRASDA 1463
            LTV A   G    + +  V ++V D N++ P  ++     ++ E+   G ++    A D 
Sbjct: 1105 LTVLAVDRGSVPLSSVTEVYIEVTDANDNPPQMSQAVFYPSIQEDAPVGTSVLQLDAWD- 1163

Query: 1464 DGPGPNSDVRYRL---LRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPA 1520
                P+S  + +L   +     +    +   TG LS  + LDRE     +L V   D   
Sbjct: 1164 ----PDSSSKGKLTFNITSGNYMGFFMIHPVTGLLSTAQQLDRENKDEHILEVTVLDN-G 1218

Query: 1521 NASRRRAARVSARVFVTDENDNAPVFASP-SRVRLPE---DQPPGPAALHVVARDPDLGE 1576
              S +  +RV   V + D NDN P+F+     VRLPE      PGP    +VA D D G 
Sbjct: 1219 EPSLKSTSRVV--VGILDVNDNPPIFSHKLFNVRLPERLSPVSPGP-VYRLVASDLDEGL 1275

Query: 1577 AARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLT 1636
              RV+Y +    +  F +   TG +S        +   ++LT+ A+D G PP SA+  L 
Sbjct: 1276 NGRVTYSIEDSDEEAFSIDLVTGVVSSSSTFTAGE--YNILTIKATDSGQPPLSASVRLH 1333

Query: 1637 VSVAD---VNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSES 1693
            +        +     F +  YS  + E +P    ++ + + +   G       GG     
Sbjct: 1334 IEWIPWPRPSSIPLAFDETYYSFTVMETDPV-NHMVGVISVEGRPGLFWFNISGGDKDMD 1392

Query: 1694 FSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGS 1753
            F ++  TG +   R LD   +   NLTV   D GS    T V +   + + N H P F  
Sbjct: 1393 FDIEKTTGSIVIARPLDTRRRSNYNLTVEVTD-GSRTIATQVHI-FMIANINHHRPQFLE 1450

Query: 1754 AHLSLEVPEGQDPQT-LTMLRASDPDVGANGQLQYRILDG-DPSGA--FVLDLASGEFGT 1809
                + VP+   P   L  ++A D D G +  L Y I    DP  A  F LD +SG   T
Sbjct: 1451 TRYEVRVPQDTVPGVELLRVQAIDQDKGKS--LIYTIHGSQDPGSASLFQLDPSSGVLVT 1508

Query: 1810 MRPLDREVEPA-FQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDV 1868
            +  LD    P+   L +  RD   P     + +T+ V D N H P F    Y   VP+ +
Sbjct: 1509 VGKLDLGSGPSQHTLTVMVRDQEIPIKRNFVWVTIHVEDGNLHPPRFTQLHYEASVPDTI 1568

Query: 1869 PAGTLLLQLQAHDPDAGANGHVTYYLGAGTA-GAFLLEPSSGELRTAAALDREQCPSYTF 1927
              GT LLQ++A D D G N  V Y L  G + G F +    G +  A  LD+     +T 
Sbjct: 1569 APGTELLQVRAMDADRGVNAEVHYSLLKGNSEGFFNINALLGIITLAQKLDQANHAPHTL 1628

Query: 1928 SVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLR 1987
            +V A D   +       +V I V   +  AP F  S   + +P   P   +P L ++ + 
Sbjct: 1629 TVKAED-QGSPQWHDLATVIIHVYPSDRSAPIFSKSEYFVEIPESIP-VGSPILLVSAM- 1685

Query: 1988 AEDRDAGANASILYRLAGTPPPGT-TVDSYTGEIRVAR-------SPVALGPRDRVLFIV 2039
                   + + + Y L      G  +++SY+G I   +       S   L  R   +   
Sbjct: 1686 -------SPSEVTYELREGNKDGVFSMNSYSGLISTQKKLDHEKISSYQLKIRGSNMAGA 1738

Query: 2040 ATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIV----SPRAVHA 2095
             TD+         +++V +  E +  P F +++    I E AP  + I+    +P  +HA
Sbjct: 1739 FTDV---------MVVVDIIDENDNAPMFLKSTFVGQISEAAPLYSMIMDKNNNPFVIHA 1789

Query: 2096 GGT----NGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGA 2151
              +    N  + Y IL       F I PS G +T+ S   +D+E  P  +  +     G+
Sbjct: 1790 SDSDKEANSLLVYKILEPEALKFFKIDPSMGTLTIVSE--MDYESMPSFQFCVYVHDQGS 1847

Query: 2152 FAF-----TVLTLTLQDANDNAPRFLRPHY-VAFLPESRPLEGPLLQVEADDLDQGSGGQ 2205
                      + + ++D ND+ PRF    Y VA +    P    LL V A D D     +
Sbjct: 1848 PVLFAPRPAQVIIHVRDVNDSPPRFSEQIYEVAIVGPIHP-GMELLMVRASDED----SE 1902

Query: 2206 ISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALV-GSATLT 2264
            ++YS+     A     + P TG+I   ++L+      +R +   T R S  L   +A + 
Sbjct: 1903 VNYSIKTGN-ADEAVTIHPVTGSI---SVLNPAFLGLSRKL---TIRASDGLYQDTALVK 1955

Query: 2265 VMVIDTNDNRPTIPQPWELRVSEDALLGSEIAQVTGNDVD--SGPVLWYVLSPSGPQDPF 2322
            + +    D      Q       ++ L   +   + G   +  +  + +++L+ +   D F
Sbjct: 1956 ISLTQVLDKSLQFDQDVYWAAVKENLQDRKALVILGAQGNHLNDTLSYFLLNGT---DMF 2012

Query: 2323 SVGRYGGRVSLTG-PLDFEQCDRYQLQLLAHDGPHEGRAN---LTVLVEDVNDNAPAFSQ 2378
             + +  G +   G   D EQ D ++L +   D     R     + V +EDVNDN P F  
Sbjct: 2013 HMVQSAGVLQTRGVAFDREQQDTHELAVEVRDNRTPQRVAQGLVRVSIEDVNDNPPKFKH 2072

Query: 2379 SLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTLFTIVGTV 2438
              Y  ++ + T PG  +  VSATD D G NG ++Y  A     F +DP  G +       
Sbjct: 2073 LPYYTIIQDGTEPGDVLFQVSATDEDLGTNGAVTYEFAEDYTYFRIDPYLGDISL---KK 2129

Query: 2439 ALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPG 2498
               +       + + ARD G P   +   V V ++++++  P F   +Y+V V E++   
Sbjct: 2130 PFDYQALNKYHLKVIARDGGTPSLQSEEEVLVTVRNKSN--PLFQSPYYKVRVPENITLY 2187

Query: 2499 STLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLE 2558
            + +L  +A   +G R    + Y+I+      +F  + +               G L +  
Sbjct: 2188 TPILHTQARSPEGLR----LIYNIVEEEPLMLFTTDFK--------------TGVLTVTG 2229

Query: 2559 PLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVG 2618
            PLD+ES T++  TV A D      S    V V V DVNDNPP F++  Y  ++ E  P  
Sbjct: 2230 PLDYESKTKHVFTVRATDTALGSFSEAT-VEVLVEDVNDNPPTFSQLVYTTSISEGLPAQ 2288

Query: 2619 AELLHVEASDADPGPHGLVRFTV--SSGDPSGLFELDESSGTLRLAHALDCETQARHQLV 2676
              ++ + ASD D G +  V + +     D S  F+++ S+G +     LD E Q    + 
Sbjct: 2289 TPVIQLLASDQDSGRNRDVSYQIVEDGSDVSKFFQINGSTGEMSTVQELDYEAQQHFHVK 2348

Query: 2677 VQAADPAGAHF-ALAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDA 2735
            V+A D           V + V D+ND+ P F       +V+E    G LV  + AID D+
Sbjct: 2349 VRAMDKGDPPLTGETLVVVNVSDINDNPPEFRQPQYEANVSELATCGHLVLKVQAIDPDS 2408

Query: 2736 GAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAADAGNLSA 2795
                RL Y +L    G + R  F +NSS+G +            S+ L VGA+D G   A
Sbjct: 2409 RDTSRLEYLILS---GNQDRH-FFINSSSGIISMFNLCKKHLDSSYNLRVGASD-GVFRA 2463

Query: 2796 SVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSLAT- 2854
            +V V +  T  ++Y P F    +  ++ E A  G  +  + A D+D G  G + Y++   
Sbjct: 2464 TVPVYINTTNANKYSPEFQQHLYEAELAENAMVGTKVIDLLAIDKDSGPYGTIDYTIINK 2523

Query: 2855 -SSPYFGIN 2862
             +S  F IN
Sbjct: 2524 LASEKFSIN 2532



 Score =  298 bits (764), Expect = 5e-80
 Identities = 323/1179 (27%), Positives = 497/1179 (42%), Gaps = 148/1179 (12%)

Query: 1785 LQYRILDGDPSGAFVLD-LASGEFGTMRP---------LDREVEPAFQLRIEARDGGQPA 1834
            ++YRI+ GD +  F  +    G F  +R          L+REV  ++ L I+A +     
Sbjct: 69   VRYRIISGDVANVFKTEEYVVGNFCFLRIRTKSSNTALLNREVRDSYTLIIQATEKTLE- 127

Query: 1835 LSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYL 1894
            L A   + V +LD ND  P F  P+Y V + ED+P  + + ++ A D D G N    YY 
Sbjct: 128  LEALTRVVVHILDQNDLKPLFSPPSYRVTISEDMPLKSPICKVTATDADLGQNAEF-YYA 186

Query: 1895 GAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVD-------GAAAGPLSTTVSVT 1947
                +  F + P+SG +  A  L+      +   V AVD       G   G L+  V   
Sbjct: 187  FNTRSEMFAIHPTSGVVTVAGKLNVTWRGKHELQVLAVDRMRKISEGNGFGSLAALVV-- 244

Query: 1948 ITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTP 2007
                    H       P  +      P  S      AT+  +   +GA    +  + G P
Sbjct: 245  --------HVEPALRKPPAIASVVVTPPDSNDGTTYATVLVDANSSGAEVESVEVVGGDP 296

Query: 2008 PPG-TTVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVG------LQG 2060
                  + SY        S V++   + + ++   +L   ARS +G           L  
Sbjct: 297  GKHFKAIKSYARSNEF--SLVSVKDINWMEYLHGFNLSLQARSGSGPYFYSQIRGFHLPP 354

Query: 2061 EAERGPRFPRASSEATIRENAPPGTPIVSPRAVHAGGTNGPITYSILSGNEKGTFSIQPS 2120
                  +F +A     + E +PPG+ +V  R   A      + Y +   +E   F +   
Sbjct: 355  SKLSSLKFEKAVYRVQLSEFSPPGSRVVMVRVTPAFPN---LQYVLKPSSENVGFKLNAR 411

Query: 2121 TGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFTVLTLTLQDANDNAPRFLRPHYVAFL 2180
            TG IT      +DF      +L ++   G A   TV+ + + D N++AP F R  Y   L
Sbjct: 412  TGLITTTKL--MDFHDRAHYQLHIRTSPGQAS--TVVVIDIVDCNNHAPLFNRSSYDGTL 467

Query: 2181 PESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIW 2240
             E+ P    +L V A D D G  G ++YS+A   P    F +DP  G I+T+  +D E+ 
Sbjct: 468  DENIPPGTSVLAVTATDRDHGENGYVTYSIAG--PKALPFSIDPYLGIISTSKPMDYELM 525

Query: 2241 AET-RLVLMATDRGSP-ALVGSATLTVMVIDTNDNRPTIPQ-PWELRVSEDALLGSEIAQ 2297
                   + A+D GSP       ++ + + + NDN+P   +      + +D  +G  I  
Sbjct: 526  KRIYTFRVRASDWGSPFRREKEVSIFLQLRNLNDNQPMFEEVNCTGSIRQDWPVGKSIMT 585

Query: 2298 VTGNDVDSGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGP---LDFEQCDRYQLQLLAHDG 2354
            ++  DVD    L Y +      + F +  + G +SL  P   L   Q   Y L++ A DG
Sbjct: 586  MSAIDVDELQNLKYEIVSGNELEYFDLNHFSGVISLKRPFINLTAGQPTSYSLKITASDG 645

Query: 2355 PHEG---RANLTVLVE-------------------------------------------- 2367
             +       N+TV+ +                                            
Sbjct: 646  KNYASPTTLNITVVKDPHFEVPVTCDKTGVLTQFTKTILHFIGLQNQESSDEEFTSLSTY 705

Query: 2368 DVNDNAPAFSQSLYQ-VMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADG--FSV 2424
             +N   P F     Q + +LE  P  + +  ++ATD D+G NG + Y +A   +   F +
Sbjct: 706  QINHYTPQFEDHFPQSIDVLESVPINTPLARLAATDPDAGFNGKLVYVIADGNEEGCFDI 765

Query: 2425 DPNNGTLFTIVGTVA--LGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSF 2482
            +   G L     TVA  L ++ +    + +   D G P +++   + V ++D ND+AP F
Sbjct: 766  ELETGLL-----TVAAPLDYEATNFYILNVTVYDLGTPQKSSWKLLTVNVKDWNDNAPRF 820

Query: 2483 TLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGE 2542
                Y++ ++ED   G+T+  L   DAD S  +  V Y+++S      F L P   E   
Sbjct: 821  PPGGYQLTISEDTEVGTTIAELTTKDAD-SEDNGRVRYTLLSPT--EKFSLHPLTGE--- 874

Query: 2543 SAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQS----SVVPVTVTVLDVNDN 2598
                       LV+   LD ES  +Y L V A D  QP +     SV  + +T+ DVNDN
Sbjct: 875  -----------LVVTGHLDRESEPRYILKVEARD--QPSKGHQLFSVTDLIITLEDVNDN 921

Query: 2599 PPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGT 2658
             P       R+ VPED P G  L  ++ASD D GP G VR+ +  G   G F +D  +G 
Sbjct: 922  SPQCITEHNRLKVPEDLPPGTVLTFLDASDPDLGPAGEVRYVLMDG-AHGTFRVDLMTGA 980

Query: 2659 LRLAHALDCETQARHQLVVQAADPAG--AHFALAPVTIEVQDVND--HGPAFPLNLLSTS 2714
            L L   LD E +A + L + A+D     A   L  V + V DVN+  H P F   +    
Sbjct: 981  LILERELDFERRAGYNLSLWASDGGRPLARRTLCHVEVIVLDVNENLHPPHFASFVHQGQ 1040

Query: 2715 VAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFD 2774
            V EN P GT V  + A D D+G  G L+Y  L AG    G  AF++N  TG ++   P D
Sbjct: 1041 VQENSPSGTQVIVVAAQDDDSGLDGELQY-FLRAG---TGLAAFSINQDTGMIQTLAPLD 1096

Query: 2775 YEHTESFRLLVGAADAGN--LSASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSL 2832
             E    + L V A D G+  LS+   V + VT  ++  P      F+  + E A  G S+
Sbjct: 1097 REFASYYWLTVLAVDRGSVPLSSVTEVYIEVTDANDNPPQMSQAVFYPSIQEDAPVGTSV 1156

Query: 2833 GHVQATDEDGGADGLVLYSLATSSPYFG---INQTTGAL 2868
              + A D D  + G + +++ TS  Y G   I+  TG L
Sbjct: 1157 LQLDAWDPDSSSKGKLTFNI-TSGNYMGFFMIHPVTGLL 1194



 Score =  110 bits (276), Expect = 2e-23
 Identities = 141/562 (25%), Positives = 243/562 (43%), Gaps = 63/562 (11%)

Query: 2332 SLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVLVE--DVNDNAPAFSQSLYQVMLLEHT 2389
            S T  L+ E  D Y L + A +   E  A   V+V   D ND  P FS   Y+V + E  
Sbjct: 102  SNTALLNREVRDSYTLIIQATEKTLELEALTRVVVHILDQNDLKPLFSPPSYRVTISEDM 161

Query: 2390 PPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSG--- 2446
            P  S I  V+ATD D G N    Y   + ++ F++ P +G + T+ G + +   G     
Sbjct: 162  PLKSPICKVTATDADLGQNAEFYYAFNTRSEMFAIHPTSGVV-TVAGKLNVTWRGKHELQ 220

Query: 2447 --AVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTL 2504
              AVD + +  +    G  A   VHV+   +   A         +A     PP S   T 
Sbjct: 221  VLAVDRMRKISEGNGFGSLAALVVHVEPALRKPPA---------IASVVVTPPDSNDGTT 271

Query: 2505 EATD-ADGSRSHAAVD-YSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDF 2562
             AT   D + S A V+   ++ G+ G+ F+     A + E +         LV ++ +++
Sbjct: 272  YATVLVDANSSGAEVESVEVVGGDPGKHFKAIKSYARSNEFS---------LVSVKDINW 322

Query: 2563 -ESLTQYNLTVAAADRGQPPQSSVV------PVTVTVLDVNDNPPVFTRASYRVTVPEDT 2615
             E L  +NL++ A     P   S +      P  ++ L        F +A YRV + E +
Sbjct: 323  MEYLHGFNLSLQARSGSGPYFYSQIRGFHLPPSKLSSLK-------FEKAVYRVQLSEFS 375

Query: 2616 PVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQL 2675
            P G+ ++ V  + A P     +++ +     +  F+L+  +G +     +D   +A +QL
Sbjct: 376  PPGSRVVMVRVTPAFPN----LQYVLKPSSENVGFKLNARTGLITTTKLMDFHDRAHYQL 431

Query: 2676 VVQAADPAGAHFALAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDA 2735
             ++ +       A   V I++ D N+H P F  +    ++ EN PPGT V  + A D D 
Sbjct: 432  HIRTSPGQ----ASTVVVIDIVDCNNHAPLFNRSSYDGTLDENIPPGTSVLAVTATDRDH 487

Query: 2736 GAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTES-FRLLVGAADAGN-- 2792
            G  G + YS+  AGP       F+++   G +    P DYE  +  +   V A+D G+  
Sbjct: 488  GENGYVTYSI--AGP---KALPFSIDPYLGIISTSKPMDYELMKRIYTFRVRASDWGSPF 542

Query: 2793 -LSASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYS 2851
                 V++ + +   ++  P+F        + +    G S+  + A D D   +  + Y 
Sbjct: 543  RREKEVSIFLQLRNLNDNQPMFEEVNCTGSIRQDWPVGKSIMTMSAIDVDELQN--LKYE 600

Query: 2852 LATSS--PYFGINQTTGALYLR 2871
            + + +   YF +N  +G + L+
Sbjct: 601  IVSGNELEYFDLNHFSGVISLK 622



 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 78/287 (27%), Positives = 122/287 (42%), Gaps = 20/287 (6%)

Query: 2482 FTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAG 2541
            FT SHY   + E+  P + + + E      +    AV Y IISG+   VF+ E  +   G
Sbjct: 33   FTHSHYNATIYENSSPKTYVESFEKMGIYLAEPQWAVRYRIISGDVANVFKTEEYV--VG 90

Query: 2542 ESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPV 2601
                   R       L  L+ E    Y L + A ++    + ++  V V +LD ND  P+
Sbjct: 91   NFCFLRIRTKSSNTAL--LNREVRDSYTLIIQATEKTLELE-ALTRVVVHILDQNDLKPL 147

Query: 2602 FTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRL 2661
            F+  SYRVT+ ED P+ + +  V A+DAD G +    F  +    S +F +  +SG + +
Sbjct: 148  FSPPSYRVTISEDMPLKSPICKVTATDADLGQN--AEFYYAFNTRSEMFAIHPTSGVVTV 205

Query: 2662 AHALDCETQARHQLVVQAAD------PAGAHFALAPVTIEVQDVNDHGPAFPLNLLSTSV 2715
            A  L+   + +H+L V A D            +LA + + V+      PA        SV
Sbjct: 206  AGKLNVTWRGKHELQVLAVDRMRKISEGNGFGSLAALVVHVEPALRKPPAI------ASV 259

Query: 2716 AENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNS 2762
                P     TT   +  DA + G      +E   G  G+   A+ S
Sbjct: 260  VVTPPDSNDGTTYATVLVDANSSG-AEVESVEVVGGDPGKHFKAIKS 305


>gi|145309304 cadherin EGF LAG seven-pass G-type receptor 3 [Homo
            sapiens]
          Length = 3312

 Score =  431 bits (1109), Expect = e-120
 Identities = 328/1010 (32%), Positives = 481/1010 (47%), Gaps = 60/1010 (5%)

Query: 1463 ADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANA 1522
            A G GP  D   R  R  P   +   ++RT    AP+   R  +  L        RP   
Sbjct: 238  ASGSGPELDSAPRTARTAPASGSAPRESRTAPEPAPK---RMRSRGLFRCRFLPQRPGPR 294

Query: 1523 SRRRAARVSARVFVTDEN--------DNAPVFASPS-RVRLPEDQPPGPAALHVVARDPD 1573
                 AR  AR  VT  N        +  P F   + +  +PE++  G A L VVA+DPD
Sbjct: 295  PPGLPARPEARK-VTSANRARFRRAANRHPQFPQYNYQTLVPENEAAGTAVLRVVAQDPD 353

Query: 1574 LGEAARVSYRLASGGDGH----FRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPR 1629
             GEA R+ Y LA+  +      F +   +G +     LDRE    H L V A DHGSP  
Sbjct: 354  AGEAGRLVYSLAALMNSRSLELFSIDPQSGLIRTAAALDRESMERHYLRVTAQDHGSPRL 413

Query: 1630 SATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGV 1689
            SAT ++ V+VAD ND +P F+Q +Y   LREN   G  +L LRATD D   N  + Y  V
Sbjct: 414  SATTMVAVTVADRNDHSPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRFV 473

Query: 1690 --------SSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRV-- 1739
                    ++ +F +DP +G+++T   +DRE  E   L V A D+G  P     TVRV  
Sbjct: 474  GPPAARAAAAAAFEIDPRSGLISTSGRVDREHMESYELVVEASDQGQEPGPRSATVRVHI 533

Query: 1740 AVEDENDHAPTFGSAHLSLEVPEGQDPQTLTM-LRASDPDVGANGQLQYRILDGDPSGAF 1798
             V DEND+AP F       +V E   P T+ + + A+D D  ANG + Y I+ G+  G F
Sbjct: 534  TVLDENDNAPQFSEKRYVAQVREDVRPHTVVLRVTATDRDKDANGLVHYNIISGNSRGHF 593

Query: 1799 VLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSA-TLLLTVTVLDANDHAPAFPV 1857
             +D  +GE   + PLD E E  + LRI A+D G+P LS  T L ++ V+D NDH P F  
Sbjct: 594  AIDSLTGEIQVVAPLDFEAEREYALRIRAQDAGRPPLSNNTGLASIQVVDINDHIPIFVS 653

Query: 1858 PAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYL-GAGTAGAFLLEPSSGELRTAAA 1916
              + V V E+ P G  ++ +QA D D G N  + Y L G      F++  ++G +  +  
Sbjct: 654  TPFQVSVLENAPLGHSVIHIQAVDADHGENARLEYSLTGVAPDTPFVINSATGWVSVSGP 713

Query: 1917 LDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSF 1976
            LDRE    Y F V A D  +  PLS + SVT+TV DVND+ P F      LRL       
Sbjct: 714  LDRESVEHYFFGVEARDHGSP-PLSASASVTVTVLDVNDNRPEFTMKEYHLRLNED---- 768

Query: 1977 STPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALG-PRDRV 2035
            +    ++ ++ A DRDA  N++I Y++ G         S  G + +    + L   ++R 
Sbjct: 769  AAVGTSVVSVTAVDRDA--NSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERY 826

Query: 2036 LFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHA 2095
              +V T   R       V I        R P F  A    ++ E+ P G+ IV   A   
Sbjct: 827  FKLVLTASDRALHDHCYVHINITDANTHR-PVFQSAHYSVSVNEDRPMGSTIVVISASDD 885

Query: 2096 G-GTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGA--- 2151
              G N  ITY  L  +    F I   +GAIT+++   LD+E      L + A   G    
Sbjct: 886  DVGENARITY--LLEDNLPQFRIDADSGAITLQAP--LDYEDQVTYTLAITARDNGIPQK 941

Query: 2152 FAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLA 2211
               T + + + D NDNAP+F+  HY   + E  P    +LQ+ A D D  + G++ Y+  
Sbjct: 942  ADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFTSVLQISATDRDAHANGRVQYTFQ 1001

Query: 2212 ASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTN 2271
              +   G F ++PT+G + T   LDRE  +   L   A DRG P L    ++ VMV D N
Sbjct: 1002 NGEDGDGDFTIEPTSGIVRTVRRLDREAVSVYELTAYAVDRGVPPLRTPVSIQVMVQDVN 1061

Query: 2272 DNRPTIP-QPWELRVSEDALLGSEIAQVTGNDVDSGP---VLWYVLSPSGPQDPFSVGRY 2327
            DN P  P + +E+RV E++++GS +AQ+T  D D GP   +++ ++  + P + F +  +
Sbjct: 1062 DNAPVFPAEEFEVRVKENSIVGSVVAQITAVDPDEGPNAHIMYQIVEGNIP-ELFQMDIF 1120

Query: 2328 GGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLE 2387
             G ++    LD+E    Y + + A   P   RA + V + D NDN+P  +   +Q++   
Sbjct: 1121 SGELTALIDLDYEARQEYVIVVQATSAPLVSRATVHVRLVDQNDNSPVLNN--FQILFNN 1178

Query: 2388 H------TPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTL 2431
            +      T P   I  + A D D   +   S+   +      V+  +G L
Sbjct: 1179 YVSNRSDTFPSGIIGRIPAYDPDVSDHLFYSFERGNELQLLVVNQTSGEL 1228



 Score =  405 bits (1040), Expect = e-112
 Identities = 313/987 (31%), Positives = 477/987 (48%), Gaps = 63/987 (6%)

Query: 1848 ANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGA----GTAGAFL 1903
            AN H P FP   Y   VPE+  AGT +L++ A DPDAG  G + Y L A     +   F 
Sbjct: 319  ANRH-PQFPQYNYQTLVPENEAAGTAVLRVVAQDPDAGEAGRLVYSLAALMNSRSLELFS 377

Query: 1904 LEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTS 1963
            ++P SG +RTAAALDRE    +   V+A D  +   LS T  V +TV D NDH+P F  +
Sbjct: 378  IDPQSGLIRTAAALDRESMERHYLRVTAQDHGSPR-LSATTMVAVTVADRNDHSPVFEQA 436

Query: 1964 PLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVA 2023
              R  L R       P L L   RA D DA  NA++ YR  G PP      +   EI   
Sbjct: 437  QYRETL-RENVEEGYPILQL---RATDGDAPPNANLRYRFVG-PPAARAAAAAAFEIDPR 491

Query: 2024 RSPVALGPR-DRV------LFIVATDLGRPA--RSATGVIIVGLQGEAERGPRFPRASSE 2074
               ++   R DR       L + A+D G+    RSAT  + + +  E +  P+F      
Sbjct: 492  SGLISTSGRVDREHMESYELVVEASDQGQEPGPRSATVRVHITVLDENDNAPQFSEKRYV 551

Query: 2075 ATIRENAPPGTPIVSPRAVHAG-GTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLD 2133
            A +RE+  P T ++   A       NG + Y+I+SGN +G F+I   TG I V +   LD
Sbjct: 552  AQVREDVRPHTVVLRVTATDRDKDANGLVHYNIISGNSRGHFAIDSLTGEIQVVAP--LD 609

Query: 2134 FEVSPRLRLVLQAESGGAFAFT----VLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGP 2189
            FE      L ++A+  G    +    + ++ + D ND+ P F+   +   + E+ PL   
Sbjct: 610  FEAEREYALRIRAQDAGRPPLSNNTGLASIQVVDINDHIPIFVSTPFQVSVLENAPLGHS 669

Query: 2190 LLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMA 2249
            ++ ++A D D G   ++ YSL    P    F ++  TG ++ +  LDRE        + A
Sbjct: 670  VIHIQAVDADHGENARLEYSLTGVAPDTP-FVINSATGWVSVSGPLDRESVEHYFFGVEA 728

Query: 2250 TDRGSPALVGSATLTVMVIDTNDNRPTIP-QPWELRVSEDALLGSEIAQVTGNDVDSGPV 2308
             D GSP L  SA++TV V+D NDNRP    + + LR++EDA +G+ +  VT  D D+   
Sbjct: 729  RDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVSVTAVDRDANSA 788

Query: 2309 LWYVLSPSGPQDPFSVGRYGG--RVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVLV 2366
            + Y ++    ++ F++   GG   V+L  PLD++Q   ++L L A D        + + +
Sbjct: 789  ISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRALHDHCYVHINI 848

Query: 2367 EDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDP 2426
             D N + P F  + Y V + E  P GS I+ +SA+D D G N  I+Y L      F +D 
Sbjct: 849  TDANTHRPVFQSAHYSVSVNEDRPMGSTIVVISASDDDVGENARITYLLEDNLPQFRIDA 908

Query: 2427 NNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSH 2486
            ++G    I     L ++      + + ARD+G P +A    V V + D ND+AP F  SH
Sbjct: 909  DSGA---ITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQFVASH 965

Query: 2487 YRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRV-FQLEPRLAEAGESAG 2545
            Y   V+ED PP +++L + ATD D + ++  V Y+  +G  G   F +EP          
Sbjct: 966  YTGLVSEDAPPFTSVLQISATDRD-AHANGRVQYTFQNGEDGDGDFTIEP---------- 1014

Query: 2546 PGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRA 2605
                  G +  +  LD E+++ Y LT  A DRG PP  + V + V V DVNDN PVF   
Sbjct: 1015 ----TSGIVRTVRRLDREAVSVYELTAYAVDRGVPPLRTPVSIQVMVQDVNDNAPVFPAE 1070

Query: 2606 SYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHAL 2665
             + V V E++ VG+ +  + A D D GP+  + + +  G+   LF++D  SG L     L
Sbjct: 1071 EFEVRVKENSIVGSVVAQITAVDPDEGPNAHIMYQIVEGNIPELFQMDIFSGELTALIDL 1130

Query: 2666 DCETQARHQLVVQAADPAGAHFALAPVTIEVQDVNDHGPAF-PLNLLSTSVAENQP---P 2721
            D E +  + +VVQA   +    + A V + + D ND+ P      +L  +   N+    P
Sbjct: 1131 DYEARQEYVIVVQAT--SAPLVSRATVHVRLVDQNDNSPVLNNFQILFNNYVSNRSDTFP 1188

Query: 2722 GTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESF 2781
              ++  + A D D      L YS  E G      +   +N ++GELR     D       
Sbjct: 1189 SGIIGRIPAYDPDVS--DHLFYS-FERG---NELQLLVVNQTSGELRLSRKLDNNRPLVA 1242

Query: 2782 RLLVGAADA-GNLSASVTVSVLVTGED 2807
             +LV   D   +++A   + V++  E+
Sbjct: 1243 SMLVTVTDGLHSVTAQCVLRVVIITEE 1269



 Score =  376 bits (966), Expect = e-103
 Identities = 304/986 (30%), Positives = 472/986 (47%), Gaps = 68/986 (6%)

Query: 998  PRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGP---ITYHLAAEGASSP---FGLEPQS 1051
            P+F    Y+  +P    AGT VL+V AQ PD G    + Y LAA   S     F ++PQS
Sbjct: 323  PQFPQYNYQTLVPENEAAGTAVLRVVAQDPDAGEAGRLVYSLAALMNSRSLELFSIDPQS 382

Query: 1052 GWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTF 1111
            G +   AALDRE+ E + L+V A       L   + T  V V++ ++N+HSP   +    
Sbjct: 383  GLIRTAAALDRESMERHYLRVTAQDHGSPRL---SATTMVAVTVADRNDHSPVFEQAQYR 439

Query: 1112 LAVAENQPPGTSVGRVFATDRDSGPNGRLTYSL----QQLSEDSKAFRIHPQTGEVTTLQ 1167
              + EN   G  + ++ ATD D+ PN  L Y         +  + AF I P++G ++T  
Sbjct: 440  ETLRENVEEGYPILQLRATDGDAPPNANLRYRFVGPPAARAAAAAAFEIDPRSGLISTSG 499

Query: 1168 TLDREQQSSYQLLVQVQDGGSPP--RSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQ 1225
             +DRE   SY+L+V+  D G  P  RS T  VH+ VLD NDN+P F +    A      Q
Sbjct: 500  RVDREHMESYELVVEASDQGQEPGPRSATVRVHITVLDENDNAPQFSEKRYVA------Q 553

Query: 1226 VPDRVPPGTLVTTLQAKDPDEGENGTILYTL-TGPGSELFSLHPHSGELLTAAPLIRAER 1284
            V + V P T+V  + A D D+  NG + Y + +G     F++   +GE+   APL     
Sbjct: 554  VREDVRPHTVVLRVTATDRDKDANGLVHYNIISGNSRGHFAIDSLTGEIQVVAPLDFEAE 613

Query: 1285 PHYVLTLSAHDQGSPPRSASLQLL-VQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAE 1343
              Y L + A D G PP S +  L  +QV+          D+ +  P   V     V+  E
Sbjct: 614  REYALRIRAQDAGRPPLSNNTGLASIQVV----------DINDHIPIF-VSTPFQVSVLE 662

Query: 1344 GLRPG-SLLGSVAAPEPAGVGA-LTYTLVGGADPEGTFALDAASGRLYLARPLDFEAGPP 1401
                G S++   A     G  A L Y+L G A P+  F +++A+G + ++ PLD E+   
Sbjct: 663  NAPLGHSVIHIQAVDADHGENARLEYSLTGVA-PDTPFVINSATGWVSVSGPLDRESVEH 721

Query: 1402 WR-ALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRA 1460
            +   +  R  G     A    V V V D N++ P F      L L E+   G ++ +  A
Sbjct: 722  YFFGVEARDHGSPPLSASA-SVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVSVTA 780

Query: 1461 SDADGPGPNSDVRYRLLRQEPPVP-ALRLDARTGALSAPRGLDRETTPALLLLVEATDRP 1519
             D D    NS + Y++         A+      G ++    LD +      L++ A+DR 
Sbjct: 781  VDRDA---NSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRA 837

Query: 1520 ANASRRRAARVSARVFVTDENDNAPVFASPS-RVRLPEDQPPGPAALHVVARDPDLGEAA 1578
             +            + +TD N + PVF S    V + ED+P G   + + A D D+GE A
Sbjct: 838  LHD------HCYVHINITDANTHRPVFQSAHYSVSVNEDRPMGSTIVVISASDDDVGENA 891

Query: 1579 RVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVS 1638
            R++Y L       FR+ + +GA+++  PLD E +  + L + A D+G P ++ T  + V 
Sbjct: 892  RITYLLEDNLP-QFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVM 950

Query: 1639 VADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSES----F 1694
            V DVND AP F    Y+ L+ E+ PP TS+L + ATD D  ANG+V Y   + E     F
Sbjct: 951  VNDVNDNAPQFVASHYTGLVSEDAPPFTSVLQISATDRDAHANGRVQYTFQNGEDGDGDF 1010

Query: 1695 SLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSA 1754
            +++P +G++ T+R LDRE      LT YA DRG PP  T V+++V V+D ND+AP F + 
Sbjct: 1011 TIEPTSGIVRTVRRLDREAVSVYELTAYAVDRGVPPLRTPVSIQVMVQDVNDNAPVFPAE 1070

Query: 1755 HLSLEVPEGQDP-QTLTMLRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPL 1813
               + V E       +  + A DPD G N  + Y+I++G+    F +D+ SGE   +  L
Sbjct: 1071 EFEVRVKENSIVGSVVAQITAVDPDEGPNAHIMYQIVEGNIPELFQMDIFSGELTALIDL 1130

Query: 1814 DREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFP-----VPAYSVEVPEDV 1868
            D E    + + ++A       L +   + V ++D ND++P           Y     +  
Sbjct: 1131 DYEARQEYVIVVQATSA---PLVSRATVHVRLVDQNDNSPVLNNFQILFNNYVSNRSDTF 1187

Query: 1869 PAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLL-EPSSGELRTAAALDREQCPSYTF 1927
            P+G ++ ++ A+DPD   + H+ Y    G     L+   +SGELR +  LD  +    + 
Sbjct: 1188 PSG-IIGRIPAYDPDV--SDHLFYSFERGNELQLLVVNQTSGELRLSRKLDNNRPLVASM 1244

Query: 1928 SVSAVDGAAAGPLSTTVSVTITVRDV 1953
             V+  DG  +      + V I   ++
Sbjct: 1245 LVTVTDGLHSVTAQCVLRVVIITEEL 1270



 Score =  360 bits (923), Expect = 2e-98
 Identities = 309/936 (33%), Positives = 441/936 (47%), Gaps = 65/936 (6%)

Query: 51   IDEEQPAGTLIGDISAGLP-AGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDR 109
            + E + AGT +  + A  P AG A  L+Y ++A   S      +ID  SG++RTA  LDR
Sbjct: 334  VPENEAAGTAVLRVVAQDPDAGEAGRLVYSLAALMNSRSLELFSIDPQSGLIRTAAALDR 393

Query: 110  EQRDRYRFTAVTPD------GATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYP 163
            E  +R+       D       AT  V V VAD NDH+P F QA+    + E+   G  YP
Sbjct: 394  ESMERHYLRVTAQDHGSPRLSATTMVAVTVADRNDHSPVFEQAQYRETLRENVEEG--YP 451

Query: 164  LEPAR--DADAGRLGTQGYALSGD-----GAGETFRLETRPGPDGTPVPELVVTGELDRE 216
            +   R  D DA       Y   G       A   F ++ R G   T       +G +DRE
Sbjct: 452  ILQLRATDGDAPPNANLRYRFVGPPAARAAAAAAFEIDPRSGLIST-------SGRVDRE 504

Query: 217  NRSHYMLQLEAYDGGSP--PRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPV 274
            +   Y L +EA D G    PR A   + +T+LD ND+AP F++ RY A V E + P + V
Sbjct: 505  HMESYELVVEASDQGQEPGPRSATVRVHITVLDENDNAPQFSEKRYVAQVREDVRPHTVV 564

Query: 275  LQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQA 334
            L+V A+D D   NG V Y I    S G   F+ID+ TG +Q+  PLDFE  R + L ++A
Sbjct: 565  LRVTATDRDKDANGLVHYNIISGNSRGH--FAIDSLTGEIQVVAPLDFEAEREYALRIRA 622

Query: 335  RDGGAHP-ELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDP 393
            +D G  P    +   ++ V D ND+ P    IF+S      V E AP G  V  I   D 
Sbjct: 623  QDAGRPPLSNNTGLASIQVVDINDHIP----IFVSTPFQVSVLENAPLGHSVIHIQAVDA 678

Query: 394  DDGDFAHVNVSLEG--GEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPP 451
            D G+ A +  SL G   +  F +   +S    V V+  LDRE  + Y   V A D GSPP
Sbjct: 679  DHGENARLEYSLTGVAPDTPFVI---NSATGWVSVSGPLDRESVEHYFFGVEARDHGSPP 735

Query: 452  LRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYS 511
            L A A+  + V DVNDN P F  + Y    L E A  G+ VV VTA D D   N  ++Y 
Sbjct: 736  LSASASVTVTVLDVNDNRPEFTMKEYHLR-LNEDAAVGTSVVSVTAVDRD--ANSAISYQ 792

Query: 512  LAPGAHTHWFSIDPTSGI--ITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQ 569
            +  G   + F+I    G+  +T A  LDY+ E   +L++ A+D     L     V + + 
Sbjct: 793  ITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRA---LHDHCYVHINIT 849

Query: 570  DVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPF 629
            D N + P FQ   Y+ S+ E    G+  + ++A+D D G    ++Y L   L     P F
Sbjct: 850  DANTHRPVFQSAHYSVSVNEDRPMGSTIVVISASDDDVGENARITYLLEDNL-----PQF 904

Query: 630  RIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGG--GLKSMVYVKVFLSDENDNPPQFYP 687
            RIDA SG +     LD +    ++   +TA D G        YV+V ++D NDN PQF  
Sbjct: 905  RIDADSGAITLQAPLDYED-QVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQFVA 963

Query: 688  REYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAG-NSPPLFTLDEQSGLLTVAW 746
              Y   +S  +PP T+VL++ A D D  ++GR+ Y    G +    FT++  SG++    
Sbjct: 964  SHYTGLVSEDAPPFTSVLQISATDRDAHANGRVQYTFQNGEDGDGDFTIEPTSGIVRTVR 1023

Query: 747  PLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPG 806
             L R A SV +L   A D G         + + +       P+F   ++   V E+   G
Sbjct: 1024 RLDREAVSVYELTAYAVDRGVPPLRTPVSIQVMVQDVNDNAPVFPAEEFEVRVKENSIVG 1083

Query: 807  TSVGIVQAHNP-PGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGPVLELEV 865
            + V  + A +P  G  A +   +  G+   LF +D  SG L  L  LD E     + + V
Sbjct: 1084 SVVAQITAVDPDEGPNAHIMYQIVEGNIPELFQMDIFSGELTALIDLDYEARQEYV-IVV 1142

Query: 866  RAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPE----DTVLLPPNTAPGTPIYTLRALDP 921
            +A S   P  + A V V L D NDNSP     +    + V    +T P   I  + A DP
Sbjct: 1143 QATSA--PLVSRATVHVRLVDQNDNSPVLNNFQILFNNYVSNRSDTFPSGIIGRIPAYDP 1200

Query: 922  DSGVNSRVTFTLLAGGG-GAFTVDPTTGHVRLMRPL 956
            D  V+  + ++   G       V+ T+G +RL R L
Sbjct: 1201 D--VSDHLFYSFERGNELQLLVVNQTSGELRLSRKL 1234



 Score =  350 bits (899), Expect = 1e-95
 Identities = 295/935 (31%), Positives = 437/935 (46%), Gaps = 54/935 (5%)

Query: 482  LPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTH---WFSIDPTSGIITTAASLDY 538
            +PE    G+ V+RV A+DPD G  G++ YSLA   ++     FSIDP SG+I TAA+LD 
Sbjct: 334  VPENEAAGTAVLRVVAQDPDAGEAGRLVYSLAALMNSRSLELFSIDPQSGLIRTAAALDR 393

Query: 539  ELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFL 598
            E   +  L V A D G P L+++  V+V + D ND+ P F++  Y  +L E  + G   L
Sbjct: 394  ESMERHYLRVTAQDHGSPRLSATTMVAVTVADRNDHSPVFEQAQYRETLRENVEEGYPIL 453

Query: 599  QVTATDADSGPFGLLSYSLGA--GLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFT 656
            Q+ ATD D+ P   L Y         ++ +  F ID  SG + T+  +DR+    S++  
Sbjct: 454  QLRATDGDAPPNANLRYRFVGPPAARAAAAAAFEIDPRSGLISTSGRVDREH-MESYELV 512

Query: 657  VTAVDGG---GLKSM-VYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDP 712
            V A D G   G +S  V V + + DENDN PQF  + Y A +     P T VLR+ A D 
Sbjct: 513  VEASDQGQEPGPRSATVRVHITVLDENDNAPQFSEKRYVAQVREDVRPHTVVLRVTATDR 572

Query: 713  DQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQ-AE 771
            D+ ++G + Y+I++GNS   F +D  +G + V  PL   A     L I A+D G    + 
Sbjct: 573  DKDANGLVHYNIISGNSRGHFAIDSLTGEIQVVAPLDFEAEREYALRIRAQDAGRPPLSN 632

Query: 772  PSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPP-GRLAPVTLSLSG 830
             +    I +V      PIF    +  SV E+   G SV  +QA +   G  A +  SL+G
Sbjct: 633  NTGLASIQVVDINDHIPIFVSTPFQVSVLENAPLGHSVIHIQAVDADHGENARLEYSLTG 692

Query: 831  GDPRGLFSLDAVSGLLQTLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDN 890
              P   F +++ +G +    PLDRE +            G PP  A A V V + DVNDN
Sbjct: 693  VAPDTPFVINSATGWVSVSGPLDRESVEHYFFGVEARDHGSPPLSASASVTVTVLDVNDN 752

Query: 891  SPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGG---AFTVDPTT 947
             P F   E  + L  + A GT + ++ A+D D+  NS +++ +  G      A +     
Sbjct: 753  RPEFTMKEYHLRLNEDAAVGTSVVSVTAVDRDA--NSAISYQITGGNTRNRFAISTQGGV 810

Query: 948  GHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRV 1007
            G V L  PL        +L L A D        H  + + + D  T    P F S  Y V
Sbjct: 811  GLVTLALPLDYKQERYFKLVLTASDRALH---DHCYVHINITDANTH--RPVFQSAHYSV 865

Query: 1008 DLPSGTTAGTQVLQVQAQAPDGGP---ITYHLAAEGASSPFGLEPQSGWLWVRAALDREA 1064
             +      G+ ++ + A   D G    ITY L  E     F ++  SG + ++A LD E 
Sbjct: 866  SVNEDRPMGSTIVVISASDDDVGENARITYLL--EDNLPQFRIDADSGAITLQAPLDYED 923

Query: 1065 QELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSV 1124
            Q  Y L + A       + Q+  T  V V + + N+++P+         V+E+ PP TSV
Sbjct: 924  QVTYTLAITARDNG---IPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFTSV 980

Query: 1125 GRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQ 1184
             ++ ATDRD+  NGR+ Y+ Q   +    F I P +G V T++ LDRE  S Y+L     
Sbjct: 981  LQISATDRDAHANGRVQYTFQNGEDGDGDFTIEPTSGIVRTVRRLDREAVSVYELTAYAV 1040

Query: 1185 DGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDP 1244
            D G PP  T  ++ V V D+NDN+P F            ++V +    G++V  + A DP
Sbjct: 1041 DRGVPPLRTPVSIQVMVQDVNDNAPVF------PAEEFEVRVKENSIVGSVVAQITAVDP 1094

Query: 1245 DEGENGTILYTLT-GPGSELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSA 1303
            DEG N  I+Y +  G   ELF +   SGEL     L    R  YV+ + A          
Sbjct: 1095 DEGPNAHIMYQIVEGNIPELFQMDIFSGELTALIDLDYEARQEYVIVVQA---------T 1145

Query: 1304 SLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVL---TVTAAEGLRPGSLLGSVAAPEPA 1360
            S  L+ +     RL     D  +  P      +L    V+      P  ++G + A +P 
Sbjct: 1146 SAPLVSRATVHVRLV----DQNDNSPVLNNFQILFNNYVSNRSDTFPSGIIGRIPAYDPD 1201

Query: 1361 GVGALTYTLVGGADPEGTFALDAASGRLYLARPLD 1395
                L Y+   G + +    ++  SG L L+R LD
Sbjct: 1202 VSDHLFYSFERGNELQ-LLVVNQTSGELRLSRKLD 1235



 Score =  349 bits (896), Expect = 2e-95
 Identities = 270/860 (31%), Positives = 395/860 (45%), Gaps = 39/860 (4%)

Query: 141  PAFPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGY---ALSGDGAGETFRLETRP 197
            P FPQ      VPE+ A GT      A+D DAG  G   Y   AL    + E F ++ + 
Sbjct: 323  PQFPQYNYQTLVPENEAAGTAVLRVVAQDPDAGEAGRLVYSLAALMNSRSLELFSIDPQS 382

Query: 198  GPDGTPVPELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQ 257
            G   T          LDRE+   + L++ A D GSP   A  ++ VT+ D NDH+P F Q
Sbjct: 383  GLIRT-------AAALDRESMERHYLRVTAQDHGSPRLSATTMVAVTVADRNDHSPVFEQ 435

Query: 258  SRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEI---NRRQSEGDGPFSIDAHTGLL 314
            ++Y   + E++  G P+LQ+ A+D DA  N  + Y        ++     F ID  +GL+
Sbjct: 436  AQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRFVGPPAARAAAAAAFEIDPRSGLI 495

Query: 315  QLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVH--VRDANDNQPSMTVIFLSADGS 372
                 +D E    +ELVV+A D G  P   SA V VH  V D NDN P     F      
Sbjct: 496  STSGRVDREHMESYELVVEASDQGQEPGPRSATVRVHITVLDENDNAPQ----FSEKRYV 551

Query: 373  PQVSEAAPPGQLVARISVS--DPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRL 430
             QV E   P  +V R++ +  D D     H N+      GHFA+   DS+   + V   L
Sbjct: 552  AQVREDVRPHTVVLRVTATDRDKDANGLVHYNIISGNSRGHFAI---DSLTGEIQVVAPL 608

Query: 431  DREERDAYNLRVTATDSGSPPLRAEAAFV-LHVTDVNDNAPAFDRQLYRPEPLPEVALPG 489
            D E    Y LR+ A D+G PPL        + V D+ND+ P F    ++   L    L G
Sbjct: 609  DFEAEREYALRIRAQDAGRPPLSNNTGLASIQVVDINDHIPIFVSTPFQVSVLENAPL-G 667

Query: 490  SFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVV 549
              V+ + A D D G N ++ YSL   A    F I+  +G ++ +  LD E        V 
Sbjct: 668  HSVIHIQAVDADHGENARLEYSLTGVAPDTPFVINSATGWVSVSGPLDRESVEHYFFGVE 727

Query: 550  ATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGP 609
            A D G PPL++SA+V+V + DVNDN P+F    Y+  L E    GT  + VTA D D+  
Sbjct: 728  ARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVSVTAVDRDAN- 786

Query: 610  FGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMV 669
               +SY +    G +    F I    G    T  L  D     +   V       L    
Sbjct: 787  -SAISYQI---TGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRALHDHC 842

Query: 670  YVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNS 729
            YV + ++D N + P F    Y+ S++   P G+ ++ + A D D G + R++Y  L  ++
Sbjct: 843  YVHINITDANTHRPVFQSAHYSVSVNEDRPMGSTIVVISASDDDVGENARITY--LLEDN 900

Query: 730  PPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPI 789
             P F +D  SG +T+  PL         L I A D G  Q   +  V++ +       P 
Sbjct: 901  LPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQ 960

Query: 790  FEQLQYVFSVPEDVAPGTSVGIVQAHNPPGRL-APVTLSLSGG-DPRGLFSLDAVSGLLQ 847
            F    Y   V ED  P TSV  + A +        V  +   G D  G F+++  SG+++
Sbjct: 961  FVASHYTGLVSEDAPPFTSVLQISATDRDAHANGRVQYTFQNGEDGDGDFTIEPTSGIVR 1020

Query: 848  TLRPLDRELLGPVLELEVRA-GSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPN 906
            T+R LDRE +  V EL   A   GVPP      ++V++ DVNDN+P FPA E  V +  N
Sbjct: 1021 TVRRLDREAVS-VYELTAYAVDRGVPPLRTPVSIQVMVQDVNDNAPVFPAEEFEVRVKEN 1079

Query: 907  TAPGTPIYTLRALDPDSGVNSRVTFTLLAGG-GGAFTVDPTTGHVRLMRPLGPSGGPAHE 965
            +  G+ +  + A+DPD G N+ + + ++ G     F +D  +G +  +  L       + 
Sbjct: 1080 SIVGSVVAQITAVDPDEGPNAHIMYQIVEGNIPELFQMDIFSGELTALIDLDYEARQEYV 1139

Query: 966  LELEARDGGSPPR-TSHFRL 984
            + ++A       R T H RL
Sbjct: 1140 IVVQATSAPLVSRATVHVRL 1159



 Score =  326 bits (836), Expect = 2e-88
 Identities = 272/915 (29%), Positives = 418/915 (45%), Gaps = 60/915 (6%)

Query: 1962 TSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIR 2021
            T+P R  LP  G S S P L  A   A    A  +A    R A  P P        G  R
Sbjct: 228  TAPRRNCLP--GASGSGPELDSAPRTARTAPASGSAPRESRTAPEPAPKRMRSR--GLFR 283

Query: 2022 VARSPVALGPRDRVLFIVATDLGRP-ARSATGVIIVGLQGEAERGPRFPRASSEATIREN 2080
                P   GPR   L        RP AR  T       +  A R P+FP+ + +  + EN
Sbjct: 284  CRFLPQRPGPRPPGL------PARPEARKVTSANRARFRRAANRHPQFPQYNYQTLVPEN 337

Query: 2081 APPGTPIVSPRAVHA-GGTNGPITYSI---LSGNEKGTFSIQPSTGAITVRSAEGLDFEV 2136
               GT ++   A     G  G + YS+   ++      FSI P +G I  R+A  LD E 
Sbjct: 338  EAAGTAVLRVVAQDPDAGEAGRLVYSLAALMNSRSLELFSIDPQSGLI--RTAAALDRES 395

Query: 2137 SPRLRLVLQAESGGA---FAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQV 2193
              R  L + A+  G+    A T++ +T+ D ND++P F +  Y   L E+     P+LQ+
Sbjct: 396  MERHYLRVTAQDHGSPRLSATTMVAVTVADRNDHSPVFEQAQYRETLRENVEEGYPILQL 455

Query: 2194 EADDLDQGSGGQISYSL----AASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMA 2249
             A D D      + Y      AA   A   F +DP +G I+T+  +DRE      LV+ A
Sbjct: 456  RATDGDAPPNANLRYRFVGPPAARAAAAAAFEIDPRSGLISTSGRVDREHMESYELVVEA 515

Query: 2250 TDRGSPALVGSATLTV--MVIDTNDNRPTIPQP-WELRVSEDALLGSEIAQVTGND--VD 2304
            +D+G      SAT+ V   V+D NDN P   +  +  +V ED    + + +VT  D   D
Sbjct: 516  SDQGQEPGPRSATVRVHITVLDENDNAPQFSEKRYVAQVREDVRPHTVVLRVTATDRDKD 575

Query: 2305 SGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTV 2364
            +  ++ Y +     +  F++    G + +  PLDFE    Y L++ A D      +N T 
Sbjct: 576  ANGLVHYNIISGNSRGHFAIDSLTGEIQVVAPLDFEAEREYALRIRAQDAGRPPLSNNTG 635

Query: 2365 L----VEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPAD 2420
            L    V D+ND+ P F  + +QV +LE+ P G +++ + A D D G N  + Y L   A 
Sbjct: 636  LASIQVVDINDHIPIFVSTPFQVSVLENAPLGHSVIHIQAVDADHGENARLEYSLTGVAP 695

Query: 2421 GFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAP 2480
                  N+ T +  V    L  +        +EARDHG+P  +A A+V V + D ND+ P
Sbjct: 696  DTPFVINSATGWVSVSG-PLDRESVEHYFFGVEARDHGSPPLSASASVTVTVLDVNDNRP 754

Query: 2481 SFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEA 2540
             FT+  Y + + ED   G++++++ A D D   +++A+ Y I  GN    F +  +    
Sbjct: 755  EFTMKEYHLRLNEDAAVGTSVVSVTAVDRD---ANSAISYQITGGNTRNRFAISTQ---- 807

Query: 2541 GESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPP 2600
                      +G + L  PLD++    + L + A+DR       V    + + D N + P
Sbjct: 808  --------GGVGLVTLALPLDYKQERYFKLVLTASDRALHDHCYV---HINITDANTHRP 856

Query: 2601 VFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLR 2660
            VF  A Y V+V ED P+G+ ++ + ASD D G +  + + +    P   F +D  SG + 
Sbjct: 857  VFQSAHYSVSVNEDRPMGSTIVVISASDDDVGENARITYLLEDNLPQ--FRIDADSGAIT 914

Query: 2661 LAHALDCETQARHQLVVQAADPAGAHFA-LAPVTIEVQDVNDHGPAFPLNLLSTSVAENQ 2719
            L   LD E Q  + L + A D      A    V + V DVND+ P F  +  +  V+E+ 
Sbjct: 915  LQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDA 974

Query: 2720 PPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTE 2779
            PP T V  + A D DA A GR++Y+      G +G   F +  ++G +R     D E   
Sbjct: 975  PPFTSVLQISATDRDAHANGRVQYTFQN---GEDGDGDFTIEPTSGIVRTVRRLDREAVS 1031

Query: 2780 SFRLLVGAADAG--NLSASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQA 2837
             + L   A D G   L   V++ V+V   ++  PVF A  F  +V E +  G  +  + A
Sbjct: 1032 VYELTAYAVDRGVPPLRTPVSIQVMVQDVNDNAPVFPAEEFEVRVKENSIVGSVVAQITA 1091

Query: 2838 TDEDGGADGLVLYSL 2852
             D D G +  ++Y +
Sbjct: 1092 VDPDEGPNAHIMYQI 1106



 Score =  301 bits (770), Expect = 9e-81
 Identities = 287/1016 (28%), Positives = 446/1016 (43%), Gaps = 73/1016 (7%)

Query: 554  GLPPLASSATVSVA----LQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGP 609
            GLP    +  V+ A     +   +  PQF +  Y   +PE    GT  L+V A D D+G 
Sbjct: 297  GLPARPEARKVTSANRARFRRAANRHPQFPQYNYQTLVPENEAAGTAVLRVVAQDPDAGE 356

Query: 610  FGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGG--LKS 667
             G L YSL A + S     F ID  SG + T   LDR+     +   VTA D G   L +
Sbjct: 357  AGRLVYSLAALMNSRSLELFSIDPQSGLIRTAAALDRESMERHY-LRVTAQDHGSPRLSA 415

Query: 668  MVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILA- 726
               V V ++D ND+ P F   +Y  ++      G  +L+LRA D D   +  L Y  +  
Sbjct: 416  TTMVAVTVADRNDHSPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRFVGP 475

Query: 727  ----GNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSA--RVDISI 780
                  +   F +D +SGL++ +  + R      +L + A D G      SA  RV I++
Sbjct: 476  PAARAAAAAAFEIDPRSGLISTSGRVDREHMESYELVVEASDQGQEPGPRSATVRVHITV 535

Query: 781  VPGTPTPPIFEQLQYVFSVPEDVAPGTSV-GIVQAHNPPGRLAPVTLSLSGGDPRGLFSL 839
            +      P F + +YV  V EDV P T V  +            V  ++  G+ RG F++
Sbjct: 536  LDENDNAPQFSEKRYVAQVREDVRPHTVVLRVTATDRDKDANGLVHYNIISGNSRGHFAI 595

Query: 840  DAVSGLLQTLRPLDRELLGPVLELEVRA-GSGVPPA---FAVARVRVLLDDVNDNSPAFP 895
            D+++G +Q + PLD E       L +RA  +G PP      +A ++V+  D+ND+ P F 
Sbjct: 596  DSLTGEIQVVAPLDFE-AEREYALRIRAQDAGRPPLSNNTGLASIQVV--DINDHIPIFV 652

Query: 896  APEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLL-AGGGGAFTVDPTTGHVRLMR 954
            +    V +  N   G  +  ++A+D D G N+R+ ++L        F ++  TG V +  
Sbjct: 653  STPFQVSVLENAPLGHSVIHIQAVDADHGENARLEYSLTGVAPDTPFVINSATGWVSVSG 712

Query: 955  PLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTT 1014
            PL       +   +EARD GSPP ++   + V V DV      P F    Y + L     
Sbjct: 713  PLDRESVEHYFFGVEARDHGSPPLSASASVTVTVLDVNDN--RPEFTMKEYHLRLNEDAA 770

Query: 1015 AGTQVLQVQAQAPD-GGPITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVM 1073
             GT V+ V A   D    I+Y +      + F +  Q G   V  AL  + ++    K++
Sbjct: 771  VGTSVVSVTAVDRDANSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLV 830

Query: 1074 AVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRD 1133
              +  +A          V ++I + N H P        ++V E++P G+++  + A+D D
Sbjct: 831  LTASDRA----LHDHCYVHINITDANTHRPVFQSAHYSVSVNEDRPMGSTIVVISASDDD 886

Query: 1134 SGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRST 1193
             G N R+TY L+   ++   FRI   +G +T    LD E Q +Y L +  +D G P ++ 
Sbjct: 887  VGENARITYLLE---DNLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKAD 943

Query: 1194 TGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTIL 1253
            T  V V V D+NDN+P F+ AS   G      V +  PP T V  + A D D   NG + 
Sbjct: 944  TTYVEVMVNDVNDNAPQFV-ASHYTG-----LVSEDAPPFTSVLQISATDRDAHANGRVQ 997

Query: 1254 YTLTG--PGSELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPP--RSASLQLLV 1309
            YT      G   F++ P SG + T   L R     Y LT  A D+G PP     S+Q++V
Sbjct: 998  YTFQNGEDGDGDFTIEPTSGIVRTVRRLDREAVSVYELTAYAVDRGVPPLRTPVSIQVMV 1057

Query: 1310 QVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEP-AGVGA-LTY 1367
            Q            D+ +  P  P      V   E    GS++  + A +P  G  A + Y
Sbjct: 1058 Q------------DVNDNAPVFPAE-EFEVRVKENSIVGSVVAQITAVDPDEGPNAHIMY 1104

Query: 1368 TLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQ 1427
             +V G  PE  F +D  SG L     LD+EA   +  +      P  + A    V V++ 
Sbjct: 1105 QIVEGNIPE-LFQMDIFSGELTALIDLDYEARQEYVIVVQATSAPLVSRA---TVHVRLV 1160

Query: 1428 DENEHAPAFARDPLA----LALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPV 1483
            D+N+++P      +     ++   +  P   +    A D D     SD  +    +   +
Sbjct: 1161 DQNDNSPVLNNFQILFNNYVSNRSDTFPSGIIGRIPAYDPD----VSDHLFYSFERGNEL 1216

Query: 1484 PALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDE 1539
              L ++  +G L   R LD        +LV  TD   + + +   RV   V +T+E
Sbjct: 1217 QLLVVNQTSGELRLSRKLDNNRPLVASMLVTVTDGLHSVTAQCVLRV---VIITEE 1269



 Score =  291 bits (745), Expect = 7e-78
 Identities = 223/687 (32%), Positives = 319/687 (46%), Gaps = 43/687 (6%)

Query: 93   AIDEHSGVVRTARVLDREQRDRYRFTAVTPDGA-------TVEVTVRVADINDHAPAFPQ 145
            AID  +G ++    LD E    Y       D         T   +++V DINDH P F  
Sbjct: 594  AIDSLTGEIQVVAPLDFEAEREYALRIRAQDAGRPPLSNNTGLASIQVVDINDHIPIFVS 653

Query: 146  ARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVP 205
                + V E+   G       A DAD G      Y+L+G      F + +  G       
Sbjct: 654  TPFQVSVLENAPLGHSVIHIQAVDADHGENARLEYSLTGVAPDTPFVINSATG------- 706

Query: 206  ELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVS 265
             + V+G LDRE+  HY   +EA D GSPP  A A + VT+LD+ND+ P F    YH  ++
Sbjct: 707  WVSVSGPLDRESVEHYFFGVEARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLN 766

Query: 266  ESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQR 325
            E  A G+ V+ V A D DA  N A++Y+I    +      S     GL+ L  PLD++Q 
Sbjct: 767  EDAAVGTSVVSVTAVDRDA--NSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQE 824

Query: 326  RVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLV 385
            R  +LV+ A D   H      +V +++ DAN ++P    +F SA  S  V+E  P G  +
Sbjct: 825  RYFKLVLTASDRALHDH---CYVHINITDANTHRP----VFQSAHYSVSVNEDRPMGSTI 877

Query: 386  ARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTAT 445
              IS SD D G+ A +   LE     F +      I L      LD E++  Y L +TA 
Sbjct: 878  VVISASDDDVGENARITYLLEDNLPQFRIDADSGAITL---QAPLDYEDQVTYTLAITAR 934

Query: 446  DSGSPPLRAEAAFV-LHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGT 504
            D+G P  +A+  +V + V DVNDNAP F    Y    + E A P + V++++A D D   
Sbjct: 935  DNGIPQ-KADTTYVEVMVNDVNDNAPQFVASHY-TGLVSEDAPPFTSVLQISATDRDAHA 992

Query: 505  NGQVTYSLAPGAHTHW-FSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSAT 563
            NG+V Y+   G      F+I+PTSGI+ T   LD E     +L   A D G+PPL +  +
Sbjct: 993  NGRVQYTFQNGEDGDGDFTIEPTSGIVRTVRRLDREAVSVYELTAYAVDRGVPPLRTPVS 1052

Query: 564  VSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGS 623
            + V +QDVNDN P F    +   + E +  G+   Q+TA D D GP   + Y +  G   
Sbjct: 1053 IQVMVQDVNDNAPVFPAEEFEVRVKENSIVGSVVAQITAVDPDEGPNAHIMYQIVEG--- 1109

Query: 624  SGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMVYVKVFLSDENDNPP 683
            +    F++D  SG++  T  +D D         V       L S   V V L D+NDN P
Sbjct: 1110 NIPELFQMDIFSGEL--TALIDLDYEARQEYVIVVQATSAPLVSRATVHVRLVDQNDNSP 1167

Query: 684  -----QFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQ 738
                 Q     Y ++ S   P G  + R+ A+DPD   H  L Y    GN   L  +++ 
Sbjct: 1168 VLNNFQILFNNYVSNRSDTFPSG-IIGRIPAYDPDVSDH--LFYSFERGNELQLLVVNQT 1224

Query: 739  SGLLTVAWPLARRANSVVQLEIGAEDG 765
            SG L ++  L      V  + +   DG
Sbjct: 1225 SGELRLSRKLDNNRPLVASMLVTVTDG 1251



 Score =  248 bits (632), Expect = 9e-65
 Identities = 183/620 (29%), Positives = 307/620 (49%), Gaps = 43/620 (6%)

Query: 2272 DNRPTIPQ-PWELRVSEDALLGSEIAQVTGNDVDSGPV--LWYVLSP---SGPQDPFSVG 2325
            +  P  PQ  ++  V E+   G+ + +V   D D+G    L Y L+    S   + FS+ 
Sbjct: 320  NRHPQFPQYNYQTLVPENEAAGTAVLRVVAQDPDAGEAGRLVYSLAALMNSRSLELFSID 379

Query: 2326 RYGGRVSLTGPLDFEQCDRYQLQLLA--HDGPHEGRANLT-VLVEDVNDNAPAFSQSLYQ 2382
               G +     LD E  +R+ L++ A  H  P      +  V V D ND++P F Q+ Y+
Sbjct: 380  PQSGLIRTAAALDRESMERHYLRVTAQDHGSPRLSATTMVAVTVADRNDHSPVFEQAQYR 439

Query: 2383 VMLLEHTPPGSAILSVSATDRDSGANGHISYHLASP-------ADGFSVDPNNGTLFTIV 2435
              L E+   G  IL + ATD D+  N ++ Y    P       A  F +DP +G + T  
Sbjct: 440  ETLRENVEEGYPILQLRATDGDAPPNANLRYRFVGPPAARAAAAAAFEIDPRSGLISTS- 498

Query: 2436 GTVALGHDGSGAVDVVLEARDHGA-PG-RAARATVHVQLQDQNDHAPSFTLSHYRVAVTE 2493
            G V   H  S   ++V+EA D G  PG R+A   VH+ + D+ND+AP F+   Y   V E
Sbjct: 499  GRVDREHMES--YELVVEASDQGQEPGPRSATVRVHITVLDENDNAPQFSEKRYVAQVRE 556

Query: 2494 DLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGC 2553
            D+ P + +L + ATD D   ++  V Y+IISGN    F ++    E              
Sbjct: 557  DVRPHTVVLRVTATDRDKD-ANGLVHYNIISGNSRGHFAIDSLTGE-------------- 601

Query: 2554 LVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPV-TVTVLDVNDNPPVFTRASYRVTVP 2612
            + ++ PLDFE+  +Y L + A D G+PP S+   + ++ V+D+ND+ P+F    ++V+V 
Sbjct: 602  IQVVAPLDFEAEREYALRIRAQDAGRPPLSNNTGLASIQVVDINDHIPIFVSTPFQVSVL 661

Query: 2613 EDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQAR 2672
            E+ P+G  ++H++A DAD G +  + ++++   P   F ++ ++G + ++  LD E+   
Sbjct: 662  ENAPLGHSVIHIQAVDADHGENARLEYSLTGVAPDTPFVINSATGWVSVSGPLDRESVEH 721

Query: 2673 HQLVVQAADPAGAHF-ALAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAI 2731
            +   V+A D       A A VT+ V DVND+ P F +      + E+   GT V ++ A+
Sbjct: 722  YFFGVEARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVSVTAV 781

Query: 2732 DGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAADAG 2791
            D DA +   + Y +   G     R A +     G +   +P DY+    F+L++ A+D  
Sbjct: 782  DRDANS--AISYQI--TGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRA 837

Query: 2792 NLSASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYS 2851
             L     V + +T  + + PVF +  +   V E    G ++  + A+D+D G +  + Y 
Sbjct: 838  -LHDHCYVHINITDANTHRPVFQSAHYSVSVNEDRPMGSTIVVISASDDDVGENARITYL 896

Query: 2852 LATSSPYFGINQTTGALYLR 2871
            L  + P F I+  +GA+ L+
Sbjct: 897  LEDNLPQFRIDADSGAITLQ 916



 Score =  167 bits (424), Expect = 1e-40
 Identities = 140/459 (30%), Positives = 209/459 (45%), Gaps = 53/459 (11%)

Query: 2480 PSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGR---VFQLEPR 2536
            P F   +Y+  V E+   G+ +L + A D D   +   V YS+ +    R   +F ++P+
Sbjct: 323  PQFPQYNYQTLVPENEAAGTAVLRVVAQDPDAGEAGRLV-YSLAALMNSRSLELFSIDPQ 381

Query: 2537 LAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVN 2596
                           G +     LD ES+ ++ L V A D G P  S+   V VTV D N
Sbjct: 382  S--------------GLIRTAAALDRESMERHYLRVTAQDHGSPRLSATTMVAVTVADRN 427

Query: 2597 DNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFT-----VSSGDPSGLFE 2651
            D+ PVF +A YR T+ E+   G  +L + A+D D  P+  +R+       +    +  FE
Sbjct: 428  DHSPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRFVGPPAARAAAAAAFE 487

Query: 2652 LDESSGTLRLAHALDCETQARHQLVVQAADPA---GAHFALAPVTIEVQDVNDHGPAFPL 2708
            +D  SG +  +  +D E    ++LVV+A+D     G   A   V I V D ND+ P F  
Sbjct: 488  IDPRSGLISTSGRVDREHMESYELVVEASDQGQEPGPRSATVRVHITVLDENDNAPQFSE 547

Query: 2709 NLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELR 2768
                  V E+  P T+V  + A D D  A G + Y+++        R  FA++S TGE++
Sbjct: 548  KRYVAQVREDVRPHTVVLRVTATDRDKDANGLVHYNIISGN----SRGHFAIDSLTGEIQ 603

Query: 2769 ARVPFDYEHTESFRLLVGAADAGNLSASVTV---SVLVTGEDEYDPVFLAPAFHFQVPEG 2825
               P D+E    + L + A DAG    S      S+ V   +++ P+F++  F   V E 
Sbjct: 604  VVAPLDFEAEREYALRIRAQDAGRPPLSNNTGLASIQVVDINDHIPIFVSTPFQVSVLEN 663

Query: 2826 ARRGHSLGHVQATDEDGGADGLVLYSLATSSP--YFGINQTTGALYLRVDSRAPGSGTAT 2883
            A  GHS+ H+QA D D G +  + YSL   +P   F IN  TG + +             
Sbjct: 664  APLGHSVIHIQAVDADHGENARLEYSLTGVAPDTPFVINSATGWVSV------------- 710

Query: 2884 SGGGGRTRREAPRELRLEVIAR--GPLPGSRSATVPVTV 2920
                G   RE+       V AR  G  P S SA+V VTV
Sbjct: 711  ---SGPLDRESVEHYFFGVEARDHGSPPLSASASVTVTV 746



 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 68/221 (30%), Positives = 97/221 (43%), Gaps = 10/221 (4%)

Query: 2704 PAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSS 2763
            P FP     T V EN+  GT V  + A D DAG  GRL YSL  A       E F+++  
Sbjct: 323  PQFPQYNYQTLVPENEAAGTAVLRVVAQDPDAGEAGRLVYSLA-ALMNSRSLELFSIDPQ 381

Query: 2764 TGELRARVPFDYEHTESFRLLVGAADAGN--LSASVTVSVLVTGEDEYDPVFLAPAFHFQ 2821
            +G +R     D E  E   L V A D G+  LSA+  V+V V   +++ PVF    +   
Sbjct: 382  SGLIRTAAALDRESMERHYLRVTAQDHGSPRLSATTMVAVTVADRNDHSPVFEQAQYRET 441

Query: 2822 VPEGARRGHSLGHVQATDEDGGADGLVLYSLATSSPYFGINQTTGALYLRVDSRAPGSGT 2881
            + E    G+ +  ++ATD D   +  + Y            +   A    +D   P SG 
Sbjct: 442  LRENVEEGYPILQLRATDGDAPPNANLRYRFVGPPAA----RAAAAAAFEID---PRSGL 494

Query: 2882 ATSGGGGRTRREAPRELRLEVIARGPLPGSRSATVPVTVDI 2922
             ++ G          EL +E   +G  PG RSATV V + +
Sbjct: 495  ISTSGRVDREHMESYELVVEASDQGQEPGPRSATVRVHITV 535


>gi|13325064 cadherin EGF LAG seven-pass G-type receptor 2 [Homo
            sapiens]
          Length = 2923

 Score =  425 bits (1092), Expect = e-118
 Identities = 317/943 (33%), Positives = 473/943 (50%), Gaps = 63/943 (6%)

Query: 1852 APAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGA----GTAGAFLLEPS 1907
            AP F  P+Y   VPE+ PAGT +  L+A DPD G  G + Y + A     +   F L+P 
Sbjct: 178  APQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFSLDPV 237

Query: 1908 SGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRL 1967
            +G + TA  LDRE   ++ F V+A D       S   ++TI V D NDH P F     + 
Sbjct: 238  TGAVTTAEELDRETKSTHVFRVTAQDHGMPRR-SALATLTILVTDTNDHDPVFEQQEYKE 296

Query: 1968 RLPRPGPSFSTPTLALATLRAEDRDAGANASILYRL----AGTPPPGTTVDSYTGEIRVA 2023
             L R         L   T+RA D DA  NA+ILYRL     G+P     +D  +G IR  
Sbjct: 297  SL-RENLEVGYEVL---TVRATDGDAPPNANILYRLLEGSGGSPSEVFEIDPRSGVIRT- 351

Query: 2024 RSPVALGPRDRV----LFIVATDLGRPA--RSATGVIIVGLQGEAERGPRFPRASSEATI 2077
            R PV    R+ V    L + A+D GR    RS T  + + ++ + +  P+F        +
Sbjct: 352  RGPV---DREEVESYQLTVEASDQGRDPGPRSTTAAVFLSVEDDNDNAPQFSEKRYVVQV 408

Query: 2078 RENAPPGTPIVSPRAVHAG-GTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEV 2136
            RE+  PG P++   A     G+N  + YSI+SGN +G F +   TGA+ V S   LD+E 
Sbjct: 409  REDVTPGAPVLRVTASDRDKGSNAVVHYSIMSGNARGQFYLDAQTGALDVVSP--LDYET 466

Query: 2137 SPRLRLVLQAESGGAFAFT----VLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQ 2192
            +    L ++A+ GG    +    ++T+ + D NDNAP F+   + A + ES PL   +L 
Sbjct: 467  TKEYTLRVRAQDGGRPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGYLVLH 526

Query: 2193 VEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDR 2252
            V+A D D G   ++ Y LA        F ++  TG I+  A LDRE        + A D 
Sbjct: 527  VQAIDADAGDNARLEYRLAGVGHDFP-FTINNGTGWISVAAELDREEVDFYSFGVEARDH 585

Query: 2253 GSPALVGSATLTVMVIDTNDNRPTIPQP-WELRVSEDALLGSEIAQVTGNDVDSGPVLWY 2311
            G+PAL  SA+++V V+D NDN PT  QP + +R++EDA +G+ +  V+  D D+  V+ Y
Sbjct: 586  GTPALTASASVSVTVLDVNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRDAHSVITY 645

Query: 2312 VLSPSGPQDPFSVGRY--GGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVLVEDV 2369
             ++    ++ FS+     GG VSL  PLD++   +Y L + A DG  +  A + V V D 
Sbjct: 646  QITSGNTRNRFSITSQSGGGLVSLALPLDYKLERQYVLAVTASDGTRQDTAQIVVNVTDA 705

Query: 2370 NDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNG 2429
            N + P F  S Y V + E  P G+ ++ +SATD D+G N  I+Y +      F +D + G
Sbjct: 706  NTHRPVFQSSHYTVNVNEDRPAGTTVVLISATDEDTGENARITYFMEDSIPQFRIDADTG 765

Query: 2430 TLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRV 2489
             + T      L ++   +  + + ARD+G P ++    + + + D ND+AP F    Y+ 
Sbjct: 766  AVTT---QAELDYEDQVSYTLAITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDSYQG 822

Query: 2490 AVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPR 2549
            +V ED+PP +++L + ATD D             SG  GRVF       + G+       
Sbjct: 823  SVYEDVPPFTSVLQISATDRD-------------SGLNGRVFYTFQG-GDDGDGDFIVES 868

Query: 2550 ALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRV 2609
              G +  L  LD E++ QY L   A D+G PP  + + VTVTVLDVNDNPPVF +  + V
Sbjct: 869  TSGIVRTLRRLDRENVAQYVLRAYAVDKGMPPARTPMEVTVTVLDVNDNPPVFEQDEFDV 928

Query: 2610 TVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCET 2669
             V E++P+G  +  V A+D D G +  + + +  G+   +F+LD  SG L     LD E 
Sbjct: 929  FVEENSPIGLAVARVTATDPDEGTNAQIMYQIVEGNIPEVFQLDIFSGELTALVDLDYED 988

Query: 2670 QARHQLVVQAADPAGAHFALAPVTIEVQDVNDHGPAF-PLNLLSTSVAENQP---PGTLV 2725
            +  + LV+QA   +    + A V + + D ND+ P      +L  +   N+    PG  +
Sbjct: 989  RPEYVLVIQAT--SAPLVSRATVHVRLLDRNDNPPVLGNFEILFNNYVTNRSSSFPGGAI 1046

Query: 2726 TTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELR 2768
              + A D D      L YS  E G          LN+STGEL+
Sbjct: 1047 GRVPAHDPDIS--DSLTYS-FERG---NELSLVLLNASTGELK 1083



 Score =  402 bits (1034), Expect = e-111
 Identities = 316/987 (32%), Positives = 467/987 (47%), Gaps = 71/987 (7%)

Query: 889  DNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLA----GGGGAFTVD 944
            + +P F  P     +P N   GTP+ +LRA+DPD G   R+ +T+ A         F++D
Sbjct: 176  NTAPQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFSLD 235

Query: 945  PTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPT 1004
            P TG V     L       H   + A+D G P R++   L ++V D  T    P F    
Sbjct: 236  PVTGAVTTAEELDRETKSTHVFRVTAQDHGMPRRSALATLTILVTD--TNDHDPVFEQQE 293

Query: 1005 YRVDLPSGTTAGTQVLQVQA---QAPDGGPITYHLAAEGASSP---FGLEPQSGWLWVRA 1058
            Y+  L      G +VL V+A    AP    I Y L      SP   F ++P+SG +  R 
Sbjct: 294  YKESLRENLEVGYEVLTVRATDGDAPPNANILYRLLEGSGGSPSEVFEIDPRSGVIRTRG 353

Query: 1059 ALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQ 1118
             +DRE  E Y L V A S    + G ++ TA V +S+ + N+++P+ SE    + V E+ 
Sbjct: 354  PVDREEVESYQLTVEA-SDQGRDPGPRSTTAAVFLSVEDDNDNAPQFSEKRYVVQVREDV 412

Query: 1119 PPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQ 1178
             PG  V RV A+DRD G N  + YS+   +   + F +  QTG +  +  LD E    Y 
Sbjct: 413  TPGAPVLRVTASDRDKGSNAVVHYSIMSGNARGQ-FYLDAQTGALDVVSPLDYETTKEYT 471

Query: 1179 LLVQVQDGGSPPRST-TGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVT 1237
            L V+ QDGG PP S  +G V V VLD+NDN+P F+     A       V + VP G LV 
Sbjct: 472  LRVRAQDGGRPPLSNVSGLVTVQVLDINDNAPIFVSTPFQA------TVLESVPLGYLVL 525

Query: 1238 TLQAKDPDEGENGTILYTLTGPGSEL-FSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQ 1296
             +QA D D G+N  + Y L G G +  F+++  +G +  AA L R E   Y   + A D 
Sbjct: 526  HVQAIDADAGDNARLEYRLAGVGHDFPFTINNGTGWISVAAELDREEVDFYSFGVEARDH 585

Query: 1297 GSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAA 1356
            G+P  +AS  + V VL          D+ + +P    P   TV   E    G+ + +V+A
Sbjct: 586  GTPALTASASVSVTVL----------DVNDNNPTFTQPEY-TVRLNEDAAVGTSVVTVSA 634

Query: 1357 PEPAGVGALTYTLVGGADPEGTFALDAASGR--LYLARPLDFEAGPPWRALTVRAEGPGG 1414
             +      +TY +  G +    F++ + SG   + LA PLD++    +      ++G   
Sbjct: 635  VDRDAHSVITYQITSG-NTRNRFSITSQSGGGLVSLALPLDYKLERQYVLAVTASDGTRQ 693

Query: 1415 AGARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRY 1474
              A+++   V V D N H P F      + + E+   G  +    A+D D  G N+ + Y
Sbjct: 694  DTAQIV---VNVTDANTHRPVFQSSHYTVNVNEDRPAGTTVVLISATDED-TGENARITY 749

Query: 1475 RLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARV 1534
             +   E  +P  R+DA TGA++    LD E   +  L + A D   N   +++      +
Sbjct: 750  FM---EDSIPQFRIDADTGAVTTQAELDYEDQVSYTLAITARD---NGIPQKSDTTYLEI 803

Query: 1535 FVTDENDNAPVFASPS-RVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASG--GDGH 1591
             V D NDNAP F   S +  + ED PP  + L + A D D G   RV Y    G  GDG 
Sbjct: 804  LVNDVNDNAPQFLRDSYQGSVYEDVPPFTSVLQISATDRDSGLNGRVFYTFQGGDDGDGD 863

Query: 1592 FRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQ 1651
            F + S++G +  +R LDRE  A++VL   A D G PP      +TV+V DVND  P F+Q
Sbjct: 864  FIVESTSGIVRTLRRLDRENVAQYVLRAYAVDKGMPPARTPMEVTVTVLDVNDNPPVFEQ 923

Query: 1652 QEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTY---GGVSSESFSLDPDTGVLTTLRA 1708
             E+ V + EN+P G ++  + ATDPD G N Q+ Y    G   E F LD  +G LT L  
Sbjct: 924  DEFDVFVEENSPIGLAVARVTATDPDEGTNAQIMYQIVEGNIPEVFQLDIFSGELTALVD 983

Query: 1709 LDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHL---------SLE 1759
            LD E++ E  L + A    S P ++  TV V + D ND+ P  G+  +         S  
Sbjct: 984  LDYEDRPEYVLVIQAT---SAPLVSRATVHVRLLDRNDNPPVLGNFEILFNNYVTNRSSS 1040

Query: 1760 VPEGQDPQTLTMLRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEP 1819
             P G     +  + A DPD+  +  L Y    G+     +L+ ++GE    R LD    P
Sbjct: 1041 FPGG----AIGRVPAHDPDI--SDSLTYSFERGNELSLVLLNASTGELKLSRALDNN-RP 1093

Query: 1820 AFQLRIEARDGGQPALSATLLLTVTVL 1846
               +       G  +++A   L VT++
Sbjct: 1094 LEAIMSVLVSDGVHSVTAQCALRVTII 1120



 Score =  378 bits (971), Expect = e-104
 Identities = 315/938 (33%), Positives = 438/938 (46%), Gaps = 55/938 (5%)

Query: 43   QAGSLDLQIDEEQPAGTLIGDISAGLP-AGTAAPLMYFISAQEGSGVGTDLAIDEHSGVV 101
            Q  S    + E QPAGT +  + A  P  G A  L Y + A   S      ++D  +G V
Sbjct: 182  QPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFSLDPVTGAV 241

Query: 102  RTARVLDREQRDRYRFTAVTPD------GATVEVTVRVADINDHAPAFPQARAALQVPEH 155
             TA  LDRE +  + F     D       A   +T+ V D NDH P F Q      + E+
Sbjct: 242  TTAEELDRETKSTHVFRVTAQDHGMPRRSALATLTILVTDTNDHDPVFEQQEYKESLREN 301

Query: 156  TAFGTRYPLEPARDADAGRLGTQGYAL---SGDGAGETFRLETRPGPDGTPVPELVVTGE 212
               G       A D DA       Y L   SG    E F ++ R G   T        G 
Sbjct: 302  LEVGYEVLTVRATDGDAPPNANILYRLLEGSGGSPSEVFEIDPRSGVIRT-------RGP 354

Query: 213  LDRENRSHYMLQLEAYDGGSP--PRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAP 270
            +DRE    Y L +EA D G    PR   A + +++ D ND+AP F++ RY   V E + P
Sbjct: 355  VDREEVESYQLTVEASDQGRDPGPRSTTAAVFLSVEDDNDNAPQFSEKRYVVQVREDVTP 414

Query: 271  GSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHEL 330
            G+PVL+V ASD D G N  V Y I        G F +DA TG L +  PLD+E  + + L
Sbjct: 415  GAPVLRVTASDRDKGSNAVVHYSI--MSGNARGQFYLDAQTGALDVVSPLDYETTKEYTL 472

Query: 331  VVQARDGGAHPELG-SAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARIS 389
             V+A+DGG  P    S  VTV V D NDN P    IF+S      V E+ P G LV  + 
Sbjct: 473  RVRAQDGGRPPLSNVSGLVTVQVLDINDNAP----IFVSTPFQATVLESVPLGYLVLHVQ 528

Query: 390  VSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGS 449
              D D GD A +   L  G GH    T ++    + VA  LDREE D Y+  V A D G+
Sbjct: 529  AIDADAGDNARLEYRL-AGVGHDFPFTINNGTGWISVAAELDREEVDFYSFGVEARDHGT 587

Query: 450  PPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVT 509
            P L A A+  + V DVNDN P F +  Y    L E A  G+ VV V+A D D   +  +T
Sbjct: 588  PALTASASVSVTVLDVNDNNPTFTQPEYTVR-LNEDAAVGTSVVTVSAVDRD--AHSVIT 644

Query: 510  YSLAPGAHTHWFSIDPTS--GIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVA 567
            Y +  G   + FSI   S  G+++ A  LDY+LE Q  L V A+DG       +A + V 
Sbjct: 645  YQITSGNTRNRFSITSQSGGGLVSLALPLDYKLERQYVLAVTASDG---TRQDTAQIVVN 701

Query: 568  LQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSP 627
            + D N + P FQ + Y  ++ E    GT  + ++ATD D+G    ++Y +         P
Sbjct: 702  VTDANTHRPVFQSSHYTVNVNEDRPAGTTVVLISATDEDTGENARITYFM-----EDSIP 756

Query: 628  PFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGG--GLKSMVYVKVFLSDENDNPPQF 685
             FRIDA +G V T   LD +    S+   +TA D G        Y+++ ++D NDN PQF
Sbjct: 757  QFRIDADTGAVTTQAELDYED-QVSYTLAITARDNGIPQKSDTTYLEILVNDVNDNAPQF 815

Query: 686  YPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAG-NSPPLFTLDEQSGLLTV 744
                Y  S+    PP T+VL++ A D D G +GR+ Y    G +    F ++  SG++  
Sbjct: 816  LRDSYQGSVYEDVPPFTSVLQISATDRDSGLNGRVFYTFQGGDDGDGDFIVESTSGIVRT 875

Query: 745  AWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVA 804
               L R   +   L   A D G   A     V ++++     PP+FEQ ++   V E+  
Sbjct: 876  LRRLDRENVAQYVLRAYAVDKGMPPARTPMEVTVTVLDVNDNPPVFEQDEFDVFVEENSP 935

Query: 805  PGTSVGIVQAHNP-PGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGPVLEL 863
             G +V  V A +P  G  A +   +  G+   +F LD  SG L  L  LD E   P   L
Sbjct: 936  IGLAVARVTATDPDEGTNAQIMYQIVEGNIPEVFQLDIFSGELTALVDLDYE-DRPEYVL 994

Query: 864  EVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPE----DTVLLPPNTAPGTPIYTLRAL 919
             ++A S   P  + A V V L D NDN P     E    + V    ++ PG  I  + A 
Sbjct: 995  VIQATSA--PLVSRATVHVRLLDRNDNPPVLGNFEILFNNYVTNRSSSFPGGAIGRVPAH 1052

Query: 920  DPDSGVNSRVTFTLLAGGG-GAFTVDPTTGHVRLMRPL 956
            DPD  ++  +T++   G       ++ +TG ++L R L
Sbjct: 1053 DPD--ISDSLTYSFERGNELSLVLLNASTGELKLSRAL 1088



 Score =  370 bits (950), Expect = e-101
 Identities = 311/946 (32%), Positives = 450/946 (47%), Gaps = 49/946 (5%)

Query: 467  DNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYS---LAPGAHTHWFSI 523
            + AP F    Y+   +PE    G+ V  + A DPD+G  G++ Y+   L       +FS+
Sbjct: 176  NTAPQFQPPSYQAT-VPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFSL 234

Query: 524  DPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFY 583
            DP +G +TTA  LD E +      V A D G+P  ++ AT+++ + D ND++P F++  Y
Sbjct: 235  DPVTGAVTTAEELDRETKSTHVFRVTAQDHGMPRRSALATLTILVTDTNDHDPVFEQQEY 294

Query: 584  NASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRT 643
              SL E  + G   L V ATD D+ P   + Y L  G G S S  F ID  SG + T   
Sbjct: 295  KESLRENLEVGYEVLTVRATDGDAPPNANILYRLLEGSGGSPSEVFEIDPRSGVIRTRGP 354

Query: 644  LDRDQGPSSFDFTVTAVDGG---GLKSMVYVKVFLS--DENDNPPQFYPREYAASISAQS 698
            +DR++   S+  TV A D G   G +S     VFLS  D+NDN PQF  + Y   +    
Sbjct: 355  VDREE-VESYQLTVEASDQGRDPGPRSTT-AAVFLSVEDDNDNAPQFSEKRYVVQVREDV 412

Query: 699  PPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQL 758
             PG  VLR+ A D D+GS+  + Y I++GN+   F LD Q+G L V  PL         L
Sbjct: 413  TPGAPVLRVTASDRDKGSNAVVHYSIMSGNARGQFYLDAQTGALDVVSPLDYETTKEYTL 472

Query: 759  EIGAEDGGGLQ-AEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHN- 816
             + A+DGG    +  S  V + ++      PIF    +  +V E V  G  V  VQA + 
Sbjct: 473  RVRAQDGGRPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGYLVLHVQAIDA 532

Query: 817  PPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGPVLELEVRAGSGVPPAFA 876
              G  A +   L+G      F+++  +G +     LDRE +            G P   A
Sbjct: 533  DAGDNARLEYRLAGVGHDFPFTINNGTGWISVAAELDREEVDFYSFGVEARDHGTPALTA 592

Query: 877  VARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAG 936
             A V V + DVNDN+P F  PE TV L  + A GT + T+ A+D D+  +S +T+ + +G
Sbjct: 593  SASVSVTVLDVNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRDA--HSVITYQITSG 650

Query: 937  GGG---AFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGT 993
                  + T     G V L  PL       + L + A DG    R    ++ V V D  T
Sbjct: 651  NTRNRFSITSQSGGGLVSLALPLDYKLERQYVLAVTASDG---TRQDTAQIVVNVTDANT 707

Query: 994  RGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGP---ITYHLAAEGASSPFGLEPQ 1050
                P F S  Y V++     AGT V+ + A   D G    ITY +  E +   F ++  
Sbjct: 708  H--RPVFQSSHYTVNVNEDRPAGTTVVLISATDEDTGENARITYFM--EDSIPQFRIDAD 763

Query: 1051 SGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPT 1110
            +G +  +A LD E Q  Y L   A++     + Q++ T  + + + + N+++P+   D  
Sbjct: 764  TGAVTTQAELDYEDQVSYTL---AITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDSY 820

Query: 1111 FLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLD 1170
              +V E+ PP TSV ++ ATDRDSG NGR+ Y+ Q   +    F +   +G V TL+ LD
Sbjct: 821  QGSVYEDVPPFTSVLQISATDRDSGLNGRVFYTFQGGDDGDGDFIVESTSGIVRTLRRLD 880

Query: 1171 REQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRV 1230
            RE  + Y L     D G PP  T   V V VLD+NDN P F Q          + V +  
Sbjct: 881  RENVAQYVLRAYAVDKGMPPARTPMEVTVTVLDVNDNPPVFEQDE------FDVFVEENS 934

Query: 1231 PPGTLVTTLQAKDPDEGENGTILYTLT-GPGSELFSLHPHSGELLTAAPLIRAERPHYVL 1289
            P G  V  + A DPDEG N  I+Y +  G   E+F L   SGEL     L   +RP YVL
Sbjct: 935  PIGLAVARVTATDPDEGTNAQIMYQIVEGNIPEVFQLDIFSGELTALVDLDYEDRPEYVL 994

Query: 1290 TLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGS 1349
             + A    S P  +   + V++L      + PP L   +    +     VT      PG 
Sbjct: 995  VIQA---TSAPLVSRATVHVRLLDR---NDNPPVLGNFE----ILFNNYVTNRSSSFPGG 1044

Query: 1350 LLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAASGRLYLARPLD 1395
             +G V A +P    +LTY+   G +      L+A++G L L+R LD
Sbjct: 1045 AIGRVPAHDPDISDSLTYSFERG-NELSLVLLNASTGELKLSRALD 1089



 Score =  355 bits (912), Expect = 3e-97
 Identities = 306/979 (31%), Positives = 450/979 (45%), Gaps = 56/979 (5%)

Query: 1433 APAFARDPLALALPENPEPGAALYTFRASDAD-GPGPNSDVRYRLLRQEPPVPALRLDAR 1491
            AP F        +PEN   G  + + RA D D G     +     L          LD  
Sbjct: 178  APQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFSLDPV 237

Query: 1492 TGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPS- 1550
            TGA++    LDRET    +  V A D   +   RR+A  +  + VTD ND+ PVF     
Sbjct: 238  TGAVTTAEELDRETKSTHVFRVTAQD---HGMPRRSALATLTILVTDTNDHDPVFEQQEY 294

Query: 1551 RVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGH----FRLHSSTGALSVVRP 1606
            +  L E+   G   L V A D D    A + YRL  G  G     F +   +G +    P
Sbjct: 295  KESLRENLEVGYEVLTVRATDGDAPPNANILYRLLEGSGGSPSEVFEIDPRSGVIRTRGP 354

Query: 1607 LDREQRAEHVLTVVASDHGSPP--RSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPP 1664
            +DRE+   + LTV ASD G  P  RS T  + +SV D ND AP F ++ Y V +RE+  P
Sbjct: 355  VDREEVESYQLTVEASDQGRDPGPRSTTAAVFLSVEDDNDNAPQFSEKRYVVQVREDVTP 414

Query: 1665 GTSLLTLRATDPDVGANGQVTYGGVSSES---FSLDPDTGVLTTLRALDREEQEEINLTV 1721
            G  +L + A+D D G+N  V Y  +S  +   F LD  TG L  +  LD E  +E  L V
Sbjct: 415  GAPVLRVTASDRDKGSNAVVHYSIMSGNARGQFYLDAQTGALDVVSPLDYETTKEYTLRV 474

Query: 1722 YAQDRGSPPQLTHVT--VRVAVEDENDHAPTFGSAHLSLEVPEGQDPQTLTM-LRASDPD 1778
             AQD G PP L++V+  V V V D ND+AP F S      V E      L + ++A D D
Sbjct: 475  RAQDGGRPP-LSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGYLVLHVQAIDAD 533

Query: 1779 VGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSAT 1838
             G N +L+YR+        F ++  +G       LDRE    +   +EARD G PAL+A+
Sbjct: 534  AGDNARLEYRLAGVGHDFPFTINNGTGWISVAAELDREEVDFYSFGVEARDHGTPALTAS 593

Query: 1839 LLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAG- 1897
              ++VTVLD ND+ P F  P Y+V + ED   GT ++ + A D D  A+  +TY + +G 
Sbjct: 594  ASVSVTVLDVNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRD--AHSVITYQITSGN 651

Query: 1898 TAGAFLLEPSSGE--LRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVND 1955
            T   F +   SG   +  A  LD +    Y  +V+A DG        T  + + V D N 
Sbjct: 652  TRNRFSITSQSGGGLVSLALPLDYKLERQYVLAVTASDGTR----QDTAQIVVNVTDANT 707

Query: 1956 HAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDS 2015
            H P F +S   + +    P+ +T  L  AT    D D G NA I Y +  + P    +D+
Sbjct: 708  HRPVFQSSHYTVNVNEDRPAGTTVVLISAT----DEDTGENARITYFMEDSIPQ-FRIDA 762

Query: 2016 YTGEIRVARSPVALGPRDRV---LFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRAS 2072
             TG +    +   L   D+V   L I A D G P +S T  + + +    +  P+F R S
Sbjct: 763  DTGAV---TTQAELDYEDQVSYTLAITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDS 819

Query: 2073 SEATIRENAPPGTPIVSPRAV-HAGGTNGPITYSILSGNE-KGTFSIQPSTGAITVRSAE 2130
             + ++ E+ PP T ++   A     G NG + Y+   G++  G F ++ ++G   VR+  
Sbjct: 820  YQGSVYEDVPPFTSVLQISATDRDSGLNGRVFYTFQGGDDGDGDFIVESTSG--IVRTLR 877

Query: 2131 GLDFE-VSPRLRLVLQAESGGAFAFTVL--TLTLQDANDNAPRFLRPHYVAFLPESRPLE 2187
             LD E V+  +      + G   A T +  T+T+ D NDN P F +  +  F+ E+ P+ 
Sbjct: 878  RLDRENVAQYVLRAYAVDKGMPPARTPMEVTVTVLDVNDNPPVFEQDEFDVFVEENSPIG 937

Query: 2188 GPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVL 2247
              + +V A D D+G+  QI Y +        +F +D  +G +T    LD E   E  LV+
Sbjct: 938  LAVARVTATDPDEGTNAQIMYQIVEGNIPE-VFQLDIFSGELTALVDLDYEDRPEYVLVI 996

Query: 2248 MATDRGSPALVGSATLTVMVIDTNDNRPTIPQPWELRVS------EDALLGSEIAQVTGN 2301
             AT   S  LV  AT+ V ++D NDN P +   +E+  +        +  G  I +V  +
Sbjct: 997  QAT---SAPLVSRATVHVRLLDRNDNPPVLGN-FEILFNNYVTNRSSSFPGGAIGRVPAH 1052

Query: 2302 DVDSGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRAN 2361
            D D    L Y            +    G + L+  LD  +     + +L  DG H   A 
Sbjct: 1053 DPDISDSLTYSFERGNELSLVLLNASTGELKLSRALDNNRPLEAIMSVLVSDGVHSVTAQ 1112

Query: 2362 LTVLVEDVNDNAPAFSQSL 2380
              + V  + D     S +L
Sbjct: 1113 CALRVTIITDEMLTHSITL 1131



 Score =  342 bits (878), Expect = 3e-93
 Identities = 300/984 (30%), Positives = 440/984 (44%), Gaps = 69/984 (7%)

Query: 1748 APTFGSAHLSLEVPEGQDPQT-LTMLRASDPDVGANGQLQYR---ILDGDPSGAFVLDLA 1803
            AP F        VPE Q   T +  LRA DPD G  G+L+Y    + D   +  F LD  
Sbjct: 178  APQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFSLDPV 237

Query: 1804 SGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVE 1863
            +G   T   LDRE +     R+ A+D G P  SA   LT+ V D NDH P F    Y   
Sbjct: 238  TGAVTTAEELDRETKSTHVFRVTAQDHGMPRRSALATLTILVTDTNDHDPVFEQQEYKES 297

Query: 1864 VPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGA----FLLEPSSGELRTAAALDR 1919
            + E++  G  +L ++A D DA  N ++ Y L  G+ G+    F ++P SG +RT   +DR
Sbjct: 298  LRENLEVGYEVLTVRATDGDAPPNANILYRLLEGSGGSPSEVFEIDPRSGVIRTRGPVDR 357

Query: 1920 EQCPSYTFSVSAVD-GAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFST 1978
            E+  SY  +V A D G   GP STT +V ++V D ND+AP F      +++        T
Sbjct: 358  EEVESYQLTVEASDQGRDPGPRSTTAAVFLSVEDDNDNAPQFSEKRYVVQVRED----VT 413

Query: 1979 PTLALATLRAEDRDAGANASILYRL-AGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLF 2037
            P   +  + A DRD G+NA + Y + +G       +D+ TG + V         ++  L 
Sbjct: 414  PGAPVLRVTASDRDKGSNAVVHYSIMSGNARGQFYLDAQTGALDVVSPLDYETTKEYTLR 473

Query: 2038 IVATDLGRPARS-ATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHA- 2095
            + A D GRP  S  +G++ V +    +  P F     +AT+ E+ P G  ++  +A+ A 
Sbjct: 474  VRAQDGGRPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGYLVLHVQAIDAD 533

Query: 2096 GGTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFT 2155
             G N  + Y +        F+I   TG I+V  A  LD E        ++A   G  A T
Sbjct: 534  AGDNARLEYRLAGVGHDFPFTINNGTGWISV--AAELDREEVDFYSFGVEARDHGTPALT 591

Query: 2156 V---LTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAA 2212
                +++T+ D NDN P F +P Y   L E   +   ++ V A D D  S   I+Y + +
Sbjct: 592  ASASVSVTVLDVNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRDAHS--VITYQITS 649

Query: 2213 SQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTND 2272
                R  F +   +G    +  L  +   E + VL  T         +A + V V D N 
Sbjct: 650  GN-TRNRFSITSQSGGGLVSLALPLDYKLERQYVLAVT-ASDGTRQDTAQIVVNVTDANT 707

Query: 2273 NRPTIPQP-WELRVSEDALLGSEIAQVTGNDVDSGPV--LWYVLSPSGPQDPFSVGRYGG 2329
            +RP      + + V+ED   G+ +  ++  D D+G    + Y +  S PQ  F +    G
Sbjct: 708  HRPVFQSSHYTVNVNEDRPAGTTVVLISATDEDTGENARITYFMEDSIPQ--FRIDADTG 765

Query: 2330 RVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLT---VLVEDVNDNAPAFSQSLYQVMLL 2386
             V+    LD+E    Y L + A D     +++ T   +LV DVNDNAP F +  YQ  + 
Sbjct: 766  AVTTQAELDYEDQVSYTLAITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDSYQGSVY 825

Query: 2387 EHTPPGSAILSVSATDRDSGANGHISYHLASPADG---FSVDPNNGTLFTIVGTVALGHD 2443
            E  PP +++L +SATDRDSG NG + Y      DG   F V+  +G + T+        D
Sbjct: 826  EDVPPFTSVLQISATDRDSGLNGRVFYTFQGGDDGDGDFIVESTSGIVRTLRRL-----D 880

Query: 2444 GSGAVDVVLEAR--DHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTL 2501
                   VL A   D G P       V V + D ND+ P F    + V V E+ P G  +
Sbjct: 881  RENVAQYVLRAYAVDKGMPPARTPMEVTVTVLDVNDNPPVFEQDEFDVFVEENSPIGLAV 940

Query: 2502 LTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLD 2561
              + ATD D   ++A + Y I+ GN   VFQL+    E              L  L  LD
Sbjct: 941  ARVTATDPDEG-TNAQIMYQIVEGNIPEVFQLDIFSGE--------------LTALVDLD 985

Query: 2562 FESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYR----VTVPEDTPV 2617
            +E   +Y L + A      P  S   V V +LD NDNPPV           VT    +  
Sbjct: 986  YEDRPEYVLVIQATSA---PLVSRATVHVRLLDRNDNPPVLGNFEILFNNYVTNRSSSFP 1042

Query: 2618 GAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVV 2677
            G  +  V A D D      + ++   G+   L  L+ S+G L+L+ ALD        + V
Sbjct: 1043 GGAIGRVPAHDPDISDS--LTYSFERGNELSLVLLNASTGELKLSRALDNNRPLEAIMSV 1100

Query: 2678 QAADPAGAHFALAPVTIEVQDVND 2701
              +D  G H   A   + V  + D
Sbjct: 1101 LVSD--GVHSVTAQCALRVTIITD 1122



 Score =  342 bits (877), Expect = 4e-93
 Identities = 307/976 (31%), Positives = 436/976 (44%), Gaps = 52/976 (5%)

Query: 140  APAFPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGY---ALSGDGAGETFRLETR 196
            AP F        VPE+   GT      A D D G  G   Y   AL    + + F L+  
Sbjct: 178  APQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFSLD-- 235

Query: 197  PGPDGTPVPELVVTGE-LDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAF 255
                  PV   V T E LDRE +S ++ ++ A D G P R A A L + + D NDH P F
Sbjct: 236  ------PVTGAVTTAEELDRETKSTHVFRVTAQDHGMPRRSALATLTILVTDTNDHDPVF 289

Query: 256  NQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGP---FSIDAHTG 312
             Q  Y   + E+L  G  VL V A+D DA  N  + Y +   +  G  P   F ID  +G
Sbjct: 290  EQQEYKESLRENLEVGYEVLTVRATDGDAPPNANILYRL--LEGSGGSPSEVFEIDPRSG 347

Query: 313  LLQLERPLDFEQRRVHELVVQARDGGAH--PELGSAFVTVHVRDANDNQPSMTVIFLSAD 370
            +++   P+D E+   ++L V+A D G    P   +A V + V D NDN P     F    
Sbjct: 348  VIRTRGPVDREEVESYQLTVEASDQGRDPGPRSTTAAVFLSVEDDNDNAPQ----FSEKR 403

Query: 371  GSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGG--EGHFALSTQDSVIYLVCVAR 428
               QV E   PG  V R++ SD D G  A V+ S+  G   G F L  Q   + +V    
Sbjct: 404  YVVQVREDVTPGAPVLRVTASDRDKGSNAVVHYSIMSGNARGQFYLDAQTGALDVV---S 460

Query: 429  RLDREERDAYNLRVTATDSGSPPLRAEAAFV-LHVTDVNDNAPAFDRQLYRPEPLPEVAL 487
             LD E    Y LRV A D G PPL   +  V + V D+NDNAP F    ++   L  V L
Sbjct: 461  PLDYETTKEYTLRVRAQDGGRPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPL 520

Query: 488  PGSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLI 547
             G  V+ V A D D G N ++ Y LA   H   F+I+  +G I+ AA LD E        
Sbjct: 521  -GYLVLHVQAIDADAGDNARLEYRLAGVGHDFPFTINNGTGWISVAAELDREEVDFYSFG 579

Query: 548  VVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADS 607
            V A D G P L +SA+VSV + DVNDN P F +  Y   L E    GT  + V+A D D+
Sbjct: 580  VEARDHGTPALTASASVSVTVLDVNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRDA 639

Query: 608  GPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRD-QGPSSFDFTVTAVDGGGLK 666
                +++Y + +G   +    F I + SG    +  L  D +    +   VTA D G  +
Sbjct: 640  --HSVITYQITSG---NTRNRFSITSQSGGGLVSLALPLDYKLERQYVLAVTASD-GTRQ 693

Query: 667  SMVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILA 726
                + V ++D N + P F    Y  +++   P GT V+ + A D D G + R++Y +  
Sbjct: 694  DTAQIVVNVTDANTHRPVFQSSHYTVNVNEDRPAGTTVVLISATDEDTGENARITYFM-- 751

Query: 727  GNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPT 786
             +S P F +D  +G +T    L         L I A D G  Q   +  ++I +      
Sbjct: 752  EDSIPQFRIDADTGAVTTQAELDYEDQVSYTLAITARDNGIPQKSDTTYLEILVNDVNDN 811

Query: 787  PPIFEQLQYVFSVPEDVAPGTSVGIVQA-HNPPGRLAPVTLSLSGGDP-RGLFSLDAVSG 844
             P F +  Y  SV EDV P TSV  + A     G    V  +  GGD   G F +++ SG
Sbjct: 812  APQFLRDSYQGSVYEDVPPFTSVLQISATDRDSGLNGRVFYTFQGGDDGDGDFIVESTSG 871

Query: 845  LLQTLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLP 904
            +++TLR LDRE +   +        G+PPA     V V + DVNDN P F   E  V + 
Sbjct: 872  IVRTLRRLDRENVAQYVLRAYAVDKGMPPARTPMEVTVTVLDVNDNPPVFEQDEFDVFVE 931

Query: 905  PNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGG-GGAFTVDPTTGHVRLMRPLGPSGGPA 963
             N+  G  +  + A DPD G N+++ + ++ G     F +D  +G +  +  L     P 
Sbjct: 932  ENSPIGLAVARVTATDPDEGTNAQIMYQIVEGNIPEVFQLDIFSGELTALVDLDYEDRPE 991

Query: 964  HELELEARDGGSPPR-TSHFRLRVVVQDVGTRG-LAPRFNSPTYRVDLPSGTTAGTQVLQ 1021
            + L ++A       R T H RL     +    G     FN+    V   S +  G  + +
Sbjct: 992  YVLVIQATSAPLVSRATVHVRLLDRNDNPPVLGNFEILFNN---YVTNRSSSFPGGAIGR 1048

Query: 1022 VQAQAPD-GGPITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKA 1080
            V A  PD    +TY        S   L   +G L +  ALD       I+ V+   G   
Sbjct: 1049 VPAHDPDISDSLTYSFERGNELSLVLLNASTGELKLSRALDNNRPLEAIMSVLVSDG--- 1105

Query: 1081 ELGQQTGTATVRVSIL 1096
             +   T    +RV+I+
Sbjct: 1106 -VHSVTAQCALRVTII 1120



 Score =  337 bits (864), Expect = 1e-91
 Identities = 285/908 (31%), Positives = 409/908 (45%), Gaps = 51/908 (5%)

Query: 74   APLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDREQRDRYRFTAVTPD--------GA 125
            A ++Y +    G        ID  SGV+RT   +DRE+ + Y+ T    D          
Sbjct: 322  ANILYRLLEGSGGSPSEVFEIDPRSGVIRTRGPVDREEVESYQLTVEASDQGRDPGPRST 381

Query: 126  TVEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGYALSGD 185
            T  V + V D ND+AP F + R  +QV E    G       A D D G      Y++   
Sbjct: 382  TAAVFLSVEDDNDNAPQFSEKRYVVQVREDVTPGAPVLRVTASDRDKGSNAVVHYSIMSG 441

Query: 186  GAGETFRLETRPGPDGTPVPELVVTGELDRENRSHYMLQLEAYDGGSPP-RRAQALLDVT 244
             A   F L+ + G        L V   LD E    Y L++ A DGG PP      L+ V 
Sbjct: 442  NARGQFYLDAQTG-------ALDVVSPLDYETTKEYTLRVRAQDGGRPPLSNVSGLVTVQ 494

Query: 245  LLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGP 304
            +LDIND+AP F  + + A V ES+  G  VL V A DADAG N  + Y +       D P
Sbjct: 495  VLDINDNAPIFVSTPFQATVLESVPLGYLVLHVQAIDADAGDNARLEYRL--AGVGHDFP 552

Query: 305  FSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTV 364
            F+I+  TG + +   LD E+   +   V+ARD G      SA V+V V D NDN P+   
Sbjct: 553  FTINNGTGWISVAAELDREEVDFYSFGVEARDHGTPALTASASVSVTVLDVNDNNPT--- 609

Query: 365  IFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLV 424
             F   + + +++E A  G  V  +S  D D        ++       F++++Q S   LV
Sbjct: 610  -FTQPEYTVRLNEDAAVGTSVVTVSAVDRDAHSVITYQITSGNTRNRFSITSQ-SGGGLV 667

Query: 425  CVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPE 484
             +A  LD +    Y L VTA+D      +  A  V++VTD N + P F    Y    + E
Sbjct: 668  SLALPLDYKLERQYVLAVTASDG---TRQDTAQIVVNVTDANTHRPVFQSSHYTVN-VNE 723

Query: 485  VALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQP 544
                G+ VV ++A D D G N ++TY +        F ID  +G +TT A LDYE +   
Sbjct: 724  DRPAGTTVVLISATDEDTGENARITYFMEDSIPQ--FRIDADTGAVTTQAELDYEDQVSY 781

Query: 545  QLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATD 604
             L + A D G+P  + +  + + + DVNDN PQF R  Y  S+ E   P T  LQ++ATD
Sbjct: 782  TLAITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDSYQGSVYEDVPPFTSVLQISATD 841

Query: 605  ADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGG- 663
             DSG  G + Y+     G  G   F +++ SG V T R LDR +  + +     AVD G 
Sbjct: 842  RDSGLNGRVFYTFQG--GDDGDGDFIVESTSGIVRTLRRLDR-ENVAQYVLRAYAVDKGM 898

Query: 664  -GLKSMVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSY 722
               ++ + V V + D NDNPP F   E+   +   SP G AV R+ A DPD+G++ ++ Y
Sbjct: 899  PPARTPMEVTVTVLDVNDNPPVFEQDEFDVFVEENSPIGLAVARVTATDPDEGTNAQIMY 958

Query: 723  HILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVP 782
             I+ GN P +F LD  SG LT    L         L I A           A V + ++ 
Sbjct: 959  QIVEGNIPEVFQLDIFSGELTALVDLDYEDRPEYVLVIQATSA---PLVSRATVHVRLLD 1015

Query: 783  GTPTPPIFEQLQYVF----SVPEDVAPGTSVGIVQAHNPPGRLAPVTLSLSGGDPRGLFS 838
                PP+    + +F    +      PG ++G V AH+ P     +T S   G+   L  
Sbjct: 1016 RNDNPPVLGNFEILFNNYVTNRSSSFPGGAIGRVPAHD-PDISDSLTYSFERGNELSLVL 1074

Query: 839  LDAVSGLLQTLRPLDREL-LGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAP 897
            L+A +G L+  R LD    L  ++ + V  G     A    RV ++ D++  +S      
Sbjct: 1075 LNASTGELKLSRALDNNRPLEAIMSVLVSDGVHSVTAQCALRVTIITDEMLTHSITLRLE 1134

Query: 898  E---DTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMR 954
            +   +  L P        +    A  PD  V   V     A GG    V  + G     +
Sbjct: 1135 DMSPERFLSPLLGLFIQAVAATLATPPDHVVVFNVQRDTDAPGGHILNVSLSVG-----Q 1189

Query: 955  PLGPSGGP 962
            P GP GGP
Sbjct: 1190 PPGPGGGP 1197



 Score =  334 bits (856), Expect = 1e-90
 Identities = 263/832 (31%), Positives = 387/832 (46%), Gaps = 51/832 (6%)

Query: 2066 PRFPRASSEATIRENAPPGTPIVSPRAVHAG-GTNGPITYS---ILSGNEKGTFSIQPST 2121
            P+F   S +AT+ EN P GTP+ S RA+    G  G + Y+   +        FS+ P T
Sbjct: 179  PQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFSLDPVT 238

Query: 2122 GAITVRSAEGLDFEVSPRLRLVLQAESGGA---FAFTVLTLTLQDANDNAPRFLRPHYVA 2178
            GA+T  +AE LD E        + A+  G     A   LT+ + D ND+ P F +  Y  
Sbjct: 239  GAVT--TAEELDRETKSTHVFRVTAQDHGMPRRSALATLTILVTDTNDHDPVFEQQEYKE 296

Query: 2179 FLPESRPLEGPLLQVEADDLDQGSGGQISYSL---AASQPARGLFHVDPTTGTITTTAIL 2235
             L E+  +   +L V A D D      I Y L   +   P+  +F +DP +G I T   +
Sbjct: 297  SLRENLEVGYEVLTVRATDGDAPPNANILYRLLEGSGGSPSE-VFEIDPRSGVIRTRGPV 355

Query: 2236 DREIWAETRLVLMATDRGSPALVGSATLTVM--VIDTNDNRPTIPQP-WELRVSEDALLG 2292
            DRE     +L + A+D+G      S T  V   V D NDN P   +  + ++V ED   G
Sbjct: 356  DREEVESYQLTVEASDQGRDPGPRSTTAAVFLSVEDDNDNAPQFSEKRYVVQVREDVTPG 415

Query: 2293 SEIAQVTGNDVDSGP--VLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLL 2350
            + + +VT +D D G   V+ Y +     +  F +    G + +  PLD+E    Y L++ 
Sbjct: 416  APVLRVTASDRDKGSNAVVHYSIMSGNARGQFYLDAQTGALDVVSPLDYETTKEYTLRVR 475

Query: 2351 AHDGPHEGRANL----TVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSG 2406
            A DG     +N+    TV V D+NDNAP F  + +Q  +LE  P G  +L V A D D+G
Sbjct: 476  AQDGGRPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGYLVLHVQAIDADAG 535

Query: 2407 ANGHISYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARA 2466
             N  + Y LA     F    NNGT +  V    L  +        +EARDHG P   A A
Sbjct: 536  DNARLEYRLAGVGHDFPFTINNGTGWISVAA-ELDREEVDFYSFGVEARDHGTPALTASA 594

Query: 2467 TVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGN 2526
            +V V + D ND+ P+FT   Y V + ED   G++++T+ A D D   +H+ + Y I SGN
Sbjct: 595  SVSVTVLDVNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRD---AHSVITYQITSGN 651

Query: 2527 WGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVV 2586
                F +        +S G      G + L  PLD++   QY L V A+D  +   + +V
Sbjct: 652  TRNRFSI------TSQSGG------GLVSLALPLDYKLERQYVLAVTASDGTRQDTAQIV 699

Query: 2587 PVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDP 2646
               V V D N + PVF  + Y V V ED P G  ++ + A+D D G +  + + +    P
Sbjct: 700  ---VNVTDANTHRPVFQSSHYTVNVNEDRPAGTTVVLISATDEDTGENARITYFMEDSIP 756

Query: 2647 SGLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHFA-LAPVTIEVQDVNDHGPA 2705
               F +D  +G +     LD E Q  + L + A D      +    + I V DVND+ P 
Sbjct: 757  Q--FRIDADTGAVTTQAELDYEDQVSYTLAITARDNGIPQKSDTTYLEILVNDVNDNAPQ 814

Query: 2706 FPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTG 2765
            F  +    SV E+ PP T V  + A D D+G  GR+ Y+      G +G   F + S++G
Sbjct: 815  FLRDSYQGSVYEDVPPFTSVLQISATDRDSGLNGRVFYTFQG---GDDGDGDFIVESTSG 871

Query: 2766 ELRARVPFDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYD--PVFLAPAFHFQVP 2823
             +R     D E+   + L   A D G   A   + V VT  D  D  PVF    F   V 
Sbjct: 872  IVRTLRRLDRENVAQYVLRAYAVDKGMPPARTPMEVTVTVLDVNDNPPVFEQDEFDVFVE 931

Query: 2824 EGARRGHSLGHVQATDEDGGADGLVLYSLATSS--PYFGINQTTGALYLRVD 2873
            E +  G ++  V ATD D G +  ++Y +   +    F ++  +G L   VD
Sbjct: 932  ENSPIGLAVARVTATDPDEGTNAQIMYQIVEGNIPEVFQLDIFSGELTALVD 983



 Score =  322 bits (826), Expect = 3e-87
 Identities = 292/949 (30%), Positives = 427/949 (44%), Gaps = 66/949 (6%)

Query: 1951 RDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPG 2010
            R+VN  AP F     +  +P   P+  TP   +A+LRA D D G    + Y +       
Sbjct: 173  RNVNT-APQFQPPSYQATVPENQPA-GTP---VASLRAIDPDEGEAGRLEYTMDALFDSR 227

Query: 2011 T----TVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGP 2066
            +    ++D  TG +  A           V  + A D G P RSA   + + +    +  P
Sbjct: 228  SNQFFSLDPVTGAVTTAEELDRETKSTHVFRVTAQDHGMPRRSALATLTILVTDTNDHDP 287

Query: 2067 RFPRASSEATIRENAPPGTPIVSPRAVHAGGT-NGPITYSILSGN---EKGTFSIQPSTG 2122
             F +   + ++REN   G  +++ RA       N  I Y +L G+       F I P +G
Sbjct: 288  VFEQQEYKESLRENLEVGYEVLTVRATDGDAPPNANILYRLLEGSGGSPSEVFEIDPRSG 347

Query: 2123 AITVRSAEGLDFEVSPRLRLVLQA-----ESGGAFAFTVLTLTLQDANDNAPRFLRPHYV 2177
             I  R    +D E     +L ++A     + G       + L+++D NDNAP+F    YV
Sbjct: 348  VIRTRGP--VDREEVESYQLTVEASDQGRDPGPRSTTAAVFLSVEDDNDNAPQFSEKRYV 405

Query: 2178 AFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDR 2237
              + E      P+L+V A D D+GS   + YS+ +   ARG F++D  TG +   + LD 
Sbjct: 406  VQVREDVTPGAPVLRVTASDRDKGSNAVVHYSIMSGN-ARGQFYLDAQTGALDVVSPLDY 464

Query: 2238 EIWAETRLVLMATDRGSPALVG-SATLTVMVIDTNDNRPT-IPQPWELRVSEDALLGSEI 2295
            E   E  L + A D G P L   S  +TV V+D NDN P  +  P++  V E   LG  +
Sbjct: 465  ETTKEYTLRVRAQDGGRPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGYLV 524

Query: 2296 AQVTGNDVDSGPV--LWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHD 2353
              V   D D+G    L Y L+  G   PF++    G +S+   LD E+ D Y   + A D
Sbjct: 525  LHVQAIDADAGDNARLEYRLAGVGHDFPFTINNGTGWISVAAELDREEVDFYSFGVEARD 584

Query: 2354 GPHEG---RANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGH 2410
                     A+++V V DVNDN P F+Q  Y V L E    G+++++VSA DRD  A+  
Sbjct: 585  HGTPALTASASVSVTVLDVNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRD--AHSV 642

Query: 2411 ISYHLAS--PADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATV 2468
            I+Y + S    + FS+   +G       ++AL  D       VL         R   A +
Sbjct: 643  ITYQITSGNTRNRFSITSQSGGGLV---SLALPLDYKLERQYVLAVTASDGT-RQDTAQI 698

Query: 2469 HVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWG 2528
             V + D N H P F  SHY V V ED P G+T++ + ATD D +  +A + Y        
Sbjct: 699  VVNVTDANTHRPVFQSSHYTVNVNEDRPAGTTVVLISATDED-TGENARITYF------- 750

Query: 2529 RVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPV 2588
                +E  + +    A  G      +     LD+E    Y L + A D G P +S    +
Sbjct: 751  ----MEDSIPQFRIDADTG-----AVTTQAELDYEDQVSYTLAITARDNGIPQKSDTTYL 801

Query: 2589 TVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPS- 2647
             + V DVNDN P F R SY+ +V ED P    +L + A+D D G +G V +T   GD   
Sbjct: 802  EILVNDVNDNAPQFLRDSYQGSVYEDVPPFTSVLQISATDRDSGLNGRVFYTFQGGDDGD 861

Query: 2648 GLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHFALAP--VTIEVQDVNDHGPA 2705
            G F ++ +SG +R    LD E  A++ L   A D  G   A  P  VT+ V DVND+ P 
Sbjct: 862  GDFIVESTSGIVRTLRRLDRENVAQYVLRAYAVDK-GMPPARTPMEVTVTVLDVNDNPPV 920

Query: 2706 FPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTG 2765
            F  +     V EN P G  V  + A D D G   ++ Y ++E G  PE    F L+  +G
Sbjct: 921  FEQDEFDVFVEENSPIGLAVARVTATDPDEGTNAQIMYQIVE-GNIPE---VFQLDIFSG 976

Query: 2766 ELRARVPFDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYDPVF--LAPAFHFQVP 2823
            EL A V  DYE    + L++ A  A  L +  TV V +   ++  PV       F+  V 
Sbjct: 977  ELTALVDLDYEDRPEYVLVIQATSA-PLVSRATVHVRLLDRNDNPPVLGNFEILFNNYVT 1035

Query: 2824 EGARR--GHSLGHVQATDEDGGADGLVLYSLATSSPYFGINQTTGALYL 2870
              +    G ++G V A D D        +          +N +TG L L
Sbjct: 1036 NRSSSFPGGAIGRVPAHDPDISDSLTYSFERGNELSLVLLNASTGELKL 1084



 Score =  131 bits (330), Expect = 1e-29
 Identities = 144/493 (29%), Positives = 206/493 (41%), Gaps = 44/493 (8%)

Query: 43   QAGSLDLQIDEEQPAGTLIGDISA-GLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVV 101
            Q+    + ++E++PAGT +  ISA     G  A + YF+             ID  +G V
Sbjct: 713  QSSHYTVNVNEDRPAGTTVVLISATDEDTGENARITYFMEDSI-----PQFRIDADTGAV 767

Query: 102  RTARVLDREQRDRYRFTAVTPDGA------TVEVTVRVADINDHAPAFPQARAALQVPEH 155
             T   LD E +  Y       D        T  + + V D+ND+AP F +      V E 
Sbjct: 768  TTQAELDYEDQVSYTLAITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDSYQGSVYED 827

Query: 156  TAFGTRYPLEPARDADAGRLGTQGYALSG--DGAGETFRLETRPGPDGTPVPELVVTGEL 213
                T      A D D+G  G   Y   G  DG G+ F +E+  G   T          L
Sbjct: 828  VPPFTSVLQISATDRDSGLNGRVFYTFQGGDDGDGD-FIVESTSGIVRT-------LRRL 879

Query: 214  DRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSP 273
            DREN + Y+L+  A D G PP R    + VT+LD+ND+ P F Q  +   V E+   G  
Sbjct: 880  DRENVAQYVLRAYAVDKGMPPARTPMEVTVTVLDVNDNPPVFEQDEFDVFVEENSPIGLA 939

Query: 274  VLQVFASDADAGVNGAVTYEINRRQSEGDGP--FSIDAHTGLLQLERPLDFEQRRVHELV 331
            V +V A+D D G N  + Y+I     EG+ P  F +D  +G L     LD+E R  + LV
Sbjct: 940  VARVTATDPDEGTNAQIMYQI----VEGNIPEVFQLDIFSGELTALVDLDYEDRPEYVLV 995

Query: 332  VQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVS 391
            +QA      P +  A V V + D NDN P +    +  +       ++ PG  + R+   
Sbjct: 996  IQATSA---PLVSRATVHVRLLDRNDNPPVLGNFEILFNNYVTNRSSSFPGGAIGRVPAH 1052

Query: 392  DPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPP 451
            DPD  D   +  S E G    +L   ++    + ++R LD        + V  +D G   
Sbjct: 1053 DPDISD--SLTYSFERG-NELSLVLLNASTGELKLSRALDNNRPLEAIMSVLVSD-GVHS 1108

Query: 452  LRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPE---VALPGSFVVRVT---ARDPDQGTN 505
            + A+ A  L VT + D        L   +  PE     L G F+  V    A  PD    
Sbjct: 1109 VTAQCA--LRVTIITDEMLTHSITLRLEDMSPERFLSPLLGLFIQAVAATLATPPDHVVV 1166

Query: 506  GQVTYSL-APGAH 517
              V     APG H
Sbjct: 1167 FNVQRDTDAPGGH 1179


>gi|7656967 cadherin EGF LAG seven-pass G-type receptor 1 [Homo
            sapiens]
          Length = 3014

 Score =  414 bits (1065), Expect = e-115
 Identities = 335/1018 (32%), Positives = 483/1018 (47%), Gaps = 86/1018 (8%)

Query: 1468 PNSDVRYRLL---RQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASR 1524
            P   VR RLL   R+      + L         P      + P    L EA   PA  +R
Sbjct: 175  PGGSVRLRLLCALRRAAGAVRVGLALEAATAGTPSASPSPSPPLPPNLPEARAGPARRAR 234

Query: 1525 R-RAARVSARVFVTDENDNAPVFASPS-RVRLPEDQPPGPAALHVVARDPDLGEAARVSY 1582
            R  + R S +            F  P+ +V L E++P G   L + A     GE  RVSY
Sbjct: 235  RGTSGRGSLK------------FPMPNYQVALFENEPAGTLILQLHAHYTIEGEEERVSY 282

Query: 1583 RLASGGD----GHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVS 1638
             +    D    G+FR+ S+TGA+S    LDRE +  HVL V A D+ +PPRSAT  +TV 
Sbjct: 283  YMEGLFDERSRGYFRIDSATGAVSTDSVLDRETKETHVLRVKAVDYSTPPRSATTYITVL 342

Query: 1639 VADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYG--GVSSESFSL 1696
            V D ND +P F+Q EY   +REN   G  +LT+RA+D D   N  + Y   G + + F L
Sbjct: 343  VKDTNDHSPVFEQSEYRERVRENLEVGYEVLTIRASDRDSPINANLRYRVLGGAWDVFQL 402

Query: 1697 DPDTGVLTTLRALDREEQEEINLTVYAQDRG--SPPQLTHVTVRVAVEDENDHAPTFGSA 1754
            +  +GV++T   LDREE  E  L V A D+G    P     TV + VEDEND+ P F   
Sbjct: 403  NESSGVVSTRAVLDREEAAEYQLLVEANDQGRNPGPLSATATVYIEVEDENDNYPQFSEQ 462

Query: 1755 HLSLEVPEGQDPQTLTM-LRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPL 1813
            +  ++VPE     T  + ++A+D D G N  + Y IL G+ +G F L   SG    + PL
Sbjct: 463  NYVVQVPEDVGLNTAVLRVQATDRDQGQNAAIHYSILSGNVAGQFYLHSLSGILDVINPL 522

Query: 1814 DREVEPAFQLRIEARDGGQPAL-SATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGT 1872
            D E    + L I+A+DGG+P L +++ +++V VLD ND+ P F    +   V E+VP G 
Sbjct: 523  DFEDVQKYSLSIKAQDGGRPPLINSSGVVSVQVLDVNDNEPIFVSSPFQATVLENVPLGY 582

Query: 1873 LLLQLQAHDPDAGANGHVTY--------YLGAGTAG----------AFLLEPSSGELRTA 1914
             ++ +QA D D+G N  + Y        +LG G+AG           F +  SSG +   
Sbjct: 583  PVVHIQAVDADSGENARLHYRLVDTASTFLGGGSAGPKNPAPTPDFPFQIHNSSGWITVC 642

Query: 1915 AALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGP 1974
            A LDRE+   Y+F V AVD  +  P+S++ SV+ITV DVND+ P F      LRL     
Sbjct: 643  AELDREEVEHYSFGVEAVDHGSP-PMSSSTSVSITVLDVNDNDPVFTQPTYELRLNEDAA 701

Query: 1975 SFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYT-------GEIRVARSPV 2027
              S    ++ TL+A DRD  AN+ I Y+L G    G T + +        G I +A   +
Sbjct: 702  VGS----SVLTLQARDRD--ANSVITYQLTG----GNTRNRFALSSQRGGGLITLA---L 748

Query: 2028 ALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPI 2087
             L  +    +++A       RS T  +++ +       P F  +    ++ E+ P GT I
Sbjct: 749  PLDYKQEQQYVLAVTASDGTRSHTAHVLINVTDANTHRPVFQSSHYTVSVSEDRPVGTSI 808

Query: 2088 VSPRAVHAG-GTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQA 2146
             +  A     G N  ITY I   +    F I P +G  T+ +   LD+E      L + A
Sbjct: 809  ATLSANDEDTGENARITYVI--QDPVPQFRIDPDSG--TMYTMMELDYENQVAYTLTIMA 864

Query: 2147 ESGG---AFAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSG 2203
            +  G       T L + + DANDNAP+FL   Y   + E  P    +LQV A D D G  
Sbjct: 865  QDNGIPQKSDTTTLEILILDANDNAPQFLWDFYQGSIFEDAPPSTSILQVSATDRDSGPN 924

Query: 2204 GQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPA-LVGSAT 2262
            G++ Y+        G F+++PT+G I T   LDRE  A   L  +A DRGSP  L  S  
Sbjct: 925  GRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLDRENVAVYNLWALAVDRGSPTPLSASVE 984

Query: 2263 LTVMVIDTNDNRPTIPQ-PWELRVSEDALLGSEIAQVTGNDVDSGP--VLWYVLSPSGPQ 2319
            + V ++D NDN P   +   EL V E+  +GS +A++  ND D GP   + Y +     +
Sbjct: 985  IQVTILDINDNAPMFEKDELELFVEENNPVGSVVAKIRANDPDEGPNAQIMYQIVEGDMR 1044

Query: 2320 DPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVLVEDVNDNAPAFSQS 2379
              F +    G +     LDFE    Y L + A   P   RA + +L+ D NDN P     
Sbjct: 1045 HFFQLDLLNGDLRAMVELDFEVRREYVLVVQATSAPLVSRATVHILLVDQNDNPPVLPD- 1103

Query: 2380 LYQVMLLEHTP------PGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTL 2431
             +Q++   +        P   I  + A D D   + + ++   +      +DP  G L
Sbjct: 1104 -FQILFNNYVTNKSNSFPTGVIGCIPAHDPDVSDSLNYTFVQGNELRLLLLDPATGEL 1160



 Score =  414 bits (1065), Expect = e-115
 Identities = 306/991 (30%), Positives = 492/991 (49%), Gaps = 72/991 (7%)

Query: 1855 FPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGA----GTAGAFLLEPSSGE 1910
            FP+P Y V + E+ PAGTL+LQL AH    G    V+YY+       + G F ++ ++G 
Sbjct: 245  FPMPNYQVALFENEPAGTLILQLHAHYTIEGEEERVSYYMEGLFDERSRGYFRIDSATGA 304

Query: 1911 LRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLP 1970
            + T + LDRE   ++   V AVD +   P S T  +T+ V+D NDH+P F  S  R R+ 
Sbjct: 305  VSTDSVLDRETKETHVLRVKAVDYSTP-PRSATTYITVLVKDTNDHSPVFEQSEYRERV- 362

Query: 1971 RPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALG 2030
            R         L   T+RA DRD+  NA++ YR+ G       ++  +G +          
Sbjct: 363  RENLEVGYEVL---TIRASDRDSPINANLRYRVLGGAWDVFQLNESSGVVSTRAVLDREE 419

Query: 2031 PRDRVLFIVATDLGRPAR--SATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIV 2088
              +  L + A D GR     SAT  + + ++ E +  P+F   +    + E+    T ++
Sbjct: 420  AAEYQLLVEANDQGRNPGPLSATATVYIEVEDENDNYPQFSEQNYVVQVPEDVGLNTAVL 479

Query: 2089 SPRAVHAG-GTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAE 2147
              +A     G N  I YSILSGN  G F +   +G + V +   LDFE   +  L ++A+
Sbjct: 480  RVQATDRDQGQNAAIHYSILSGNVAGQFYLHSLSGILDVINP--LDFEDVQKYSLSIKAQ 537

Query: 2148 SGGAFAFT----VLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSG 2203
             GG         V+++ + D NDN P F+   + A + E+ PL  P++ ++A D D G  
Sbjct: 538  DGGRPPLINSSGVVSVQVLDVNDNEPIFVSSPFQATVLENVPLGYPVVHIQAVDADSGEN 597

Query: 2204 GQISYSLAAS-------------QPARGL---FHVDPTTGTITTTAILDREIWAETRLVL 2247
             ++ Y L  +              PA      F +  ++G IT  A LDRE        +
Sbjct: 598  ARLHYRLVDTASTFLGGGSAGPKNPAPTPDFPFQIHNSSGWITVCAELDREEVEHYSFGV 657

Query: 2248 MATDRGSPALVGSATLTVMVIDTNDNRPTIPQP-WELRVSEDALLGSEIAQVTGNDVDSG 2306
             A D GSP +  S ++++ V+D NDN P   QP +ELR++EDA +GS +  +   D D+ 
Sbjct: 658  EAVDHGSPPMSSSTSVSITVLDVNDNDPVFTQPTYELRLNEDAAVGSSVLTLQARDRDAN 717

Query: 2307 PVLWYVLSPSGPQDPFSVG--RYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTV 2364
             V+ Y L+    ++ F++   R GG ++L  PLD++Q  +Y L + A DG     A++ +
Sbjct: 718  SVITYQLTGGNTRNRFALSSQRGGGLITLALPLDYKQEQQYVLAVTASDGTRSHTAHVLI 777

Query: 2365 LVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSV 2424
             V D N + P F  S Y V + E  P G++I ++SA D D+G N  I+Y +  P   F +
Sbjct: 778  NVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATLSANDEDTGENARITYVIQDPVPQFRI 837

Query: 2425 DPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTL 2484
            DP++GT++T+   + L ++   A  + + A+D+G P ++   T+ + + D ND+AP F  
Sbjct: 838  DPDSGTMYTM---MELDYENQVAYTLTIMAQDNGIPQKSDTTTLEILILDANDNAPQFLW 894

Query: 2485 SHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWG-RVFQLEPRLAEAGES 2543
              Y+ ++ ED PP +++L + ATD D S  +  + Y+   G+ G   F +EP        
Sbjct: 895  DFYQGSIFEDAPPSTSILQVSATDRD-SGPNGRLLYTFQGGDDGDGDFYIEP-------- 945

Query: 2544 AGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQP-PQSSVVPVTVTVLDVNDNPPVF 2602
                    G +     LD E++  YNL   A DRG P P S+ V + VT+LD+NDN P+F
Sbjct: 946  ------TSGVIRTQRRLDRENVAVYNLWALAVDRGSPTPLSASVEIQVTILDINDNAPMF 999

Query: 2603 TRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLA 2662
             +    + V E+ PVG+ +  + A+D D GP+  + + +  GD    F+LD  +G LR  
Sbjct: 1000 EKDELELFVEENNPVGSVVAKIRANDPDEGPNAQIMYQIVEGDMRHFFQLDLLNGDLRAM 1059

Query: 2663 HALDCETQARHQLVVQAADPAGAHFALAPVTIEVQDVNDHGPAFP-----LNLLSTSVAE 2717
              LD E +  + LVVQA   +    + A V I + D ND+ P  P      N   T+ + 
Sbjct: 1060 VELDFEVRREYVLVVQAT--SAPLVSRATVHILLVDQNDNPPVLPDFQILFNNYVTNKSN 1117

Query: 2718 NQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEH 2777
            + P G ++  + A D D      L Y+ ++   G E R    L+ +TGEL+     D   
Sbjct: 1118 SFPTG-VIGCIPAHDPDVS--DSLNYTFVQ---GNELR-LLLLDPATGELQLSRDLDNNR 1170

Query: 2778 TESFRLLVGAADA-GNLSASVTVSVLVTGED 2807
                 + V  +D   +++A  T+ V +  +D
Sbjct: 1171 PLEALMEVSVSDGIHSVTAFCTLRVTIITDD 1201



 Score =  354 bits (909), Expect = 7e-97
 Identities = 315/1035 (30%), Positives = 477/1035 (46%), Gaps = 87/1035 (8%)

Query: 992  GTRGLAP-RFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGP---ITYHLAA---EGASSP 1044
            GT G    +F  P Y+V L     AGT +LQ+ A     G    ++Y++     E +   
Sbjct: 236  GTSGRGSLKFPMPNYQVALFENEPAGTLILQLHAHYTIEGEEERVSYYMEGLFDERSRGY 295

Query: 1045 FGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPR 1104
            F ++  +G +   + LDRE +E ++L+V AV  S      ++ T  + V + + N+HSP 
Sbjct: 296  FRIDSATGAVSTDSVLDRETKETHVLRVKAVDYSTPP---RSATTYITVLVKDTNDHSPV 352

Query: 1105 LSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVT 1164
              +      V EN   G  V  + A+DRDS  N  L Y +   + D   F+++  +G V+
Sbjct: 353  FEQSEYRERVRENLEVGYEVLTIRASDRDSPINANLRYRVLGGAWD--VFQLNESSGVVS 410

Query: 1165 TLQTLDREQQSSYQLLVQVQDGGSPPR--STTGTVHVAVLDLNDNSPTFLQASGAAGGGL 1222
            T   LDRE+ + YQLLV+  D G  P   S T TV++ V D NDN P F + +       
Sbjct: 411  TRAVLDREEAAEYQLLVEANDQGRNPGPLSATATVYIEVEDENDNYPQFSEQNYV----- 465

Query: 1223 PIQVPDRVPPGTLVTTLQAKDPDEGENGTILYT-LTGPGSELFSLHPHSGELLTAAPLIR 1281
             +QVP+ V   T V  +QA D D+G+N  I Y+ L+G  +  F LH  SG L    PL  
Sbjct: 466  -VQVPEDVGLNTAVLRVQATDRDQGQNAAIHYSILSGNVAGQFYLHSLSGILDVINPLDF 524

Query: 1282 AERPHYVLTLSAHDQGSPPR-SASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVT 1340
             +   Y L++ A D G PP  ++S  + VQVL          D+ + +P   V      T
Sbjct: 525  EDVQKYSLSIKAQDGGRPPLINSSGVVSVQVL----------DVNDNEPIF-VSSPFQAT 573

Query: 1341 AAEGLRPGSLLGSVAAPEP-AGVGALTY--------TLVGGAD---------PEGTFALD 1382
              E +  G  +  + A +  +G  A  +        T +GG           P+  F + 
Sbjct: 574  VLENVPLGYPVVHIQAVDADSGENARLHYRLVDTASTFLGGGSAGPKNPAPTPDFPFQIH 633

Query: 1383 AASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDPLA 1442
             +SG + +   LD E    +       +      +    V + V D N++ P F +    
Sbjct: 634  NSSGWITVCAELDREEVEHYSFGVEAVDHGSPPMSSSTSVSITVLDVNDNDPVFTQPTYE 693

Query: 1443 LALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVP-ALRLDARTGALSAPRGL 1501
            L L E+   G+++ T +A D D    NS + Y+L         AL      G ++    L
Sbjct: 694  LRLNEDAAVGSSVLTLQARDRDA---NSVITYQLTGGNTRNRFALSSQRGGGLITLALPL 750

Query: 1502 DRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPS-RVRLPEDQPP 1560
            D +     +L V A+D     +R   A V   + VTD N + PVF S    V + ED+P 
Sbjct: 751  DYKQEQQYVLAVTASD----GTRSHTAHVL--INVTDANTHRPVFQSSHYTVSVSEDRPV 804

Query: 1561 GPAALHVVARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVV 1620
            G +   + A D D GE AR++Y +       FR+   +G +  +  LD E +  + LT++
Sbjct: 805  GTSIATLSANDEDTGENARITYVIQDPVP-QFRIDPDSGTMYTMMELDYENQVAYTLTIM 863

Query: 1621 ASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGA 1680
            A D+G P +S T  L + + D ND AP F    Y   + E+ PP TS+L + ATD D G 
Sbjct: 864  AQDNGIPQKSDTTTLEILILDANDNAPQFLWDFYQGSIFEDAPPSTSILQVSATDRDSGP 923

Query: 1681 NGQVTY----GGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLT-HV 1735
            NG++ Y    G      F ++P +GV+ T R LDRE     NL   A DRGSP  L+  V
Sbjct: 924  NGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLDRENVAVYNLWALAVDRGSPTPLSASV 983

Query: 1736 TVRVAVEDENDHAPTFGSAHLSLEVPEGQDP-QTLTMLRASDPDVGANGQLQYRILDGDP 1794
             ++V + D ND+AP F    L L V E       +  +RA+DPD G N Q+ Y+I++GD 
Sbjct: 984  EIQVTILDINDNAPMFEKDELELFVEENNPVGSVVAKIRANDPDEGPNAQIMYQIVEGDM 1043

Query: 1795 SGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPA 1854
               F LDL +G+   M  LD EV   + L ++A       L +   + + ++D ND+ P 
Sbjct: 1044 RHFFQLDLLNGDLRAMVELDFEVRREYVLVVQATSA---PLVSRATVHILLVDQNDNPPV 1100

Query: 1855 FP-----VPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSG 1909
             P        Y        P G +   + AHDPD   + + T+  G       LL+P++G
Sbjct: 1101 LPDFQILFNNYVTNKSNSFPTGVIGC-IPAHDPDVSDSLNYTFVQG-NELRLLLLDPATG 1158

Query: 1910 ELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRL 1969
            EL+ +  LD  +       VS  DG  +     T+ VTI   D+        T+ + +RL
Sbjct: 1159 ELQLSRDLDNNRPLEALMEVSVSDGIHSVTAFCTLRVTIITDDM-------LTNSITVRL 1211

Query: 1970 PRPG-PSFSTPTLAL 1983
                   F +P LAL
Sbjct: 1212 ENMSQEKFLSPLLAL 1226



 Score =  343 bits (880), Expect = 2e-93
 Identities = 303/989 (30%), Positives = 451/989 (45%), Gaps = 70/989 (7%)

Query: 53   EEQPAGTLIGDISAGLPA-GTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDREQ 111
            E +PAGTLI  + A     G    + Y++             ID  +G V T  VLDRE 
Sbjct: 256  ENEPAGTLILQLHAHYTIEGEEERVSYYMEGLFDERSRGYFRIDSATGAVSTDSVLDRET 315

Query: 112  RDRY--RFTAVT----PDGATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLE 165
            ++ +  R  AV     P  AT  +TV V D NDH+P F Q+    +V E+   G      
Sbjct: 316  KETHVLRVKAVDYSTPPRSATTYITVLVKDTNDHSPVFEQSEYRERVRENLEVGYEVLTI 375

Query: 166  PARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSHYMLQL 225
             A D D+       Y + G GA + F+L    G   T          LDRE  + Y L +
Sbjct: 376  RASDRDSPINANLRYRVLG-GAWDVFQLNESSGVVST-------RAVLDREEAAEYQLLV 427

Query: 226  EAYDGG--SPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDAD 283
            EA D G    P  A A + + + D ND+ P F++  Y   V E +   + VL+V A+D D
Sbjct: 428  EANDQGRNPGPLSATATVYIEVEDENDNYPQFSEQNYVVQVPEDVGLNTAVLRVQATDRD 487

Query: 284  AGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPEL 343
             G N A+ Y I        G F + + +G+L +  PLDFE  + + L ++A+DGG  P +
Sbjct: 488  QGQNAAIHYSI--LSGNVAGQFYLHSLSGILDVINPLDFEDVQKYSLSIKAQDGGRPPLI 545

Query: 344  GSA-FVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVN 402
             S+  V+V V D NDN+P    IF+S+     V E  P G  V  I   D D G+ A ++
Sbjct: 546  NSSGVVSVQVLDVNDNEP----IFVSSPFQATVLENVPLGYPVVHIQAVDADSGENARLH 601

Query: 403  VSLEGGEGHF----------ALSTQDSVIYL------VCVARRLDREERDAYNLRVTATD 446
              L      F             T D    +      + V   LDREE + Y+  V A D
Sbjct: 602  YRLVDTASTFLGGGSAGPKNPAPTPDFPFQIHNSSGWITVCAELDREEVEHYSFGVEAVD 661

Query: 447  SGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNG 506
             GSPP+ +  +  + V DVNDN P F +  Y    L E A  GS V+ + ARD D   N 
Sbjct: 662  HGSPPMSSSTSVSITVLDVNDNDPVFTQPTYELR-LNEDAAVGSSVLTLQARDRD--ANS 718

Query: 507  QVTYSLAPGAHTHWFSIDPT--SGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATV 564
             +TY L  G   + F++      G+IT A  LDY+ E Q  L V A+DG     + +A V
Sbjct: 719  VITYQLTGGNTRNRFALSSQRGGGLITLALPLDYKQEQQYVLAVTASDG---TRSHTAHV 775

Query: 565  SVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSS 624
             + + D N + P FQ + Y  S+ E    GT    ++A D D+G    ++Y +       
Sbjct: 776  LINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATLSANDEDTGENARITYVI-----QD 830

Query: 625  GSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGG--GLKSMVYVKVFLSDENDNP 682
              P FRID  SG + T   LD  +   ++  T+ A D G         +++ + D NDN 
Sbjct: 831  PVPQFRIDPDSGTMYTMMELDY-ENQVAYTLTIMAQDNGIPQKSDTTTLEILILDANDNA 889

Query: 683  PQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAG-NSPPLFTLDEQSGL 741
            PQF    Y  SI   +PP T++L++ A D D G +GRL Y    G +    F ++  SG+
Sbjct: 890  PQFLWDFYQGSIFEDAPPSTSILQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGV 949

Query: 742  LTVAWPLARRANSVVQL-EIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVP 800
            +     L R   +V  L  +  + G       S  + ++I+      P+FE+ +    V 
Sbjct: 950  IRTQRRLDRENVAVYNLWALAVDRGSPTPLSASVEIQVTILDINDNAPMFEKDELELFVE 1009

Query: 801  EDVAPGTSVGIVQAHNP-PGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGP 859
            E+   G+ V  ++A++P  G  A +   +  GD R  F LD ++G L+ +  LD E+   
Sbjct: 1010 ENNPVGSVVAKIRANDPDEGPNAQIMYQIVEGDMRHFFQLDLLNGDLRAMVELDFEVRRE 1069

Query: 860  VLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPE----DTVLLPPNTAPGTPIYT 915
             + L V+A S   P  + A V +LL D NDN P  P  +    + V    N+ P   I  
Sbjct: 1070 YV-LVVQATSA--PLVSRATVHILLVDQNDNPPVLPDFQILFNNYVTNKSNSFPTGVIGC 1126

Query: 916  LRALDPDSGVNSRVTFTLLAGGG-GAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDG- 973
            + A DPD  V+  + +T + G       +DP TG ++L R L  +      +E+   DG 
Sbjct: 1127 IPAHDPD--VSDSLNYTFVQGNELRLLLLDPATGELQLSRDLDNNRPLEALMEVSVSDGI 1184

Query: 974  GSPPRTSHFRLRVVVQDVGTRGLAPRFNS 1002
             S       R+ ++  D+ T  +  R  +
Sbjct: 1185 HSVTAFCTLRVTIITDDMLTNSITVRLEN 1213



 Score =  336 bits (861), Expect = 3e-91
 Identities = 293/966 (30%), Positives = 429/966 (44%), Gaps = 61/966 (6%)

Query: 255  FNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSEGD-GPFSIDAHTGL 313
            F    Y   + E+   G+ +LQ+ A     G    V+Y +     E   G F ID+ TG 
Sbjct: 245  FPMPNYQVALFENEPAGTLILQLHAHYTIEGEEERVSYYMEGLFDERSRGYFRIDSATGA 304

Query: 314  LQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSP 373
            +  +  LD E +  H L V+A D    P   + ++TV V+D ND+ P    +F  ++   
Sbjct: 305  VSTDSVLDRETKETHVLRVKAVDYSTPPRSATTYITVLVKDTNDHSP----VFEQSEYRE 360

Query: 374  QVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGH-FALSTQDSVIYLVCVARRLDR 432
            +V E    G  V  I  SD D    A++   + GG    F L+    V+    V   LDR
Sbjct: 361  RVRENLEVGYEVLTIRASDRDSPINANLRYRVLGGAWDVFQLNESSGVVSTRAV---LDR 417

Query: 433  EERDAYNLRVTATDSG--SPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGS 490
            EE   Y L V A D G    PL A A   + V D NDN P F  Q Y  +   +V L  +
Sbjct: 418  EEAAEYQLLVEANDQGRNPGPLSATATVYIEVEDENDNYPQFSEQNYVVQVPEDVGL-NT 476

Query: 491  FVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVA 550
             V+RV A D DQG N  + YS+  G     F +   SGI+     LD+E   +  L + A
Sbjct: 477  AVLRVQATDRDQGQNAAIHYSILSGNVAGQFYLHSLSGILDVINPLDFEDVQKYSLSIKA 536

Query: 551  TDGGLPPLA-SSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGP 609
             DGG PPL  SS  VSV + DVNDNEP F  + + A++ E    G   + + A DADSG 
Sbjct: 537  QDGGRPPLINSSGVVSVQVLDVNDNEPIFVSSPFQATVLENVPLGYPVVHIQAVDADSGE 596

Query: 610  FGLLSYS--------LGAGLGSSGSP------PFRIDAHSGDVCTTRTLDRDQGPSSFDF 655
               L Y         LG G     +P      PF+I   SG +     LDR++    + F
Sbjct: 597  NARLHYRLVDTASTFLGGGSAGPKNPAPTPDFPFQIHNSSGWITVCAELDREE-VEHYSF 655

Query: 656  TVTAVDGGG--LKSMVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPD 713
             V AVD G   + S   V + + D NDN P F    Y   ++  +  G++VL L+A D D
Sbjct: 656  GVEAVDHGSPPMSSSTSVSITVLDVNDNDPVFTQPTYELRLNEDAAVGSSVLTLQARDRD 715

Query: 714  QGSHGRLSYHILAGNSPPLFTLDEQ--SGLLTVAWPLARRANSVVQLEIGAEDGGGLQAE 771
              S   ++Y +  GN+   F L  Q   GL+T+A PL  +      L + A DG      
Sbjct: 716  ANS--VITYQLTGGNTRNRFALSSQRGGGLITLALPLDYKQEQQYVLAVTASDG---TRS 770

Query: 772  PSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHN-PPGRLAPVTLSLSG 830
             +A V I++       P+F+   Y  SV ED   GTS+  + A++   G  A +T  +  
Sbjct: 771  HTAHVLINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATLSANDEDTGENARITYVIQ- 829

Query: 831  GDPRGLFSLDAVSGLLQTLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDN 890
             DP   F +D  SG + T+  LD E         +   +G+P       + +L+ D NDN
Sbjct: 830  -DPVPQFRIDPDSGTMYTMMELDYENQVAYTLTIMAQDNGIPQKSDTTTLEILILDANDN 888

Query: 891  SPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAG--GGGAFTVDPTTG 948
            +P F        +  +  P T I  + A D DSG N R+ +T   G  G G F ++PT+G
Sbjct: 889  APQFLWDFYQGSIFEDAPPSTSILQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSG 948

Query: 949  HVRLMRPLGPSGGPAHELELEARDGGSP-PRTSHFRLRVVVQDVGTRGLAPRFNSPTYRV 1007
             +R  R L       + L   A D GSP P ++   ++V + D+     AP F      +
Sbjct: 949  VIRTQRRLDRENVAVYNLWALAVDRGSPTPLSASVEIQVTILDINDN--APMFEKDELEL 1006

Query: 1008 DLPSGTTAGTQVLQVQAQAPDGGP---ITYHLAAEGASSPFGLEPQSGWLWVRAALDREA 1064
             +      G+ V +++A  PD GP   I Y +        F L+  +G L     LD E 
Sbjct: 1007 FVEENNPVGSVVAKIRANDPDEGPNAQIMYQIVEGDMRHFFQLDLLNGDLRAMVELDFEV 1066

Query: 1065 QELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDP----TFLAVAENQPP 1120
            +  Y+L V A S            ATV + +++QN++ P L +       ++    N  P
Sbjct: 1067 RREYVLVVQATS------APLVSRATVHILLVDQNDNPPVLPDFQILFNNYVTNKSNSFP 1120

Query: 1121 GTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLL 1180
               +G + A D D   +  L Y+  Q   + +   + P TGE+   + LD  +     + 
Sbjct: 1121 TGVIGCIPAHDPDVSDS--LNYTFVQ-GNELRLLLLDPATGELQLSRDLDNNRPLEALME 1177

Query: 1181 VQVQDG 1186
            V V DG
Sbjct: 1178 VSVSDG 1183



 Score =  326 bits (835), Expect = 3e-88
 Identities = 282/927 (30%), Positives = 417/927 (44%), Gaps = 57/927 (6%)

Query: 1377 GTFALDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAF 1436
            G F +D+A+G +     LD E            +      +    + V V+D N+H+P F
Sbjct: 294  GYFRIDSATGAVSTDSVLDRETKETHVLRVKAVDYSTPPRSATTYITVLVKDTNDHSPVF 353

Query: 1437 ARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALS 1496
             +      + EN E G  + T RASD D P  N+++RYR+L     V   +L+  +G +S
Sbjct: 354  EQSEYRERVRENLEVGYEVLTIRASDRDSP-INANLRYRVLGGAWDV--FQLNESSGVVS 410

Query: 1497 APRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSR-VRLP 1555
                LDRE      LLVEA D+  N     +A  +  + V DENDN P F+  +  V++P
Sbjct: 411  TRAVLDREEAAEYQLLVEANDQGRNPG-PLSATATVYIEVEDENDNYPQFSEQNYVVQVP 469

Query: 1556 EDQPPGPAALHVVARDPDLGEAARVSYRLASGG-DGHFRLHSSTGALSVVRPLDREQRAE 1614
            ED     A L V A D D G+ A + Y + SG   G F LHS +G L V+ PLD E   +
Sbjct: 470  EDVGLNTAVLRVQATDRDQGQNAAIHYSILSGNVAGQFYLHSLSGILDVINPLDFEDVQK 529

Query: 1615 HVLTVVASDHGSPPR-SATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRA 1673
            + L++ A D G PP  +++ V++V V DVND  P F    +   + EN P G  ++ ++A
Sbjct: 530  YSLSIKAQDGGRPPLINSSGVVSVQVLDVNDNEPIFVSSPFQATVLENVPLGYPVVHIQA 589

Query: 1674 TDPDVGANGQVTYGGVSSES--------------------FSLDPDTGVLTTLRALDREE 1713
             D D G N ++ Y  V + S                    F +   +G +T    LDREE
Sbjct: 590  VDADSGENARLHYRLVDTASTFLGGGSAGPKNPAPTPDFPFQIHNSSGWITVCAELDREE 649

Query: 1714 QEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPE-GQDPQTLTML 1772
             E  +  V A D GSPP  +  +V + V D ND+ P F      L + E      ++  L
Sbjct: 650  VEHYSFGVEAVDHGSPPMSSSTSVSITVLDVNDNDPVFTQPTYELRLNEDAAVGSSVLTL 709

Query: 1773 RASDPDVGANGQLQYRILDGDPSGAFVL--DLASGEFGTMRPLDREVEPAFQLRIEARDG 1830
            +A D D  AN  + Y++  G+    F L      G      PLD + E  + L + A DG
Sbjct: 710  QARDRD--ANSVITYQLTGGNTRNRFALSSQRGGGLITLALPLDYKQEQQYVLAVTASDG 767

Query: 1831 GQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHV 1890
             +   S T  + + V DAN H P F    Y+V V ED P GT +  L A+D D G N  +
Sbjct: 768  TR---SHTAHVLINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATLSANDEDTGENARI 824

Query: 1891 TYYLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITV 1950
            TY +       F ++P SG + T   LD E   +YT ++ A D       S T ++ I +
Sbjct: 825  TYVI-QDPVPQFRIDPDSGTMYTMMELDYENQVAYTLTIMAQDNGIP-QKSDTTTLEILI 882

Query: 1951 RDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPG 2010
             D ND+AP F     +  +    P    P+ ++  + A DRD+G N  +LY   G     
Sbjct: 883  LDANDNAPQFLWDFYQGSIFEDAP----PSTSILQVSATDRDSGPNGRLLYTFQGGDDGD 938

Query: 2011 TT--VDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPA-RSATGVIIVGLQGEAERGPR 2067
                ++  +G IR  R           L+ +A D G P   SA+  I V +    +  P 
Sbjct: 939  GDFYIEPTSGVIRTQRRLDRENVAVYNLWALAVDRGSPTPLSASVEIQVTILDINDNAPM 998

Query: 2068 FPRASSEATIRENAPPGTPIVSPRAVHAG-GTNGPITYSILSGNEKGTFSIQPSTGAITV 2126
            F +   E  + EN P G+ +   RA     G N  I Y I+ G+ +  F +    G   +
Sbjct: 999  FEKDELELFVEENNPVGSVVAKIRANDPDEGPNAQIMYQIVEGDMRHFFQLDLLNG--DL 1056

Query: 2127 RSAEGLDFEVSPRLRLVLQAESGGAFAFTVLTLTLQDANDNAP-----RFLRPHYVAFLP 2181
            R+   LDFEV     LV+QA S    +   + + L D NDN P     + L  +YV    
Sbjct: 1057 RAMVELDFEVRREYVLVVQATSAPLVSRATVHILLVDQNDNPPVLPDFQILFNNYVTNKS 1116

Query: 2182 ESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWA 2241
             S P  G +  + A D D      ++Y+       R L  +DP TG +  +  LD     
Sbjct: 1117 NSFP-TGVIGCIPAHDPDVSD--SLNYTFVQGNELR-LLLLDPATGELQLSRDLDNNRPL 1172

Query: 2242 ETRLVLMATDRGSPALVGSATLTVMVI 2268
            E  + +  +D G  ++    TL V +I
Sbjct: 1173 EALMEVSVSD-GIHSVTAFCTLRVTII 1198



 Score =  323 bits (829), Expect = 1e-87
 Identities = 288/959 (30%), Positives = 427/959 (44%), Gaps = 79/959 (8%)

Query: 479  PEPLPEVAL-----PGSFVVRVTARDPDQGTNGQVTY---SLAPGAHTHWFSIDPTSGII 530
            P P  +VAL      G+ ++++ A    +G   +V+Y    L       +F ID  +G +
Sbjct: 246  PMPNYQVALFENEPAGTLILQLHAHYTIEGEEERVSYYMEGLFDERSRGYFRIDSATGAV 305

Query: 531  TTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEG 590
            +T + LD E +    L V A D   PP +++  ++V ++D ND+ P F+++ Y   + E 
Sbjct: 306  STDSVLDRETKETHVLRVKAVDYSTPPRSATTYITVLVKDTNDHSPVFEQSEYRERVREN 365

Query: 591  TQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGP 650
             + G   L + A+D DS     L Y +  G        F+++  SG V T   LDR++  
Sbjct: 366  LEVGYEVLTIRASDRDSPINANLRYRVLGGAWDV----FQLNESSGVVSTRAVLDREEA- 420

Query: 651  SSFDFTVTAVDGGG----LKSMVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLR 706
            + +   V A D G     L +   V + + DENDN PQF  + Y   +       TAVLR
Sbjct: 421  AEYQLLVEANDQGRNPGPLSATATVYIEVEDENDNYPQFSEQNYVVQVPEDVGLNTAVLR 480

Query: 707  LRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGG 766
            ++A D DQG +  + Y IL+GN    F L   SG+L V  PL         L I A+DGG
Sbjct: 481  VQATDRDQGQNAAIHYSILSGNVAGQFYLHSLSGILDVINPLDFEDVQKYSLSIKAQDGG 540

Query: 767  GLQA-EPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPPG------ 819
                   S  V + ++      PIF    +  +V E+V  G  V  +QA +         
Sbjct: 541  RPPLINSSGVVSVQVLDVNDNEPIFVSSPFQATVLENVPLGYPVVHIQAVDADSGENARL 600

Query: 820  --RLAPVTLSLSGGDPRGL----------FSLDAVSGLLQTLRPLDRELLGPVLELEVRA 867
              RL     +  GG   G           F +   SG +     LDRE +          
Sbjct: 601  HYRLVDTASTFLGGGSAGPKNPAPTPDFPFQIHNSSGWITVCAELDREEVEHYSFGVEAV 660

Query: 868  GSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNS 927
              G PP  +   V + + DVNDN P F  P   + L  + A G+ + TL+A D D+  NS
Sbjct: 661  DHGSPPMSSSTSVSITVLDVNDNDPVFTQPTYELRLNEDAAVGSSVLTLQARDRDA--NS 718

Query: 928  RVTFTLLAGGGG---AFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRL 984
             +T+ L  G      A +     G + L  PL       + L + A DG +   T+H  +
Sbjct: 719  VITYQLTGGNTRNRFALSSQRGGGLITLALPLDYKQEQQYVLAVTASDG-TRSHTAHVLI 777

Query: 985  RVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGP---ITYHLAAEGA 1041
             V   D  T    P F S  Y V +      GT +  + A   D G    ITY +  +  
Sbjct: 778  NVT--DANTH--RPVFQSSHYTVSVSEDRPVGTSIATLSANDEDTGENARITYVI--QDP 831

Query: 1042 SSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEH 1101
               F ++P SG ++    LD E Q  Y L +MA       + Q++ T T+ + IL+ N++
Sbjct: 832  VPQFRIDPDSGTMYTMMELDYENQVAYTLTIMAQDNG---IPQKSDTTTLEILILDANDN 888

Query: 1102 SPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTG 1161
            +P+   D    ++ E+ PP TS+ +V ATDRDSGPNGRL Y+ Q   +    F I P +G
Sbjct: 889  APQFLWDFYQGSIFEDAPPSTSILQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSG 948

Query: 1162 EVTTLQTLDREQQSSYQLLVQVQDGGSP-PRSTTGTVHVAVLDLNDNSPTFLQASGAAGG 1220
             + T + LDRE  + Y L     D GSP P S +  + V +LD+NDN+P F +       
Sbjct: 949  VIRTQRRLDRENVAVYNLWALAVDRGSPTPLSASVEIQVTILDINDNAPMFEKDE----- 1003

Query: 1221 GLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLT-GPGSELFSLHPHSGELLTAAPL 1279
             L + V +  P G++V  ++A DPDEG N  I+Y +  G     F L   +G+L     L
Sbjct: 1004 -LELFVEENNPVGSVVAKIRANDPDEGPNAQIMYQIVEGDMRHFFQLDLLNGDLRAMVEL 1062

Query: 1280 IRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVL-- 1337
                R  YVL + A       R+    LLV             D  +  P  P   +L  
Sbjct: 1063 DFEVRREYVLVVQATSAPLVSRATVHILLV-------------DQNDNPPVLPDFQILFN 1109

Query: 1338 -TVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAASGRLYLARPLD 1395
              VT      P  ++G + A +P    +L YT V G +      LD A+G L L+R LD
Sbjct: 1110 NYVTNKSNSFPTGVIGCIPAHDPDVSDSLNYTFVQGNELR-LLLLDPATGELQLSRDLD 1167



 Score =  318 bits (815), Expect = 6e-86
 Identities = 288/977 (29%), Positives = 431/977 (44%), Gaps = 74/977 (7%)

Query: 577  QFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSG 636
            +F    Y  +L E    GT  LQ+ A     G    +SY +           FRID+ +G
Sbjct: 244  KFPMPNYQVALFENEPAGTLILQLHAHYTIEGEEERVSYYMEGLFDERSRGYFRIDSATG 303

Query: 637  DVCTTRTLDRDQGPSSFDFTVTAVDGG--GLKSMVYVKVFLSDENDNPPQFYPREYAASI 694
             V T   LDR+    +    V AVD       +  Y+ V + D ND+ P F   EY   +
Sbjct: 304  AVSTDSVLDRET-KETHVLRVKAVDYSTPPRSATTYITVLVKDTNDHSPVFEQSEYRERV 362

Query: 695  SAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRANS 754
                  G  VL +RA D D   +  L Y +L G +  +F L+E SG+++    L R   +
Sbjct: 363  RENLEVGYEVLTIRASDRDSPINANLRYRVL-GGAWDVFQLNESSGVVSTRAVLDREEAA 421

Query: 755  VVQLEIGAEDGGGLQA--EPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIV 812
              QL + A D G        +A V I +       P F +  YV  VPEDV   T+V  V
Sbjct: 422  EYQLLVEANDQGRNPGPLSATATVYIEVEDENDNYPQFSEQNYVVQVPEDVGLNTAVLRV 481

Query: 813  QA-HNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLGPV-LELEVRAGSG 870
            QA     G+ A +  S+  G+  G F L ++SG+L  + PLD E +    L ++ + G  
Sbjct: 482  QATDRDQGQNAAIHYSILSGNVAGQFYLHSLSGILDVINPLDFEDVQKYSLSIKAQDGGR 541

Query: 871  VPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVT 930
             P   +   V V + DVNDN P F +      +  N   G P+  ++A+D DSG N+R+ 
Sbjct: 542  PPLINSSGVVSVQVLDVNDNEPIFVSSPFQATVLENVPLGYPVVHIQAVDADSGENARLH 601

Query: 931  FTLL------AGGGGA------------FTVDPTTGHVRLMRPLGPSGGPAHELELEARD 972
            + L+       GGG A            F +  ++G + +   L       +   +EA D
Sbjct: 602  YRLVDTASTFLGGGSAGPKNPAPTPDFPFQIHNSSGWITVCAELDREEVEHYSFGVEAVD 661

Query: 973  GGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGP- 1031
             GSPP +S   + + V DV      P F  PTY + L      G+ VL +QA+  D    
Sbjct: 662  HGSPPMSSSTSVSITVLDVNDND--PVFTQPTYELRLNEDAAVGSSVLTLQARDRDANSV 719

Query: 1032 ITYHLAAEGASSPFGLEPQ--SGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTA 1089
            ITY L      + F L  Q   G + +   LD + ++ Y+L V A  G+++       TA
Sbjct: 720  ITYQLTGGNTRNRFALSSQRGGGLITLALPLDYKQEQQYVLAVTASDGTRSH------TA 773

Query: 1090 TVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSE 1149
             V +++ + N H P        ++V+E++P GTS+  + A D D+G N R+TY +Q   +
Sbjct: 774  HVLINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATLSANDEDTGENARITYVIQ---D 830

Query: 1150 DSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSP 1209
                FRI P +G + T+  LD E Q +Y L +  QD G P +S T T+ + +LD NDN+P
Sbjct: 831  PVPQFRIDPDSGTMYTMMELDYENQVAYTLTIMAQDNGIPQKSDTTTLEILILDANDNAP 890

Query: 1210 TFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTG--PGSELFSLH 1267
             FL             + +  PP T +  + A D D G NG +LYT  G   G   F + 
Sbjct: 891  QFLWDFYQG------SIFEDAPPSTSILQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIE 944

Query: 1268 PHSGELLTAAPLIRAERPHYVLTLSAHDQGSP-PRSASLQLLVQVLPSARLAEPPPDLAE 1326
            P SG + T   L R     Y L   A D+GSP P SAS+++ V +L    + +  P + E
Sbjct: 945  PTSGVIRTQRRLDRENVAVYNLWALAVDRGSPTPLSASVEIQVTILD---INDNAP-MFE 1000

Query: 1327 RDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEP-AGVGA-LTYTLVGGADPEGTFALDAA 1384
            +D        L +   E    GS++  + A +P  G  A + Y +V G D    F LD  
Sbjct: 1001 KDE-------LELFVEENNPVGSVVAKIRANDPDEGPNAQIMYQIVEG-DMRHFFQLDLL 1052

Query: 1385 SGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDPLA-- 1442
            +G L     LDFE    +  +      P  + A    V + + D+N++ P      +   
Sbjct: 1053 NGDLRAMVELDFEVRREYVLVVQATSAPLVSRA---TVHILLVDQNDNPPVLPDFQILFN 1109

Query: 1443 --LALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRG 1500
              +    N  P   +    A D   P  +  + Y  + Q   +  L LD  TG L   R 
Sbjct: 1110 NYVTNKSNSFPTGVIGCIPAHD---PDVSDSLNYTFV-QGNELRLLLLDPATGELQLSRD 1165

Query: 1501 LDRETTPALLLLVEATD 1517
            LD       L+ V  +D
Sbjct: 1166 LDNNRPLEALMEVSVSD 1182



 Score =  308 bits (789), Expect = 6e-83
 Identities = 247/860 (28%), Positives = 396/860 (46%), Gaps = 78/860 (9%)

Query: 2059 QGEAERGP-RFPRASSEATIRENAPPGTPIVSPRAVHA-GGTNGPITY---SILSGNEKG 2113
            +G + RG  +FP  + +  + EN P GT I+   A +   G    ++Y    +     +G
Sbjct: 235  RGTSGRGSLKFPMPNYQVALFENEPAGTLILQLHAHYTIEGEEERVSYYMEGLFDERSRG 294

Query: 2114 TFSIQPSTGAITVRSAEGLDFEVSPRLRL-VLQAESGGAFAFTVLTLTLQDANDNAPRFL 2172
             F I  +TGA++  S    + + +  LR+  +   +    A T +T+ ++D ND++P F 
Sbjct: 295  YFRIDSATGAVSTDSVLDRETKETHVLRVKAVDYSTPPRSATTYITVLVKDTNDHSPVFE 354

Query: 2173 RPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTT 2232
            +  Y   + E+  +   +L + A D D      + Y +     A  +F ++ ++G ++T 
Sbjct: 355  QSEYRERVRENLEVGYEVLTIRASDRDSPINANLRYRVLGG--AWDVFQLNESSGVVSTR 412

Query: 2233 AILDREIWAETRLVLMATDRG-SPA-LVGSATLTVMVIDTNDNRPTIP-QPWELRVSEDA 2289
            A+LDRE  AE +L++ A D+G +P  L  +AT+ + V D NDN P    Q + ++V ED 
Sbjct: 413  AVLDREEAAEYQLLVEANDQGRNPGPLSATATVYIEVEDENDNYPQFSEQNYVVQVPEDV 472

Query: 2290 LLGSEIAQVTGNDVDSGP--VLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQL 2347
             L + + +V   D D G    + Y +        F +    G + +  PLDFE   +Y L
Sbjct: 473  GLNTAVLRVQATDRDQGQNAAIHYSILSGNVAGQFYLHSLSGILDVINPLDFEDVQKYSL 532

Query: 2348 QLLAHDGPHEGRAN----LTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDR 2403
             + A DG      N    ++V V DVNDN P F  S +Q  +LE+ P G  ++ + A D 
Sbjct: 533  SIKAQDGGRPPLINSSGVVSVQVLDVNDNEPIFVSSPFQATVLENVPLGYPVVHIQAVDA 592

Query: 2404 DSGANGHISYHLASPADGF----SVDPNNGTL-----FTIVGTVALGHDGSGAVDVV--- 2451
            DSG N  + Y L   A  F    S  P N        F I       H+ SG + V    
Sbjct: 593  DSGENARLHYRLVDTASTFLGGGSAGPKNPAPTPDFPFQI-------HNSSGWITVCAEL 645

Query: 2452 -----------LEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGST 2500
                       +EA DHG+P  ++  +V + + D ND+ P FT   Y + + ED   GS+
Sbjct: 646  DREEVEHYSFGVEAVDHGSPPMSSSTSVSITVLDVNDNDPVFTQPTYELRLNEDAAVGSS 705

Query: 2501 LLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPL 2560
            +LTL+A D D   +++ + Y +  GN    F L  +            R  G + L  PL
Sbjct: 706  VLTLQARDRD---ANSVITYQLTGGNTRNRFALSSQ------------RGGGLITLALPL 750

Query: 2561 DFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAE 2620
            D++   QY L V A+D     +S    V + V D N + PVF  + Y V+V ED PVG  
Sbjct: 751  DYKQEQQYVLAVTASDG---TRSHTAHVLINVTDANTHRPVFQSSHYTVSVSEDRPVGTS 807

Query: 2621 LLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAA 2680
            +  + A+D D G +  + + +   DP   F +D  SGT+     LD E Q  + L + A 
Sbjct: 808  IATLSANDEDTGENARITYVIQ--DPVPQFRIDPDSGTMYTMMELDYENQVAYTLTIMAQ 865

Query: 2681 DPAGAHFALAPVTIEVQ--DVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAF 2738
            D  G        T+E+   D ND+ P F  +    S+ E+ PP T +  + A D D+G  
Sbjct: 866  DN-GIPQKSDTTTLEILILDANDNAPQFLWDFYQGSIFEDAPPSTSILQVSATDRDSGPN 924

Query: 2739 GRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAADAGN---LSA 2795
            GRL Y+      G +G   F +  ++G +R +   D E+   + L   A D G+   LSA
Sbjct: 925  GRLLYTFQG---GDDGDGDFYIEPTSGVIRTQRRLDRENVAVYNLWALAVDRGSPTPLSA 981

Query: 2796 SVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSLATS 2855
            SV + V +   ++  P+F        V E    G  +  ++A D D G +  ++Y +   
Sbjct: 982  SVEIQVTILDINDNAPMFEKDELELFVEENNPVGSVVAKIRANDPDEGPNAQIMYQIVEG 1041

Query: 2856 S--PYFGINQTTGALYLRVD 2873
                +F ++   G L   V+
Sbjct: 1042 DMRHFFQLDLLNGDLRAMVE 1061



 Score =  300 bits (769), Expect = 1e-80
 Identities = 267/919 (29%), Positives = 406/919 (44%), Gaps = 60/919 (6%)

Query: 213  LDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGS 272
            LDRE +  ++L+++A D  +PPR A   + V + D NDH+P F QS Y   V E+L  G 
Sbjct: 311  LDRETKETHVLRVKAVDYSTPPRSATTYITVLVKDTNDHSPVFEQSEYRERVRENLEVGY 370

Query: 273  PVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVV 332
             VL + ASD D+ +N  + Y +          F ++  +G++     LD E+   ++L+V
Sbjct: 371  EVLTIRASDRDSPINANLRYRV---LGGAWDVFQLNESSGVVSTRAVLDREEAAEYQLLV 427

Query: 333  QARDGGAHPELGSAFVTVH--VRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISV 390
            +A D G +P   SA  TV+  V D NDN P     F   +   QV E       V R+  
Sbjct: 428  EANDQGRNPGPLSATATVYIEVEDENDNYPQ----FSEQNYVVQVPEDVGLNTAVLRVQA 483

Query: 391  SDPDDGDFAHVNVSLEGGE--GHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSG 448
            +D D G  A ++ S+  G   G F L +   ++ ++     LD E+   Y+L + A D G
Sbjct: 484  TDRDQGQNAAIHYSILSGNVAGQFYLHSLSGILDVI---NPLDFEDVQKYSLSIKAQDGG 540

Query: 449  SPPLRAEAAFV-LHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQ 507
             PPL   +  V + V DVNDN P F    ++   L  V L G  VV + A D D G N +
Sbjct: 541  RPPLINSSGVVSVQVLDVNDNEPIFVSSPFQATVLENVPL-GYPVVHIQAVDADSGENAR 599

Query: 508  VTYSLAPGAHTHW-----------------FSIDPTSGIITTAASLDYELEPQPQLIVVA 550
            + Y L   A T                   F I  +SG IT  A LD E        V A
Sbjct: 600  LHYRLVDTASTFLGGGSAGPKNPAPTPDFPFQIHNSSGWITVCAELDREEVEHYSFGVEA 659

Query: 551  TDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPF 610
             D G PP++SS +VS+ + DVNDN+P F +  Y   L E    G+  L + A D D+   
Sbjct: 660  VDHGSPPMSSSTSVSITVLDVNDNDPVFTQPTYELRLNEDAAVGSSVLTLQARDRDAN-- 717

Query: 611  GLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRD-QGPSSFDFTVTAVDGGGLKSMV 669
             +++Y L    G +    F + +  G    T  L  D +    +   VTA D G      
Sbjct: 718  SVITYQL---TGGNTRNRFALSSQRGGGLITLALPLDYKQEQQYVLAVTASD-GTRSHTA 773

Query: 670  YVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNS 729
            +V + ++D N + P F    Y  S+S   P GT++  L A+D D G + R++Y I   + 
Sbjct: 774  HVLINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATLSANDEDTGENARITYVI--QDP 831

Query: 730  PPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPI 789
             P F +D  SG +     L         L I A+D G  Q   +  ++I I+      P 
Sbjct: 832  VPQFRIDPDSGTMYTMMELDYENQVAYTLTIMAQDNGIPQKSDTTTLEILILDANDNAPQ 891

Query: 790  FEQLQYVFSVPEDVAPGTSVGIVQA----HNPPGRLAPVTLSLSGGDPRGLFSLDAVSGL 845
            F    Y  S+ ED  P TS+  V A      P GRL  +     G D  G F ++  SG+
Sbjct: 892  FLWDFYQGSIFEDAPPSTSILQVSATDRDSGPNGRL--LYTFQGGDDGDGDFYIEPTSGV 949

Query: 846  LQTLRPLDRELLGPVLELEVRAGSGVP-PAFAVARVRVLLDDVNDNSPAFPAPEDTVLLP 904
            ++T R LDRE +       +    G P P  A   ++V + D+NDN+P F   E  + + 
Sbjct: 950  IRTQRRLDRENVAVYNLWALAVDRGSPTPLSASVEIQVTILDINDNAPMFEKDELELFVE 1009

Query: 905  PNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGG-GGAFTVDPTTGHVRLMRPLGPSGGPA 963
             N   G+ +  +RA DPD G N+++ + ++ G     F +D   G +R M  L       
Sbjct: 1010 ENNPVGSVVAKIRANDPDEGPNAQIMYQIVEGDMRHFFQLDLLNGDLRAMVELDFEVRRE 1069

Query: 964  HELELEARDGGSPPRTSHFRLRVVVQDVGTR-GLAPRFNSPTYRVDLPSGTTAGTQVLQ- 1021
            + L ++A    S P  S   + +++ D      + P F             +  T V+  
Sbjct: 1070 YVLVVQAT---SAPLVSRATVHILLVDQNDNPPVLPDFQILFNNYVTNKSNSFPTGVIGC 1126

Query: 1022 VQAQAPD-GGPITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKA 1080
            + A  PD    + Y            L+P +G L +   LD       +++V    G   
Sbjct: 1127 IPAHDPDVSDSLNYTFVQGNELRLLLLDPATGELQLSRDLDNNRPLEALMEVSVSDG--- 1183

Query: 1081 ELGQQTGTATVRVSILNQN 1099
             +   T   T+RV+I+  +
Sbjct: 1184 -IHSVTAFCTLRVTIITDD 1201



 Score =  297 bits (760), Expect = 1e-79
 Identities = 245/795 (30%), Positives = 372/795 (46%), Gaps = 80/795 (10%)

Query: 2170 RFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAA--SQPARGLFHVDPTTG 2227
            +F  P+Y   L E+ P    +LQ+ A    +G   ++SY +     + +RG F +D  TG
Sbjct: 244  KFPMPNYQVALFENEPAGTLILQLHAHYTIEGEEERVSYYMEGLFDERSRGYFRIDSATG 303

Query: 2228 TITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP-WELRVS 2286
             ++T ++LDRE      L + A D  +P    +  +TV+V DTND+ P   Q  +  RV 
Sbjct: 304  AVSTDSVLDRETKETHVLRVKAVDYSTPPRSATTYITVLVKDTNDHSPVFEQSEYRERVR 363

Query: 2287 EDALLGSEIAQVTGNDVDS---GPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCD 2343
            E+  +G E+  +  +D DS     + + VL   G  D F +    G VS    LD E+  
Sbjct: 364  ENLEVGYEVLTIRASDRDSPINANLRYRVLG--GAWDVFQLNESSGVVSTRAVLDREEAA 421

Query: 2344 RYQLQLLAHD-----GPHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSV 2398
             YQL + A+D     GP    A + + VED NDN P FS+  Y V + E     +A+L V
Sbjct: 422  EYQLLVEANDQGRNPGPLSATATVYIEVEDENDNYPQFSEQNYVVQVPEDVGLNTAVLRV 481

Query: 2399 SATDRDSGANGHISYHLASP--ADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARD 2456
             ATDRD G N  I Y + S   A  F +   +G L  I     L  +      + ++A+D
Sbjct: 482  QATDRDQGQNAAIHYSILSGNVAGQFYLHSLSGILDVIN---PLDFEDVQKYSLSIKAQD 538

Query: 2457 HGAPGRA-ARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSH 2515
             G P    +   V VQ+ D ND+ P F  S ++  V E++P G  ++ ++A DAD S  +
Sbjct: 539  GGRPPLINSSGVVSVQVLDVNDNEPIFVSSPFQATVLENVPLGYPVVHIQAVDAD-SGEN 597

Query: 2516 AAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRA------------LGCLVLLEPLDFE 2563
            A + Y ++                 G SAGP   A             G + +   LD E
Sbjct: 598  ARLHYRLVD---------TASTFLGGGSAGPKNPAPTPDFPFQIHNSSGWITVCAELDRE 648

Query: 2564 SLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLH 2623
             +  Y+  V A D G PP SS   V++TVLDVNDN PVFT+ +Y + + ED  VG+ +L 
Sbjct: 649  EVEHYSFGVEAVDHGSPPMSSSTSVSITVLDVNDNDPVFTQPTYELRLNEDAAVGSSVLT 708

Query: 2624 VEASDADPGPHGLVRFTVSSGDPSGLFELDES--SGTLRLAHALDCETQARHQLVVQAAD 2681
            ++A D D   + ++ + ++ G+    F L      G + LA  LD + + ++ L V A+D
Sbjct: 709  LQARDRDA--NSVITYQLTGGNTRNRFALSSQRGGGLITLALPLDYKQEQQYVLAVTASD 766

Query: 2682 PAGAHFALAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRL 2741
               +H   A V I V D N H P F  +  + SV+E++P GT + TL A D D G   R+
Sbjct: 767  GTRSH--TAHVLINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATLSANDEDTGENARI 824

Query: 2742 RYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAADAG--NLSASVTV 2799
             Y + +  P       F ++  +G +   +  DYE+  ++ L + A D G    S + T+
Sbjct: 825  TYVIQDPVP------QFRIDPDSGTMYTMMELDYENQVAYTLTIMAQDNGIPQKSDTTTL 878

Query: 2800 SVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSSPYF 2859
             +L+   ++  P FL   +   + E A    S+  V ATD D G +G +LY+      + 
Sbjct: 879  EILILDANDNAPQFLWDFYQGSIFEDAPPSTSILQVSATDRDSGPNGRLLYT------FQ 932

Query: 2860 GINQTTGALYLRVDSRAPGSGTATSGGGGRTRREAPRE-------LRLEVIARGPLPGSR 2912
            G +   G  Y+      P SG        RT+R   RE         L V    P P S 
Sbjct: 933  GGDDGDGDFYIE-----PTSGVI------RTQRRLDRENVAVYNLWALAVDRGSPTPLSA 981

Query: 2913 SATVPVTV-DITHTA 2926
            S  + VT+ DI   A
Sbjct: 982  SVEIQVTILDINDNA 996


>gi|216548395 dachsous 2 isoform 3 [Homo sapiens]
          Length = 709

 Score =  398 bits (1022), Expect = e-110
 Identities = 257/641 (40%), Positives = 351/641 (54%), Gaps = 67/641 (10%)

Query: 25  LLLLLLLLLGAGVPGAWGQAGSLDLQIDEEQPAGTLIGDISAGLPAGTAAPLMYFISAQE 84
           LL LL+ +      G+  Q  +L L +DE  P  TL+GDI AGLPA        F  +++
Sbjct: 47  LLWLLVHVWLWAASGSSAQLFNLTLSVDEGLPPDTLVGDIRAGLPAAQQQEGSGFFLSED 106

Query: 85  G--SGVGTDLAIDEHSGVVRTARVLDREQRDRYRFTAVTPDGATVEVTVRVADINDHAPA 142
              S +  D  +   +G++RTAR LDRE+RD Y F A T  GA V+V +RV D+NDH+P 
Sbjct: 107 SDDSPLLDDFHVHPDTGIIRTARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPR 166

Query: 143 FPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGYAL------SGDGAGETFRLETR 196
           FP     L V E +  GT + L  A D DAG   TQGY L        D AG  F+L  R
Sbjct: 167 FPLDSLQLDVSELSPPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYR 226

Query: 197 -PGPDGTPVP----------ELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTL 245
            PGP  +P+           +LV+   LDRE  + + LQ+EA+DGG P R     +++ +
Sbjct: 227 TPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWDGGRPRRTGLLSVELRV 286

Query: 246 LDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGP- 304
           LD ND+ P F Q  Y A V E   PG+ V +V A+D D G NG V Y +  RQ  G G  
Sbjct: 287 LDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSG 346

Query: 305 ---------FSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDA 355
                    F+++  +G++++ RPLD E +  H+LVV+ARDGGA PE+ +  V++ V D 
Sbjct: 347 GGALGDAAYFAVEELSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDV 406

Query: 356 NDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDF----------------A 399
           NDN+P++ V+FL+  G  +VSE A PG  VAR+SVSD  DGD+                 
Sbjct: 407 NDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDA-DGDWEKEDEATGELGVGLGDG 465

Query: 400 HVNVSLEGGEGHFALSTQDSV-IYLVCVARRLDREERDAYNLRVTATDSGSPPLRAEAAF 458
            +++SLEGGEG FAL       ++ +CV   LDRE RD Y L + ATD+GSPPL  E   
Sbjct: 466 SISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETL 525

Query: 459 VLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQ------VTYSL 512
           +L V D+ND  P F +Q Y+   + E A PG+ V+ V+A D D+  +        V    
Sbjct: 526 LLRVADLNDQPPLFSQQHYKAS-VSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLS 584

Query: 513 AP---------GAHT----HWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLA 559
           AP           HT      F+ID  SG I+T  +LD E++   +L VVA D G PPL+
Sbjct: 585 APCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQDLGEPPLS 644

Query: 560 SSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQV 600
           ++  VS+ + DVNDNEP F R  YNA++ E    G CFLQ+
Sbjct: 645 ATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQL 685



 Score =  215 bits (548), Expect = 5e-55
 Identities = 197/627 (31%), Positives = 272/627 (43%), Gaps = 96/627 (15%)

Query: 1337 LTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALD-----AASGRLYLA 1391
            LT++  EGL P +L+G + A  PA             D + +  LD       +G +  A
Sbjct: 69   LTLSVDEGLPPDTLVGDIRAGLPAAQQQEGSGFFLSEDSDDSPLLDDFHVHPDTGIIRTA 128

Query: 1392 RPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDPLALALPENPEP 1451
            R LD E    +  +     G       +++V+++V D N+H+P F  D L L + E   P
Sbjct: 129  RRLDRERRDHYSFVAATLLGA------VVQVEIRVNDVNDHSPRFPLDSLQLDVSELSPP 182

Query: 1452 GAALYTFRASDADGPGPNSDVRYRLLR-----QEPPVPALRLDART-GALSAP------- 1498
            G A     A D D  G  S   Y L++     ++P  P  +L  RT G L +P       
Sbjct: 183  GTAFRLPVAHDPDA-GLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSSS 241

Query: 1499 ----------RGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFAS 1548
                      R LDRE   A  L +EA D       RR   +S  + V DENDN PVF  
Sbjct: 242  PLEPLDLVLLRRLDREEAAAHRLQIEAWD---GGRPRRTGLLSVELRVLDENDNPPVFEQ 298

Query: 1549 PS-RVRLPEDQPPGPAALHVVARDPDLGEAARVSYRL-------------ASGGDGHFRL 1594
               R  + ED  PG     V A D DLG    V Y +             A G   +F +
Sbjct: 299  DEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAV 358

Query: 1595 HSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPT----FQ 1650
               +G + V RPLDRE +A H L V A D G+ P  AT  ++++V DVND  P     F 
Sbjct: 359  EELSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFL 418

Query: 1651 QQEYSVLLRENNPPGTSLLTLRATDPDVG------ANGQVTYG-GVSSESFSLDPDTGVL 1703
             +     + E   PG  +  +  +D D        A G++  G G  S S SL+   G  
Sbjct: 419  TEGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGELGVGLGDGSISLSLEGGEGDF 478

Query: 1704 TTLRA-------------LDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPT 1750
              L               LDRE ++   L + A D GSPP  T  T+ + V D ND  P 
Sbjct: 479  ALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPL 538

Query: 1751 FGSAHLSLEVPEGQDPQTLTM-LRASDPDVGAN------------------GQLQYRILD 1791
            F   H    V E   P T+ M + ASD D   +                  G LQ +++ 
Sbjct: 539  FSQQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVH 598

Query: 1792 GDPSG-AFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDAND 1850
                G +F +D  SG   T+R LDREV+ A +L++ A+D G+P LSAT L+++TV D ND
Sbjct: 599  TAECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQDLGEPPLSATCLVSITVDDVND 658

Query: 1851 HAPAFPVPAYSVEVPEDVPAGTLLLQL 1877
            + P F    Y+  + E  P G   LQL
Sbjct: 659  NEPIFWRQVYNATIAEHAPVGHCFLQL 685



 Score =  183 bits (465), Expect = 2e-45
 Identities = 169/554 (30%), Positives = 231/554 (41%), Gaps = 97/554 (17%)

Query: 1492 TGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPS- 1550
            TG +   R LDRE       +         A+    A V   + V D ND++P F   S 
Sbjct: 122  TGIIRTARRLDRERRDHYSFV---------AATLLGAVVQVEIRVNDVNDHSPRFPLDSL 172

Query: 1551 RVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGD-------GHFRLHSSTGA--- 1600
            ++ + E  PPG A    VA DPD G  +   Y L    D         F+L   T     
Sbjct: 173  QLDVSELSPPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLP 232

Query: 1601 ---------------LSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDE 1645
                           L ++R LDRE+ A H L + A D G P R+    + + V D ND 
Sbjct: 233  SPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWDGGRPRRTGLLSVELRVLDENDN 292

Query: 1646 APTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTY-------------GGVSSE 1692
             P F+Q EY   +RE+  PG  +  +RATD D+G NG V Y             GG   +
Sbjct: 293  PPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGD 352

Query: 1693 S--FSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPT 1750
            +  F+++  +GV+   R LDRE Q    L V A+D G+ P++  V V +AV D ND+ P 
Sbjct: 353  AAYFAVEELSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPA 412

Query: 1751 FGSAHLS----LEVPEGQDP-QTLTMLRASDPDVG------ANGQLQYRILDGDPSGAFV 1799
                 L+      V EG  P   +  +  SD D        A G+L   +  GD S +  
Sbjct: 413  IHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGELGVGL--GDGSISLS 470

Query: 1800 LDLASGEFGTMR-------------PLDREVEPAFQLRIEARDGGQPALSATLLLTVTVL 1846
            L+   G+F  +              PLDRE    ++L + A D G P LS    L + V 
Sbjct: 471  LEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVA 530

Query: 1847 DANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGH-----------VTYYLG 1895
            D ND  P F    Y   V E    GT+++ + A D D   + H               LG
Sbjct: 531  DLNDQPPLFSQQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLG 590

Query: 1896 ---------AGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSV 1946
                     A    +F ++  SG + T   LDRE   +    V A D     PLS T  V
Sbjct: 591  SLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQD-LGEPPLSATCLV 649

Query: 1947 TITVRDVNDHAPTF 1960
            +ITV DVND+ P F
Sbjct: 650  SITVDDVNDNEPIF 663



 Score =  182 bits (463), Expect = 4e-45
 Identities = 171/567 (30%), Positives = 239/567 (42%), Gaps = 84/567 (14%)

Query: 213 LDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGS 272
           LDRE R HY        G      A   +++ + D+NDH+P F        VSE   PG+
Sbjct: 131 LDRERRDHYSFVAATLLG------AVVQVEIRVNDVNDHSPRFPLDSLQLDVSELSPPGT 184

Query: 273 PVLQVFASDADAGVNGAVTYEINRRQS---EGDGPF-------------------SIDAH 310
                 A D DAG+     Y + +      +  GPF                   S    
Sbjct: 185 AFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSSSPLE 244

Query: 311 TGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSAD 370
              L L R LD E+   H L ++A DGG     G   V + V D NDN P    +F   +
Sbjct: 245 PLDLVLLRRLDREEAAAHRLQIEAWDGGRPRRTGLLSVELRVLDENDNPP----VFEQDE 300

Query: 371 GSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLE-----------GGEGHFALSTQDS 419
               V E A PG  V R+  +D D G    V  S+            G  G  A    + 
Sbjct: 301 YRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEE 360

Query: 420 VIYLVCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRP 479
           +  +V V R LDRE +  + L V A D G+ P  A     + V DVNDN PA    L+  
Sbjct: 361 LSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAI-HVLFLT 419

Query: 480 EP----LPEVALPGSFVVRVTARDPD-------QGT--------NGQVTYSLAPGAHTHW 520
           E     + E A PG +V RV+  D D       + T        +G ++ SL  G     
Sbjct: 420 EGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGELGVGLGDGSISLSLEGGEGDFA 479

Query: 521 FSIDPTSGI--ITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQF 578
                  G+  +     LD E     +L++VATD G PPL++  T+ + + D+ND  P F
Sbjct: 480 LLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLF 539

Query: 579 QRTFYNASLPEGTQPGTCFLQVTATDADSG-------PFGLLSYSLGAGLGSSGS----- 626
            +  Y AS+ E   PGT  + V+A+DAD          + ++  S    LGS  S     
Sbjct: 540 SQQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHT 599

Query: 627 ----PPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGG--GLKSMVYVKVFLSDEND 680
               P F ID+ SG + T RTLDR+    + +  V A D G   L +   V + + D ND
Sbjct: 600 AECGPSFAIDSESGAISTIRTLDREV-QEAVELKVVAQDLGEPPLSATCLVSITVDDVND 658

Query: 681 NPPQFYPREYAASISAQSPPGTAVLRL 707
           N P F+ + Y A+I+  +P G   L+L
Sbjct: 659 NEPIFWRQVYNATIAEHAPVGHCFLQL 685



 Score =  173 bits (438), Expect = 3e-42
 Identities = 198/688 (28%), Positives = 276/688 (40%), Gaps = 103/688 (14%)

Query: 2106 ILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFTVLTLTLQDAN 2165
            +L G          S+GA T RS   L       + + L A SG +     LTL++ +  
Sbjct: 24   LLPGRRDTPHGRSGSSGARTQRSLLWL------LVHVWLWAASGSSAQLFNLTLSVDEGL 77

Query: 2166 DNAPRFLRPHYVAFLPESRPLEGP--LLQVEADDLDQGSGGQISYSLAASQPARGLFHVD 2223
               P  L     A LP ++  EG    L  ++DD                 P    FHV 
Sbjct: 78   P--PDTLVGDIRAGLPAAQQQEGSGFFLSEDSDD----------------SPLLDDFHVH 119

Query: 2224 PTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSAT-LTVMVIDTNDNRPTIP-QPW 2281
            P TG I T   LDRE       V       +  L+G+   + + V D ND+ P  P    
Sbjct: 120  PDTGIIRTARRLDRERRDHYSFV-------AATLLGAVVQVEIRVNDVNDHSPRFPLDSL 172

Query: 2282 ELRVSEDALLGSEIAQVTGNDVDSG--PVLWYVLS-----PSGPQDPFSVGRYGGRVSLT 2334
            +L VSE +  G+       +D D+G      Y L      P  P  PF   RY     L 
Sbjct: 173  QLDVSELSPPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLP 232

Query: 2335 GPL-------------------DFEQCDRYQLQLLAHDGPHEGRANLTVL---VEDVNDN 2372
             PL                   D E+   ++LQ+ A DG    R  L  +   V D NDN
Sbjct: 233  SPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWDGGRPRRTGLLSVELRVLDENDN 292

Query: 2373 APAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHL-------ASPADGFSVD 2425
             P F Q  Y+  + E   PG+ +  V ATDRD G NG + Y +       A    G   D
Sbjct: 293  PPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGD 352

Query: 2426 PNNGTLFTIVGTVA----LGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPS 2481
                 +  + G V     L  +      +V+EARD GA    A   V + + D ND+ P+
Sbjct: 353  AAYFAVEELSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPA 412

Query: 2482 FT---LSHYRVA-VTEDLPPGSTLLTLEATDADGS---RSHAAVDYSIISGNWGRVFQLE 2534
                 L+   VA V+E   PG  +  +  +DADG       A  +  +  G+      LE
Sbjct: 413  IHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGELGVGLGDGSISLSLE 472

Query: 2535 PRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLD 2594
                +     G GP  +  L +  PLD ES   Y L + A D G PP S+   + + V D
Sbjct: 473  GGEGDFALLPG-GPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVAD 531

Query: 2595 VNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPG--PHGLVRFTVSS-GDPSGL-- 2649
            +ND PP+F++  Y+ +V E    G  ++ V ASDAD     H  +R+TV     P  L  
Sbjct: 532  LNDQPPLFSQQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGS 591

Query: 2650 --------------FELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHF-ALAPVTI 2694
                          F +D  SG +     LD E Q   +L V A D       A   V+I
Sbjct: 592  LQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQDLGEPPLSATCLVSI 651

Query: 2695 EVQDVNDHGPAFPLNLLSTSVAENQPPG 2722
             V DVND+ P F   + + ++AE+ P G
Sbjct: 652  TVDDVNDNEPIFWRQVYNATIAEHAPVG 679



 Score =  164 bits (416), Expect = 1e-39
 Identities = 192/658 (29%), Positives = 272/658 (41%), Gaps = 133/658 (20%)

Query: 1623 DHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANG 1682
            D G PP +        V D+    P  QQQE S      +   + LL             
Sbjct: 74   DEGLPPDTL-------VGDIRAGLPAAQQQEGSGFFLSEDSDDSPLL------------- 113

Query: 1683 QVTYGGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVE 1742
                     + F + PDTG++ T R LDRE ++  +  V A   G+  Q     V + V 
Sbjct: 114  ---------DDFHVHPDTGIIRTARRLDRERRDHYSF-VAATLLGAVVQ-----VEIRVN 158

Query: 1743 DENDHAPTFGSAHLSLEVPEGQDPQTLTMLR-ASDPDVGANGQLQYRI-----LDGDPSG 1796
            D NDH+P F    L L+V E   P T   L  A DPD G      Y +     L  DP+G
Sbjct: 159  DVNDHSPRFPLDSLQLDVSELSPPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAG 218

Query: 1797 AFVL-----------DLASGEFGTMRPLD--------REVEPAFQLRIEARDGGQPALSA 1837
             F              L  G    + PLD        RE   A +L+IEA DGG+P  + 
Sbjct: 219  PFFQLRYRTPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWDGGRPRRTG 278

Query: 1838 TLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYL--- 1894
             L + + VLD ND+ P F    Y   V ED   G  + +++A D D G NG V Y +   
Sbjct: 279  LLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRAR 338

Query: 1895 ---GAGTAGA-------FLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTV 1944
               GAG+ G        F +E  SG +R    LDRE    +   V A DG A  P   TV
Sbjct: 339  QVPGAGSGGGALGDAAYFAVEELSGVVRVWRPLDREAQAWHQLVVEARDGGAE-PEVATV 397

Query: 1945 SVTITVRDVNDHAPT----FPTSPLRLRL---PRPGPSFSTPTLALA--TLRAEDRDAG- 1994
             V+I V DVND+ P     F T     R+    RPG   +  +++ A      ED   G 
Sbjct: 398  RVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGE 457

Query: 1995 -----ANASILYRLAGTP---------PPGTTVDSYTGEIRVARSPVALGPRDRV-LFIV 2039
                  + SI   L G           PPG       G       P+    RD   L +V
Sbjct: 458  LGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEG-------PLDRESRDLYELLLV 510

Query: 2040 ATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIV---SPRAVHAG 2096
            ATD G P  S    +++ +    ++ P F +   +A++ E A PGT ++   +  A  AG
Sbjct: 511  ATDAGSPPLSTEETLLLRVADLNDQPPLFSQQHYKASVSEAAAPGTVVMWVSASDADEAG 570

Query: 2097 GTNGPITYSILS-------GNEKG----------TFSIQPSTGAI-TVRSAEGLDFEVSP 2138
              +  + Y+++        G+ +           +F+I   +GAI T+R+   LD EV  
Sbjct: 571  SDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRT---LDREVQE 627

Query: 2139 RLRLVLQAESGG---AFAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQV 2193
             + L + A+  G     A  ++++T+ D NDN P F R  Y A + E  P+    LQ+
Sbjct: 628  AVELKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQL 685



 Score =  163 bits (412), Expect = 3e-39
 Identities = 167/562 (29%), Positives = 243/562 (43%), Gaps = 81/562 (14%)

Query: 2420 DGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDH----GAPGRAARATVHVQLQDQ 2475
            D F V P+ G + T             A  +  E RDH     A    A   V +++ D 
Sbjct: 114  DDFHVHPDTGIIRT-------------ARRLDRERRDHYSFVAATLLGAVVQVEIRVNDV 160

Query: 2476 NDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGN------WGR 2529
            NDH+P F L   ++ V+E  PPG+      A D D     +   Y+++  +       G 
Sbjct: 161  NDHSPRFPLDSLQLDVSELSPPGTAFRLPVAHDPDAGL-FSTQGYTLVQPSDLPKDPAGP 219

Query: 2530 VFQLEPRLAEAGESAGPGPRAL--GC--------LVLLEPLDFESLTQYNLTVAAADRGQ 2579
             FQL  R      + GP P  L  G         LVLL  LD E    + L + A D G+
Sbjct: 220  FFQLRYR------TPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWDGGR 273

Query: 2580 PPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRF 2639
            P ++ ++ V + VLD NDNPPVF +  YR  V ED   GAE+  V A+D D GP+G VR+
Sbjct: 274  PRRTGLLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRY 333

Query: 2640 TVSSGDPSG------------LFELDESSGTLRLAHALDCETQARHQLVVQAAD-PAGAH 2686
            +V +    G             F ++E SG +R+   LD E QA HQLVV+A D  A   
Sbjct: 334  SVRARQVPGAGSGGGALGDAAYFAVEELSGVVRVWRPLDREAQAWHQLVVEARDGGAEPE 393

Query: 2687 FALAPVTIEVQDVNDHGPAFPLNLLS----TSVAENQPPGTLVTTLHAIDGDAGAFGRLR 2742
             A   V+I V DVND+ PA  +  L+      V+E   PG  V  +   D D G + +  
Sbjct: 394  VATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDAD-GDWEKED 452

Query: 2743 YSLLEAGPG-PEGREAFALNSSTGE-------------LRARVPFDYEHTESFRLLVGAA 2788
             +  E G G  +G  + +L    G+             L    P D E  + + LL+ A 
Sbjct: 453  EATGELGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVAT 512

Query: 2789 DAGN--LSASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGHSLGHVQATDED--GGA 2844
            DAG+  LS   T+ + V   ++  P+F    +   V E A  G  +  V A+D D  G  
Sbjct: 513  DAGSPPLSTEETLLLRVADLNDQPPLFSQQHYKASVSEAAAPGTVVMWVSASDADEAGSD 572

Query: 2845 DGLVLYSLATSSPYFGINQTTGALYLRVDSRAPGSGTATSGGGGRTR---REAPRELRLE 2901
               + Y++   S    +      +    +     +  + SG     R   RE    + L+
Sbjct: 573  HAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVELK 632

Query: 2902 VIAR--GPLPGSRSATVPVTVD 2921
            V+A+  G  P S +  V +TVD
Sbjct: 633  VVAQDLGEPPLSATCLVSITVD 654



 Score =  152 bits (384), Expect = 5e-36
 Identities = 161/587 (27%), Positives = 230/587 (39%), Gaps = 122/587 (20%)

Query: 2017 TGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEAT 2076
            TG IR AR  +    RD   F+ AT LG     A   + + +    +  PRFP  S +  
Sbjct: 122  TGIIRTARR-LDRERRDHYSFVAATLLG-----AVVQVEIRVNDVNDHSPRFPLDSLQLD 175

Query: 2077 IRENAPPGTPIVSPRAVHAGG------------------------------TNGPITYSI 2106
            + E +PPGT    P A                                   T GP+   +
Sbjct: 176  VSELSPPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPL 235

Query: 2107 LSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFTVLT---LTLQD 2163
            L G+      ++P    +  R    LD E +   RL ++A  GG    T L    L + D
Sbjct: 236  LPGSSS---PLEPLDLVLLRR----LDREEAAAHRLQIEAWDGGRPRRTGLLSVELRVLD 288

Query: 2164 ANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQ-PARG---- 2218
             NDN P F +  Y A + E       + +V A D D G  G + YS+ A Q P  G    
Sbjct: 289  ENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGG 348

Query: 2219 ------LFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTND 2272
                   F V+  +G +     LDRE  A  +LV+ A D G+   V +  +++ V+D ND
Sbjct: 349  ALGDAAYFAVEELSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVND 408

Query: 2273 NRPTI-----PQPWELRVSEDALLGSEIAQVTGNDVDS---------------------- 2305
            NRP I      +    RVSE A  G  +A+V+ +D D                       
Sbjct: 409  NRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGELGVGLGDGSIS 468

Query: 2306 ----GPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDG---PHEG 2358
                G    + L P GP   F +        + GPLD E  D Y+L L+A D    P   
Sbjct: 469  LSLEGGEGDFALLPGGPPGVFFL-------CVEGPLDRESRDLYELLLVATDAGSPPLST 521

Query: 2359 RANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHI------- 2411
               L + V D+ND  P FSQ  Y+  + E   PG+ ++ VSA+D D   + H        
Sbjct: 522  EETLLLRVADLNDQPPLFSQQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVV 581

Query: 2412 --------------SYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDH 2457
                            H A     F++D  +G + TI     L  +   AV++ + A+D 
Sbjct: 582  QLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIR---TLDREVQEAVELKVVAQDL 638

Query: 2458 GAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTL 2504
            G P  +A   V + + D ND+ P F    Y   + E  P G   L L
Sbjct: 639  GEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQL 685



 Score =  151 bits (382), Expect = 9e-36
 Identities = 174/606 (28%), Positives = 250/606 (41%), Gaps = 101/606 (16%)

Query: 693  SISAQSPPGTAVLRLRAHDP----DQGSHGRLSYHILAGNSPPL--FTLDEQSGLLTVAW 746
            S+    PP T V  +RA  P     +GS   LS    + +SP L  F +   +G++  A 
Sbjct: 72   SVDEGLPPDTLVGDIRAGLPAAQQQEGSGFFLSED--SDDSPLLDDFHVHPDTGIIRTAR 129

Query: 747  PLARRAN------------SVVQLEIGAEDGGGLQAE---PSARVDISIV--PGT----- 784
             L R               +VVQ+EI   D           S ++D+S +  PGT     
Sbjct: 130  RLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPRFPLDSLQLDVSELSPPGTAFRLP 189

Query: 785  ----PTPPIFEQLQYVFSVPEDVAPGTSVGIVQA-HNPPGRLAPVTLSLSGGDPRGLFSL 839
                P   +F    Y    P D+    +    Q  +  PG   P+   L  G    L  L
Sbjct: 190  VAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPG---PLPSPLLPGSSSPLEPL 246

Query: 840  DAVSGLLQTLRPLDRE-LLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPE 898
            D V      LR LDRE      L++E   G G P    +  V + + D NDN P F   E
Sbjct: 247  DLV-----LLRRLDREEAAAHRLQIEAWDG-GRPRRTGLLSVELRVLDENDNPPVFEQDE 300

Query: 899  DTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLA-------GGGGA------FTVDP 945
                +  +  PG  +  +RA D D G N  V +++ A        GGGA      F V+ 
Sbjct: 301  YRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEE 360

Query: 946  TTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPR--FNSP 1003
             +G VR+ RPL       H+L +EARDGG+ P  +  R+ + V DV     A    F + 
Sbjct: 361  LSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTE 420

Query: 1004 TYRVDLPSGTTAGTQVLQVQAQAPDG----------------GPITYHLAAEGASSPFGL 1047
                 +  G   G  V +V     DG                G  +  L+ EG    F L
Sbjct: 421  GGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGELGVGLGDGSISLSLEGGEGDFAL 480

Query: 1048 EPQSG----WLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSP 1103
             P       +L V   LDRE+++LY L ++A       L  +    T+ + + + N+  P
Sbjct: 481  LPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEE---TLLLRVADLNDQPP 537

Query: 1104 RLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGR--LTYSLQQLS------------- 1148
              S+     +V+E   PGT V  V A+D D   +    L Y++ QLS             
Sbjct: 538  LFSQQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMV 597

Query: 1149 ---EDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLN 1205
               E   +F I  ++G ++T++TLDRE Q + +L V  QD G PP S T  V + V D+N
Sbjct: 598  HTAECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQDLGEPPLSATCLVSITVDDVN 657

Query: 1206 DNSPTF 1211
            DN P F
Sbjct: 658  DNEPIF 663



 Score =  149 bits (377), Expect = 3e-35
 Identities = 177/631 (28%), Positives = 262/631 (41%), Gaps = 108/631 (17%)

Query: 1861 SVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLE-----PSSGELRTAA 1915
            ++ V E +P  TL+  ++A  P A       ++L   +  + LL+     P +G +RTA 
Sbjct: 70   TLSVDEGLPPDTLVGDIRAGLPAAQQQEGSGFFLSEDSDDSPLLDDFHVHPDTGIIRTAR 129

Query: 1916 ALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRL---RLPRP 1972
             LDRE+   Y+F        AA  L   V V I V DVNDH+P FP   L+L    L  P
Sbjct: 130  RLDRERRDHYSF-------VAATLLGAVVQVEIRVNDVNDHSPRFPLDSLQLDVSELSPP 182

Query: 1973 GPSFSTP-----------TLALATLRAEDRD---AGANASILYRLAGTPP----PGTTVD 2014
            G +F  P           T     ++  D     AG    + YR  G  P    PG++  
Sbjct: 183  GTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSSSP 242

Query: 2015 SYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQ--GEAERGPRFPRAS 2072
                ++ + R           L I A D GRP R  TG++ V L+   E +  P F +  
Sbjct: 243  LEPLDLVLLRRLDREEAAAHRLQIEAWDGGRPRR--TGLLSVELRVLDENDNPPVFEQDE 300

Query: 2073 SEATIRENAPPGTPIVSPRAVHAG-GTNGPITYSILSGNEKGT------------FSIQP 2119
              A +RE+A PG  +   RA     G NG + YS+ +    G             F+++ 
Sbjct: 301  YRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEE 360

Query: 2120 STGAITVRSAEGLDFEVSPRLRLVLQAESGGA---FAFTVLTLTLQDANDNAPRFLRPHY 2176
             +G   VR    LD E     +LV++A  GGA    A   +++ + D NDN P      +
Sbjct: 361  LSGV--VRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAI----H 414

Query: 2177 VAFLPE---SRPLEGP-----LLQVEADDLD-------QGSG--------GQISYSLAAS 2213
            V FL E   +R  EG      + +V   D D       + +G        G IS SL   
Sbjct: 415  VLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGELGVGLGDGSISLSLEGG 474

Query: 2214 QPARGLFHVDPT-TGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTND 2272
            +    L    P     +     LDRE      L+L+ATD GSP L    TL + V D ND
Sbjct: 475  EGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLND 534

Query: 2273 NRPTIPQP-WELRVSEDALLGSEIAQVTGNDVDSGP-----VLWYVLSPSGPQD------ 2320
              P   Q  ++  VSE A  G+ +  V+ +D D        + + V+  S P +      
Sbjct: 535  QPPLFSQQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQS 594

Query: 2321 ----------PFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHD---GPHEGRANLTVLVE 2367
                       F++    G +S    LD E  +  +L+++A D    P      +++ V+
Sbjct: 595  KMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQDLGEPPLSATCLVSITVD 654

Query: 2368 DVNDNAPAFSQSLYQVMLLEHTPPGSAILSV 2398
            DVNDN P F + +Y   + EH P G   L +
Sbjct: 655  DVNDNEPIFWRQVYNATIAEHAPVGHCFLQL 685



 Score =  149 bits (375), Expect = 6e-35
 Identities = 170/665 (25%), Positives = 251/665 (37%), Gaps = 107/665 (16%)

Query: 447  SGSPPLRAEAAFVLHV---TDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQG 503
            SG+   R+    ++HV        +A  F+  L   E LP   L G     + A    +G
Sbjct: 39   SGARTQRSLLWLLVHVWLWAASGSSAQLFNLTLSVDEGLPPDTLVGDIRAGLPAAQQQEG 98

Query: 504  TNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSAT 563
            +   ++           F + P +GII TA  LD E       +     G +        
Sbjct: 99   SGFFLSEDSDDSPLLDDFHVHPDTGIIRTARRLDRERRDHYSFVAATLLGAV------VQ 152

Query: 564  VSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSG--------------- 608
            V + + DVND+ P+F        + E + PGT F    A D D+G               
Sbjct: 153  VEIRVNDVNDHSPRFPLDSLQLDVSELSPPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDL 212

Query: 609  ------PFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDG 662
                  PF  L Y     L S   P         D+   R LDR++  ++    + A DG
Sbjct: 213  PKDPAGPFFQLRYRTPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEA-AAHRLQIEAWDG 271

Query: 663  GGLK--SMVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRL 720
            G  +   ++ V++ + DENDNPP F   EY A++   + PG  V R+RA D D G +G +
Sbjct: 272  GRPRRTGLLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFV 331

Query: 721  SYHILAGNSP------------PLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGL 768
             Y + A   P              F ++E SG++ V  PL R A +  QL + A DGG  
Sbjct: 332  RYSVRARQVPGAGSGGGALGDAAYFAVEELSGVVRVWRPLDREAQAWHQLVVEARDGGAE 391

Query: 769  QAEPSARVDISIVPGTPTPPIFEQLQY----VFSVPEDVAPGTSVGIVQAHNPPGRL--- 821
                + RV I+++      P    L      V  V E   PG  V  V   +  G     
Sbjct: 392  PEVATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEKE 451

Query: 822  -------------APVTLSLSGGD---------PRGLFSLDAVSGLLQTLRPLDRELLGP 859
                           ++LSL GG+         P G+F L  V G      PLDRE    
Sbjct: 452  DEATGELGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFL-CVEG------PLDRESRDL 504

Query: 860  VLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRAL 919
               L V   +G PP      + + + D+ND  P F        +    APGT +  + A 
Sbjct: 505  YELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFSQQHYKASVSEAAAPGTVVMWVSAS 564

Query: 920  DPD----------------------SGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLG 957
            D D                        + S++  T  A  G +F +D  +G +  +R L 
Sbjct: 565  DADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHT--AECGPSFAIDSESGAISTIRTLD 622

Query: 958  PSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGT 1017
                 A EL++ A+D G PP ++   + + V DV      P F    Y   +      G 
Sbjct: 623  REVQEAVELKVVAQDLGEPPLSATCLVSITVDDVNDN--EPIFWRQVYNATIAEHAPVGH 680

Query: 1018 QVLQV 1022
              LQ+
Sbjct: 681  CFLQL 685



 Score =  144 bits (363), Expect = 1e-33
 Identities = 161/597 (26%), Positives = 235/597 (39%), Gaps = 90/597 (15%)

Query: 2302 DVDSGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRAN 2361
            D D  P+L          D F V    G +     LD E+ D Y        G       
Sbjct: 106  DSDDSPLL----------DDFHVHPDTGIIRTARRLDRERRDHYSFVAATLLG---AVVQ 152

Query: 2362 LTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADG 2421
            + + V DVND++P F     Q+ + E +PPG+A     A D D+G      Y L  P+D 
Sbjct: 153  VEIRVNDVNDHSPRFPLDSLQLDVSELSPPGTAFRLPVAHDPDAGLFSTQGYTLVQPSD- 211

Query: 2422 FSVDPNN----------GTL--------------FTIVGTVALGHDGSGAVDVVLEARDH 2457
               DP            G L                +V    L  + + A  + +EA D 
Sbjct: 212  LPKDPAGPFFQLRYRTPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWDG 271

Query: 2458 GAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAA 2517
            G P R    +V +++ D+ND+ P F    YR AV ED  PG+ +  + ATD D    +  
Sbjct: 272  GRPRRTGLLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLG-PNGF 330

Query: 2518 VDYSIISGNWGRVFQLEPRLAEAGESAGPGP-----RALGCLVLLEPLDFESLTQYNLTV 2572
            V YS+      R  Q+ P     G + G           G + +  PLD E+   + L V
Sbjct: 331  VRYSV------RARQV-PGAGSGGGALGDAAYFAVEELSGVVRVWRPLDREAQAWHQLVV 383

Query: 2573 AAADRGQPPQSSVVPVTVTVLDVNDNPP----VFTRASYRVTVPEDTPVGAELLHVEASD 2628
             A D G  P+ + V V++ VLDVNDN P    +F        V E    G  +  V  SD
Sbjct: 384  EARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSD 443

Query: 2629 ADPG----PHGLVRFTVSSGDPSGLFELDESSGTLRLAHA-------------LDCETQA 2671
            AD              V  GD S    L+   G   L                LD E++ 
Sbjct: 444  ADGDWEKEDEATGELGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRD 503

Query: 2672 RHQLVVQAADPAGAHFALAP-VTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHA 2730
             ++L++ A D      +    + + V D+ND  P F       SV+E   PGT+V  + A
Sbjct: 504  LYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFSQQHYKASVSEAAAPGTVVMWVSA 563

Query: 2731 IDGDAGAFGR--LRYSLLEAGPG-------------PEGREAFALNSSTGELRARVPFDY 2775
             D D        LRY++++                  E   +FA++S +G +      D 
Sbjct: 564  SDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDR 623

Query: 2776 EHTESFRLLVGAADAGN--LSASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGH 2830
            E  E+  L V A D G   LSA+  VS+ V   ++ +P+F    ++  + E A  GH
Sbjct: 624  EVQEAVELKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGH 680



 Score =  141 bits (356), Expect = 9e-33
 Identities = 170/617 (27%), Positives = 246/617 (39%), Gaps = 138/617 (22%)

Query: 798  SVPEDVAPGTSVGIVQAHNPPGRLAPVT---LSLSGGDPRGL--FSLDAVSGLLQTLRPL 852
            SV E + P T VG ++A  P  +    +   LS    D   L  F +   +G+++T R L
Sbjct: 72   SVDEGLPPDTLVGDIRAGLPAAQQQEGSGFFLSEDSDDSPLLDDFHVHPDTGIIRTARRL 131

Query: 853  DRE-----------LLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTV 901
            DRE           LLG V+++E+R                 ++DVND+SP FP     +
Sbjct: 132  DRERRDHYSFVAATLLGAVVQVEIR-----------------VNDVNDHSPRFPLDSLQL 174

Query: 902  LLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGG------------------------ 937
             +   + PGT      A DPD+G+ S   +TL+                           
Sbjct: 175  DVSELSPPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSP 234

Query: 938  ---GGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTR 994
               G +  ++P    + L+R L      AH L++EA DGG P RT    + + V D    
Sbjct: 235  LLPGSSSPLEPLD--LVLLRRLDREEAAAHRLQIEAWDGGRPRRTGLLSVELRVLDENDN 292

Query: 995  GLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGP---ITYHLAAE------------ 1039
               P F    YR  +      G +V +V+A   D GP   + Y + A             
Sbjct: 293  --PPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGAL 350

Query: 1040 GASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSI--LN 1097
            G ++ F +E  SG + V   LDREAQ  + L V A  G     G +   ATVRVSI  L+
Sbjct: 351  GDAAYFAVEELSGVVRVWRPLDREAQAWHQLVVEARDG-----GAEPEVATVRVSIAVLD 405

Query: 1098 QNEHSPRLS----EDPTFLAVAENQPPGTSVGRVFATDRDSG------PNGRLTYSLQQL 1147
             N++ P +      +     V+E   PG  V RV  +D D          G L   L   
Sbjct: 406  VNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGELGVGL--- 462

Query: 1148 SEDSKAFRIHPQTGEVTTLQ-------------TLDREQQSSYQLLVQVQDGGSPPRSTT 1194
             + S +  +    G+   L               LDRE +  Y+LL+   D GSPP ST 
Sbjct: 463  GDGSISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTE 522

Query: 1195 GTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDE--GENGTI 1252
             T+ + V DLND  P F Q    A       V +   PGT+V  + A D DE   ++  +
Sbjct: 523  ETLLLRVADLNDQPPLFSQQHYKA------SVSEAAAPGTVVMWVSASDADEAGSDHAWL 576

Query: 1253 LYTL------------------TGPGSELFSLHPHSGELLTAAPLIRAERPHYVLTLSAH 1294
             YT+                  T      F++   SG + T   L R  +    L + A 
Sbjct: 577  RYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQ 636

Query: 1295 DQGSPPRSASLQLLVQV 1311
            D G PP SA+  + + V
Sbjct: 637  DLGEPPLSATCLVSITV 653



 Score = 69.3 bits (168), Expect = 6e-11
 Identities = 58/199 (29%), Positives = 84/199 (42%), Gaps = 32/199 (16%)

Query: 107 LDREQRDRYRFTAVTPDGATVEVT------VRVADINDHAPAFPQARAALQVPEHTAFGT 160
           LDRE RD Y    V  D  +  ++      +RVAD+ND  P F Q      V E  A GT
Sbjct: 497 LDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFSQQHYKASVSEAAAPGT 556

Query: 161 RYPLEPARDADAG------------------RLGT-QGYALSGDGAGETFRLETRPGPDG 201
                 A DAD                     LG+ Q   +     G +F +++  G   
Sbjct: 557 VVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAIS 616

Query: 202 TPVPELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYH 261
           T          LDRE +    L++ A D G PP  A  L+ +T+ D+ND+ P F +  Y+
Sbjct: 617 T-------IRTLDREVQEAVELKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYN 669

Query: 262 AVVSESLAPGSPVLQVFAS 280
           A ++E    G   LQ+ ++
Sbjct: 670 ATIAEHAPVGHCFLQLISA 688



 Score = 32.3 bits (72), Expect = 8.0
 Identities = 39/154 (25%), Positives = 58/154 (37%), Gaps = 4/154 (2%)

Query: 2703 GPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNS 2762
            G +  L  L+ SV E  PP TLV  + A    A       + L E        + F ++ 
Sbjct: 61   GSSAQLFNLTLSVDEGLPPDTLVGDIRAGLPAAQQQEGSGFFLSEDSDDSPLLDDFHVHP 120

Query: 2763 STGELRARVPFDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYDPVFLAPAFHFQV 2822
             TG +R     D E  + +  +     A  L A V V + V   +++ P F   +    V
Sbjct: 121  DTGIIRTARRLDRERRDHYSFVA----ATLLGAVVQVEIRVNDVNDHSPRFPLDSLQLDV 176

Query: 2823 PEGARRGHSLGHVQATDEDGGADGLVLYSLATSS 2856
             E +  G +     A D D G      Y+L   S
Sbjct: 177  SELSPPGTAFRLPVAHDPDAGLFSTQGYTLVQPS 210


>gi|27754773 protocadherin 1 isoform 2 precursor [Homo sapiens]
          Length = 1237

 Score =  348 bits (894), Expect = 4e-95
 Identities = 264/784 (33%), Positives = 379/784 (48%), Gaps = 47/784 (5%)

Query: 16  SPRP---HLLLPLLLLLLLLLGAGVPGAWGQAGSLDLQIDEEQPAGTLIGDISA--GLP- 69
           SP P    LLLP +LL LLLL A  PG    A  +  ++ EEQP  TLIG ++A  G P 
Sbjct: 29  SPGPGGQRLLLPSMLLALLLLLAPSPG---HATRVVYKVPEEQPPNTLIGSLAADYGFPD 85

Query: 70  ------AGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDREQ---RDRYRFTAV 120
                     AP +  +  + G    T+ +ID   G+      L  +          T +
Sbjct: 86  VGHLYKLEVGAPYLR-VDGKTGDIFTTETSIDRE-GLRECQNQLPGDPCILEFEVSITDL 143

Query: 121 TPDGAT--VEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQ 178
             +G+   +E  + V DIND+ P F      L +PE+T  G+ +P+  A D DAG  G  
Sbjct: 144 VQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVA 203

Query: 179 GYAL-SGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSHYMLQLEAYDGGSPPRRA 237
            Y L +G  A E F L+     +    P+L+V G LDRE    Y L ++  DGGSPPR +
Sbjct: 204 SYELQAGPEAQELFGLQVAEDQEEKQ-PQLIVMGNLDRERWDSYDLTIKVQDGGSPPRAS 262

Query: 238 QALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRR 297
            ALL VT+LD ND+AP F +  Y A +SE+   G  V+QV A+D+D G N  + Y  ++ 
Sbjct: 263 SALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQA 322

Query: 298 QSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDAND 357
                    +D +TGL+ ++ P+D E        V A+D G +P+   A V V V+D ND
Sbjct: 323 PEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMND 382

Query: 358 NQPSMTV----IFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFA 413
           N P++ +    +    DG   +SE       VA + VSD D+G+ A V   +  G+  F 
Sbjct: 383 NAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAV-TCVVAGDVPFQ 441

Query: 414 L------STQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVND 467
           L       +     Y +     LD E+   Y + + A DSG+PPL +  +  + V DVND
Sbjct: 442 LRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVND 501

Query: 468 NAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAP-GAHTHWFSIDPT 526
           NAP F  Q       PE   PG  +  +TA D D G+N ++ YSL P  A    F+I P 
Sbjct: 502 NAPVF-TQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPE 560

Query: 527 SGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNAS 586
           +G I    SLD E     +L VVA D G P L  +ATV V + D NDN+P+F  + YN S
Sbjct: 561 TGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFS 620

Query: 587 LPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDR 646
           + E     +    VT  D D G    +  S+    G      F I   +G + ++ + DR
Sbjct: 621 VMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGD-----FVIQNGTGTILSSLSFDR 675

Query: 647 DQGPSSFDFTVTAVDGGGLKSMVYVKVFLS--DENDNPPQFYPREYAAS--ISAQSPPGT 702
           +Q  S++ F + AVDGG      YV V ++  DENDN P        +   ++ Q+  G 
Sbjct: 676 EQ-QSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGE 734

Query: 703 AVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGA 762
            V ++ A D D G +  L Y I  GN   LF +   SG +T+   + RR + + +L +  
Sbjct: 735 TVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKV 794

Query: 763 EDGG 766
            D G
Sbjct: 795 SDRG 798



 Score =  255 bits (651), Expect = 6e-67
 Identities = 274/1033 (26%), Positives = 420/1033 (40%), Gaps = 118/1033 (11%)

Query: 1543 APVFASPSRVRLPEDQPPGPAALHVVARD---PDLGEAARVSYRLASGGDGHFRLHSSTG 1599
            +P  A+    ++PE+QPP    +  +A D   PD+G      Y+L  G   + R+   TG
Sbjct: 53   SPGHATRVVYKVPEEQPPN-TLIGSLAADYGFPDVGHL----YKLEVGAP-YLRVDGKTG 106

Query: 1600 ALSVVRP-LDREQRAE--------------HVLTVVASDHGSPPRSATQVLTVSVADVND 1644
             +      +DRE   E               V       +GSP     Q+    V D+ND
Sbjct: 107  DIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQI---EVQDIND 163

Query: 1645 EAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTY----GGVSSESFSL---- 1696
              P F     ++ + EN   G+      A+D D G NG  +Y    G  + E F L    
Sbjct: 164  NTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAE 223

Query: 1697 --DPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSA 1754
              +     L  +  LDRE  +  +LT+  QD GSPP+ +   +RV V D ND+AP F   
Sbjct: 224  DQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERP 283

Query: 1755 HLSLEVPEGQD-PQTLTMLRASDPDVGANGQLQYRILDGDP--SGAFVLDLASGEFGTMR 1811
                E+ E      ++  ++A+D D GAN +++Y              LD  +G      
Sbjct: 284  SYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQG 343

Query: 1812 PLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSV--------E 1863
            P+DRE     +  + A+D G    SA   + VTV D ND+AP   +    +         
Sbjct: 344  PVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMAN 403

Query: 1864 VPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGE-------LRTAAA 1916
            + EDV   T +  +Q  D D G N  VT  +             +G        L+T   
Sbjct: 404  ISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTP 463

Query: 1917 LDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSF 1976
            LD E+   YT  + AVD     PLS+T S+ + V DVND+AP F  S   +  P      
Sbjct: 464  LDYEKVKDYTIEIVAVDSGNP-PLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPEN---- 518

Query: 1977 STPTLALATLRAEDRDAGANASILYRLAGTPPPGT--TVDSYTGEIRVARSPVALGPRDR 2034
            + P   +A + A D D+G+NA ++Y L   P      T+   TGEI+V  S         
Sbjct: 519  NKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESY 578

Query: 2035 VLFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVH 2094
             L +VA D G P+   T  ++V +    +  P+F  +    ++ EN P  +P+     + 
Sbjct: 579  ELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVID 638

Query: 2095 AG-GTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGA-- 2151
               G N  +  S+   N  G F IQ  TG  T+ S+   D E        L+A  GG   
Sbjct: 639  GDKGENAQVQLSVEQDN--GDFVIQNGTG--TILSSLSFDREQQSTYTFQLKAVDGGVPP 694

Query: 2152 -FAFTVLTLTLQDANDNAPRFLRPHYVA---FLPESRPLEGPLLQVEADDLDQGSGGQIS 2207
              A+  +T+ + D NDNAP    P   +     P++R L   + QV A+D D G   ++ 
Sbjct: 695  RSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTR-LGETVSQVAAEDFDSGVNAELI 753

Query: 2208 YSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMV 2267
            YS+A   P  GLF +   +G IT    ++R      RLV+  +DRG P   G+A + + V
Sbjct: 754  YSIAGGNPY-GLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYV 812

Query: 2268 IDTNDNRPTIPQPWELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDPFSVGRY 2327
             +T  NR  +          + LLG  +      D+   P        S  +     G  
Sbjct: 813  NETLANRTLL----------ETLLGHSLDTPLDIDIAGDP----EYERSKQRGNILFGVV 858

Query: 2328 GGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLE 2387
             G V++   +      RY  Q  A  G   G+       +D+    P+   S       +
Sbjct: 859  AGVVAVALLIALAVLVRYCRQREAKSGYQAGKKE----TKDLYAPKPSGKASKGNKSKGK 914

Query: 2388 HTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSGA 2447
             +     +  V   D ++G    + ++L S A G S   +          + L +     
Sbjct: 915  KSKSPKPVKPVEDED-EAGLQKSLKFNLMSDAPGDSPRIH----------LPLNYPPG-- 961

Query: 2448 VDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEAT 2507
                  + D G   R+      +QLQ Q   +PS +  H    V +DLPP +T +    T
Sbjct: 962  ------SPDLGRHYRSNSPLPSIQLQPQ---SPSASKKH---QVVQDLPPANTFVGTGDT 1009

Query: 2508 DADGSRSHAAVDY 2520
             + GS  ++   Y
Sbjct: 1010 TSTGSEQYSDYSY 1022



 Score =  253 bits (645), Expect = 3e-66
 Identities = 234/785 (29%), Positives = 347/785 (44%), Gaps = 84/785 (10%)

Query: 1399 GPPWRALTVRAEGPGGAG----ARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAA 1454
            GPP       + GPGG      + LL + + +     HA       +   +PE   P   
Sbjct: 19   GPPRMEHLRHSPGPGGQRLLLPSMLLALLLLLAPSPGHATR-----VVYKVPEEQPPNTL 73

Query: 1455 LYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGAL-SAPRGLDRETT------- 1506
            + +  A   D   P+    Y+L   E   P LR+D +TG + +    +DRE         
Sbjct: 74   IGSLAA---DYGFPDVGHLYKL---EVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQL 127

Query: 1507 ---PALLLL-VEATDRPANASRRRAARVSARVFVTDENDNAPVFASPS-RVRLPEDQPPG 1561
               P +L   V  TD   N S R    +  ++ V D NDN P FASP   + +PE+   G
Sbjct: 128  PGDPCILEFEVSITDLVQNGSPRL---LEGQIEVQDINDNTPNFASPVITLAIPENTNIG 184

Query: 1562 PAALHVVARDPDLGEAARVSYRLASGGDGH--FRLHSSTGA------LSVVRPLDREQRA 1613
                  +A D D G     SY L +G +    F L  +         L V+  LDRE+  
Sbjct: 185  SLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWD 244

Query: 1614 EHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRA 1673
             + LT+   D GSPPR+++ +L V+V D ND AP F++  Y   L EN+P G S++ ++A
Sbjct: 245  SYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKA 304

Query: 1674 TDPDVGANGQVTY-----GGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGS 1728
             D D GAN ++ Y       V      LD +TG++T    +DRE+   +  +V A+DRG+
Sbjct: 305  NDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGT 364

Query: 1729 PPQLTHVTVRVAVEDENDHAPTF------------GSAHLSLEVPEGQDPQTLTMLRASD 1776
             P+     V V V+D ND+APT             G A++S +V E      + +++ SD
Sbjct: 365  NPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAE---ETAVALVQVSD 421

Query: 1777 PDVGAN--------GQLQYRILDGDPSGAFVLDLASGEF-GTMRPLDREVEPAFQLRIEA 1827
             D G N        G + +++     +G+   D     F  T  PLD E    + + I A
Sbjct: 422  RDEGENAAVTCVVAGDVPFQLRQASETGS---DSKKKYFLQTTTPLDYEKVKDYTIEIVA 478

Query: 1828 RDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGAN 1887
             D G P LS+T  L V V+D ND+AP F      V  PE+   G ++ ++ A D D+G+N
Sbjct: 479  VDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSN 538

Query: 1888 GHVTYYLGAGTA--GAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVS 1945
              + Y L    A  G F + P +GE++   +LDREQ  SY   V A D  +   L  T +
Sbjct: 539  AELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPS-LQGTAT 597

Query: 1946 VTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAG 2005
            V + V D ND+ P F  S     +    P+ S     +  +   D D G NA +  +L+ 
Sbjct: 598  VLVNVLDCNDNDPKFMLSGYNFSVMENMPALS----PVGMVTVIDGDKGENAQV--QLSV 651

Query: 2006 TPPPGT-TVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAER 2064
                G   + + TG I  + S            + A D G P RSA   + + +  E + 
Sbjct: 652  EQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDN 711

Query: 2065 GPRF--PRASSEATIRENAPPGTPIVSPRAV-HAGGTNGPITYSILSGNEKGTFSIQPST 2121
             P    P  +S   +      G  +    A     G N  + YSI  GN  G F I   +
Sbjct: 712  APYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHS 771

Query: 2122 GAITV 2126
            GAIT+
Sbjct: 772  GAITL 776



 Score =  242 bits (618), Expect = 4e-63
 Identities = 245/878 (27%), Positives = 380/878 (43%), Gaps = 133/878 (15%)

Query: 2208 YSLAASQPARGLFHVDPTTGTI-TTTAILDREIWAETRLVLMA--------------TDR 2252
            Y L    P      VD  TG I TT   +DRE   E +  L                   
Sbjct: 90   YKLEVGAP---YLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQN 146

Query: 2253 GSPALVGSATLTVMVIDTNDNRPTIPQPW-ELRVSEDALLGSEIAQVTGNDVDSGP--VL 2309
            GSP L+      + V D NDN P    P   L + E+  +GS       +D D+GP  V 
Sbjct: 147  GSPRLLEGQ---IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVA 203

Query: 2310 WYVLSPSGPQDPFSVGRYGG--------RVSLTGPLDFEQCDRYQLQLLAHDG---PHEG 2358
             Y L  +GP+     G            ++ + G LD E+ D Y L +   DG   P   
Sbjct: 204  SYELQ-AGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRAS 262

Query: 2359 RANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASP 2418
             A L V V D NDNAP F +  Y+  L E++P G +++ V A D D GAN  I Y     
Sbjct: 263  SALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQA 322

Query: 2419 ADG----FSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQD 2474
             +       +D N G L T+ G V    +    +   + A+D G   ++ARA V V ++D
Sbjct: 323  PEVVRRLLRLDRNTG-LITVQGPV--DREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKD 379

Query: 2475 QNDHAPSFTLSHYRVA--------VTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGN 2526
             ND+AP+  +    +         ++ED+   + +  ++ +D D   + A     +++G+
Sbjct: 380  MNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVT--CVVAGD 437

Query: 2527 WGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVV 2586
                  +  +L +A E+ G   +    L    PLD+E +  Y + + A D G PP SS  
Sbjct: 438  ------VPFQLRQASET-GSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTN 490

Query: 2587 PVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDP 2646
             + V V+DVNDN PVFT++   V  PE+   G  +  + ASDAD G +  + +++     
Sbjct: 491  SLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPA 550

Query: 2647 S-GLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHF-ALAPVTIEVQDVNDHGP 2704
            + GLF +   +G +++  +LD E +  ++L V AAD         A V + V D ND+ P
Sbjct: 551  AKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDP 610

Query: 2705 AFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSST 2764
             F L+  + SV EN P  + V  +  IDGD G   +++ S+       +    F + + T
Sbjct: 611  KFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSV------EQDNGDFVIQNGT 664

Query: 2765 GELRARVPFDYEHTESFRLLVGAADAG--NLSASVTVSVLVTGEDEYDPVFLAPA--FHF 2820
            G + + + FD E   ++   + A D G    SA V V++ V  E++  P   AP+   H 
Sbjct: 665  GTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHK 724

Query: 2821 QVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSSPY--FGINQTTGALYLRVDSRAPG 2878
             +    R G ++  V A D D G +  ++YS+A  +PY  F I   +GA+ L  +     
Sbjct: 725  LLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEI---- 780

Query: 2879 SGTATSGGGGRTRREAPRELRLEVIARGPLPGSRSATVPVTVDIT-------HTALGLAP 2931
                        R      L ++V  RG  P   +A V + V+ T        T LG + 
Sbjct: 781  ----------ERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLANRTLLETLLGHSL 830

Query: 2932 DLNL------------------LLVGAVAASLGVVVVLALAALVLGLVRARSRKAEA--- 2970
            D  L                  +L G VA  + V +++ALA LV      R R+A++   
Sbjct: 831  DTPLDIDIAGDPEYERSKQRGNILFGVVAGVVAVALLIALAVLVR---YCRQREAKSGYQ 887

Query: 2971 ----------APGPMSQAAPLASDSLQKLGREPPSPPP 2998
                      AP P  +    AS   +  G++  SP P
Sbjct: 888  AGKKETKDLYAPKPSGK----ASKGNKSKGKKSKSPKP 921



 Score =  242 bits (617), Expect = 5e-63
 Identities = 221/772 (28%), Positives = 337/772 (43%), Gaps = 62/772 (8%)

Query: 474  RQLYR-PEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSG-IIT 531
            R +Y+ PE  P   L GS         PD G      Y L  GA   +  +D  +G I T
Sbjct: 59   RVVYKVPEEQPPNTLIGSLAADYGF--PDVGH----LYKLEVGAP--YLRVDGKTGDIFT 110

Query: 532  TAASLDYE--LEPQPQL------------IVVATDGGLPPLASSATVSVALQDVNDNEPQ 577
            T  S+D E   E Q QL            I      G P L       + +QD+NDN P 
Sbjct: 111  TETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEG---QIEVQDINDNTPN 167

Query: 578  FQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRI----DA 633
            F       ++PE T  G+ F    A+D D+GP G+ SY L AG  +      ++    + 
Sbjct: 168  FASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEE 227

Query: 634  HSGDVCTTRTLDRDQGPSSFDFTVTAVDGGG--LKSMVYVKVFLSDENDNPPQFYPREYA 691
                +     LDR++   S+D T+   DGG     S   ++V + D NDN P+F    Y 
Sbjct: 228  KQPQLIVMGNLDRERW-DSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYE 286

Query: 692  ASISAQSPPGTAVLRLRAHDPDQGSHGRLSY--HILAGNSPPLFTLDEQSGLLTVAWPLA 749
            A +S  SP G +V++++A+D DQG++  + Y  H        L  LD  +GL+TV  P+ 
Sbjct: 287  AELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVD 346

Query: 750  RRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFE--------QLQYVFSVPE 801
            R   S ++  + A+D G       A+V +++       P  E            + ++ E
Sbjct: 347  REDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISE 406

Query: 802  DVAPGTSVGIVQAHN-PPGRLAPVTLSLSGGDPRGLFSLDAVSG------LLQTLRPLDR 854
            DVA  T+V +VQ  +   G  A VT  ++G  P  L               LQT  PLD 
Sbjct: 407  DVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDY 466

Query: 855  ELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIY 914
            E +       V   SG PP  +   ++V + DVNDN+P F      V  P N  PG  I 
Sbjct: 467  EKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIA 526

Query: 915  TLRALDPDSGVNSRVTFTLLA--GGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARD 972
             + A D DSG N+ + ++L       G FT+ P TG +++   L      ++EL++ A D
Sbjct: 527  EITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAAD 586

Query: 973  GGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGP- 1031
             GSP       + V V D       P+F    Y   +     A + V  V     D G  
Sbjct: 587  RGSPSLQGTATVLVNVLDCNDND--PKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGEN 644

Query: 1032 ITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATV 1091
                L+ E  +  F ++  +G +    + DRE Q  Y  ++ AV G         G   V
Sbjct: 645  AQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVG---V 701

Query: 1092 RVSILNQNEHSPRLS--EDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSE 1149
             +++L++N+++P ++   + +   +      G +V +V A D DSG N  L YS+     
Sbjct: 702  TINVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAG-GN 760

Query: 1150 DSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAV 1201
                F+I   +G +T  + ++R     ++L+V+V D G PPR  T  VH+ V
Sbjct: 761  PYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYV 812



 Score =  227 bits (579), Expect = 1e-58
 Identities = 207/695 (29%), Positives = 300/695 (43%), Gaps = 65/695 (9%)

Query: 2132 LDFEVSPRLRLVLQAESGGAFAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLL 2191
            L+FEVS     +      G+       + +QD NDN P F  P     +PE+  + G L 
Sbjct: 134  LEFEVS-----ITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNI-GSLF 187

Query: 2192 QVE-ADDLDQGSGGQISYSLAASQPARGLFHV------DPTTGTITTTAILDREIWAETR 2244
             +  A D D G  G  SY L A   A+ LF +      +     +     LDRE W    
Sbjct: 188  PIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYD 247

Query: 2245 LVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP-WELRVSEDALLGSEIAQVTGNDV 2303
            L +   D GSP    SA L V V+DTNDN P   +P +E  +SE++ +G  + QV  ND 
Sbjct: 248  LTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDS 307

Query: 2304 DSGP----VLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHD---GPH 2356
            D G        +  +P   +    + R  G +++ GP+D E     +  +LA D    P 
Sbjct: 308  DQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPK 367

Query: 2357 EGRANLTVLVEDVNDNAPAF--------SQSLYQVMLLEHTPPGSAILSVSATDRDSGAN 2408
              RA + V V+D+NDNAP          +       + E     +A+  V  +DRD G N
Sbjct: 368  SARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGEN 427

Query: 2409 --------GHISYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAP 2460
                    G + + L   ++  S       L T   T  L ++      + + A D G P
Sbjct: 428  AAVTCVVAGDVPFQLRQASETGSDSKKKYFLQT---TTPLDYEKVKDYTIEIVAVDSGNP 484

Query: 2461 GRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDY 2520
              ++  ++ VQ+ D ND+AP FT S   VA  E+  PG  +  + A+DAD S S+A + Y
Sbjct: 485  PLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDAD-SGSNAELVY 543

Query: 2521 SIISGNWGRVFQLEPRLAEAGE-SAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQ 2579
            S           LEP  A  G  +  P     G + +   LD E    Y L V AADRG 
Sbjct: 544  S-----------LEPEPAAKGLFTISP---ETGEIQVKTSLDREQRESYELKVVAADRGS 589

Query: 2580 PPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRF 2639
            P       V V VLD NDN P F  + Y  +V E+ P  + +  V   D D G +  V+ 
Sbjct: 590  PSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQL 649

Query: 2640 TVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAAD-PAGAHFALAPVTIEVQD 2698
            +V     +G F +   +GT+  + + D E Q+ +   ++A D       A   VTI V D
Sbjct: 650  SVE--QDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLD 707

Query: 2699 VNDHGP--AFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGRE 2756
             ND+ P    P N     +      G  V+ + A D D+G    L YS+  AG  P G  
Sbjct: 708  ENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSI--AGGNPYG-- 763

Query: 2757 AFALNSSTGELRARVPFDYEHTESFRLLVGAADAG 2791
             F + S +G +      +  H    RL+V  +D G
Sbjct: 764  LFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRG 798



 Score =  216 bits (551), Expect = 2e-55
 Identities = 218/775 (28%), Positives = 331/775 (42%), Gaps = 59/775 (7%)

Query: 1748 APTFGSA-HLSLEVPEGQDPQTLTMLRASD---PDVGANGQLQ----YRILDGDPSGAFV 1799
            AP+ G A  +  +VPE Q P TL    A+D   PDVG   +L+    Y  +DG     F 
Sbjct: 51   APSPGHATRVVYKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFT 110

Query: 1800 LDLASGEFGTMRPLDREV--EPAF-QLRIEARDGGQPALSATLLLTVTVLDANDHAPAFP 1856
             + +    G +R    ++  +P   +  +   D  Q      L   + V D ND+ P F 
Sbjct: 111  TETSIDREG-LRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFA 169

Query: 1857 VPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLL--------EPSS 1908
             P  ++ +PE+   G+L     A D DAG NG  +Y L AG     L         E   
Sbjct: 170  SPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQ 229

Query: 1909 GELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLR 1968
             +L     LDRE+  SY  ++   DG +  P +++  + +TV D ND+AP F        
Sbjct: 230  PQLIVMGNLDRERWDSYDLTIKVQDGGSP-PRASSALLRVTVLDTNDNAPKFERPSYEAE 288

Query: 1969 LPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTTV---DSYTGEIRVARS 2025
            L    P   +    +  ++A D D GANA I Y     P     +   D  TG I V + 
Sbjct: 289  LSENSPIGHS----VIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITV-QG 343

Query: 2026 PVALGPRDRVLF-IVATDLGRPARSATGVIIVGLQGEAERGPRFP--------RASSEAT 2076
            PV       + F ++A D G   +SA   ++V ++   +  P                A 
Sbjct: 344  PVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMAN 403

Query: 2077 IRENAPPGTPIVSPRAVHAG-GTNGPITYSILSGNEKGTFSIQPSTGAIT-----VRSAE 2130
            I E+    T +   +      G N  +T  +++G+          TG+ +     +++  
Sbjct: 404  ISEDVAEETAVALVQVSDRDEGENAAVT-CVVAGDVPFQLRQASETGSDSKKKYFLQTTT 462

Query: 2131 GLDFE-VSPRLRLVLQAESGGAFAFTVLTLTLQ--DANDNAPRFLRPHYVAFLPESRPLE 2187
             LD+E V      ++  +SG     +  +L +Q  D NDNAP F +       PE+    
Sbjct: 463  PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPG 522

Query: 2188 GPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVL 2247
              + ++ A D D GS  ++ YSL     A+GLF + P TG I     LDRE      L +
Sbjct: 523  EVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKV 582

Query: 2248 MATDRGSPALVGSATLTVMVIDTNDNRPT-IPQPWELRVSEDALLGSEIAQVTGNDVDSG 2306
            +A DRGSP+L G+AT+ V V+D NDN P  +   +   V E+    S +  VT  D D G
Sbjct: 583  VAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKG 642

Query: 2307 PVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDG---PHEGRANLT 2363
                  LS       F +    G +  +   D EQ   Y  QL A DG   P      +T
Sbjct: 643  ENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVT 702

Query: 2364 VLVEDVNDNAPAFS--QSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLA--SPA 2419
            + V D NDNAP  +   +    +L   T  G  +  V+A D DSG N  + Y +A  +P 
Sbjct: 703  INVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPY 762

Query: 2420 DGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQD 2474
              F +  ++G + T+   +   H G     +V++  D G P R   A VH+ + +
Sbjct: 763  GLFQIGSHSGAI-TLEKEIERRHHGLHR--LVVKVSDRGKPPRYGTALVHLYVNE 814



 Score =  207 bits (528), Expect = 1e-52
 Identities = 161/545 (29%), Positives = 239/545 (43%), Gaps = 26/545 (4%)

Query: 46  SLDLQIDEEQPAGTLIGDISAGLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTAR 105
           S + ++ E  P G  +  + A      A   + +   Q    V   L +D ++G++    
Sbjct: 284 SYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQG 343

Query: 106 VLDREQRDRYRFTAVT------PDGATVEVTVRVADINDHAPAFPQARAAL--------Q 151
            +DRE     RF+ +       P  A  +V V V D+ND+AP        L         
Sbjct: 344 PVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMAN 403

Query: 152 VPEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTG 211
           + E  A  T   L    D D G        ++GD   +  R  +  G D      L  T 
Sbjct: 404 ISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQ-LRQASETGSDSKKKYFLQTTT 462

Query: 212 ELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPG 271
            LD E    Y +++ A D G+PP  +   L V ++D+ND+AP F QS       E+  PG
Sbjct: 463 PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPG 522

Query: 272 SPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELV 331
             + ++ ASDAD+G N  + Y +    +   G F+I   TG +Q++  LD EQR  +EL 
Sbjct: 523 EVIAEITASDADSGSNAELVYSLEPEPA-AKGLFTISPETGEIQVKTSLDREQRESYELK 581

Query: 332 VQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVS 391
           V A D G+    G+A V V+V D NDN P     F+ +  +  V E  P    V  ++V 
Sbjct: 582 VVAADRGSPSLQGTATVLVNVLDCNDNDPK----FMLSGYNFSVMENMPALSPVGMVTVI 637

Query: 392 DPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPP 451
           D D G+ A V +S+E   G F +      I     +   DRE++  Y  ++ A D G PP
Sbjct: 638 DGDKGENAQVQLSVEQDNGDFVIQNGTGTILS---SLSFDREQQSTYTFQLKAVDGGVPP 694

Query: 452 LRAEAAFVLHVTDVNDNAPAFDRQLYRPEPL--PEVALPGSFVVRVTARDPDQGTNGQVT 509
             A     ++V D NDNAP           L  P+  L G  V +V A D D G N ++ 
Sbjct: 695 RSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRL-GETVSQVAAEDFDSGVNAELI 753

Query: 510 YSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQ 569
           YS+A G     F I   SG IT    ++       +L+V  +D G PP   +A V + + 
Sbjct: 754 YSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVN 813

Query: 570 DVNDN 574
           +   N
Sbjct: 814 ETLAN 818



 Score =  197 bits (500), Expect = 2e-49
 Identities = 191/685 (27%), Positives = 286/685 (41%), Gaps = 57/685 (8%)

Query: 985  RVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGP---ITYHL-AAEG 1040
            ++ VQD+      P F SP   + +P  T  G+      A   D GP    +Y L A   
Sbjct: 155  QIEVQDINDN--TPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPE 212

Query: 1041 ASSPFGL------EPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVS 1094
            A   FGL      E +   L V   LDRE  + Y L +    G       +  +A +RV+
Sbjct: 213  AQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPP---RASSALLRVT 269

Query: 1095 ILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSED-SKA 1153
            +L+ N+++P+         ++EN P G SV +V A D D G N  + Y+  Q  E   + 
Sbjct: 270  VLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRL 329

Query: 1154 FRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQ 1213
             R+   TG +T    +DRE  S+ +  V  +D G+ P+S    V V V D+NDN+PT   
Sbjct: 330  LRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTI-- 387

Query: 1214 ASGAAGGGLPIQ------VPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGP-------G 1260
                 G GL         + + V   T V  +Q  D DEGEN  +   + G         
Sbjct: 388  --EIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQA 445

Query: 1261 SELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEP 1320
            SE  S       L T  PL   +   Y + + A D G+PP S++  L VQV+        
Sbjct: 446  SETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVV-------- 497

Query: 1321 PPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEP-AGVGA-LTYTLVGGADPEGT 1378
              D+ +  P     V   V   E  +PG ++  + A +  +G  A L Y+L      +G 
Sbjct: 498  --DVNDNAPVFTQSVT-EVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGL 554

Query: 1379 FALDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFAR 1438
            F +   +G + +   LD E    +    V A+    +      V V V D N++ P F  
Sbjct: 555  FTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFML 614

Query: 1439 DPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAP 1498
                 ++ EN    + +      D D  G N+ V+   L  E       +   TG + + 
Sbjct: 615  SGYNFSVMENMPALSPVGMVTVIDGD-KGENAQVQ---LSVEQDNGDFVIQNGTGTILSS 670

Query: 1499 RGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRVR---LP 1555
               DRE        ++A D        R+A V   + V DENDNAP   +PS      L 
Sbjct: 671  LSFDREQQSTYTFQLKAVD---GGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLT 727

Query: 1556 EDQPPGPAALHVVARDPDLGEAARVSYRLASGGD-GHFRLHSSTGALSVVRPLDREQRAE 1614
                 G     V A D D G  A + Y +A G   G F++ S +GA+++ + ++R     
Sbjct: 728  PQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGL 787

Query: 1615 HVLTVVASDHGSPPRSATQVLTVSV 1639
            H L V  SD G PPR  T ++ + V
Sbjct: 788  HRLVVKVSDRGKPPRYGTALVHLYV 812



 Score =  189 bits (479), Expect = 5e-47
 Identities = 199/774 (25%), Positives = 334/774 (43%), Gaps = 88/774 (11%)

Query: 796  VFSVPEDVAPGTSVGIVQAHNPPGRLAPVTLSLSGGDPRGLFSLDAVSG-LLQTLRPLDR 854
            V+ VPE+  P T +G + A      +  +   L  G P     +D  +G +  T   +DR
Sbjct: 61   VYKVPEEQPPNTLIGSLAADYGFPDVGHL-YKLEVGAP--YLRVDGKTGDIFTTETSIDR 117

Query: 855  ELLGP----------VLELEVRAGSGVP---PAFAVARVRVLLDDVNDNSPAFPAPEDTV 901
            E L            +LE EV     V    P     ++ V   D+NDN+P F +P  T+
Sbjct: 118  EGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEV--QDINDNTPNFASPVITL 175

Query: 902  LLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGG--------AFTVDPTTGHVRLM 953
             +P NT  G+      A D D+G N   ++ L AG           A   +     + +M
Sbjct: 176  AIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVM 235

Query: 954  RPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGT 1013
              L      +++L ++ +DGGSPPR S   LRV V D  T   AP+F  P+Y  +L   +
Sbjct: 236  GNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLD--TNDNAPKFERPSYEAELSENS 293

Query: 1014 TAGTQVLQVQAQAPDGG-----PITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELY 1068
              G  V+QV+A   D G       T+H A E       L+  +G + V+  +DRE  +L 
Sbjct: 294  PIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDRE--DLS 351

Query: 1069 ILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRL--------SEDPTFLAVAENQPP 1120
             L+   ++  +     ++  A V V++ + N+++P +        +       ++E+   
Sbjct: 352  TLRFSVLAKDRG-TNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAE 410

Query: 1121 GTSVGRVFATDRDSGPNGRLT--------YSLQQLSE---DSKAFRIHPQTGEVTTLQTL 1169
             T+V  V  +DRD G N  +T        + L+Q SE   DSK      +   + T   L
Sbjct: 411  ETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSK------KKYFLQTTTPL 464

Query: 1170 DREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDR 1229
            D E+   Y + +   D G+PP S+T ++ V V+D+NDN+P F Q+         +  P+ 
Sbjct: 465  DYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSV------TEVAFPEN 518

Query: 1230 VPPGTLVTTLQAKDPDEGENGTILYTL-TGPGSE-LFSLHPHSGELLTAAPLIRAERPHY 1287
              PG ++  + A D D G N  ++Y+L   P ++ LF++ P +GE+     L R +R  Y
Sbjct: 519  NKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESY 578

Query: 1288 VLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRP 1347
             L + A D+GSP    +  +LV VL          D  + DP   +      +  E +  
Sbjct: 579  ELKVVAADRGSPSLQGTATVLVNVL----------DCNDNDPKFMLS-GYNFSVMENMPA 627

Query: 1348 GSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALTV 1407
             S +G V   +    G      +      G F +   +G +  +   D E    +     
Sbjct: 628  LSPVGMVTVID-GDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLK 686

Query: 1408 RAEGPGGAGARLLRVQVQVQDENEHAP---AFARDPLALALPENPEPGAALYTFRASDAD 1464
              +G     +  + V + V DEN++AP   A +     L  P+    G  +    A D D
Sbjct: 687  AVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQT-RLGETVSQVAAEDFD 745

Query: 1465 GPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDR 1518
              G N+++ Y +     P    ++ + +GA++  + ++R       L+V+ +DR
Sbjct: 746  S-GVNAELIYSIAGGN-PYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDR 797



 Score =  187 bits (476), Expect = 1e-46
 Identities = 175/649 (26%), Positives = 283/649 (43%), Gaps = 74/649 (11%)

Query: 788  PIFEQLQYVFSVPEDVAPGTSVGIVQAHNP---PGRLAPVTLSLSGGDPRGLFSLDAVSG 844
            P F       ++PE+   G+   I  A +    P  +A   L  +G + + LF L     
Sbjct: 166  PNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQ-AGPEAQELFGLQVAED 224

Query: 845  L------LQTLRPLDRELLGPV-LELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAP 897
                   L  +  LDRE      L ++V+ G G PP  + A +RV + D NDN+P F  P
Sbjct: 225  QEEKQPQLIVMGNLDRERWDSYDLTIKVQDG-GSPPRASSALLRVTVLDTNDNAPKFERP 283

Query: 898  EDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGA---FTVDPTTGHVRLMR 954
                 L  N+  G  +  ++A D D G N+ + +T             +D  TG + +  
Sbjct: 284  SYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQG 343

Query: 955  PLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRV------- 1007
            P+           + A+D G+ P+++  ++ V V+D+         N+PT  +       
Sbjct: 344  PVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMND-------NAPTIEIRGIGLVT 396

Query: 1008 ------DLPSGTTAGTQVLQVQAQAPDGGPITYHLAAEGASSPFGLEPQSG--------- 1052
                  ++       T V  VQ    D G             PF L   S          
Sbjct: 397  HQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKY 456

Query: 1053 WLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFL 1112
            +L     LD E  + Y ++++AV      L   + T +++V +++ N+++P  ++  T +
Sbjct: 457  FLQTTTPLDYEKVKDYTIEIVAVDSGNPPL---SSTNSLKVQVVDVNDNAPVFTQSVTEV 513

Query: 1113 AVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDRE 1172
            A  EN  PG  +  + A+D DSG N  L YSL+        F I P+TGE+    +LDRE
Sbjct: 514  AFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDRE 573

Query: 1173 QQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPP 1232
            Q+ SY+L V   D GSP    T TV V VLD NDN P F+ +      G    V + +P 
Sbjct: 574  QRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLS------GYNFSVMENMPA 627

Query: 1233 GTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHSGELLTAAPLIRAERPHYVLTLS 1292
             + V  +   D D+GEN  +  ++     + F +   +G +L++    R ++  Y   L 
Sbjct: 628  LSPVGMVTVIDGDKGENAQVQLSVEQDNGD-FVIQNGTGTILSSLSFDREQQSTYTFQLK 686

Query: 1293 AHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLG 1352
            A D G PPRSA + + + VL             + +  AP     + T+ + L P + LG
Sbjct: 687  AVDGGVPPRSAYVGVTINVL-------------DENDNAPYITAPSNTSHKLLTPQTRLG 733

Query: 1353 ----SVAAPE-PAGVGA-LTYTLVGGADPEGTFALDAASGRLYLARPLD 1395
                 VAA +  +GV A L Y++ GG +P G F + + SG + L + ++
Sbjct: 734  ETVSQVAAEDFDSGVNAELIYSIAGG-NPYGLFQIGSHSGAITLEKEIE 781



 Score =  144 bits (364), Expect = 1e-33
 Identities = 147/573 (25%), Positives = 249/573 (43%), Gaps = 75/573 (13%)

Query: 2387 EHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSG 2446
            E  PP + I S++A D      GH+ Y L   A    VD   G +FT   ++    D  G
Sbjct: 66   EEQPPNTLIGSLAA-DYGFPDVGHL-YKLEVGAPYLRVDGKTGDIFTTETSI----DREG 119

Query: 2447 A-------------VDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTE 2493
                          ++  +   D    G        +++QD ND+ P+F      +A+ E
Sbjct: 120  LRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPE 179

Query: 2494 DLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGR-VFQLEPRLAEAGESAGPGPRALG 2552
            +   GS      A+D D   +  A  Y + +G   + +F L+  +AE  E   P      
Sbjct: 180  NTNIGSLFPIPLASDRDAGPNGVA-SYELQAGPEAQELFGLQ--VAEDQEEKQPQ----- 231

Query: 2553 CLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVP 2612
             L+++  LD E    Y+LT+   D G PP++S   + VTVLD NDN P F R SY   + 
Sbjct: 232  -LIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELS 290

Query: 2613 EDTPVGAELLHVEASDADPGPHGLVRFTVSSGDP--SGLFELDESSGTLRLAHALDCETQ 2670
            E++P+G  ++ V+A+D+D G +  + +T          L  LD ++G + +   +D E  
Sbjct: 291  ENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDL 350

Query: 2671 ARHQLVVQAAD-PAGAHFALAPVTIEVQDVNDHGPAFPLNLLS--------TSVAENQPP 2721
            +  +  V A D       A A V + V+D+ND+ P   +  +          +++E+   
Sbjct: 351  STLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAE 410

Query: 2722 GTLVTTLHAIDGDAG--------AFGRLRYSLLEAG-PGPEGREAFALNSSTGELRARVP 2772
             T V  +   D D G          G + + L +A   G + ++ + L ++T       P
Sbjct: 411  ETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT-------P 463

Query: 2773 FDYEHTESFRLLVGAADAGN--LSASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGH 2830
             DYE  + + + + A D+GN  LS++ ++ V V   ++  PVF         PE  + G 
Sbjct: 464  LDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGE 523

Query: 2831 SLGHVQATDEDGGADGLVLYSL---ATSSPYFGINQTTGALYLRVDSRAPGSGTATSGGG 2887
             +  + A+D D G++  ++YSL     +   F I+  TG + ++                
Sbjct: 524  VIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSL------------- 570

Query: 2888 GRTRREAPRELRLEVIARGPLPGSRSATVPVTV 2920
             R +RE+  EL++    RG      +ATV V V
Sbjct: 571  DREQRES-YELKVVAADRGSPSLQGTATVLVNV 602



 Score =  117 bits (292), Expect = 2e-25
 Identities = 99/345 (28%), Positives = 153/345 (44%), Gaps = 25/345 (7%)

Query: 48  DLQIDEEQPAGTLIGDISAG-LPAGTAAPLMYFISAQEGS-GVGTDLAIDEHSGVVRTAR 105
           ++   E    G +I +I+A    +G+ A L+Y +  +  + G+ T   I   +G ++   
Sbjct: 512 EVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFT---ISPETGEIQVKT 568

Query: 106 VLDREQRDRYRFTAVTPDGA------TVEVTVRVADINDHAPAFPQARAALQVPEHTAFG 159
            LDREQR+ Y    V  D        T  V V V D ND+ P F  +     V E+    
Sbjct: 569 SLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPAL 628

Query: 160 TRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRS 219
           +   +    D D G       ++  D      +  T     GT +  L      DRE +S
Sbjct: 629 SPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGT-----GTILSSL----SFDREQQS 679

Query: 220 HYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFN--QSRYHAVVSESLAPGSPVLQV 277
            Y  QL+A DGG PPR A   + + +LD ND+AP      +  H +++     G  V QV
Sbjct: 680 TYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQV 739

Query: 278 FASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDG 337
            A D D+GVN  + Y I        G F I +H+G + LE+ ++     +H LVV+  D 
Sbjct: 740 AAEDFDSGVNAELIYSI--AGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDR 797

Query: 338 GAHPELGSAFVTVHVRDANDNQPSM-TVIFLSADGSPQVSEAAPP 381
           G  P  G+A V ++V +   N+  + T++  S D    +  A  P
Sbjct: 798 GKPPRYGTALVHLYVNETLANRTLLETLLGHSLDTPLDIDIAGDP 842



 Score = 33.1 bits (74), Expect = 4.7
 Identities = 52/216 (24%), Positives = 78/216 (36%), Gaps = 19/216 (8%)

Query: 2715 VAENQPPGTLVTTLHAIDG--DAGAFGRLRYSLLEAGPGPEGREAFALNSSTG-----EL 2767
            V E QPP TL+ +L A  G  D G   +L           +  + F   +S       E 
Sbjct: 64   VPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLREC 123

Query: 2768 RARVPFD---YEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYDPVFLAPAFHFQVPE 2824
            + ++P D    E   S   LV       L   + V  +    ++  P F +P     +PE
Sbjct: 124  QNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDI----NDNTPNFASPVITLAIPE 179

Query: 2825 GARRGHSLGHVQATDEDGGADGLVLYSLATSSPYFGINQTTGALYLRVDSRAPGSGTATS 2884
                G       A+D D G +G+  Y L          Q    L +  D           
Sbjct: 180  NTNIGSLFPIPLASDRDAGPNGVASYELQAGPE----AQELFGLQVAEDQEEKQPQLIVM 235

Query: 2885 GGGGRTRREAPRELRLEVIARGPLPGSRSATVPVTV 2920
            G   R R ++  +L ++V   G  P + SA + VTV
Sbjct: 236  GNLDRERWDS-YDLTIKVQDGGSPPRASSALLRVTV 270


>gi|27754771 protocadherin 1 isoform 1 precursor [Homo sapiens]
          Length = 1060

 Score =  348 bits (894), Expect = 4e-95
 Identities = 264/784 (33%), Positives = 379/784 (48%), Gaps = 47/784 (5%)

Query: 16  SPRP---HLLLPLLLLLLLLLGAGVPGAWGQAGSLDLQIDEEQPAGTLIGDISA--GLP- 69
           SP P    LLLP +LL LLLL A  PG    A  +  ++ EEQP  TLIG ++A  G P 
Sbjct: 29  SPGPGGQRLLLPSMLLALLLLLAPSPG---HATRVVYKVPEEQPPNTLIGSLAADYGFPD 85

Query: 70  ------AGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDREQ---RDRYRFTAV 120
                     AP +  +  + G    T+ +ID   G+      L  +          T +
Sbjct: 86  VGHLYKLEVGAPYLR-VDGKTGDIFTTETSIDRE-GLRECQNQLPGDPCILEFEVSITDL 143

Query: 121 TPDGAT--VEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQ 178
             +G+   +E  + V DIND+ P F      L +PE+T  G+ +P+  A D DAG  G  
Sbjct: 144 VQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVA 203

Query: 179 GYAL-SGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSHYMLQLEAYDGGSPPRRA 237
            Y L +G  A E F L+     +    P+L+V G LDRE    Y L ++  DGGSPPR +
Sbjct: 204 SYELQAGPEAQELFGLQVAEDQEEKQ-PQLIVMGNLDRERWDSYDLTIKVQDGGSPPRAS 262

Query: 238 QALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRR 297
            ALL VT+LD ND+AP F +  Y A +SE+   G  V+QV A+D+D G N  + Y  ++ 
Sbjct: 263 SALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQA 322

Query: 298 QSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDAND 357
                    +D +TGL+ ++ P+D E        V A+D G +P+   A V V V+D ND
Sbjct: 323 PEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMND 382

Query: 358 NQPSMTV----IFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFA 413
           N P++ +    +    DG   +SE       VA + VSD D+G+ A V   +  G+  F 
Sbjct: 383 NAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAV-TCVVAGDVPFQ 441

Query: 414 L------STQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVND 467
           L       +     Y +     LD E+   Y + + A DSG+PPL +  +  + V DVND
Sbjct: 442 LRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVND 501

Query: 468 NAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAP-GAHTHWFSIDPT 526
           NAP F  Q       PE   PG  +  +TA D D G+N ++ YSL P  A    F+I P 
Sbjct: 502 NAPVF-TQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPE 560

Query: 527 SGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNAS 586
           +G I    SLD E     +L VVA D G P L  +ATV V + D NDN+P+F  + YN S
Sbjct: 561 TGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFS 620

Query: 587 LPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDR 646
           + E     +    VT  D D G    +  S+    G      F I   +G + ++ + DR
Sbjct: 621 VMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGD-----FVIQNGTGTILSSLSFDR 675

Query: 647 DQGPSSFDFTVTAVDGGGLKSMVYVKVFLS--DENDNPPQFYPREYAAS--ISAQSPPGT 702
           +Q  S++ F + AVDGG      YV V ++  DENDN P        +   ++ Q+  G 
Sbjct: 676 EQ-QSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGE 734

Query: 703 AVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGA 762
            V ++ A D D G +  L Y I  GN   LF +   SG +T+   + RR + + +L +  
Sbjct: 735 TVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKV 794

Query: 763 EDGG 766
            D G
Sbjct: 795 SDRG 798



 Score =  255 bits (651), Expect = 6e-67
 Identities = 274/1033 (26%), Positives = 420/1033 (40%), Gaps = 118/1033 (11%)

Query: 1543 APVFASPSRVRLPEDQPPGPAALHVVARD---PDLGEAARVSYRLASGGDGHFRLHSSTG 1599
            +P  A+    ++PE+QPP    +  +A D   PD+G      Y+L  G   + R+   TG
Sbjct: 53   SPGHATRVVYKVPEEQPPN-TLIGSLAADYGFPDVGHL----YKLEVGAP-YLRVDGKTG 106

Query: 1600 ALSVVRP-LDREQRAE--------------HVLTVVASDHGSPPRSATQVLTVSVADVND 1644
             +      +DRE   E               V       +GSP     Q+    V D+ND
Sbjct: 107  DIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQI---EVQDIND 163

Query: 1645 EAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTY----GGVSSESFSL---- 1696
              P F     ++ + EN   G+      A+D D G NG  +Y    G  + E F L    
Sbjct: 164  NTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAE 223

Query: 1697 --DPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSA 1754
              +     L  +  LDRE  +  +LT+  QD GSPP+ +   +RV V D ND+AP F   
Sbjct: 224  DQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERP 283

Query: 1755 HLSLEVPEGQD-PQTLTMLRASDPDVGANGQLQYRILDGDP--SGAFVLDLASGEFGTMR 1811
                E+ E      ++  ++A+D D GAN +++Y              LD  +G      
Sbjct: 284  SYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQG 343

Query: 1812 PLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSV--------E 1863
            P+DRE     +  + A+D G    SA   + VTV D ND+AP   +    +         
Sbjct: 344  PVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMAN 403

Query: 1864 VPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGE-------LRTAAA 1916
            + EDV   T +  +Q  D D G N  VT  +             +G        L+T   
Sbjct: 404  ISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTP 463

Query: 1917 LDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSF 1976
            LD E+   YT  + AVD     PLS+T S+ + V DVND+AP F  S   +  P      
Sbjct: 464  LDYEKVKDYTIEIVAVDSGNP-PLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPEN---- 518

Query: 1977 STPTLALATLRAEDRDAGANASILYRLAGTPPPGT--TVDSYTGEIRVARSPVALGPRDR 2034
            + P   +A + A D D+G+NA ++Y L   P      T+   TGEI+V  S         
Sbjct: 519  NKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESY 578

Query: 2035 VLFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVH 2094
             L +VA D G P+   T  ++V +    +  P+F  +    ++ EN P  +P+     + 
Sbjct: 579  ELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVID 638

Query: 2095 AG-GTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGA-- 2151
               G N  +  S+   N  G F IQ  TG  T+ S+   D E        L+A  GG   
Sbjct: 639  GDKGENAQVQLSVEQDN--GDFVIQNGTG--TILSSLSFDREQQSTYTFQLKAVDGGVPP 694

Query: 2152 -FAFTVLTLTLQDANDNAPRFLRPHYVA---FLPESRPLEGPLLQVEADDLDQGSGGQIS 2207
              A+  +T+ + D NDNAP    P   +     P++R L   + QV A+D D G   ++ 
Sbjct: 695  RSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTR-LGETVSQVAAEDFDSGVNAELI 753

Query: 2208 YSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMV 2267
            YS+A   P  GLF +   +G IT    ++R      RLV+  +DRG P   G+A + + V
Sbjct: 754  YSIAGGNPY-GLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYV 812

Query: 2268 IDTNDNRPTIPQPWELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDPFSVGRY 2327
             +T  NR  +          + LLG  +      D+   P        S  +     G  
Sbjct: 813  NETLANRTLL----------ETLLGHSLDTPLDIDIAGDP----EYERSKQRGNILFGVV 858

Query: 2328 GGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLE 2387
             G V++   +      RY  Q  A  G   G+       +D+    P+   S       +
Sbjct: 859  AGVVAVALLIALAVLVRYCRQREAKSGYQAGKKE----TKDLYAPKPSGKASKGNKSKGK 914

Query: 2388 HTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSGA 2447
             +     +  V   D ++G    + ++L S A G S   +          + L +     
Sbjct: 915  KSKSPKPVKPVEDED-EAGLQKSLKFNLMSDAPGDSPRIH----------LPLNYPPG-- 961

Query: 2448 VDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEAT 2507
                  + D G   R+      +QLQ Q   +PS +  H    V +DLPP +T +    T
Sbjct: 962  ------SPDLGRHYRSNSPLPSIQLQPQ---SPSASKKH---QVVQDLPPANTFVGTGDT 1009

Query: 2508 DADGSRSHAAVDY 2520
             + GS  ++   Y
Sbjct: 1010 TSTGSEQYSDYSY 1022



 Score =  253 bits (645), Expect = 3e-66
 Identities = 234/785 (29%), Positives = 347/785 (44%), Gaps = 84/785 (10%)

Query: 1399 GPPWRALTVRAEGPGGAG----ARLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAA 1454
            GPP       + GPGG      + LL + + +     HA       +   +PE   P   
Sbjct: 19   GPPRMEHLRHSPGPGGQRLLLPSMLLALLLLLAPSPGHATR-----VVYKVPEEQPPNTL 73

Query: 1455 LYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGAL-SAPRGLDRETT------- 1506
            + +  A   D   P+    Y+L   E   P LR+D +TG + +    +DRE         
Sbjct: 74   IGSLAA---DYGFPDVGHLYKL---EVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQL 127

Query: 1507 ---PALLLL-VEATDRPANASRRRAARVSARVFVTDENDNAPVFASPS-RVRLPEDQPPG 1561
               P +L   V  TD   N S R    +  ++ V D NDN P FASP   + +PE+   G
Sbjct: 128  PGDPCILEFEVSITDLVQNGSPRL---LEGQIEVQDINDNTPNFASPVITLAIPENTNIG 184

Query: 1562 PAALHVVARDPDLGEAARVSYRLASGGDGH--FRLHSSTGA------LSVVRPLDREQRA 1613
                  +A D D G     SY L +G +    F L  +         L V+  LDRE+  
Sbjct: 185  SLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWD 244

Query: 1614 EHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRA 1673
             + LT+   D GSPPR+++ +L V+V D ND AP F++  Y   L EN+P G S++ ++A
Sbjct: 245  SYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKA 304

Query: 1674 TDPDVGANGQVTY-----GGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGS 1728
             D D GAN ++ Y       V      LD +TG++T    +DRE+   +  +V A+DRG+
Sbjct: 305  NDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGT 364

Query: 1729 PPQLTHVTVRVAVEDENDHAPTF------------GSAHLSLEVPEGQDPQTLTMLRASD 1776
             P+     V V V+D ND+APT             G A++S +V E      + +++ SD
Sbjct: 365  NPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAE---ETAVALVQVSD 421

Query: 1777 PDVGAN--------GQLQYRILDGDPSGAFVLDLASGEF-GTMRPLDREVEPAFQLRIEA 1827
             D G N        G + +++     +G+   D     F  T  PLD E    + + I A
Sbjct: 422  RDEGENAAVTCVVAGDVPFQLRQASETGS---DSKKKYFLQTTTPLDYEKVKDYTIEIVA 478

Query: 1828 RDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGAN 1887
             D G P LS+T  L V V+D ND+AP F      V  PE+   G ++ ++ A D D+G+N
Sbjct: 479  VDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSN 538

Query: 1888 GHVTYYLGAGTA--GAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVS 1945
              + Y L    A  G F + P +GE++   +LDREQ  SY   V A D  +   L  T +
Sbjct: 539  AELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPS-LQGTAT 597

Query: 1946 VTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAG 2005
            V + V D ND+ P F  S     +    P+ S     +  +   D D G NA +  +L+ 
Sbjct: 598  VLVNVLDCNDNDPKFMLSGYNFSVMENMPALS----PVGMVTVIDGDKGENAQV--QLSV 651

Query: 2006 TPPPGT-TVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAER 2064
                G   + + TG I  + S            + A D G P RSA   + + +  E + 
Sbjct: 652  EQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDN 711

Query: 2065 GPRF--PRASSEATIRENAPPGTPIVSPRAV-HAGGTNGPITYSILSGNEKGTFSIQPST 2121
             P    P  +S   +      G  +    A     G N  + YSI  GN  G F I   +
Sbjct: 712  APYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHS 771

Query: 2122 GAITV 2126
            GAIT+
Sbjct: 772  GAITL 776



 Score =  242 bits (618), Expect = 4e-63
 Identities = 245/878 (27%), Positives = 380/878 (43%), Gaps = 133/878 (15%)

Query: 2208 YSLAASQPARGLFHVDPTTGTI-TTTAILDREIWAETRLVLMA--------------TDR 2252
            Y L    P      VD  TG I TT   +DRE   E +  L                   
Sbjct: 90   YKLEVGAP---YLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQN 146

Query: 2253 GSPALVGSATLTVMVIDTNDNRPTIPQPW-ELRVSEDALLGSEIAQVTGNDVDSGP--VL 2309
            GSP L+      + V D NDN P    P   L + E+  +GS       +D D+GP  V 
Sbjct: 147  GSPRLLEGQ---IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVA 203

Query: 2310 WYVLSPSGPQDPFSVGRYGG--------RVSLTGPLDFEQCDRYQLQLLAHDG---PHEG 2358
             Y L  +GP+     G            ++ + G LD E+ D Y L +   DG   P   
Sbjct: 204  SYELQ-AGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRAS 262

Query: 2359 RANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASP 2418
             A L V V D NDNAP F +  Y+  L E++P G +++ V A D D GAN  I Y     
Sbjct: 263  SALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQA 322

Query: 2419 ADG----FSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQD 2474
             +       +D N G L T+ G V    +    +   + A+D G   ++ARA V V ++D
Sbjct: 323  PEVVRRLLRLDRNTG-LITVQGPV--DREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKD 379

Query: 2475 QNDHAPSFTLSHYRVA--------VTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGN 2526
             ND+AP+  +    +         ++ED+   + +  ++ +D D   + A     +++G+
Sbjct: 380  MNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVT--CVVAGD 437

Query: 2527 WGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVV 2586
                  +  +L +A E+ G   +    L    PLD+E +  Y + + A D G PP SS  
Sbjct: 438  ------VPFQLRQASET-GSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTN 490

Query: 2587 PVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDP 2646
             + V V+DVNDN PVFT++   V  PE+   G  +  + ASDAD G +  + +++     
Sbjct: 491  SLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPA 550

Query: 2647 S-GLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHF-ALAPVTIEVQDVNDHGP 2704
            + GLF +   +G +++  +LD E +  ++L V AAD         A V + V D ND+ P
Sbjct: 551  AKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDP 610

Query: 2705 AFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSST 2764
             F L+  + SV EN P  + V  +  IDGD G   +++ S+       +    F + + T
Sbjct: 611  KFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSV------EQDNGDFVIQNGT 664

Query: 2765 GELRARVPFDYEHTESFRLLVGAADAG--NLSASVTVSVLVTGEDEYDPVFLAPA--FHF 2820
            G + + + FD E   ++   + A D G    SA V V++ V  E++  P   AP+   H 
Sbjct: 665  GTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHK 724

Query: 2821 QVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSSPY--FGINQTTGALYLRVDSRAPG 2878
             +    R G ++  V A D D G +  ++YS+A  +PY  F I   +GA+ L  +     
Sbjct: 725  LLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEI---- 780

Query: 2879 SGTATSGGGGRTRREAPRELRLEVIARGPLPGSRSATVPVTVDIT-------HTALGLAP 2931
                        R      L ++V  RG  P   +A V + V+ T        T LG + 
Sbjct: 781  ----------ERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLANRTLLETLLGHSL 830

Query: 2932 DLNL------------------LLVGAVAASLGVVVVLALAALVLGLVRARSRKAEA--- 2970
            D  L                  +L G VA  + V +++ALA LV      R R+A++   
Sbjct: 831  DTPLDIDIAGDPEYERSKQRGNILFGVVAGVVAVALLIALAVLVR---YCRQREAKSGYQ 887

Query: 2971 ----------APGPMSQAAPLASDSLQKLGREPPSPPP 2998
                      AP P  +    AS   +  G++  SP P
Sbjct: 888  AGKKETKDLYAPKPSGK----ASKGNKSKGKKSKSPKP 921



 Score =  242 bits (617), Expect = 5e-63
 Identities = 221/772 (28%), Positives = 337/772 (43%), Gaps = 62/772 (8%)

Query: 474  RQLYR-PEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSG-IIT 531
            R +Y+ PE  P   L GS         PD G      Y L  GA   +  +D  +G I T
Sbjct: 59   RVVYKVPEEQPPNTLIGSLAADYGF--PDVGH----LYKLEVGAP--YLRVDGKTGDIFT 110

Query: 532  TAASLDYE--LEPQPQL------------IVVATDGGLPPLASSATVSVALQDVNDNEPQ 577
            T  S+D E   E Q QL            I      G P L       + +QD+NDN P 
Sbjct: 111  TETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEG---QIEVQDINDNTPN 167

Query: 578  FQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRI----DA 633
            F       ++PE T  G+ F    A+D D+GP G+ SY L AG  +      ++    + 
Sbjct: 168  FASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEE 227

Query: 634  HSGDVCTTRTLDRDQGPSSFDFTVTAVDGGG--LKSMVYVKVFLSDENDNPPQFYPREYA 691
                +     LDR++   S+D T+   DGG     S   ++V + D NDN P+F    Y 
Sbjct: 228  KQPQLIVMGNLDRERW-DSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYE 286

Query: 692  ASISAQSPPGTAVLRLRAHDPDQGSHGRLSY--HILAGNSPPLFTLDEQSGLLTVAWPLA 749
            A +S  SP G +V++++A+D DQG++  + Y  H        L  LD  +GL+TV  P+ 
Sbjct: 287  AELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVD 346

Query: 750  RRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFE--------QLQYVFSVPE 801
            R   S ++  + A+D G       A+V +++       P  E            + ++ E
Sbjct: 347  REDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISE 406

Query: 802  DVAPGTSVGIVQAHN-PPGRLAPVTLSLSGGDPRGLFSLDAVSG------LLQTLRPLDR 854
            DVA  T+V +VQ  +   G  A VT  ++G  P  L               LQT  PLD 
Sbjct: 407  DVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDY 466

Query: 855  ELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIY 914
            E +       V   SG PP  +   ++V + DVNDN+P F      V  P N  PG  I 
Sbjct: 467  EKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIA 526

Query: 915  TLRALDPDSGVNSRVTFTLLA--GGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARD 972
             + A D DSG N+ + ++L       G FT+ P TG +++   L      ++EL++ A D
Sbjct: 527  EITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAAD 586

Query: 973  GGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGP- 1031
             GSP       + V V D       P+F    Y   +     A + V  V     D G  
Sbjct: 587  RGSPSLQGTATVLVNVLDCNDND--PKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGEN 644

Query: 1032 ITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATV 1091
                L+ E  +  F ++  +G +    + DRE Q  Y  ++ AV G         G   V
Sbjct: 645  AQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVG---V 701

Query: 1092 RVSILNQNEHSPRLS--EDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSE 1149
             +++L++N+++P ++   + +   +      G +V +V A D DSG N  L YS+     
Sbjct: 702  TINVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAG-GN 760

Query: 1150 DSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAV 1201
                F+I   +G +T  + ++R     ++L+V+V D G PPR  T  VH+ V
Sbjct: 761  PYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYV 812



 Score =  227 bits (579), Expect = 1e-58
 Identities = 207/695 (29%), Positives = 300/695 (43%), Gaps = 65/695 (9%)

Query: 2132 LDFEVSPRLRLVLQAESGGAFAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLL 2191
            L+FEVS     +      G+       + +QD NDN P F  P     +PE+  + G L 
Sbjct: 134  LEFEVS-----ITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNI-GSLF 187

Query: 2192 QVE-ADDLDQGSGGQISYSLAASQPARGLFHV------DPTTGTITTTAILDREIWAETR 2244
             +  A D D G  G  SY L A   A+ LF +      +     +     LDRE W    
Sbjct: 188  PIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYD 247

Query: 2245 LVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP-WELRVSEDALLGSEIAQVTGNDV 2303
            L +   D GSP    SA L V V+DTNDN P   +P +E  +SE++ +G  + QV  ND 
Sbjct: 248  LTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDS 307

Query: 2304 DSGP----VLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHD---GPH 2356
            D G        +  +P   +    + R  G +++ GP+D E     +  +LA D    P 
Sbjct: 308  DQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPK 367

Query: 2357 EGRANLTVLVEDVNDNAPAF--------SQSLYQVMLLEHTPPGSAILSVSATDRDSGAN 2408
              RA + V V+D+NDNAP          +       + E     +A+  V  +DRD G N
Sbjct: 368  SARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGEN 427

Query: 2409 --------GHISYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAP 2460
                    G + + L   ++  S       L T   T  L ++      + + A D G P
Sbjct: 428  AAVTCVVAGDVPFQLRQASETGSDSKKKYFLQT---TTPLDYEKVKDYTIEIVAVDSGNP 484

Query: 2461 GRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDY 2520
              ++  ++ VQ+ D ND+AP FT S   VA  E+  PG  +  + A+DAD S S+A + Y
Sbjct: 485  PLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDAD-SGSNAELVY 543

Query: 2521 SIISGNWGRVFQLEPRLAEAGE-SAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQ 2579
            S           LEP  A  G  +  P     G + +   LD E    Y L V AADRG 
Sbjct: 544  S-----------LEPEPAAKGLFTISP---ETGEIQVKTSLDREQRESYELKVVAADRGS 589

Query: 2580 PPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRF 2639
            P       V V VLD NDN P F  + Y  +V E+ P  + +  V   D D G +  V+ 
Sbjct: 590  PSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQL 649

Query: 2640 TVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAAD-PAGAHFALAPVTIEVQD 2698
            +V     +G F +   +GT+  + + D E Q+ +   ++A D       A   VTI V D
Sbjct: 650  SVE--QDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLD 707

Query: 2699 VNDHGP--AFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGRE 2756
             ND+ P    P N     +      G  V+ + A D D+G    L YS+  AG  P G  
Sbjct: 708  ENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSI--AGGNPYG-- 763

Query: 2757 AFALNSSTGELRARVPFDYEHTESFRLLVGAADAG 2791
             F + S +G +      +  H    RL+V  +D G
Sbjct: 764  LFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRG 798



 Score =  216 bits (551), Expect = 2e-55
 Identities = 218/775 (28%), Positives = 331/775 (42%), Gaps = 59/775 (7%)

Query: 1748 APTFGSA-HLSLEVPEGQDPQTLTMLRASD---PDVGANGQLQ----YRILDGDPSGAFV 1799
            AP+ G A  +  +VPE Q P TL    A+D   PDVG   +L+    Y  +DG     F 
Sbjct: 51   APSPGHATRVVYKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFT 110

Query: 1800 LDLASGEFGTMRPLDREV--EPAF-QLRIEARDGGQPALSATLLLTVTVLDANDHAPAFP 1856
             + +    G +R    ++  +P   +  +   D  Q      L   + V D ND+ P F 
Sbjct: 111  TETSIDREG-LRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFA 169

Query: 1857 VPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLL--------EPSS 1908
             P  ++ +PE+   G+L     A D DAG NG  +Y L AG     L         E   
Sbjct: 170  SPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQ 229

Query: 1909 GELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLR 1968
             +L     LDRE+  SY  ++   DG +  P +++  + +TV D ND+AP F        
Sbjct: 230  PQLIVMGNLDRERWDSYDLTIKVQDGGSP-PRASSALLRVTVLDTNDNAPKFERPSYEAE 288

Query: 1969 LPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTTV---DSYTGEIRVARS 2025
            L    P   +    +  ++A D D GANA I Y     P     +   D  TG I V + 
Sbjct: 289  LSENSPIGHS----VIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITV-QG 343

Query: 2026 PVALGPRDRVLF-IVATDLGRPARSATGVIIVGLQGEAERGPRFP--------RASSEAT 2076
            PV       + F ++A D G   +SA   ++V ++   +  P                A 
Sbjct: 344  PVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMAN 403

Query: 2077 IRENAPPGTPIVSPRAVHAG-GTNGPITYSILSGNEKGTFSIQPSTGAIT-----VRSAE 2130
            I E+    T +   +      G N  +T  +++G+          TG+ +     +++  
Sbjct: 404  ISEDVAEETAVALVQVSDRDEGENAAVT-CVVAGDVPFQLRQASETGSDSKKKYFLQTTT 462

Query: 2131 GLDFE-VSPRLRLVLQAESGGAFAFTVLTLTLQ--DANDNAPRFLRPHYVAFLPESRPLE 2187
             LD+E V      ++  +SG     +  +L +Q  D NDNAP F +       PE+    
Sbjct: 463  PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPG 522

Query: 2188 GPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVL 2247
              + ++ A D D GS  ++ YSL     A+GLF + P TG I     LDRE      L +
Sbjct: 523  EVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKV 582

Query: 2248 MATDRGSPALVGSATLTVMVIDTNDNRPT-IPQPWELRVSEDALLGSEIAQVTGNDVDSG 2306
            +A DRGSP+L G+AT+ V V+D NDN P  +   +   V E+    S +  VT  D D G
Sbjct: 583  VAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKG 642

Query: 2307 PVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDG---PHEGRANLT 2363
                  LS       F +    G +  +   D EQ   Y  QL A DG   P      +T
Sbjct: 643  ENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVT 702

Query: 2364 VLVEDVNDNAPAFS--QSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLA--SPA 2419
            + V D NDNAP  +   +    +L   T  G  +  V+A D DSG N  + Y +A  +P 
Sbjct: 703  INVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPY 762

Query: 2420 DGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQD 2474
              F +  ++G + T+   +   H G     +V++  D G P R   A VH+ + +
Sbjct: 763  GLFQIGSHSGAI-TLEKEIERRHHGLHR--LVVKVSDRGKPPRYGTALVHLYVNE 814



 Score =  207 bits (528), Expect = 1e-52
 Identities = 161/545 (29%), Positives = 239/545 (43%), Gaps = 26/545 (4%)

Query: 46  SLDLQIDEEQPAGTLIGDISAGLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTAR 105
           S + ++ E  P G  +  + A      A   + +   Q    V   L +D ++G++    
Sbjct: 284 SYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQG 343

Query: 106 VLDREQRDRYRFTAVT------PDGATVEVTVRVADINDHAPAFPQARAAL--------Q 151
            +DRE     RF+ +       P  A  +V V V D+ND+AP        L         
Sbjct: 344 PVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMAN 403

Query: 152 VPEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTG 211
           + E  A  T   L    D D G        ++GD   +  R  +  G D      L  T 
Sbjct: 404 ISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQ-LRQASETGSDSKKKYFLQTTT 462

Query: 212 ELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPG 271
            LD E    Y +++ A D G+PP  +   L V ++D+ND+AP F QS       E+  PG
Sbjct: 463 PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPG 522

Query: 272 SPVLQVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELV 331
             + ++ ASDAD+G N  + Y +    +   G F+I   TG +Q++  LD EQR  +EL 
Sbjct: 523 EVIAEITASDADSGSNAELVYSLEPEPA-AKGLFTISPETGEIQVKTSLDREQRESYELK 581

Query: 332 VQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVS 391
           V A D G+    G+A V V+V D NDN P     F+ +  +  V E  P    V  ++V 
Sbjct: 582 VVAADRGSPSLQGTATVLVNVLDCNDNDPK----FMLSGYNFSVMENMPALSPVGMVTVI 637

Query: 392 DPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPP 451
           D D G+ A V +S+E   G F +      I     +   DRE++  Y  ++ A D G PP
Sbjct: 638 DGDKGENAQVQLSVEQDNGDFVIQNGTGTILS---SLSFDREQQSTYTFQLKAVDGGVPP 694

Query: 452 LRAEAAFVLHVTDVNDNAPAFDRQLYRPEPL--PEVALPGSFVVRVTARDPDQGTNGQVT 509
             A     ++V D NDNAP           L  P+  L G  V +V A D D G N ++ 
Sbjct: 695 RSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRL-GETVSQVAAEDFDSGVNAELI 753

Query: 510 YSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQ 569
           YS+A G     F I   SG IT    ++       +L+V  +D G PP   +A V + + 
Sbjct: 754 YSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVN 813

Query: 570 DVNDN 574
           +   N
Sbjct: 814 ETLAN 818



 Score =  197 bits (500), Expect = 2e-49
 Identities = 191/685 (27%), Positives = 286/685 (41%), Gaps = 57/685 (8%)

Query: 985  RVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGP---ITYHL-AAEG 1040
            ++ VQD+      P F SP   + +P  T  G+      A   D GP    +Y L A   
Sbjct: 155  QIEVQDINDN--TPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPE 212

Query: 1041 ASSPFGL------EPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVS 1094
            A   FGL      E +   L V   LDRE  + Y L +    G       +  +A +RV+
Sbjct: 213  AQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPP---RASSALLRVT 269

Query: 1095 ILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSED-SKA 1153
            +L+ N+++P+         ++EN P G SV +V A D D G N  + Y+  Q  E   + 
Sbjct: 270  VLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRL 329

Query: 1154 FRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQ 1213
             R+   TG +T    +DRE  S+ +  V  +D G+ P+S    V V V D+NDN+PT   
Sbjct: 330  LRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTI-- 387

Query: 1214 ASGAAGGGLPIQ------VPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGP-------G 1260
                 G GL         + + V   T V  +Q  D DEGEN  +   + G         
Sbjct: 388  --EIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQA 445

Query: 1261 SELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEP 1320
            SE  S       L T  PL   +   Y + + A D G+PP S++  L VQV+        
Sbjct: 446  SETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVV-------- 497

Query: 1321 PPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEP-AGVGA-LTYTLVGGADPEGT 1378
              D+ +  P     V   V   E  +PG ++  + A +  +G  A L Y+L      +G 
Sbjct: 498  --DVNDNAPVFTQSVT-EVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGL 554

Query: 1379 FALDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFAR 1438
            F +   +G + +   LD E    +    V A+    +      V V V D N++ P F  
Sbjct: 555  FTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFML 614

Query: 1439 DPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAP 1498
                 ++ EN    + +      D D  G N+ V+   L  E       +   TG + + 
Sbjct: 615  SGYNFSVMENMPALSPVGMVTVIDGD-KGENAQVQ---LSVEQDNGDFVIQNGTGTILSS 670

Query: 1499 RGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRVR---LP 1555
               DRE        ++A D        R+A V   + V DENDNAP   +PS      L 
Sbjct: 671  LSFDREQQSTYTFQLKAVD---GGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLT 727

Query: 1556 EDQPPGPAALHVVARDPDLGEAARVSYRLASGGD-GHFRLHSSTGALSVVRPLDREQRAE 1614
                 G     V A D D G  A + Y +A G   G F++ S +GA+++ + ++R     
Sbjct: 728  PQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGL 787

Query: 1615 HVLTVVASDHGSPPRSATQVLTVSV 1639
            H L V  SD G PPR  T ++ + V
Sbjct: 788  HRLVVKVSDRGKPPRYGTALVHLYV 812



 Score =  189 bits (479), Expect = 5e-47
 Identities = 199/774 (25%), Positives = 334/774 (43%), Gaps = 88/774 (11%)

Query: 796  VFSVPEDVAPGTSVGIVQAHNPPGRLAPVTLSLSGGDPRGLFSLDAVSG-LLQTLRPLDR 854
            V+ VPE+  P T +G + A      +  +   L  G P     +D  +G +  T   +DR
Sbjct: 61   VYKVPEEQPPNTLIGSLAADYGFPDVGHL-YKLEVGAP--YLRVDGKTGDIFTTETSIDR 117

Query: 855  ELLGP----------VLELEVRAGSGVP---PAFAVARVRVLLDDVNDNSPAFPAPEDTV 901
            E L            +LE EV     V    P     ++ V   D+NDN+P F +P  T+
Sbjct: 118  EGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEV--QDINDNTPNFASPVITL 175

Query: 902  LLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGG--------AFTVDPTTGHVRLM 953
             +P NT  G+      A D D+G N   ++ L AG           A   +     + +M
Sbjct: 176  AIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVM 235

Query: 954  RPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGT 1013
              L      +++L ++ +DGGSPPR S   LRV V D  T   AP+F  P+Y  +L   +
Sbjct: 236  GNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLD--TNDNAPKFERPSYEAELSENS 293

Query: 1014 TAGTQVLQVQAQAPDGG-----PITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELY 1068
              G  V+QV+A   D G       T+H A E       L+  +G + V+  +DRE  +L 
Sbjct: 294  PIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDRE--DLS 351

Query: 1069 ILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRL--------SEDPTFLAVAENQPP 1120
             L+   ++  +     ++  A V V++ + N+++P +        +       ++E+   
Sbjct: 352  TLRFSVLAKDRG-TNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAE 410

Query: 1121 GTSVGRVFATDRDSGPNGRLT--------YSLQQLSE---DSKAFRIHPQTGEVTTLQTL 1169
             T+V  V  +DRD G N  +T        + L+Q SE   DSK      +   + T   L
Sbjct: 411  ETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSK------KKYFLQTTTPL 464

Query: 1170 DREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDR 1229
            D E+   Y + +   D G+PP S+T ++ V V+D+NDN+P F Q+         +  P+ 
Sbjct: 465  DYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSV------TEVAFPEN 518

Query: 1230 VPPGTLVTTLQAKDPDEGENGTILYTL-TGPGSE-LFSLHPHSGELLTAAPLIRAERPHY 1287
              PG ++  + A D D G N  ++Y+L   P ++ LF++ P +GE+     L R +R  Y
Sbjct: 519  NKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESY 578

Query: 1288 VLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRP 1347
             L + A D+GSP    +  +LV VL          D  + DP   +      +  E +  
Sbjct: 579  ELKVVAADRGSPSLQGTATVLVNVL----------DCNDNDPKFMLS-GYNFSVMENMPA 627

Query: 1348 GSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALTV 1407
             S +G V   +    G      +      G F +   +G +  +   D E    +     
Sbjct: 628  LSPVGMVTVID-GDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLK 686

Query: 1408 RAEGPGGAGARLLRVQVQVQDENEHAP---AFARDPLALALPENPEPGAALYTFRASDAD 1464
              +G     +  + V + V DEN++AP   A +     L  P+    G  +    A D D
Sbjct: 687  AVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQT-RLGETVSQVAAEDFD 745

Query: 1465 GPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDR 1518
              G N+++ Y +     P    ++ + +GA++  + ++R       L+V+ +DR
Sbjct: 746  S-GVNAELIYSIAGGN-PYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDR 797



 Score =  187 bits (476), Expect = 1e-46
 Identities = 175/649 (26%), Positives = 283/649 (43%), Gaps = 74/649 (11%)

Query: 788  PIFEQLQYVFSVPEDVAPGTSVGIVQAHNP---PGRLAPVTLSLSGGDPRGLFSLDAVSG 844
            P F       ++PE+   G+   I  A +    P  +A   L  +G + + LF L     
Sbjct: 166  PNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQ-AGPEAQELFGLQVAED 224

Query: 845  L------LQTLRPLDRELLGPV-LELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAP 897
                   L  +  LDRE      L ++V+ G G PP  + A +RV + D NDN+P F  P
Sbjct: 225  QEEKQPQLIVMGNLDRERWDSYDLTIKVQDG-GSPPRASSALLRVTVLDTNDNAPKFERP 283

Query: 898  EDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGA---FTVDPTTGHVRLMR 954
                 L  N+  G  +  ++A D D G N+ + +T             +D  TG + +  
Sbjct: 284  SYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQG 343

Query: 955  PLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRV------- 1007
            P+           + A+D G+ P+++  ++ V V+D+         N+PT  +       
Sbjct: 344  PVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMND-------NAPTIEIRGIGLVT 396

Query: 1008 ------DLPSGTTAGTQVLQVQAQAPDGGPITYHLAAEGASSPFGLEPQSG--------- 1052
                  ++       T V  VQ    D G             PF L   S          
Sbjct: 397  HQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKY 456

Query: 1053 WLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFL 1112
            +L     LD E  + Y ++++AV      L   + T +++V +++ N+++P  ++  T +
Sbjct: 457  FLQTTTPLDYEKVKDYTIEIVAVDSGNPPL---SSTNSLKVQVVDVNDNAPVFTQSVTEV 513

Query: 1113 AVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDRE 1172
            A  EN  PG  +  + A+D DSG N  L YSL+        F I P+TGE+    +LDRE
Sbjct: 514  AFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDRE 573

Query: 1173 QQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPP 1232
            Q+ SY+L V   D GSP    T TV V VLD NDN P F+ +      G    V + +P 
Sbjct: 574  QRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLS------GYNFSVMENMPA 627

Query: 1233 GTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHSGELLTAAPLIRAERPHYVLTLS 1292
             + V  +   D D+GEN  +  ++     + F +   +G +L++    R ++  Y   L 
Sbjct: 628  LSPVGMVTVIDGDKGENAQVQLSVEQDNGD-FVIQNGTGTILSSLSFDREQQSTYTFQLK 686

Query: 1293 AHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLG 1352
            A D G PPRSA + + + VL             + +  AP     + T+ + L P + LG
Sbjct: 687  AVDGGVPPRSAYVGVTINVL-------------DENDNAPYITAPSNTSHKLLTPQTRLG 733

Query: 1353 ----SVAAPE-PAGVGA-LTYTLVGGADPEGTFALDAASGRLYLARPLD 1395
                 VAA +  +GV A L Y++ GG +P G F + + SG + L + ++
Sbjct: 734  ETVSQVAAEDFDSGVNAELIYSIAGG-NPYGLFQIGSHSGAITLEKEIE 781



 Score =  144 bits (364), Expect = 1e-33
 Identities = 147/573 (25%), Positives = 249/573 (43%), Gaps = 75/573 (13%)

Query: 2387 EHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSG 2446
            E  PP + I S++A D      GH+ Y L   A    VD   G +FT   ++    D  G
Sbjct: 66   EEQPPNTLIGSLAA-DYGFPDVGHL-YKLEVGAPYLRVDGKTGDIFTTETSI----DREG 119

Query: 2447 A-------------VDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTE 2493
                          ++  +   D    G        +++QD ND+ P+F      +A+ E
Sbjct: 120  LRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPE 179

Query: 2494 DLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGR-VFQLEPRLAEAGESAGPGPRALG 2552
            +   GS      A+D D   +  A  Y + +G   + +F L+  +AE  E   P      
Sbjct: 180  NTNIGSLFPIPLASDRDAGPNGVA-SYELQAGPEAQELFGLQ--VAEDQEEKQPQ----- 231

Query: 2553 CLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVP 2612
             L+++  LD E    Y+LT+   D G PP++S   + VTVLD NDN P F R SY   + 
Sbjct: 232  -LIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELS 290

Query: 2613 EDTPVGAELLHVEASDADPGPHGLVRFTVSSGDP--SGLFELDESSGTLRLAHALDCETQ 2670
            E++P+G  ++ V+A+D+D G +  + +T          L  LD ++G + +   +D E  
Sbjct: 291  ENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDL 350

Query: 2671 ARHQLVVQAAD-PAGAHFALAPVTIEVQDVNDHGPAFPLNLLS--------TSVAENQPP 2721
            +  +  V A D       A A V + V+D+ND+ P   +  +          +++E+   
Sbjct: 351  STLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAE 410

Query: 2722 GTLVTTLHAIDGDAG--------AFGRLRYSLLEAG-PGPEGREAFALNSSTGELRARVP 2772
             T V  +   D D G          G + + L +A   G + ++ + L ++T       P
Sbjct: 411  ETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT-------P 463

Query: 2773 FDYEHTESFRLLVGAADAGN--LSASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARRGH 2830
             DYE  + + + + A D+GN  LS++ ++ V V   ++  PVF         PE  + G 
Sbjct: 464  LDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGE 523

Query: 2831 SLGHVQATDEDGGADGLVLYSL---ATSSPYFGINQTTGALYLRVDSRAPGSGTATSGGG 2887
             +  + A+D D G++  ++YSL     +   F I+  TG + ++                
Sbjct: 524  VIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSL------------- 570

Query: 2888 GRTRREAPRELRLEVIARGPLPGSRSATVPVTV 2920
             R +RE+  EL++    RG      +ATV V V
Sbjct: 571  DREQRES-YELKVVAADRGSPSLQGTATVLVNV 602



 Score =  117 bits (292), Expect = 2e-25
 Identities = 99/345 (28%), Positives = 153/345 (44%), Gaps = 25/345 (7%)

Query: 48  DLQIDEEQPAGTLIGDISAG-LPAGTAAPLMYFISAQEGS-GVGTDLAIDEHSGVVRTAR 105
           ++   E    G +I +I+A    +G+ A L+Y +  +  + G+ T   I   +G ++   
Sbjct: 512 EVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFT---ISPETGEIQVKT 568

Query: 106 VLDREQRDRYRFTAVTPDGA------TVEVTVRVADINDHAPAFPQARAALQVPEHTAFG 159
            LDREQR+ Y    V  D        T  V V V D ND+ P F  +     V E+    
Sbjct: 569 SLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPAL 628

Query: 160 TRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRS 219
           +   +    D D G       ++  D      +  T     GT +  L      DRE +S
Sbjct: 629 SPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGT-----GTILSSL----SFDREQQS 679

Query: 220 HYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFN--QSRYHAVVSESLAPGSPVLQV 277
            Y  QL+A DGG PPR A   + + +LD ND+AP      +  H +++     G  V QV
Sbjct: 680 TYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQV 739

Query: 278 FASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDG 337
            A D D+GVN  + Y I        G F I +H+G + LE+ ++     +H LVV+  D 
Sbjct: 740 AAEDFDSGVNAELIYSI--AGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDR 797

Query: 338 GAHPELGSAFVTVHVRDANDNQPSM-TVIFLSADGSPQVSEAAPP 381
           G  P  G+A V ++V +   N+  + T++  S D    +  A  P
Sbjct: 798 GKPPRYGTALVHLYVNETLANRTLLETLLGHSLDTPLDIDIAGDP 842



 Score = 33.1 bits (74), Expect = 4.7
 Identities = 52/216 (24%), Positives = 78/216 (36%), Gaps = 19/216 (8%)

Query: 2715 VAENQPPGTLVTTLHAIDG--DAGAFGRLRYSLLEAGPGPEGREAFALNSSTG-----EL 2767
            V E QPP TL+ +L A  G  D G   +L           +  + F   +S       E 
Sbjct: 64   VPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLREC 123

Query: 2768 RARVPFD---YEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYDPVFLAPAFHFQVPE 2824
            + ++P D    E   S   LV       L   + V  +    ++  P F +P     +PE
Sbjct: 124  QNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDI----NDNTPNFASPVITLAIPE 179

Query: 2825 GARRGHSLGHVQATDEDGGADGLVLYSLATSSPYFGINQTTGALYLRVDSRAPGSGTATS 2884
                G       A+D D G +G+  Y L          Q    L +  D           
Sbjct: 180  NTNIGSLFPIPLASDRDAGPNGVASYELQAGPE----AQELFGLQVAEDQEEKQPQLIVM 235

Query: 2885 GGGGRTRREAPRELRLEVIARGPLPGSRSATVPVTV 2920
            G   R R ++  +L ++V   G  P + SA + VTV
Sbjct: 236  GNLDRERWDS-YDLTIKVQDGGSPPRASSALLRVTV 270


>gi|157426847 protocadherin 19 isoform a [Homo sapiens]
          Length = 1101

 Score =  342 bits (876), Expect = 5e-93
 Identities = 247/687 (35%), Positives = 356/687 (51%), Gaps = 50/687 (7%)

Query: 21  LLLPLLLLLLLLLGAGVPGAWGQAGSL---DLQIDEEQPAGTLIGDISAGL-PAGTAAPL 76
           LLLP+LLLL +L        W QA +L      ++EEQ AGT+I +++     AG A   
Sbjct: 4   LLLPVLLLLAIL--------WTQAAALINLKYSVEEEQRAGTVIANVAKDAREAGFALDP 55

Query: 77  MYFISAQEGSGVGTDLA-IDEHSGVVRTARVLDREQRDRYR------FTAVTPDGATVEV 129
               + +  S     L  I+  SG++ T + +DR+   R           ++       +
Sbjct: 56  RQASAFRVVSNSAPHLVDINPSSGLLVTKQKIDRDLLCRQSPKCIISLEVMSSSMEICVI 115

Query: 130 TVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGE 189
            V + D+ND+AP+FP A+  L++ E  + GTR PL+ A D D+G  G Q Y L+ +   E
Sbjct: 116 KVEIKDLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPDSGSFGVQTYELTPN---E 172

Query: 190 TFRLETRPGPDGTPVPELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDIN 249
            F LE +   DG+   ELVV   LDRE +SHY  ++ A DGG PPR     L + + D N
Sbjct: 173 LFGLEIKTRGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPRLGTVGLSIKVTDSN 232

Query: 250 DHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYE----INRRQSEGDGPF 305
           D+ P F++S Y   V E+  P +PV+++ ASD D G NG V Y     +N R  E    F
Sbjct: 233 DNNPVFSESTYAVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFYGYVNDRTRE---LF 289

Query: 306 SIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTVI 365
            ID H+GL+ +   LD+E+  V+EL VQA+D G +       VTV V D NDN P + ++
Sbjct: 290 QIDPHSGLVTVTGALDYEEGHVYELDVQAKDLGPNSIPAHCKVTVSVLDTNDNPPVINLL 349

Query: 366 FLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVC 425
            ++++   +VSE+APPG ++A + VSD D G    V   L G    F L   +S    + 
Sbjct: 350 SVNSE-LVEVSESAPPGYVIALVRVSDRDSGLNGRVQCRLLGNV-PFRLQEYES-FSTIL 406

Query: 426 VARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEV 485
           V  RLDRE+ D YNL + A D G P L++  +F + +TD NDN P F +  Y+   + E 
Sbjct: 407 VDGRLDREQHDQYNLTIQARDGGVPMLQSAKSFTVLITDENDNHPHFSKPYYQ-VIVQEN 465

Query: 486 ALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTH-----WFSIDPTSGIITTAASLDYEL 540
             PG++++ V+ARDPD G NG V+Y + P          + SI+P SG I    S ++E 
Sbjct: 466 NTPGAYLLSVSARDPDLGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGDIYALRSFNHEQ 525

Query: 541 EPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQR-TFYNAS----LPEGTQPGT 595
               +  V+A DGGLP L S+ATV V + DVNDN P        N +    +P  +  G 
Sbjct: 526 TKAFEFKVLAKDGGLPSLQSNATVRVIILDVNDNTPVITAPPLINGTAEVYIPRNSGIGY 585

Query: 596 CFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDF 655
               V A D D G  G ++Y +  G        F ID  +G+V TTRT   +   SS++ 
Sbjct: 586 LVTVVKAEDYDEGENGRVTYDMTEG----DRGFFEIDQVNGEVRTTRTFG-ESSKSSYEL 640

Query: 656 TVTAVDGG--GLKSMVYVKVFLSDEND 680
            V A D G   L +   V ++LS   D
Sbjct: 641 IVVAHDHGKTSLSASALVLIYLSPALD 667



 Score =  212 bits (539), Expect = 6e-54
 Identities = 185/676 (27%), Positives = 294/676 (43%), Gaps = 60/676 (8%)

Query: 1212 LQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEG------ENGTILYTLTGPGSELFS 1265
            L    AA   L   V +    GT++  + AKD  E          +    ++     L  
Sbjct: 15   LWTQAAALINLKYSVEEEQRAGTVIANV-AKDAREAGFALDPRQASAFRVVSNSAPHLVD 73

Query: 1266 LHPHSGELLTAAPLIR----AERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPP 1321
            ++P SG L+T   + R     + P  +++L          S+S+++ V  +    L +  
Sbjct: 74   INPSSGLLVTKQKIDRDLLCRQSPKCIISLEV-------MSSSMEICVIKVEIKDLNDNA 126

Query: 1322 PDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFAL 1381
            P      PAA + + ++  A+ G R    L S   P+    G  TY L     P   F L
Sbjct: 127  PSF----PAAQIELEISEAASPGTRIP--LDSAYDPDSGSFGVQTYELT----PNELFGL 176

Query: 1382 DAAS-------GRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAP 1434
            +  +         L + + LD E    +       +G        + + ++V D N++ P
Sbjct: 177  EIKTRGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPRLGTVGLSIKVTDSNDNNP 236

Query: 1435 AFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLR--QEPPVPALRLDART 1492
             F+    A+++PEN  P   +    ASD D  G N  V Y       +      ++D  +
Sbjct: 237  VFSESTYAVSVPENSPPNTPVIRLNASDPD-EGTNGQVVYSFYGYVNDRTRELFQIDPHS 295

Query: 1493 GALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVF----AS 1548
            G ++    LD E      L V+A D   N+     A     V V D NDN PV      +
Sbjct: 296  GLVTVTGALDYEEGHVYELDVQAKDLGPNSI---PAHCKVTVSVLDTNDNPPVINLLSVN 352

Query: 1549 PSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLD 1608
               V + E  PPG     V   D D G   RV  RL        + + S   + V   LD
Sbjct: 353  SELVEVSESAPPGYVIALVRVSDRDSGLNGRVQCRLLGNVPFRLQEYESFSTILVDGRLD 412

Query: 1609 REQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSL 1668
            REQ  ++ LT+ A D G P   + +  TV + D ND  P F +  Y V+++ENN PG  L
Sbjct: 413  REQHDQYNLTIQARDGGVPMLQSAKSFTVLITDENDNHPHFSKPYYQVIVQENNTPGAYL 472

Query: 1669 LTLRATDPDVGANGQVTYGGVSSE--------SFSLDPDTGVLTTLRALDREEQEEINLT 1720
            L++ A DPD+G NG V+Y  V S+          S++P++G +  LR+ + E+ +     
Sbjct: 473  LSVSARDPDLGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGDIYALRSFNHEQTKAFEFK 532

Query: 1721 VYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQT------LTMLRA 1774
            V A+D G P   ++ TVRV + D ND+ P   +  L     E   P+       +T+++A
Sbjct: 533  VLAKDGGLPSLQSNATVRVIILDVNDNTPVITAPPLINGTAEVYIPRNSGIGYLVTVVKA 592

Query: 1775 SDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPA 1834
             D D G NG++ Y + +GD  G F +D  +GE  T R      + +++L + A D G+ +
Sbjct: 593  EDYDEGENGRVTYDMTEGD-RGFFEIDQVNGEVRTTRTFGESSKSSYELIVVAHDHGKTS 651

Query: 1835 LSATLLLTVTVLDAND 1850
            LSA+ L+ + +  A D
Sbjct: 652  LSASALVLIYLSPALD 667



 Score =  211 bits (536), Expect = 1e-53
 Identities = 179/619 (28%), Positives = 284/619 (45%), Gaps = 51/619 (8%)

Query: 497  ARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYEL--EPQPQLIVVATDGG 554
            A DP Q +  +V  + AP    H   I+P+SG++ T   +D +L     P+ I+      
Sbjct: 52   ALDPRQASAFRVVSNSAP----HLVDINPSSGLLVTKQKIDRDLLCRQSPKCII-----S 102

Query: 555  LPPLASS---ATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFG 611
            L  ++SS     + V ++D+NDN P F        + E   PGT     +A D DSG FG
Sbjct: 103  LEVMSSSMEICVIKVEIKDLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPDSGSFG 162

Query: 612  LLSYSL------GAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGL 665
            + +Y L      G  + + G       +   ++   ++LDR+   S + F +TA+DGG  
Sbjct: 163  VQTYELTPNELFGLEIKTRGD-----GSRFAELVVEKSLDRET-QSHYSFRITALDGGDP 216

Query: 666  KSM--VYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYH 723
              +  V + + ++D NDN P F    YA S+   SPP T V+RL A DPD+G++G++ Y 
Sbjct: 217  PRLGTVGLSIKVTDSNDNNPVFSESTYAVSVPENSPPNTPVIRLNASDPDEGTNGQVVYS 276

Query: 724  I---LAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISI 780
                +   +  LF +D  SGL+TV   L      V +L++ A+D G        +V +S+
Sbjct: 277  FYGYVNDRTRELFQIDPHSGLVTVTGALDYEEGHVYELDVQAKDLGPNSIPAHCKVTVSV 336

Query: 781  VPGTPTPPIFEQLQY---VFSVPEDVAPGTSVGIVQ-AHNPPGRLAPVTLSLSGGDPRGL 836
            +     PP+   L     +  V E   PG  + +V+ +    G    V   L G  P  L
Sbjct: 337  LDTNDNPPVINLLSVNSELVEVSESAPPGYVIALVRVSDRDSGLNGRVQCRLLGNVPFRL 396

Query: 837  FSLDAVSGLLQTLRPLDRELLGPV-LELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFP 895
               ++ S +L   R LDRE      L ++ R G GVP   +     VL+ D NDN P F 
Sbjct: 397  QEYESFSTILVDGR-LDREQHDQYNLTIQARDG-GVPMLQSAKSFTVLITDENDNHPHFS 454

Query: 896  APEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAG---GGGAFT---VDPTTGH 949
             P   V++  N  PG  + ++ A DPD G+N  V++ ++         FT   ++P +G 
Sbjct: 455  KPYYQVIVQENNTPGAYLLSVSARDPDLGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGD 514

Query: 950  VRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRG---LAPRFNSPTYR 1006
            +  +R        A E ++ A+DGG P   S+  +RV++ DV        AP   + T  
Sbjct: 515  IYALRSFNHEQTKAFEFKVLAKDGGLPSLQSNATVRVIILDVNDNTPVITAPPLINGTAE 574

Query: 1007 VDLPSGTTAGTQVLQVQAQAPD---GGPITYHLAAEGASSPFGLEPQSGWLWVRAALDRE 1063
            V +P  +  G  V  V+A+  D    G +TY +  EG    F ++  +G +         
Sbjct: 575  VYIPRNSGIGYLVTVVKAEDYDEGENGRVTYDM-TEGDRGFFEIDQVNGEVRTTRTFGES 633

Query: 1064 AQELYILKVMAVSGSKAEL 1082
            ++  Y L V+A    K  L
Sbjct: 634  SKSSYELIVVAHDHGKTSL 652



 Score =  209 bits (531), Expect = 5e-53
 Identities = 166/603 (27%), Positives = 270/603 (44%), Gaps = 49/603 (8%)

Query: 1696 LDPDTGVLTTLRALDREE--QEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGS 1753
            ++P +G+L T + +DR+   ++     +  +   S  ++    ++V ++D ND+AP+F +
Sbjct: 74   INPSSGLLVTKQKIDRDLLCRQSPKCIISLEVMSSSMEIC--VIKVEIKDLNDNAPSFPA 131

Query: 1754 AHLSLEVPEGQDPQTLTML-RASDPDVGANGQLQYRILDGDPSGAFVLDLASG----EFG 1808
            A + LE+ E   P T   L  A DPD G+ G   Y +   +  G  +     G    E  
Sbjct: 132  AQIELEISEAASPGTRIPLDSAYDPDSGSFGVQTYELTPNELFGLEIKTRGDGSRFAELV 191

Query: 1809 TMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDV 1868
              + LDRE +  +  RI A DGG P    T+ L++ V D+ND+ P F    Y+V VPE+ 
Sbjct: 192  VEKSLDRETQSHYSFRITALDGGDPPRLGTVGLSIKVTDSNDNNPVFSESTYAVSVPENS 251

Query: 1869 PAGTLLLQLQAHDPDAGANGHVTY----YLGAGTAGAFLLEPSSGELRTAAALDREQCPS 1924
            P  T +++L A DPD G NG V Y    Y+   T   F ++P SG +    ALD E+   
Sbjct: 252  PPNTPVIRLNASDPDEGTNGQVVYSFYGYVNDRTRELFQIDPHSGLVTVTGALDYEEGHV 311

Query: 1925 YTFSVSAVDGAAAGPLSTTV--SVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLA 1982
            Y   V A D    GP S      VT++V D ND+ P      +   L     S + P   
Sbjct: 312  YELDVQAKD---LGPNSIPAHCKVTVSVLDTNDNPPVINLLSVNSELVEVSES-APPGYV 367

Query: 1983 LATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRV------L 2036
            +A +R  DRD+G N  +  RL G  P          E     + +  G  DR       L
Sbjct: 368  IALVRVSDRDSGLNGRVQCRLLGNVP------FRLQEYESFSTILVDGRLDREQHDQYNL 421

Query: 2037 FIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHAG 2096
             I A D G P   +     V +  E +  P F +   +  ++EN  PG  ++S  A    
Sbjct: 422  TIQARDGGVPMLQSAKSFTVLITDENDNHPHFSKPYYQVIVQENNTPGAYLLSVSARDPD 481

Query: 2097 -GTNGPITYSILSGNEKGT-----FSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGG 2150
             G NG ++Y I+    +        SI P++G   + +    + E +      + A+ GG
Sbjct: 482  LGLNGSVSYQIVPSQVRDMPVFTYVSINPNSG--DIYALRSFNHEQTKAFEFKVLAKDGG 539

Query: 2151 AFAF---TVLTLTLQDANDNAPRFLRPHYV-----AFLPESRPLEGPLLQVEADDLDQGS 2202
              +      + + + D NDN P    P  +      ++P +  +   +  V+A+D D+G 
Sbjct: 540  LPSLQSNATVRVIILDVNDNTPVITAPPLINGTAEVYIPRNSGIGYLVTVVKAEDYDEGE 599

Query: 2203 GGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSAT 2262
             G+++Y +  ++  RG F +D   G + TT        +   L+++A D G  +L  SA 
Sbjct: 600  NGRVTYDM--TEGDRGFFEIDQVNGEVRTTRTFGESSKSSYELIVVAHDHGKTSLSASAL 657

Query: 2263 LTV 2265
            + +
Sbjct: 658  VLI 660



 Score =  199 bits (507), Expect = 3e-50
 Identities = 168/643 (26%), Positives = 274/643 (42%), Gaps = 66/643 (10%)

Query: 709  AHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLAR------RANSVVQLEIGA 762
            A DP Q S    ++ +++ ++P L  ++  SGLL     + R          ++ LE+ +
Sbjct: 52   ALDPRQAS----AFRVVSNSAPHLVDINPSSGLLVTKQKIDRDLLCRQSPKCIISLEVMS 107

Query: 763  EDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPP-GRL 821
                   +     + + I       P F   Q    + E  +PGT + +  A++P  G  
Sbjct: 108  S------SMEICVIKVEIKDLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPDSGSF 161

Query: 822  APVTLSLSGGDPRGLFSLDAVS-------GLLQTLRPLDRELLGPVLELEVRAGSGVPPA 874
               T  L+   P  LF L+  +         L   + LDRE              G PP 
Sbjct: 162  GVQTYELT---PNELFGLEIKTRGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPR 218

Query: 875  FAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLL 934
                 + + + D NDN+P F      V +P N+ P TP+  L A DPD G N +V ++  
Sbjct: 219  LGTVGLSIKVTDSNDNNPVFSESTYAVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFY 278

Query: 935  AGGGGA----FTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQD 990
                      F +DP +G V +   L    G  +EL+++A+D G     +H ++ V V D
Sbjct: 279  GYVNDRTRELFQIDPHSGLVTVTGALDYEEGHVYELDVQAKDLGPNSIPAHCKVTVSVLD 338

Query: 991  VGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGPITYHLAAEGASS------- 1043
                      N P   +      +  +++++V   AP G  I     ++  S        
Sbjct: 339  TND-------NPPVINL-----LSVNSELVEVSESAPPGYVIALVRVSDRDSGLNGRVQC 386

Query: 1044 ------PFGLEPQSGW--LWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSI 1095
                  PF L+    +  + V   LDRE  + Y L + A  G    L       +  V I
Sbjct: 387  RLLGNVPFRLQEYESFSTILVDGRLDREQHDQYNLTIQARDGGVPML---QSAKSFTVLI 443

Query: 1096 LNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLS-EDSKAF 1154
             ++N++ P  S+    + V EN  PG  +  V A D D G NG ++Y +      D   F
Sbjct: 444  TDENDNHPHFSKPYYQVIVQENNTPGAYLLSVSARDPDLGLNGSVSYQIVPSQVRDMPVF 503

Query: 1155 R---IHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTF 1211
                I+P +G++  L++ + EQ  +++  V  +DGG P   +  TV V +LD+NDN+P  
Sbjct: 504  TYVSINPNSGDIYALRSFNHEQTKAFEFKVLAKDGGLPSLQSNATVRVIILDVNDNTPV- 562

Query: 1212 LQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHSG 1271
            + A     G   + +P     G LVT ++A+D DEGENG + Y +T      F +   +G
Sbjct: 563  ITAPPLINGTAEVYIPRNSGIGYLVTVVKAEDYDEGENGRVTYDMTEGDRGFFEIDQVNG 622

Query: 1272 ELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPS 1314
            E+ T      + +  Y L + AHD G    SAS  +L+ + P+
Sbjct: 623  EVRTTRTFGESSKSSYELIVVAHDHGKTSLSASALVLIYLSPA 665



 Score =  199 bits (506), Expect = 4e-50
 Identities = 186/654 (28%), Positives = 282/654 (43%), Gaps = 68/654 (10%)

Query: 2205 QISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLT 2264
            Q S     S  A  L  ++P++G + T   +DR++        + +     + +    + 
Sbjct: 57   QASAFRVVSNSAPHLVDINPSSGLLVTKQKIDRDLLCRQSPKCIISLEVMSSSMEICVIK 116

Query: 2265 VMVIDTNDNRPTIPQPW-ELRVSEDALLGSEIAQVTGNDVDSGP--VLWYVLSPSGPQDP 2321
            V + D NDN P+ P    EL +SE A  G+ I   +  D DSG   V  Y L+P+   + 
Sbjct: 117  VEIKDLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPDSGSFGVQTYELTPN---EL 173

Query: 2322 FSV-------GRYGGRVSLTGPLDFEQCDRYQLQLLAHDG---PHEGRANLTVLVEDVND 2371
            F +       G     + +   LD E    Y  ++ A DG   P  G   L++ V D ND
Sbjct: 174  FGLEIKTRGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPRLGTVGLSIKVTDSND 233

Query: 2372 NAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADG-----FSVDP 2426
            N P FS+S Y V + E++PP + ++ ++A+D D G NG + Y      +      F +DP
Sbjct: 234  NNPVFSESTYAVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFYGYVNDRTRELFQIDP 293

Query: 2427 NNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSH 2486
            ++G L T+ G  AL ++     ++ ++A+D G     A   V V + D ND+ P   L  
Sbjct: 294  HSG-LVTVTG--ALDYEEGHVYELDVQAKDLGPNSIPAHCKVTVSVLDTNDNPPVINLLS 350

Query: 2487 YR---VAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGES 2543
                 V V+E  PPG  +  +  +D D             SG  GRV   + RL      
Sbjct: 351  VNSELVEVSESAPPGYVIALVRVSDRD-------------SGLNGRV---QCRLLGNVPF 394

Query: 2544 AGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFT 2603
                  +   +++   LD E   QYNLT+ A D G P   S    TV + D NDN P F+
Sbjct: 395  RLQEYESFSTILVDGRLDREQHDQYNLTIQARDGGVPMLQSAKSFTVLITDENDNHPHFS 454

Query: 2604 RASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGL-----FELDESSGT 2658
            +  Y+V V E+   GA LL V A D D G +G V + +       +       ++ +SG 
Sbjct: 455  KPYYQVIVQENNTPGAYLLSVSARDPDLGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGD 514

Query: 2659 LRLAHALDCETQARHQLVVQAADPAGAHF-ALAPVTIEVQDVNDHGPAFPLNLLSTSVAE 2717
            +    + + E     +  V A D       + A V + + DVND+ P      L    AE
Sbjct: 515  IYALRSFNHEQTKAFEFKVLAKDGGLPSLQSNATVRVIILDVNDNTPVITAPPLINGTAE 574

Query: 2718 -----NQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVP 2772
                 N   G LVT + A D D G  GR+ Y + E   G      F ++   GE+R    
Sbjct: 575  VYIPRNSGIGYLVTVVKAEDYDEGENGRVTYDMTEGDRG-----FFEIDQVNGEVRTTRT 629

Query: 2773 FDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGA 2826
            F      S+ L+V A D G  S S +  VL         ++L+PA   Q   G+
Sbjct: 630  FGESSKSSYELIVVAHDHGKTSLSASALVL---------IYLSPALDAQESMGS 674



 Score =  194 bits (492), Expect = 2e-48
 Identities = 175/637 (27%), Positives = 284/637 (44%), Gaps = 49/637 (7%)

Query: 2076 TIRENAPPGTPI--VSPRAVHAGGTNGP---ITYSILSGNEKGTFSIQPSTGAITVRSAE 2130
            ++ E    GT I  V+  A  AG    P     + ++S +      I PS+G +  +   
Sbjct: 28   SVEEEQRAGTVIANVAKDAREAGFALDPRQASAFRVVSNSAPHLVDINPSSGLLVTKQKI 87

Query: 2131 GLDF--EVSPRLRLVLQAESGGAFAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEG 2188
              D     SP+  + L+  S  +    V+ + ++D NDNAP F        + E+     
Sbjct: 88   DRDLLCRQSPKCIISLEVMSS-SMEICVIKVEIKDLNDNAPSFPAAQIELEISEAASPGT 146

Query: 2189 PLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTT-------GTITTTAILDREIWA 2241
             +    A D D GS G  +Y L  ++    LF ++  T         +     LDRE  +
Sbjct: 147  RIPLDSAYDPDSGSFGVQTYELTPNE----LFGLEIKTRGDGSRFAELVVEKSLDRETQS 202

Query: 2242 ETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP-WELRVSEDALLGSEIAQVTG 2300
                 + A D G P  +G+  L++ V D+NDN P   +  + + V E++   + + ++  
Sbjct: 203  HYSFRITALDGGDPPRLGTVGLSIKVTDSNDNNPVFSESTYAVSVPENSPPNTPVIRLNA 262

Query: 2301 NDVDSGPVLWYVLSPSG-----PQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHD-G 2354
            +D D G     V S  G      ++ F +  + G V++TG LD+E+   Y+L + A D G
Sbjct: 263  SDPDEGTNGQVVYSFYGYVNDRTRELFQIDPHSGLVTVTGALDYEEGHVYELDVQAKDLG 322

Query: 2355 PHE--GRANLTVLVEDVNDNAPAF---SQSLYQVMLLEHTPPGSAILSVSATDRDSGANG 2409
            P+       +TV V D NDN P     S +   V + E  PPG  I  V  +DRDSG NG
Sbjct: 323  PNSIPAHCKVTVSVLDTNDNPPVINLLSVNSELVEVSESAPPGYVIALVRVSDRDSGLNG 382

Query: 2410 HISYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVH 2469
             +   L      F +     +  TI+    L  +     ++ ++ARD G P   +  +  
Sbjct: 383  RVQCRLLGNVP-FRLQEYE-SFSTILVDGRLDREQHDQYNLTIQARDGGVPMLQSAKSFT 440

Query: 2470 VQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGR 2529
            V + D+ND+ P F+  +Y+V V E+  PG+ LL++ A D D   +  +V Y I+      
Sbjct: 441  VLITDENDNHPHFSKPYYQVIVQENNTPGAYLLSVSARDPDLGLN-GSVSYQIVPS---- 495

Query: 2530 VFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVT 2589
              Q+         S  P     G +  L   + E    +   V A D G P   S   V 
Sbjct: 496  --QVRDMPVFTYVSINPNS---GDIYALRSFNHEQTKAFEFKVLAKDGGLPSLQSNATVR 550

Query: 2590 VTVLDVNDNPPVFT-----RASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSG 2644
            V +LDVNDN PV T       +  V +P ++ +G  +  V+A D D G +G V + ++ G
Sbjct: 551  VIILDVNDNTPVITAPPLINGTAEVYIPRNSGIGYLVTVVKAEDYDEGENGRVTYDMTEG 610

Query: 2645 DPSGLFELDESSGTLRLAHALDCETQARHQLVVQAAD 2681
            D  G FE+D+ +G +R        +++ ++L+V A D
Sbjct: 611  D-RGFFEIDQVNGEVRTTRTFGESSKSSYELIVVAHD 646



 Score =  189 bits (481), Expect = 3e-47
 Identities = 176/570 (30%), Positives = 255/570 (44%), Gaps = 55/570 (9%)

Query: 2053 VIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHA-GGTNGPITYSILSGNE 2111
            VI V ++   +  P FP A  E  I E A PGT I    A     G+ G  TY  L+ NE
Sbjct: 114  VIKVEIKDLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPDSGSFGVQTYE-LTPNE 172

Query: 2112 KGTFSIQPSTGAITVRSAE-----GLDFEVSPRLRLVLQAESGG---AFAFTVLTLTLQD 2163
               F ++  T     R AE      LD E        + A  GG         L++ + D
Sbjct: 173  --LFGLEIKTRGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPRLGTVGLSIKVTD 230

Query: 2164 ANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAA--SQPARGLFH 2221
            +NDN P F    Y   +PE+ P   P++++ A D D+G+ GQ+ YS     +   R LF 
Sbjct: 231  SNDNNPVFSESTYAVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFYGYVNDRTRELFQ 290

Query: 2222 VDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIP--- 2278
            +DP +G +T T  LD E      L + A D G  ++     +TV V+DTNDN P I    
Sbjct: 291  IDPHSGLVTVTGALDYEEGHVYELDVQAKDLGPNSIPAHCKVTVSVLDTNDNPPVINLLS 350

Query: 2279 -QPWELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDPFSVGRYGG--RVSLTG 2335
                 + VSE A  G  IA V  +D DSG +   V        PF +  Y     + + G
Sbjct: 351  VNSELVEVSESAPPGYVIALVRVSDRDSG-LNGRVQCRLLGNVPFRLQEYESFSTILVDG 409

Query: 2336 PLDFEQCDRYQLQLLAHDGPH---EGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPG 2392
             LD EQ D+Y L + A DG     +   + TVL+ D NDN P FS+  YQV++ E+  PG
Sbjct: 410  RLDREQHDQYNLTIQARDGGVPMLQSAKSFTVLITDENDNHPHFSKPYYQVIVQENNTPG 469

Query: 2393 SAILSVSATDRDSGANGHISYHLA------SPADGF-SVDPNNGTLFTIVGTVALGHDGS 2445
            + +LSVSA D D G NG +SY +        P   + S++PN+G ++ +    +  H+ +
Sbjct: 470  AYLLSVSARDPDLGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGDIYAL---RSFNHEQT 526

Query: 2446 GAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPP-----GST 2500
             A +  + A+D G P   + ATV V + D ND+ P  T         E   P     G  
Sbjct: 527  KAFEFKVLAKDGGLPSLQSNATVRVIILDVNDNTPVITAPPLINGTAEVYIPRNSGIGYL 586

Query: 2501 LLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPL 2560
            +  ++A D D    +  V Y +  G+ G  F+++    E   +   G             
Sbjct: 587  VTVVKAEDYD-EGENGRVTYDMTEGDRG-FFEIDQVNGEVRTTRTFGE------------ 632

Query: 2561 DFESLTQYNLTVAAADRGQPPQSSVVPVTV 2590
               S + Y L V A D G+   S+   V +
Sbjct: 633  --SSKSSYELIVVAHDHGKTSLSASALVLI 660



 Score =  174 bits (442), Expect = 1e-42
 Identities = 185/681 (27%), Positives = 291/681 (42%), Gaps = 64/681 (9%)

Query: 1113 AVAENQPPGTSVGRVFATDRDSG--PNGRLTYSLQQLSEDSKAF-RIHPQTGEVTTLQTL 1169
            +V E Q  GT +  V    R++G   + R   + + +S  +     I+P +G + T Q +
Sbjct: 28   SVEEEQRAGTVIANVAKDAREAGFALDPRQASAFRVVSNSAPHLVDINPSSGLLVTKQKI 87

Query: 1170 DREQ--QSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVP 1227
            DR+   + S + ++ ++   S        + V + DLNDN+P+F  A       + +++ 
Sbjct: 88   DRDLLCRQSPKCIISLEVMSSSMEICV--IKVEIKDLNDNAPSFPAAQ------IELEIS 139

Query: 1228 DRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHS-------GELLTAAPLI 1280
            +   PGT +    A DPD G  G   Y LT   +ELF L   +        EL+    L 
Sbjct: 140  EAASPGTRIPLDSAYDPDSGSFGVQTYELTP--NELFGLEIKTRGDGSRFAELVVEKSLD 197

Query: 1281 RAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVT 1340
            R  + HY   ++A D G PPR  ++ L ++V  S    +  P  +E   A  VP      
Sbjct: 198  RETQSHYSFRITALDGGDPPRLGTVGLSIKVTDSN---DNNPVFSESTYAVSVP------ 248

Query: 1341 AAEGLRPGSLLGSVAAPEP--AGVGALTYTLVGGADPEGT--FALDAASGRLYLARPLDF 1396
              E   P + +  + A +P     G + Y+  G  +      F +D  SG + +   LD+
Sbjct: 249  --ENSPPNTPVIRLNASDPDEGTNGQVVYSFYGYVNDRTRELFQIDPHSGLVTVTGALDY 306

Query: 1397 EAGPPWRALTVRAE--GPGGAGARLLRVQVQVQDENEHAPAF---ARDPLALALPENPEP 1451
            E G  +  L V+A+  GP    A   +V V V D N++ P     + +   + + E+  P
Sbjct: 307  EEGHVYE-LDVQAKDLGPNSIPAHC-KVTVSVLDTNDNPPVINLLSVNSELVEVSESAPP 364

Query: 1452 GAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLL 1511
            G  +   R SD D  G N  V+ RLL   P    L+       +     LDRE      L
Sbjct: 365  GYVIALVRVSDRDS-GLNGRVQCRLLGNVPF--RLQEYESFSTILVDGRLDREQHDQYNL 421

Query: 1512 LVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPS-RVRLPEDQPPGPAALHVVAR 1570
             ++A D        ++A+ S  V +TDENDN P F+ P  +V + E+  PG   L V AR
Sbjct: 422  TIQARD--GGVPMLQSAK-SFTVLITDENDNHPHFSKPYYQVIVQENNTPGAYLLSVSAR 478

Query: 1571 DPDLGEAARVSYRLASGGDG------HFRLHSSTGALSVVRPLDREQRAEHVLTVVASDH 1624
            DPDLG    VSY++            +  ++ ++G +  +R  + EQ       V+A D 
Sbjct: 479  DPDLGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGDIYALRSFNHEQTKAFEFKVLAKDG 538

Query: 1625 GSPPRSATQVLTVSVADVNDEAPTFQQQEY-----SVLLRENNPPGTSLLTLRATDPDVG 1679
            G P   +   + V + DVND  P             V +  N+  G  +  ++A D D G
Sbjct: 539  GLPSLQSNATVRVIILDVNDNTPVITAPPLINGTAEVYIPRNSGIGYLVTVVKAEDYDEG 598

Query: 1680 ANGQVTYGGVSSES--FSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTV 1737
             NG+VTY     +   F +D   G + T R      +    L V A D G         V
Sbjct: 599  ENGRVTYDMTEGDRGFFEIDQVNGEVRTTRTFGESSKSSYELIVVAHDHGKTSLSASALV 658

Query: 1738 RVAVEDENDHAPTFGSAHLSL 1758
             + +    D   + GS +LSL
Sbjct: 659  LIYLSPALDAQESMGSVNLSL 679



 Score =  162 bits (411), Expect = 4e-39
 Identities = 131/424 (30%), Positives = 207/424 (48%), Gaps = 44/424 (10%)

Query: 2468 VHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNW 2527
            + V+++D ND+APSF  +   + ++E   PG+ +    A D D             SG++
Sbjct: 115  IKVEIKDLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPD-------------SGSF 161

Query: 2528 G-RVFQLEPRLAEAGE--SAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSS 2584
            G + ++L P      E  + G G R    LV+ + LD E+ + Y+  + A D G PP+  
Sbjct: 162  GVQTYELTPNELFGLEIKTRGDGSR-FAELVVEKSLDRETQSHYSFRITALDGGDPPRLG 220

Query: 2585 VVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFT---V 2641
             V +++ V D NDN PVF+ ++Y V+VPE++P    ++ + ASD D G +G V ++    
Sbjct: 221  TVGLSIKVTDSNDNNPVFSESTYAVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFYGY 280

Query: 2642 SSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHF-ALAPVTIEVQDVN 2700
             +     LF++D  SG + +  ALD E    ++L VQA D       A   VT+ V D N
Sbjct: 281  VNDRTRELFQIDPHSGLVTVTGALDYEEGHVYELDVQAKDLGPNSIPAHCKVTVSVLDTN 340

Query: 2701 DHGPAFPLNLLSTS-----VAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGP-GPEG 2754
            D+ P   +NLLS +     V+E+ PPG ++  +   D D+G  GR++  LL   P   + 
Sbjct: 341  DNPPV--INLLSVNSELVEVSESAPPGYVIALVRVSDRDSGLNGRVQCRLLGNVPFRLQE 398

Query: 2755 REAFALNSSTGELRARVPFDYEHTESFRLLVGAADAG--NLSASVTVSVLVTGEDEYDPV 2812
             E+F+     G L      D E  + + L + A D G   L ++ + +VL+T E++  P 
Sbjct: 399  YESFSTILVDGRL------DREQHDQYNLTIQARDGGVPMLQSAKSFTVLITDENDNHPH 452

Query: 2813 FLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSS-------PYFGINQTT 2865
            F  P +   V E    G  L  V A D D G +G V Y +  S         Y  IN  +
Sbjct: 453  FSKPYYQVIVQENNTPGAYLLSVSARDPDLGLNGSVSYQIVPSQVRDMPVFTYVSINPNS 512

Query: 2866 GALY 2869
            G +Y
Sbjct: 513  GDIY 516


>gi|157426845 protocadherin 19 isoform b [Homo sapiens]
          Length = 1100

 Score =  342 bits (876), Expect = 5e-93
 Identities = 247/687 (35%), Positives = 356/687 (51%), Gaps = 50/687 (7%)

Query: 21  LLLPLLLLLLLLLGAGVPGAWGQAGSL---DLQIDEEQPAGTLIGDISAGL-PAGTAAPL 76
           LLLP+LLLL +L        W QA +L      ++EEQ AGT+I +++     AG A   
Sbjct: 4   LLLPVLLLLAIL--------WTQAAALINLKYSVEEEQRAGTVIANVAKDAREAGFALDP 55

Query: 77  MYFISAQEGSGVGTDLA-IDEHSGVVRTARVLDREQRDRYR------FTAVTPDGATVEV 129
               + +  S     L  I+  SG++ T + +DR+   R           ++       +
Sbjct: 56  RQASAFRVVSNSAPHLVDINPSSGLLVTKQKIDRDLLCRQSPKCIISLEVMSSSMEICVI 115

Query: 130 TVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGE 189
            V + D+ND+AP+FP A+  L++ E  + GTR PL+ A D D+G  G Q Y L+ +   E
Sbjct: 116 KVEIKDLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPDSGSFGVQTYELTPN---E 172

Query: 190 TFRLETRPGPDGTPVPELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDIN 249
            F LE +   DG+   ELVV   LDRE +SHY  ++ A DGG PPR     L + + D N
Sbjct: 173 LFGLEIKTRGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPRLGTVGLSIKVTDSN 232

Query: 250 DHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYE----INRRQSEGDGPF 305
           D+ P F++S Y   V E+  P +PV+++ ASD D G NG V Y     +N R  E    F
Sbjct: 233 DNNPVFSESTYAVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFYGYVNDRTRE---LF 289

Query: 306 SIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTVI 365
            ID H+GL+ +   LD+E+  V+EL VQA+D G +       VTV V D NDN P + ++
Sbjct: 290 QIDPHSGLVTVTGALDYEEGHVYELDVQAKDLGPNSIPAHCKVTVSVLDTNDNPPVINLL 349

Query: 366 FLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVC 425
            ++++   +VSE+APPG ++A + VSD D G    V   L G    F L   +S    + 
Sbjct: 350 SVNSE-LVEVSESAPPGYVIALVRVSDRDSGLNGRVQCRLLGNV-PFRLQEYES-FSTIL 406

Query: 426 VARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEV 485
           V  RLDRE+ D YNL + A D G P L++  +F + +TD NDN P F +  Y+   + E 
Sbjct: 407 VDGRLDREQHDQYNLTIQARDGGVPMLQSAKSFTVLITDENDNHPHFSKPYYQ-VIVQEN 465

Query: 486 ALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTH-----WFSIDPTSGIITTAASLDYEL 540
             PG++++ V+ARDPD G NG V+Y + P          + SI+P SG I    S ++E 
Sbjct: 466 NTPGAYLLSVSARDPDLGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGDIYALRSFNHEQ 525

Query: 541 EPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQR-TFYNAS----LPEGTQPGT 595
               +  V+A DGGLP L S+ATV V + DVNDN P        N +    +P  +  G 
Sbjct: 526 TKAFEFKVLAKDGGLPSLQSNATVRVIILDVNDNTPVITAPPLINGTAEVYIPRNSGIGY 585

Query: 596 CFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDF 655
               V A D D G  G ++Y +  G        F ID  +G+V TTRT   +   SS++ 
Sbjct: 586 LVTVVKAEDYDEGENGRVTYDMTEG----DRGFFEIDQVNGEVRTTRTFG-ESSKSSYEL 640

Query: 656 TVTAVDGG--GLKSMVYVKVFLSDEND 680
            V A D G   L +   V ++LS   D
Sbjct: 641 IVVAHDHGKTSLSASALVLIYLSPALD 667



 Score =  212 bits (539), Expect = 6e-54
 Identities = 185/676 (27%), Positives = 294/676 (43%), Gaps = 60/676 (8%)

Query: 1212 LQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEG------ENGTILYTLTGPGSELFS 1265
            L    AA   L   V +    GT++  + AKD  E          +    ++     L  
Sbjct: 15   LWTQAAALINLKYSVEEEQRAGTVIANV-AKDAREAGFALDPRQASAFRVVSNSAPHLVD 73

Query: 1266 LHPHSGELLTAAPLIR----AERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPP 1321
            ++P SG L+T   + R     + P  +++L          S+S+++ V  +    L +  
Sbjct: 74   INPSSGLLVTKQKIDRDLLCRQSPKCIISLEV-------MSSSMEICVIKVEIKDLNDNA 126

Query: 1322 PDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFAL 1381
            P      PAA + + ++  A+ G R    L S   P+    G  TY L     P   F L
Sbjct: 127  PSF----PAAQIELEISEAASPGTRIP--LDSAYDPDSGSFGVQTYELT----PNELFGL 176

Query: 1382 DAAS-------GRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAP 1434
            +  +         L + + LD E    +       +G        + + ++V D N++ P
Sbjct: 177  EIKTRGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPRLGTVGLSIKVTDSNDNNP 236

Query: 1435 AFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLR--QEPPVPALRLDART 1492
             F+    A+++PEN  P   +    ASD D  G N  V Y       +      ++D  +
Sbjct: 237  VFSESTYAVSVPENSPPNTPVIRLNASDPD-EGTNGQVVYSFYGYVNDRTRELFQIDPHS 295

Query: 1493 GALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVF----AS 1548
            G ++    LD E      L V+A D   N+     A     V V D NDN PV      +
Sbjct: 296  GLVTVTGALDYEEGHVYELDVQAKDLGPNSI---PAHCKVTVSVLDTNDNPPVINLLSVN 352

Query: 1549 PSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLD 1608
               V + E  PPG     V   D D G   RV  RL        + + S   + V   LD
Sbjct: 353  SELVEVSESAPPGYVIALVRVSDRDSGLNGRVQCRLLGNVPFRLQEYESFSTILVDGRLD 412

Query: 1609 REQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSL 1668
            REQ  ++ LT+ A D G P   + +  TV + D ND  P F +  Y V+++ENN PG  L
Sbjct: 413  REQHDQYNLTIQARDGGVPMLQSAKSFTVLITDENDNHPHFSKPYYQVIVQENNTPGAYL 472

Query: 1669 LTLRATDPDVGANGQVTYGGVSSE--------SFSLDPDTGVLTTLRALDREEQEEINLT 1720
            L++ A DPD+G NG V+Y  V S+          S++P++G +  LR+ + E+ +     
Sbjct: 473  LSVSARDPDLGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGDIYALRSFNHEQTKAFEFK 532

Query: 1721 VYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQT------LTMLRA 1774
            V A+D G P   ++ TVRV + D ND+ P   +  L     E   P+       +T+++A
Sbjct: 533  VLAKDGGLPSLQSNATVRVIILDVNDNTPVITAPPLINGTAEVYIPRNSGIGYLVTVVKA 592

Query: 1775 SDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPA 1834
             D D G NG++ Y + +GD  G F +D  +GE  T R      + +++L + A D G+ +
Sbjct: 593  EDYDEGENGRVTYDMTEGD-RGFFEIDQVNGEVRTTRTFGESSKSSYELIVVAHDHGKTS 651

Query: 1835 LSATLLLTVTVLDAND 1850
            LSA+ L+ + +  A D
Sbjct: 652  LSASALVLIYLSPALD 667



 Score =  211 bits (536), Expect = 1e-53
 Identities = 179/619 (28%), Positives = 284/619 (45%), Gaps = 51/619 (8%)

Query: 497  ARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYEL--EPQPQLIVVATDGG 554
            A DP Q +  +V  + AP    H   I+P+SG++ T   +D +L     P+ I+      
Sbjct: 52   ALDPRQASAFRVVSNSAP----HLVDINPSSGLLVTKQKIDRDLLCRQSPKCII-----S 102

Query: 555  LPPLASS---ATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFG 611
            L  ++SS     + V ++D+NDN P F        + E   PGT     +A D DSG FG
Sbjct: 103  LEVMSSSMEICVIKVEIKDLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPDSGSFG 162

Query: 612  LLSYSL------GAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGL 665
            + +Y L      G  + + G       +   ++   ++LDR+   S + F +TA+DGG  
Sbjct: 163  VQTYELTPNELFGLEIKTRGD-----GSRFAELVVEKSLDRET-QSHYSFRITALDGGDP 216

Query: 666  KSM--VYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYH 723
              +  V + + ++D NDN P F    YA S+   SPP T V+RL A DPD+G++G++ Y 
Sbjct: 217  PRLGTVGLSIKVTDSNDNNPVFSESTYAVSVPENSPPNTPVIRLNASDPDEGTNGQVVYS 276

Query: 724  I---LAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISI 780
                +   +  LF +D  SGL+TV   L      V +L++ A+D G        +V +S+
Sbjct: 277  FYGYVNDRTRELFQIDPHSGLVTVTGALDYEEGHVYELDVQAKDLGPNSIPAHCKVTVSV 336

Query: 781  VPGTPTPPIFEQLQY---VFSVPEDVAPGTSVGIVQ-AHNPPGRLAPVTLSLSGGDPRGL 836
            +     PP+   L     +  V E   PG  + +V+ +    G    V   L G  P  L
Sbjct: 337  LDTNDNPPVINLLSVNSELVEVSESAPPGYVIALVRVSDRDSGLNGRVQCRLLGNVPFRL 396

Query: 837  FSLDAVSGLLQTLRPLDRELLGPV-LELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFP 895
               ++ S +L   R LDRE      L ++ R G GVP   +     VL+ D NDN P F 
Sbjct: 397  QEYESFSTILVDGR-LDREQHDQYNLTIQARDG-GVPMLQSAKSFTVLITDENDNHPHFS 454

Query: 896  APEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAG---GGGAFT---VDPTTGH 949
             P   V++  N  PG  + ++ A DPD G+N  V++ ++         FT   ++P +G 
Sbjct: 455  KPYYQVIVQENNTPGAYLLSVSARDPDLGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGD 514

Query: 950  VRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRG---LAPRFNSPTYR 1006
            +  +R        A E ++ A+DGG P   S+  +RV++ DV        AP   + T  
Sbjct: 515  IYALRSFNHEQTKAFEFKVLAKDGGLPSLQSNATVRVIILDVNDNTPVITAPPLINGTAE 574

Query: 1007 VDLPSGTTAGTQVLQVQAQAPD---GGPITYHLAAEGASSPFGLEPQSGWLWVRAALDRE 1063
            V +P  +  G  V  V+A+  D    G +TY +  EG    F ++  +G +         
Sbjct: 575  VYIPRNSGIGYLVTVVKAEDYDEGENGRVTYDM-TEGDRGFFEIDQVNGEVRTTRTFGES 633

Query: 1064 AQELYILKVMAVSGSKAEL 1082
            ++  Y L V+A    K  L
Sbjct: 634  SKSSYELIVVAHDHGKTSL 652



 Score =  209 bits (531), Expect = 5e-53
 Identities = 166/603 (27%), Positives = 270/603 (44%), Gaps = 49/603 (8%)

Query: 1696 LDPDTGVLTTLRALDREE--QEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGS 1753
            ++P +G+L T + +DR+   ++     +  +   S  ++    ++V ++D ND+AP+F +
Sbjct: 74   INPSSGLLVTKQKIDRDLLCRQSPKCIISLEVMSSSMEIC--VIKVEIKDLNDNAPSFPA 131

Query: 1754 AHLSLEVPEGQDPQTLTML-RASDPDVGANGQLQYRILDGDPSGAFVLDLASG----EFG 1808
            A + LE+ E   P T   L  A DPD G+ G   Y +   +  G  +     G    E  
Sbjct: 132  AQIELEISEAASPGTRIPLDSAYDPDSGSFGVQTYELTPNELFGLEIKTRGDGSRFAELV 191

Query: 1809 TMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDV 1868
              + LDRE +  +  RI A DGG P    T+ L++ V D+ND+ P F    Y+V VPE+ 
Sbjct: 192  VEKSLDRETQSHYSFRITALDGGDPPRLGTVGLSIKVTDSNDNNPVFSESTYAVSVPENS 251

Query: 1869 PAGTLLLQLQAHDPDAGANGHVTY----YLGAGTAGAFLLEPSSGELRTAAALDREQCPS 1924
            P  T +++L A DPD G NG V Y    Y+   T   F ++P SG +    ALD E+   
Sbjct: 252  PPNTPVIRLNASDPDEGTNGQVVYSFYGYVNDRTRELFQIDPHSGLVTVTGALDYEEGHV 311

Query: 1925 YTFSVSAVDGAAAGPLSTTV--SVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLA 1982
            Y   V A D    GP S      VT++V D ND+ P      +   L     S + P   
Sbjct: 312  YELDVQAKD---LGPNSIPAHCKVTVSVLDTNDNPPVINLLSVNSELVEVSES-APPGYV 367

Query: 1983 LATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRV------L 2036
            +A +R  DRD+G N  +  RL G  P          E     + +  G  DR       L
Sbjct: 368  IALVRVSDRDSGLNGRVQCRLLGNVP------FRLQEYESFSTILVDGRLDREQHDQYNL 421

Query: 2037 FIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHAG 2096
             I A D G P   +     V +  E +  P F +   +  ++EN  PG  ++S  A    
Sbjct: 422  TIQARDGGVPMLQSAKSFTVLITDENDNHPHFSKPYYQVIVQENNTPGAYLLSVSARDPD 481

Query: 2097 -GTNGPITYSILSGNEKGT-----FSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGG 2150
             G NG ++Y I+    +        SI P++G   + +    + E +      + A+ GG
Sbjct: 482  LGLNGSVSYQIVPSQVRDMPVFTYVSINPNSG--DIYALRSFNHEQTKAFEFKVLAKDGG 539

Query: 2151 AFAF---TVLTLTLQDANDNAPRFLRPHYV-----AFLPESRPLEGPLLQVEADDLDQGS 2202
              +      + + + D NDN P    P  +      ++P +  +   +  V+A+D D+G 
Sbjct: 540  LPSLQSNATVRVIILDVNDNTPVITAPPLINGTAEVYIPRNSGIGYLVTVVKAEDYDEGE 599

Query: 2203 GGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSAT 2262
             G+++Y +  ++  RG F +D   G + TT        +   L+++A D G  +L  SA 
Sbjct: 600  NGRVTYDM--TEGDRGFFEIDQVNGEVRTTRTFGESSKSSYELIVVAHDHGKTSLSASAL 657

Query: 2263 LTV 2265
            + +
Sbjct: 658  VLI 660



 Score =  199 bits (507), Expect = 3e-50
 Identities = 168/643 (26%), Positives = 274/643 (42%), Gaps = 66/643 (10%)

Query: 709  AHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLTVAWPLAR------RANSVVQLEIGA 762
            A DP Q S    ++ +++ ++P L  ++  SGLL     + R          ++ LE+ +
Sbjct: 52   ALDPRQAS----AFRVVSNSAPHLVDINPSSGLLVTKQKIDRDLLCRQSPKCIISLEVMS 107

Query: 763  EDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPP-GRL 821
                   +     + + I       P F   Q    + E  +PGT + +  A++P  G  
Sbjct: 108  S------SMEICVIKVEIKDLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPDSGSF 161

Query: 822  APVTLSLSGGDPRGLFSLDAVS-------GLLQTLRPLDRELLGPVLELEVRAGSGVPPA 874
               T  L+   P  LF L+  +         L   + LDRE              G PP 
Sbjct: 162  GVQTYELT---PNELFGLEIKTRGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPR 218

Query: 875  FAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLL 934
                 + + + D NDN+P F      V +P N+ P TP+  L A DPD G N +V ++  
Sbjct: 219  LGTVGLSIKVTDSNDNNPVFSESTYAVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFY 278

Query: 935  AGGGGA----FTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVVQD 990
                      F +DP +G V +   L    G  +EL+++A+D G     +H ++ V V D
Sbjct: 279  GYVNDRTRELFQIDPHSGLVTVTGALDYEEGHVYELDVQAKDLGPNSIPAHCKVTVSVLD 338

Query: 991  VGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGPITYHLAAEGASS------- 1043
                      N P   +      +  +++++V   AP G  I     ++  S        
Sbjct: 339  TND-------NPPVINL-----LSVNSELVEVSESAPPGYVIALVRVSDRDSGLNGRVQC 386

Query: 1044 ------PFGLEPQSGW--LWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSI 1095
                  PF L+    +  + V   LDRE  + Y L + A  G    L       +  V I
Sbjct: 387  RLLGNVPFRLQEYESFSTILVDGRLDREQHDQYNLTIQARDGGVPML---QSAKSFTVLI 443

Query: 1096 LNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLS-EDSKAF 1154
             ++N++ P  S+    + V EN  PG  +  V A D D G NG ++Y +      D   F
Sbjct: 444  TDENDNHPHFSKPYYQVIVQENNTPGAYLLSVSARDPDLGLNGSVSYQIVPSQVRDMPVF 503

Query: 1155 R---IHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTF 1211
                I+P +G++  L++ + EQ  +++  V  +DGG P   +  TV V +LD+NDN+P  
Sbjct: 504  TYVSINPNSGDIYALRSFNHEQTKAFEFKVLAKDGGLPSLQSNATVRVIILDVNDNTPV- 562

Query: 1212 LQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHSG 1271
            + A     G   + +P     G LVT ++A+D DEGENG + Y +T      F +   +G
Sbjct: 563  ITAPPLINGTAEVYIPRNSGIGYLVTVVKAEDYDEGENGRVTYDMTEGDRGFFEIDQVNG 622

Query: 1272 ELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPS 1314
            E+ T      + +  Y L + AHD G    SAS  +L+ + P+
Sbjct: 623  EVRTTRTFGESSKSSYELIVVAHDHGKTSLSASALVLIYLSPA 665



 Score =  199 bits (506), Expect = 4e-50
 Identities = 186/654 (28%), Positives = 282/654 (43%), Gaps = 68/654 (10%)

Query: 2205 QISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLT 2264
            Q S     S  A  L  ++P++G + T   +DR++        + +     + +    + 
Sbjct: 57   QASAFRVVSNSAPHLVDINPSSGLLVTKQKIDRDLLCRQSPKCIISLEVMSSSMEICVIK 116

Query: 2265 VMVIDTNDNRPTIPQPW-ELRVSEDALLGSEIAQVTGNDVDSGP--VLWYVLSPSGPQDP 2321
            V + D NDN P+ P    EL +SE A  G+ I   +  D DSG   V  Y L+P+   + 
Sbjct: 117  VEIKDLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPDSGSFGVQTYELTPN---EL 173

Query: 2322 FSV-------GRYGGRVSLTGPLDFEQCDRYQLQLLAHDG---PHEGRANLTVLVEDVND 2371
            F +       G     + +   LD E    Y  ++ A DG   P  G   L++ V D ND
Sbjct: 174  FGLEIKTRGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPRLGTVGLSIKVTDSND 233

Query: 2372 NAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADG-----FSVDP 2426
            N P FS+S Y V + E++PP + ++ ++A+D D G NG + Y      +      F +DP
Sbjct: 234  NNPVFSESTYAVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFYGYVNDRTRELFQIDP 293

Query: 2427 NNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSH 2486
            ++G L T+ G  AL ++     ++ ++A+D G     A   V V + D ND+ P   L  
Sbjct: 294  HSG-LVTVTG--ALDYEEGHVYELDVQAKDLGPNSIPAHCKVTVSVLDTNDNPPVINLLS 350

Query: 2487 YR---VAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGES 2543
                 V V+E  PPG  +  +  +D D             SG  GRV   + RL      
Sbjct: 351  VNSELVEVSESAPPGYVIALVRVSDRD-------------SGLNGRV---QCRLLGNVPF 394

Query: 2544 AGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFT 2603
                  +   +++   LD E   QYNLT+ A D G P   S    TV + D NDN P F+
Sbjct: 395  RLQEYESFSTILVDGRLDREQHDQYNLTIQARDGGVPMLQSAKSFTVLITDENDNHPHFS 454

Query: 2604 RASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGL-----FELDESSGT 2658
            +  Y+V V E+   GA LL V A D D G +G V + +       +       ++ +SG 
Sbjct: 455  KPYYQVIVQENNTPGAYLLSVSARDPDLGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGD 514

Query: 2659 LRLAHALDCETQARHQLVVQAADPAGAHF-ALAPVTIEVQDVNDHGPAFPLNLLSTSVAE 2717
            +    + + E     +  V A D       + A V + + DVND+ P      L    AE
Sbjct: 515  IYALRSFNHEQTKAFEFKVLAKDGGLPSLQSNATVRVIILDVNDNTPVITAPPLINGTAE 574

Query: 2718 -----NQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVP 2772
                 N   G LVT + A D D G  GR+ Y + E   G      F ++   GE+R    
Sbjct: 575  VYIPRNSGIGYLVTVVKAEDYDEGENGRVTYDMTEGDRG-----FFEIDQVNGEVRTTRT 629

Query: 2773 FDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGA 2826
            F      S+ L+V A D G  S S +  VL         ++L+PA   Q   G+
Sbjct: 630  FGESSKSSYELIVVAHDHGKTSLSASALVL---------IYLSPALDAQESMGS 674



 Score =  194 bits (492), Expect = 2e-48
 Identities = 175/637 (27%), Positives = 284/637 (44%), Gaps = 49/637 (7%)

Query: 2076 TIRENAPPGTPI--VSPRAVHAGGTNGP---ITYSILSGNEKGTFSIQPSTGAITVRSAE 2130
            ++ E    GT I  V+  A  AG    P     + ++S +      I PS+G +  +   
Sbjct: 28   SVEEEQRAGTVIANVAKDAREAGFALDPRQASAFRVVSNSAPHLVDINPSSGLLVTKQKI 87

Query: 2131 GLDF--EVSPRLRLVLQAESGGAFAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEG 2188
              D     SP+  + L+  S  +    V+ + ++D NDNAP F        + E+     
Sbjct: 88   DRDLLCRQSPKCIISLEVMSS-SMEICVIKVEIKDLNDNAPSFPAAQIELEISEAASPGT 146

Query: 2189 PLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTT-------GTITTTAILDREIWA 2241
             +    A D D GS G  +Y L  ++    LF ++  T         +     LDRE  +
Sbjct: 147  RIPLDSAYDPDSGSFGVQTYELTPNE----LFGLEIKTRGDGSRFAELVVEKSLDRETQS 202

Query: 2242 ETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP-WELRVSEDALLGSEIAQVTG 2300
                 + A D G P  +G+  L++ V D+NDN P   +  + + V E++   + + ++  
Sbjct: 203  HYSFRITALDGGDPPRLGTVGLSIKVTDSNDNNPVFSESTYAVSVPENSPPNTPVIRLNA 262

Query: 2301 NDVDSGPVLWYVLSPSG-----PQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHD-G 2354
            +D D G     V S  G      ++ F +  + G V++TG LD+E+   Y+L + A D G
Sbjct: 263  SDPDEGTNGQVVYSFYGYVNDRTRELFQIDPHSGLVTVTGALDYEEGHVYELDVQAKDLG 322

Query: 2355 PHE--GRANLTVLVEDVNDNAPAF---SQSLYQVMLLEHTPPGSAILSVSATDRDSGANG 2409
            P+       +TV V D NDN P     S +   V + E  PPG  I  V  +DRDSG NG
Sbjct: 323  PNSIPAHCKVTVSVLDTNDNPPVINLLSVNSELVEVSESAPPGYVIALVRVSDRDSGLNG 382

Query: 2410 HISYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVH 2469
             +   L      F +     +  TI+    L  +     ++ ++ARD G P   +  +  
Sbjct: 383  RVQCRLLGNVP-FRLQEYE-SFSTILVDGRLDREQHDQYNLTIQARDGGVPMLQSAKSFT 440

Query: 2470 VQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGR 2529
            V + D+ND+ P F+  +Y+V V E+  PG+ LL++ A D D   +  +V Y I+      
Sbjct: 441  VLITDENDNHPHFSKPYYQVIVQENNTPGAYLLSVSARDPDLGLN-GSVSYQIVPS---- 495

Query: 2530 VFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVT 2589
              Q+         S  P     G +  L   + E    +   V A D G P   S   V 
Sbjct: 496  --QVRDMPVFTYVSINPNS---GDIYALRSFNHEQTKAFEFKVLAKDGGLPSLQSNATVR 550

Query: 2590 VTVLDVNDNPPVFT-----RASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSG 2644
            V +LDVNDN PV T       +  V +P ++ +G  +  V+A D D G +G V + ++ G
Sbjct: 551  VIILDVNDNTPVITAPPLINGTAEVYIPRNSGIGYLVTVVKAEDYDEGENGRVTYDMTEG 610

Query: 2645 DPSGLFELDESSGTLRLAHALDCETQARHQLVVQAAD 2681
            D  G FE+D+ +G +R        +++ ++L+V A D
Sbjct: 611  D-RGFFEIDQVNGEVRTTRTFGESSKSSYELIVVAHD 646



 Score =  189 bits (481), Expect = 3e-47
 Identities = 176/570 (30%), Positives = 255/570 (44%), Gaps = 55/570 (9%)

Query: 2053 VIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHA-GGTNGPITYSILSGNE 2111
            VI V ++   +  P FP A  E  I E A PGT I    A     G+ G  TY  L+ NE
Sbjct: 114  VIKVEIKDLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPDSGSFGVQTYE-LTPNE 172

Query: 2112 KGTFSIQPSTGAITVRSAE-----GLDFEVSPRLRLVLQAESGG---AFAFTVLTLTLQD 2163
               F ++  T     R AE      LD E        + A  GG         L++ + D
Sbjct: 173  --LFGLEIKTRGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPRLGTVGLSIKVTD 230

Query: 2164 ANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAA--SQPARGLFH 2221
            +NDN P F    Y   +PE+ P   P++++ A D D+G+ GQ+ YS     +   R LF 
Sbjct: 231  SNDNNPVFSESTYAVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFYGYVNDRTRELFQ 290

Query: 2222 VDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIP--- 2278
            +DP +G +T T  LD E      L + A D G  ++     +TV V+DTNDN P I    
Sbjct: 291  IDPHSGLVTVTGALDYEEGHVYELDVQAKDLGPNSIPAHCKVTVSVLDTNDNPPVINLLS 350

Query: 2279 -QPWELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDPFSVGRYGG--RVSLTG 2335
                 + VSE A  G  IA V  +D DSG +   V        PF +  Y     + + G
Sbjct: 351  VNSELVEVSESAPPGYVIALVRVSDRDSG-LNGRVQCRLLGNVPFRLQEYESFSTILVDG 409

Query: 2336 PLDFEQCDRYQLQLLAHDGPH---EGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPG 2392
             LD EQ D+Y L + A DG     +   + TVL+ D NDN P FS+  YQV++ E+  PG
Sbjct: 410  RLDREQHDQYNLTIQARDGGVPMLQSAKSFTVLITDENDNHPHFSKPYYQVIVQENNTPG 469

Query: 2393 SAILSVSATDRDSGANGHISYHLA------SPADGF-SVDPNNGTLFTIVGTVALGHDGS 2445
            + +LSVSA D D G NG +SY +        P   + S++PN+G ++ +    +  H+ +
Sbjct: 470  AYLLSVSARDPDLGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGDIYAL---RSFNHEQT 526

Query: 2446 GAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPP-----GST 2500
             A +  + A+D G P   + ATV V + D ND+ P  T         E   P     G  
Sbjct: 527  KAFEFKVLAKDGGLPSLQSNATVRVIILDVNDNTPVITAPPLINGTAEVYIPRNSGIGYL 586

Query: 2501 LLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPL 2560
            +  ++A D D    +  V Y +  G+ G  F+++    E   +   G             
Sbjct: 587  VTVVKAEDYD-EGENGRVTYDMTEGDRG-FFEIDQVNGEVRTTRTFGE------------ 632

Query: 2561 DFESLTQYNLTVAAADRGQPPQSSVVPVTV 2590
               S + Y L V A D G+   S+   V +
Sbjct: 633  --SSKSSYELIVVAHDHGKTSLSASALVLI 660



 Score =  174 bits (442), Expect = 1e-42
 Identities = 185/681 (27%), Positives = 291/681 (42%), Gaps = 64/681 (9%)

Query: 1113 AVAENQPPGTSVGRVFATDRDSG--PNGRLTYSLQQLSEDSKAF-RIHPQTGEVTTLQTL 1169
            +V E Q  GT +  V    R++G   + R   + + +S  +     I+P +G + T Q +
Sbjct: 28   SVEEEQRAGTVIANVAKDAREAGFALDPRQASAFRVVSNSAPHLVDINPSSGLLVTKQKI 87

Query: 1170 DREQ--QSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVP 1227
            DR+   + S + ++ ++   S        + V + DLNDN+P+F  A       + +++ 
Sbjct: 88   DRDLLCRQSPKCIISLEVMSSSMEICV--IKVEIKDLNDNAPSFPAAQ------IELEIS 139

Query: 1228 DRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHS-------GELLTAAPLI 1280
            +   PGT +    A DPD G  G   Y LT   +ELF L   +        EL+    L 
Sbjct: 140  EAASPGTRIPLDSAYDPDSGSFGVQTYELTP--NELFGLEIKTRGDGSRFAELVVEKSLD 197

Query: 1281 RAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVT 1340
            R  + HY   ++A D G PPR  ++ L ++V  S    +  P  +E   A  VP      
Sbjct: 198  RETQSHYSFRITALDGGDPPRLGTVGLSIKVTDSN---DNNPVFSESTYAVSVP------ 248

Query: 1341 AAEGLRPGSLLGSVAAPEP--AGVGALTYTLVGGADPEGT--FALDAASGRLYLARPLDF 1396
              E   P + +  + A +P     G + Y+  G  +      F +D  SG + +   LD+
Sbjct: 249  --ENSPPNTPVIRLNASDPDEGTNGQVVYSFYGYVNDRTRELFQIDPHSGLVTVTGALDY 306

Query: 1397 EAGPPWRALTVRAE--GPGGAGARLLRVQVQVQDENEHAPAF---ARDPLALALPENPEP 1451
            E G  +  L V+A+  GP    A   +V V V D N++ P     + +   + + E+  P
Sbjct: 307  EEGHVYE-LDVQAKDLGPNSIPAHC-KVTVSVLDTNDNPPVINLLSVNSELVEVSESAPP 364

Query: 1452 GAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLL 1511
            G  +   R SD D  G N  V+ RLL   P    L+       +     LDRE      L
Sbjct: 365  GYVIALVRVSDRDS-GLNGRVQCRLLGNVPF--RLQEYESFSTILVDGRLDREQHDQYNL 421

Query: 1512 LVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPS-RVRLPEDQPPGPAALHVVAR 1570
             ++A D        ++A+ S  V +TDENDN P F+ P  +V + E+  PG   L V AR
Sbjct: 422  TIQARD--GGVPMLQSAK-SFTVLITDENDNHPHFSKPYYQVIVQENNTPGAYLLSVSAR 478

Query: 1571 DPDLGEAARVSYRLASGGDG------HFRLHSSTGALSVVRPLDREQRAEHVLTVVASDH 1624
            DPDLG    VSY++            +  ++ ++G +  +R  + EQ       V+A D 
Sbjct: 479  DPDLGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGDIYALRSFNHEQTKAFEFKVLAKDG 538

Query: 1625 GSPPRSATQVLTVSVADVNDEAPTFQQQEY-----SVLLRENNPPGTSLLTLRATDPDVG 1679
            G P   +   + V + DVND  P             V +  N+  G  +  ++A D D G
Sbjct: 539  GLPSLQSNATVRVIILDVNDNTPVITAPPLINGTAEVYIPRNSGIGYLVTVVKAEDYDEG 598

Query: 1680 ANGQVTYGGVSSES--FSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTV 1737
             NG+VTY     +   F +D   G + T R      +    L V A D G         V
Sbjct: 599  ENGRVTYDMTEGDRGFFEIDQVNGEVRTTRTFGESSKSSYELIVVAHDHGKTSLSASALV 658

Query: 1738 RVAVEDENDHAPTFGSAHLSL 1758
             + +    D   + GS +LSL
Sbjct: 659  LIYLSPALDAQESMGSVNLSL 679



 Score =  162 bits (411), Expect = 4e-39
 Identities = 131/424 (30%), Positives = 207/424 (48%), Gaps = 44/424 (10%)

Query: 2468 VHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNW 2527
            + V+++D ND+APSF  +   + ++E   PG+ +    A D D             SG++
Sbjct: 115  IKVEIKDLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPD-------------SGSF 161

Query: 2528 G-RVFQLEPRLAEAGE--SAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSS 2584
            G + ++L P      E  + G G R    LV+ + LD E+ + Y+  + A D G PP+  
Sbjct: 162  GVQTYELTPNELFGLEIKTRGDGSR-FAELVVEKSLDRETQSHYSFRITALDGGDPPRLG 220

Query: 2585 VVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFT---V 2641
             V +++ V D NDN PVF+ ++Y V+VPE++P    ++ + ASD D G +G V ++    
Sbjct: 221  TVGLSIKVTDSNDNNPVFSESTYAVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFYGY 280

Query: 2642 SSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHF-ALAPVTIEVQDVN 2700
             +     LF++D  SG + +  ALD E    ++L VQA D       A   VT+ V D N
Sbjct: 281  VNDRTRELFQIDPHSGLVTVTGALDYEEGHVYELDVQAKDLGPNSIPAHCKVTVSVLDTN 340

Query: 2701 DHGPAFPLNLLSTS-----VAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGP-GPEG 2754
            D+ P   +NLLS +     V+E+ PPG ++  +   D D+G  GR++  LL   P   + 
Sbjct: 341  DNPPV--INLLSVNSELVEVSESAPPGYVIALVRVSDRDSGLNGRVQCRLLGNVPFRLQE 398

Query: 2755 REAFALNSSTGELRARVPFDYEHTESFRLLVGAADAG--NLSASVTVSVLVTGEDEYDPV 2812
             E+F+     G L      D E  + + L + A D G   L ++ + +VL+T E++  P 
Sbjct: 399  YESFSTILVDGRL------DREQHDQYNLTIQARDGGVPMLQSAKSFTVLITDENDNHPH 452

Query: 2813 FLAPAFHFQVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSS-------PYFGINQTT 2865
            F  P +   V E    G  L  V A D D G +G V Y +  S         Y  IN  +
Sbjct: 453  FSKPYYQVIVQENNTPGAYLLSVSARDPDLGLNGSVSYQIVPSQVRDMPVFTYVSINPNS 512

Query: 2866 GALY 2869
            G +Y
Sbjct: 513  GDIY 516


>gi|7657443 protocadherin 11 X-linked isoform a precursor [Homo
           sapiens]
          Length = 1021

 Score =  330 bits (845), Expect = 2e-89
 Identities = 240/721 (33%), Positives = 361/721 (50%), Gaps = 42/721 (5%)

Query: 51  IDEEQPAGTLIGDISAGL-----PAGTAAPLMYFISAQEGSGVGTDLAIDEHSG-VVRTA 104
           I EE P   LIGD+   L     P  +    M F    +   V   + I+E +G +  T 
Sbjct: 30  IREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPL-IRIEEDTGEIFTTG 88

Query: 105 RVLDREQ------RDRYRF----TAVTPDGATVEVTVR--VADINDHAPAFPQARAALQV 152
             +DRE+      RD + F     A+ PD     V +R  + DIND+AP FP     + +
Sbjct: 89  ARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISI 148

Query: 153 PEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGE 212
           PE++A  ++Y L  A D D G  G Q Y L    +   F L+    P+G  +P+L+V  E
Sbjct: 149 PENSAINSKYTLPAAVDPDVGINGVQNYELIK--SQNIFGLDVIETPEGDKMPQLIVQKE 206

Query: 213 LDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGS 272
           LDRE +  Y+++++  DGG P R + A+L V++ D ND+ P F ++     + E+   G+
Sbjct: 207 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGT 266

Query: 273 PVLQVFASDADAGVNGAVTYEINRRQSE-GDGPFSIDAHTGLLQLERPLDFEQRRVHELV 331
            V Q+ A+DAD G N  + +  +   S      F ++A TGL+ ++ PLD E+   H+L+
Sbjct: 267 SVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLL 326

Query: 332 VQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFL--SADGSPQVSEAAPPGQLVARIS 389
           V A DGG  P    A V V+V D NDN PS+ + ++    + +  +SE  P    +A I+
Sbjct: 327 VLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALIT 384

Query: 390 VSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGS 449
           V+D D      V    +  E  F L    S  +L+  A  LD E    Y +++ A D+G 
Sbjct: 385 VTDKDADHNGRVTCFTD-HEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGK 443

Query: 450 PPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVT 509
           PPL   A   + V D NDNAP F  Q +    +PE   PG  + +V+A D D G N ++ 
Sbjct: 444 PPLNQSAMLFIKVKDENDNAPVF-TQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKIN 502

Query: 510 YSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQ 569
           Y L P A    FS+D  +G++T    LD E E +    ++A D G+PPL S+ TV V++ 
Sbjct: 503 YLLGPDAPPE-FSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSII 561

Query: 570 DVNDNEPQFQRTFYNASLPEG-TQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPP 628
           D NDN P F    YN  +PE   + GT  L +T TD D G    ++ S+        +  
Sbjct: 562 DQNDNSPVFTHNEYNFYVPENLPRHGTVGL-ITVTDPDYGDNSAVTLSI-----LDENDD 615

Query: 629 FRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMVYVKVFLS--DENDNPPQFY 686
           F ID+ +G +    + DR++   S+ F V A DGG +      KV ++  D NDN P F 
Sbjct: 616 FTIDSQTGVIRPNISFDREK-QESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFI 674

Query: 687 PREYAASISAQSP---PGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLT 743
                 S     P   PGT V ++ A D D G +  + Y I+ GN+  LF +D+++G +T
Sbjct: 675 VPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNIT 734

Query: 744 V 744
           +
Sbjct: 735 L 735



 Score =  272 bits (696), Expect = 4e-72
 Identities = 206/665 (30%), Positives = 320/665 (48%), Gaps = 39/665 (5%)

Query: 1418 RLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLL 1477
            RL++++  ++D N++AP F    + +++PEN    +  YT  A+     G N    Y L+
Sbjct: 121  RLVKIRFLIEDINDNAPLFPATVINISIPENSAINSK-YTLPAAVDPDVGINGVQNYELI 179

Query: 1478 RQEPPVPALRLDARTG----ALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSAR 1533
            + +       ++   G     L   + LDRE     ++ V+  D       +R++    +
Sbjct: 180  KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVED---GGFPQRSSTAILQ 236

Query: 1534 VFVTDENDNAPVFASPS-RVRLPEDQPPGPAALHVVARDPDLGEAARVSYR----LASGG 1588
            V VTD NDN PVF      V +PE+ P G +   + A D D+GE A++ +     +++  
Sbjct: 237  VSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIA 296

Query: 1589 DGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPT 1648
               F L+++TG +++  PLDRE+   H L V+ASD G  P  A  ++ V+V DVND  P+
Sbjct: 297  RRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPS 354

Query: 1649 FQQQ------EYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSESFSLDP---D 1699
               +        +V+L EN P  T +  +  TD D   NG+VT        F L P   +
Sbjct: 355  IDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN 414

Query: 1700 TGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLE 1759
              +L T   LD E  +E  + + A D G PP      + + V+DEND+AP F  + +++ 
Sbjct: 415  QFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVS 474

Query: 1760 VPEGQDPQ-TLTMLRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVE 1818
            +PE   P   LT + A D D G N ++ Y +L  D    F LD  +G    ++ LDRE E
Sbjct: 475  IPENNSPGIQLTKVSAMDADSGPNAKINY-LLGPDAPPEFSLDCRTGMLTVVKKLDREKE 533

Query: 1819 PAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQ 1878
              +   I A+D G P L++ + + V+++D ND++P F    Y+  VPE++P    +  + 
Sbjct: 534  DKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLIT 593

Query: 1879 AHDPDAGANGHVTYYLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAG 1938
              DPD G N  VT  +       F ++  +G +R   + DRE+  SYTF V A DG    
Sbjct: 594  VTDPDYGDNSAVTLSI-LDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVS 652

Query: 1939 PLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANAS 1998
              S++  VTI V DVND+ P F   P         PS +  T+    + A D D G NA 
Sbjct: 653  -RSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVI-AVDNDTGMNAE 710

Query: 1999 ILYRLAGTPPPGTT-----VDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGV 2053
            + Y + G    G T     +D  TG I +             + + A DLG+P  S   V
Sbjct: 711  VRYSIVG----GNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP-DSLFSV 765

Query: 2054 IIVGL 2058
            +IV L
Sbjct: 766  VIVNL 770



 Score =  246 bits (628), Expect = 3e-64
 Identities = 217/767 (28%), Positives = 343/767 (44%), Gaps = 64/767 (8%)

Query: 1445 LPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGAL-SAPRGLDR 1503
            +PEN   G  L     S        + ++++L+ +   VP +R++  TG + +    +DR
Sbjct: 34   MPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDR 93

Query: 1504 ETTPA-------LLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVF-ASPSRVRLP 1555
            E   A           VE    P    R     V  R  + D NDNAP+F A+   + +P
Sbjct: 94   EKLCAGIPRDEHCFYEVEVAILPDEIFRL----VKIRFLIEDINDNAPLFPATVINISIP 149

Query: 1556 EDQPPGPAALHVVARDPDLGEAARVSYRLASGGD--GHFRLHSSTG----ALSVVRPLDR 1609
            E+           A DPD+G     +Y L    +  G   + +  G     L V + LDR
Sbjct: 150  ENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDR 209

Query: 1610 EQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLL 1669
            E++  +V+ V   D G P RS+T +L VSV D ND  P F++ E  V + EN P GTS+ 
Sbjct: 210  EEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVT 269

Query: 1670 TLRATDPDVGANGQVTY------GGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYA 1723
             L ATD D+G N ++ +        ++   F L+  TG++T    LDREE     L V A
Sbjct: 270  QLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLA 329

Query: 1724 QDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHL------SLEVPEGQDPQT-LTMLRASD 1776
             D G  P      V V V D ND+ P+    ++      ++ + E     T + ++  +D
Sbjct: 330  SDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTD 387

Query: 1777 PDVGANGQLQYRILDGDP-------SGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARD 1829
             D   NG++        P       S  F+L+ A+        LD E    + +++ A D
Sbjct: 388  KDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAA-------YLDYESTKEYAIKLLAAD 440

Query: 1830 GGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGH 1889
             G+P L+ + +L + V D ND+AP F     +V +PE+   G  L ++ A D D+G N  
Sbjct: 441  AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAK 500

Query: 1890 VTYYLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTIT 1949
            + Y LG      F L+  +G L     LDRE+   Y F++ A D     PL++ V+V ++
Sbjct: 501  INYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVP-PLTSNVTVFVS 559

Query: 1950 VRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPP 2009
            + D ND++P F  +     +P   P   T  L   T    D D G N+++   +      
Sbjct: 560  IIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVT----DPDYGDNSAVTLSIL-DEND 614

Query: 2010 GTTVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRF- 2068
              T+DS TG IR   S           ++ A D GR +RS++  + + +    +  P F 
Sbjct: 615  DFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFI 674

Query: 2069 --PRASSEATIRENAPPGTPIVSPRAV-HAGGTNGPITYSILSGNEKGTFSIQPSTGAIT 2125
              P   S   +  +  PGT +    AV +  G N  + YSI+ GN +  F+I   TG IT
Sbjct: 675  VPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNIT 734

Query: 2126 VRSAEGLDFEVSPRLRLVLQAESGG----AFAFTVLTLTLQDANDNA 2168
            +   E  D       R++++A   G     F+  ++ L + ++  NA
Sbjct: 735  L--MEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNA 779



 Score =  238 bits (608), Expect = 6e-62
 Identities = 188/655 (28%), Positives = 299/655 (45%), Gaps = 36/655 (5%)

Query: 1323 DLAERDPAAPVPVV-LTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFAL 1381
            D+ +  P  P  V+ +++     +     L +   P+    G   Y L+   +  G   +
Sbjct: 131  DINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVI 190

Query: 1382 DAASG----RLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFA 1437
            +   G    +L + + LD E    +       +G     +    +QV V D N++ P F 
Sbjct: 191  ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFK 250

Query: 1438 RDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVP--ALRLDARTGAL 1495
               + +++PEN   G ++    A+DAD  G N+ + +        +      L+A TG +
Sbjct: 251  ETEIEVSIPENAPVGTSVTQLHATDAD-IGENAKIHFSFSNLVSNIARRLFHLNATTGLI 309

Query: 1496 SAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAP-------VFAS 1548
            +    LDRE TP   LLV A+D          AR    V VTD NDN P       V   
Sbjct: 310  TIKEPLDREETPNHKLLVLASD-----GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPV 364

Query: 1549 PSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGHFRLH---SSTGALSVVR 1605
               V L E+ P       +   D D     RV+    +  +  FRL    S+   L    
Sbjct: 365  NDTVVLSENIPLNTKIALITVTDKDADHNGRVT--CFTDHEIPFRLRPVFSNQFLLETAA 422

Query: 1606 PLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPG 1665
             LD E   E+ + ++A+D G PP + + +L + V D ND AP F Q   +V + ENN PG
Sbjct: 423  YLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPG 482

Query: 1666 TSLLTLRATDPDVGANGQVTY--GGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYA 1723
              L  + A D D G N ++ Y  G  +   FSLD  TG+LT ++ LDRE++++   T+ A
Sbjct: 483  IQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILA 542

Query: 1724 QDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQ-TLTMLRASDPDVGAN 1782
            +D G PP  ++VTV V++ D+ND++P F     +  VPE      T+ ++  +DPD G N
Sbjct: 543  KDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDN 602

Query: 1783 GQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLT 1842
              +   ILD +    F +D  +G        DRE + ++   ++A DGG+ + S++  +T
Sbjct: 603  SAVTLSILDENDD--FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVT 660

Query: 1843 VTVLDANDHAPAFPVP----AYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTY-YLGAG 1897
            + V+D ND+ P F VP    +Y + +P   P GT++ Q+ A D D G N  V Y  +G  
Sbjct: 661  INVVDVNDNKPVFIVPPSNCSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRYSIVGGN 719

Query: 1898 TAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRD 1952
            T   F ++  +G +      D      +   V A D      L + V V + V +
Sbjct: 720  TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNE 774



 Score =  236 bits (601), Expect = 4e-61
 Identities = 197/672 (29%), Positives = 306/672 (45%), Gaps = 44/672 (6%)

Query: 2152 FAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLA 2211
            F    +   ++D NDNAP F        +PE+  +        A D D G  G  +Y L 
Sbjct: 120  FRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELI 179

Query: 2212 ASQPARGLFHVDPTTGTITTTAILDREIWAETR----LVLMATDRGSPALVGSATLTVMV 2267
             SQ   GL  ++   G      I+ +E+  E +    + +   D G P    +A L V V
Sbjct: 180  KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSV 239

Query: 2268 IDTNDNRPTIPQ-PWELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSG-----PQDP 2321
             DTNDN P   +   E+ + E+A +G+ + Q+   D D G       S S       +  
Sbjct: 240  TDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRL 299

Query: 2322 FSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGP-HEGRANLTVLVEDVNDNAPAFSQSL 2380
            F +    G +++  PLD E+   ++L +LA DG     RA + V V DVNDN P+     
Sbjct: 300  FHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRY 359

Query: 2381 Y------QVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTLFTI 2434
                    V+L E+ P  + I  ++ TD+D+  NG ++         F + P     F +
Sbjct: 360  IVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRLRPVFSNQFLL 418

Query: 2435 VGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTED 2494
                 L ++ +    + L A D G P     A + ++++D+ND+AP FT S   V++ E+
Sbjct: 419  ETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPEN 478

Query: 2495 LPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCL 2554
              PG  L  + A DAD S  +A ++Y ++  +    F L+ R               G L
Sbjct: 479  NSPGIQLTKVSAMDAD-SGPNAKINY-LLGPDAPPEFSLDCR--------------TGML 522

Query: 2555 VLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPED 2614
             +++ LD E   +Y  T+ A D G PP +S V V V+++D NDN PVFT   Y   VPE+
Sbjct: 523  TVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN 582

Query: 2615 TPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQ 2674
             P    +  +  +D D G +  V  T+S  D +  F +D  +G +R   + D E Q  + 
Sbjct: 583  LPRHGTVGLITVTDPDYGDNSAV--TLSILDENDDFTIDSQTGVIRPNISFDREKQESYT 640

Query: 2675 LVVQAADPAG-AHFALAPVTIEVQDVNDHGPAF---PLNLLSTSVAENQPPGTLVTTLHA 2730
              V+A D    +  + A VTI V DVND+ P F   P N     V  +  PGT+V  + A
Sbjct: 641  FYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIA 700

Query: 2731 IDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAADA 2790
            +D D G    +RYS++    G   R+ FA++  TG +      D       R+LV A D 
Sbjct: 701  VDNDTGMNAEVRYSIV----GGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDL 756

Query: 2791 GNLSASVTVSVL 2802
            G   +  +V ++
Sbjct: 757  GQPDSLFSVVIV 768



 Score =  230 bits (586), Expect = 2e-59
 Identities = 203/702 (28%), Positives = 315/702 (44%), Gaps = 47/702 (6%)

Query: 1639 VADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSES-FSLD 1697
            + D+ND AP F     ++ + EN+   +      A DPDVG NG   Y  + S++ F LD
Sbjct: 129  IEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLD 188

Query: 1698 ----PDTGVLTTL---RALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPT 1750
                P+   +  L   + LDREE++   + V  +D G P + +   ++V+V D ND+ P 
Sbjct: 189  VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPV 248

Query: 1751 FGSAHLSLEVPEGQDPQT-LTMLRASDPDVGANGQLQY---RILDGDPSGAFVLDLASGE 1806
            F    + + +PE     T +T L A+D D+G N ++ +    ++       F L+  +G 
Sbjct: 249  FKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGL 308

Query: 1807 FGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAY------ 1860
                 PLDRE  P  +L + A DGG     A +L+ VT  D ND+ P+  +         
Sbjct: 309  ITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVND 366

Query: 1861 SVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGE---LRTAAAL 1917
            +V + E++P  T +  +   D DA  NG VT +        F L P       L TAA L
Sbjct: 367  TVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIP--FRLRPVFSNQFLLETAAYL 424

Query: 1918 DREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFS 1977
            D E    Y   + A D A   PL+ +  + I V+D ND+AP F  S + + +P      +
Sbjct: 425  DYESTKEYAIKLLAAD-AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPEN----N 479

Query: 1978 TPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLF 2037
            +P + L  + A D D+G NA I Y L    PP  ++D  TG + V +  +     D+ LF
Sbjct: 480  SPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKK-LDREKEDKYLF 538

Query: 2038 -IVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPP-GTPIVSPRAVHA 2095
             I+A D G P  ++   + V +  + +  P F        + EN P  GT  +       
Sbjct: 539  TILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPD 598

Query: 2096 GGTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFT 2155
             G N  +T SIL  N+   F+I   TG I  R     D E        ++AE GG  + +
Sbjct: 599  YGDNSAVTLSILDENDD--FTIDSQTGVI--RPNISFDREKQESYTFYVKAEDGGRVSRS 654

Query: 2156 V---LTLTLQDANDNAPRFLRP----HYVAFLPESRPLEGPLLQVEADDLDQGSGGQISY 2208
                +T+ + D NDN P F+ P     Y   LP + P    + QV A D D G   ++ Y
Sbjct: 655  SSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRY 713

Query: 2209 SLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVI 2268
            S+      R LF +D  TG IT     D       R+++ A D G P  + S  +  + +
Sbjct: 714  SIVGGN-TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFV 772

Query: 2269 DTNDNRPTIPQPWELRVSEDALL-GSEIAQVTGNDVDSGPVL 2309
            + +    T+      + +E  +   +EIA V+    D   +L
Sbjct: 773  NESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSDYVKIL 814



 Score =  229 bits (583), Expect = 4e-59
 Identities = 212/740 (28%), Positives = 326/740 (44%), Gaps = 51/740 (6%)

Query: 627  PPFRIDAHSGDVCTTRT-LDRDQ-------GPSSFDFTVTAVDGGGLKSMVYVKVFLSDE 678
            P  RI+  +G++ TT   +DR++           F     A+    +  +V ++  + D 
Sbjct: 73   PLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDI 132

Query: 679  NDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLD-- 736
            NDN P F       SI   S   +      A DPD G +G  +Y ++   S  +F LD  
Sbjct: 133  NDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELI--KSQNIFGLDVI 190

Query: 737  -----EQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFE 791
                 ++   L V   L R       +++  EDGG  Q   +A + +S+       P+F+
Sbjct: 191  ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFK 250

Query: 792  QLQYVFSVPEDVAPGTSVGIVQAHNPP-GRLAPVTLSLSG---GDPRGLFSLDAVSGLLQ 847
            + +   S+PE+   GTSV  + A +   G  A +  S S       R LF L+A +GL+ 
Sbjct: 251  ETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLIT 310

Query: 848  TLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAP------EDTV 901
               PLDRE       L + +  G+ PA A+  V V   DVNDN P+           DTV
Sbjct: 311  IKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVNDTV 368

Query: 902  LLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRP---LGP 958
            +L  N    T I  +   D D+  N RVT          F + P   +  L+     L  
Sbjct: 369  VLSENIPLNTKIALITVTDKDADHNGRVT--CFTDHEIPFRLRPVFSNQFLLETAAYLDY 426

Query: 959  SGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQ 1018
                 + ++L A D G PP      L + V+D      AP F      V +P   + G Q
Sbjct: 427  ESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDN--APVFTQSFVTVSIPENNSPGIQ 484

Query: 1019 VLQVQAQAPDGGP---ITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAV 1075
            + +V A   D GP   I Y L  + A   F L+ ++G L V   LDRE ++ Y+  ++A 
Sbjct: 485  LTKVSAMDADSGPNAKINYLLGPD-APPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAK 543

Query: 1076 SGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSG 1135
                  L   T   TV VSI++QN++SP  + +     V EN P   +VG +  TD D G
Sbjct: 544  DNGVPPL---TSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYG 600

Query: 1136 PNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTG 1195
             N  +T S+   ++D   F I  QTG +    + DRE+Q SY   V+ +DGG   RS++ 
Sbjct: 601  DNSAVTLSILDENDD---FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSA 657

Query: 1196 TVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYT 1255
             V + V+D+NDN P F+         L   V     PGT+V  + A D D G N  + Y+
Sbjct: 658  KVTINVVDVNDNKPVFIVPPSNCSYEL---VLPSTNPGTVVFQVIAVDNDTGMNAEVRYS 714

Query: 1256 LTGPGS-ELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLL-VQVLP 1313
            + G  + +LF++   +G +         +   + + + A+D G P    S+ ++ + V  
Sbjct: 715  IVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNE 774

Query: 1314 SARLAEPPPDLAERDPAAPV 1333
            S   A    +L  +   APV
Sbjct: 775  SVTNATLINELVRKSTEAPV 794



 Score =  227 bits (579), Expect = 1e-58
 Identities = 198/649 (30%), Positives = 294/649 (45%), Gaps = 57/649 (8%)

Query: 2063 ERGPRFPRASSEATIRENAPPGTPIVSPRAVHAG-GTNGPITYSIL-SGNEKGTFSIQPS 2120
            +  P FP      +I EN+   +    P AV    G NG   Y ++ S N  G   I+  
Sbjct: 134  DNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETP 193

Query: 2121 TGAITVRSA--EGLDFEVSPRLRLVLQAESGG---AFAFTVLTLTLQDANDNAPRFLRPH 2175
             G    +    + LD E      + ++ E GG     +  +L +++ D NDN P F    
Sbjct: 194  EGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETE 253

Query: 2176 YVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLA--ASQPARGLFHVDPTTGTITTTA 2233
                +PE+ P+   + Q+ A D D G   +I +S +   S  AR LFH++ TTG IT   
Sbjct: 254  IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE 313

Query: 2234 ILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTI-------PQPWELRVS 2286
             LDRE     +L+++A+D G   +   A + V V D NDN P+I       P    + +S
Sbjct: 314  PLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLS 371

Query: 2287 EDALLGSEIAQVTGNDVDS---GPVLWYVLSPSGPQDPFSVGRYGGRVSL---TGPLDFE 2340
            E+  L ++IA +T  D D+   G V  +    +  + PF +        L      LD+E
Sbjct: 372  ENIPLNTKIALITVTDKDADHNGRVTCF----TDHEIPFRLRPVFSNQFLLETAAYLDYE 427

Query: 2341 QCDRYQLQLLAHDG---PHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILS 2397
                Y ++LLA D    P    A L + V+D NDNAP F+QS   V + E+  PG  +  
Sbjct: 428  STKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTK 487

Query: 2398 VSATDRDSGANGHISYHLASPADG-FSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARD 2456
            VSA D DSG N  I+Y L   A   FS+D   G L  +     L  +        + A+D
Sbjct: 488  VSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVK---KLDREKEDKYLFTILAKD 544

Query: 2457 HGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHA 2516
            +G P   +  TV V + DQND++P FT + Y   V E+LP   T+  +  TD D    ++
Sbjct: 545  NGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYG-DNS 603

Query: 2517 AVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAAD 2576
            AV  SI+  N       +  +     S                 D E    Y   V A D
Sbjct: 604  AVTLSILDENDDFTIDSQTGVIRPNIS----------------FDREKQESYTFYVKAED 647

Query: 2577 RGQPPQSSVVPVTVTVLDVNDNPPVF----TRASYRVTVPEDTPVGAELLHVEASDADPG 2632
             G+  +SS   VT+ V+DVNDN PVF    +  SY + +P   P G  +  V A D D G
Sbjct: 648  GGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNP-GTVVFQVIAVDNDTG 706

Query: 2633 PHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAAD 2681
             +  VR+++  G+   LF +D+ +G + L    D      H+++V+A D
Sbjct: 707  MNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKAND 755



 Score =  198 bits (504), Expect = 6e-50
 Identities = 181/695 (26%), Positives = 304/695 (43%), Gaps = 43/695 (6%)

Query: 524  DPTSGIITTAASLDYELE----PQPQLIVVATDGGLPP--LASSATVSVALQDVNDNEPQ 577
            + T  I TT A +D E      P+ +      +  + P  +     +   ++D+NDN P 
Sbjct: 79   EDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPL 138

Query: 578  FQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGD 637
            F  T  N S+PE +   + +    A D D G  G+ +Y L       G     I+   GD
Sbjct: 139  FPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDV--IETPEGD 196

Query: 638  ----VCTTRTLDRDQGPSSFDFTVTAVDGG--GLKSMVYVKVFLSDENDNPPQFYPREYA 691
                +   + LDR++   ++   V   DGG     S   ++V ++D NDN P F   E  
Sbjct: 197  KMPQLIVQKELDREE-KDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIE 255

Query: 692  ASISAQSPPGTAVLRLRAHDPDQGSHGRLSY---HILAGNSPPLFTLDEQSGLLTVAWPL 748
             SI   +P GT+V +L A D D G + ++ +   ++++  +  LF L+  +GL+T+  PL
Sbjct: 256  VSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPL 315

Query: 749  ARRANSVVQLEIGAEDGGGLQAEPSARVDISIV----PGTPTPPIFEQLQYVFSVPEDVA 804
             R      +L + A DGG + A     V+++ V    P      I   +     + E++ 
Sbjct: 316  DREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIP 375

Query: 805  PGTSVGIVQA------HNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLG 858
              T + ++        HN  GR   VT       P  L  + +   LL+T   LD E   
Sbjct: 376  LNTKIALITVTDKDADHN--GR---VTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTK 430

Query: 859  PVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRA 918
                  + A +G PP    A + + + D NDN+P F     TV +P N +PG  +  + A
Sbjct: 431  EYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSA 490

Query: 919  LDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPR 978
            +D DSG N+++ + L       F++D  TG + +++ L       +   + A+D G PP 
Sbjct: 491  MDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPL 550

Query: 979  TSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPD-GGPITYHLA 1037
            TS+  + V V  +     +P F    Y   +P        V  +    PD G      L+
Sbjct: 551  TSN--VTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLS 608

Query: 1038 AEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILN 1097
                +  F ++ Q+G +    + DRE QE Y   V A  G +     ++ +A V +++++
Sbjct: 609  ILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRV---SRSSSAKVTINVVD 665

Query: 1098 QNEHSPRLSEDP---TFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAF 1154
             N++ P     P   ++  V  +  PGT V +V A D D+G N  + YS+         F
Sbjct: 666  VNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVG-GNTRDLF 724

Query: 1155 RIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSP 1189
             I  +TG +T ++  D      +++LV+  D G P
Sbjct: 725  AIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759



 Score =  189 bits (480), Expect = 4e-47
 Identities = 190/701 (27%), Positives = 304/701 (43%), Gaps = 88/701 (12%)

Query: 2219 LFHVDPTTGTITTT-AILDRE-----------IWAETRLVLMATDRGSPALVGSATLTVM 2266
            L  ++  TG I TT A +DRE            + E  + ++  +     +     +  +
Sbjct: 74   LIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDE-----IFRLVKIRFL 128

Query: 2267 VIDTNDNRPTIPQPW-ELRVSEDALLGSEIAQVTGNDVDSG--PVLWYVLSPSGPQDPFS 2323
            + D NDN P  P     + + E++ + S+       D D G   V  Y L  S  Q+ F 
Sbjct: 129  IEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS--QNIFG 186

Query: 2324 V-------GRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVL---VEDVNDNA 2373
            +       G    ++ +   LD E+ D Y +++   DG    R++  +L   V D NDN 
Sbjct: 187  LDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNH 246

Query: 2374 PAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFS--VDPNNGTL 2431
            P F ++  +V + E+ P G+++  + ATD D G N  I +  ++     +  +   N T 
Sbjct: 247  PVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATT 306

Query: 2432 FTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHY---- 2487
              I     L  + +    +++ A D G     ARA V V + D ND+ PS  + +     
Sbjct: 307  GLITIKEPLDREETPNHKLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPV 364

Query: 2488 --RVAVTEDLPPGSTLLTLEATDADGS---RSHAAVDYSIISGNWGRVFQLEPRLAEAGE 2542
               V ++E++P  + +  +  TD D     R     D+ I        F+L P  +    
Sbjct: 365  NDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEI-------PFRLRPVFSNQ-- 415

Query: 2543 SAGPGPRALGCLVLLEP---LDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNP 2599
                         LLE    LD+ES  +Y + + AAD G+PP +    + + V D NDN 
Sbjct: 416  ------------FLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNA 463

Query: 2600 PVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTL 2659
            PVFT++   V++PE+   G +L  V A DAD GP+  + + +    P   F LD  +G L
Sbjct: 464  PVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPE-FSLDCRTGML 522

Query: 2660 RLAHALDCETQARHQLVVQAADPAGAHFALAPVTIEVQ--DVNDHGPAFPLNLLSTSVAE 2717
             +   LD E + ++   + A D  G     + VT+ V   D ND+ P F  N  +  V E
Sbjct: 523  TVVKKLDREKEDKYLFTILAKD-NGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPE 581

Query: 2718 NQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEH 2777
            N P    V  +   D D G    +  S+L+        + F ++S TG +R  + FD E 
Sbjct: 582  NLPRHGTVGLITVTDPDYGDNSAVTLSILDE------NDDFTIDSQTGVIRPNISFDREK 635

Query: 2778 TESFRLLVGAADAGNLSASVTVSVLVTGEDEYD--PVFLAP----AFHFQVPEGARRGHS 2831
             ES+   V A D G +S S +  V +   D  D  PVF+ P    ++   +P     G  
Sbjct: 636  QESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLP-STNPGTV 694

Query: 2832 LGHVQATDEDGGADGLVLYSL--ATSSPYFGINQTTGALYL 2870
            +  V A D D G +  V YS+    +   F I+Q TG + L
Sbjct: 695  VFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITL 735



 Score =  181 bits (458), Expect = 1e-44
 Identities = 161/580 (27%), Positives = 251/580 (43%), Gaps = 44/580 (7%)

Query: 47  LDLQIDEEQPAGTLIGDISA-GLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTAR 105
           +++ I E  P GT +  + A     G  A + +  S    +       ++  +G++    
Sbjct: 254 IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE 313

Query: 106 VLDREQRDRYRFTAVTPDG----ATVEVTVRVADINDHAPAFP------QARAALQVPEH 155
            LDRE+   ++   +  DG    A   V V V D+ND+ P+             + + E+
Sbjct: 314 PLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSEN 373

Query: 156 TAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDR 215
               T+  L    D DA   G        +     FRL     P  +    L     LD 
Sbjct: 374 IPLNTKIALITVTDKDADHNGRVTCFTDHE---IPFRLR----PVFSNQFLLETAAYLDY 426

Query: 216 ENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVL 275
           E+   Y ++L A D G PP    A+L + + D ND+AP F QS     + E+ +PG  + 
Sbjct: 427 ESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLT 486

Query: 276 QVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQAR 335
           +V A DAD+G N  + Y +     +    FS+D  TG+L + + LD E+   +   + A+
Sbjct: 487 KVSAMDADSGPNAKINYLLG---PDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAK 543

Query: 336 DGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDD 395
           D G  P   +  V V + D NDN P    +F   + +  V E  P    V  I+V+DPD 
Sbjct: 544 DNGVPPLTSNVTVFVSIIDQNDNSP----VFTHNEYNFYVPENLPRHGTVGLITVTDPDY 599

Query: 396 GDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPLRAE 455
           GD + V +S+      F + +Q  VI         DRE++++Y   V A D G     + 
Sbjct: 600 GDNSAVTLSILDENDDFTIDSQTGVIRPNI---SFDREKQESYTFYVKAEDGGRVSRSSS 656

Query: 456 AAFVLHVTDVNDNAPAFDRQLYRPEPLP-EVALP----GSFVVRVTARDPDQGTNGQVTY 510
           A   ++V DVNDN P F   +  P     E+ LP    G+ V +V A D D G N +V Y
Sbjct: 657 AKVTINVVDVNDNKPVF---IVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRY 713

Query: 511 SLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQD 570
           S+  G     F+ID  +G IT     D       +++V A D G P     +  SV + +
Sbjct: 714 SIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP----DSLFSVVIVN 769

Query: 571 VNDNEPQFQRTFYNASLPEGTQ----PGTCFLQVTATDAD 606
           +  NE     T  N  + + T+    P T    V++  +D
Sbjct: 770 LFVNESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSD 809



 Score =  177 bits (450), Expect = 1e-43
 Identities = 165/617 (26%), Positives = 258/617 (41%), Gaps = 46/617 (7%)

Query: 1847 DANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYL--GAGTAGAFLL 1904
            D ND+AP FP    ++ +PE+    +      A DPD G NG   Y L       G  ++
Sbjct: 131  DINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVI 190

Query: 1905 EPSSGE----LRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTF 1960
            E   G+    L     LDRE+  +Y   V   DG      ST + + ++V D ND+ P F
Sbjct: 191  ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAI-LQVSVTDTNDNHPVF 249

Query: 1961 PTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTT----VDSY 2016
              + + + +P   P  ++ T     L A D D G NA I +  +            +++ 
Sbjct: 250  KETEIEVSIPENAPVGTSVT----QLHATDADIGENAKIHFSFSNLVSNIARRLFHLNAT 305

Query: 2017 TGEIRVARSPVALGPRDRVLFIVATDLG-RPARSATGVIIVGLQGEAERGPRFP------ 2069
            TG I +          +  L ++A+D G  PAR+   +++V +    +  P         
Sbjct: 306  TGLITIKEPLDREETPNHKLLVLASDGGLMPARA---MVLVNVTDVNDNVPSIDIRYIVN 362

Query: 2070 RASSEATIRENAPPGTPIVSPRAVHAGGT-NGPITYSILSGNEKGTFSIQPS-TGAITVR 2127
              +    + EN P  T I            NG +T      + +  F ++P  +    + 
Sbjct: 363  PVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFT---DHEIPFRLRPVFSNQFLLE 419

Query: 2128 SAEGLDFEVSPRLRLVLQAESGGAFAFT---VLTLTLQDANDNAPRFLRPHYVAFLPESR 2184
            +A  LD+E +    + L A   G        +L + ++D NDNAP F +      +PE+ 
Sbjct: 420  TAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENN 479

Query: 2185 PLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETR 2244
                 L +V A D D G   +I+Y L    P    F +D  TG +T    LDRE   +  
Sbjct: 480  SPGIQLTKVSAMDADSGPNAKINYLLGPDAPPE--FSLDCRTGMLTVVKKLDREKEDKYL 537

Query: 2245 LVLMATDRGSPALVGSATLTVMVIDTNDNRPTIP-QPWELRVSEDALLGSEIAQVTGNDV 2303
              ++A D G P L  + T+ V +ID NDN P      +   V E+      +  +T  D 
Sbjct: 538  FTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDP 597

Query: 2304 DSGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGR---A 2360
            D G      LS     D F++    G +      D E+ + Y   + A DG    R   A
Sbjct: 598  DYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSA 657

Query: 2361 NLTVLVEDVNDNAPAF----SQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHL- 2415
             +T+ V DVNDN P F    S   Y+ ++L  T PG+ +  V A D D+G N  + Y + 
Sbjct: 658  KVTINVVDVNDNKPVFIVPPSNCSYE-LVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIV 716

Query: 2416 -ASPADGFSVDPNNGTL 2431
              +  D F++D   G +
Sbjct: 717  GGNTRDLFAIDQETGNI 733


>gi|14589922 protocadherin 11 X-linked isoform d [Homo sapiens]
          Length = 1337

 Score =  330 bits (845), Expect = 2e-89
 Identities = 240/721 (33%), Positives = 361/721 (50%), Gaps = 42/721 (5%)

Query: 51  IDEEQPAGTLIGDISAGL-----PAGTAAPLMYFISAQEGSGVGTDLAIDEHSG-VVRTA 104
           I EE P   LIGD+   L     P  +    M F    +   V   + I+E +G +  T 
Sbjct: 30  IREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPL-IRIEEDTGEIFTTG 88

Query: 105 RVLDREQ------RDRYRF----TAVTPDGATVEVTVR--VADINDHAPAFPQARAALQV 152
             +DRE+      RD + F     A+ PD     V +R  + DIND+AP FP     + +
Sbjct: 89  ARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISI 148

Query: 153 PEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGE 212
           PE++A  ++Y L  A D D G  G Q Y L    +   F L+    P+G  +P+L+V  E
Sbjct: 149 PENSAINSKYTLPAAVDPDVGINGVQNYELIK--SQNIFGLDVIETPEGDKMPQLIVQKE 206

Query: 213 LDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGS 272
           LDRE +  Y+++++  DGG P R + A+L V++ D ND+ P F ++     + E+   G+
Sbjct: 207 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGT 266

Query: 273 PVLQVFASDADAGVNGAVTYEINRRQSE-GDGPFSIDAHTGLLQLERPLDFEQRRVHELV 331
            V Q+ A+DAD G N  + +  +   S      F ++A TGL+ ++ PLD E+   H+L+
Sbjct: 267 SVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLL 326

Query: 332 VQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFL--SADGSPQVSEAAPPGQLVARIS 389
           V A DGG  P    A V V+V D NDN PS+ + ++    + +  +SE  P    +A I+
Sbjct: 327 VLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALIT 384

Query: 390 VSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGS 449
           V+D D      V    +  E  F L    S  +L+  A  LD E    Y +++ A D+G 
Sbjct: 385 VTDKDADHNGRVTCFTD-HEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGK 443

Query: 450 PPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVT 509
           PPL   A   + V D NDNAP F  Q +    +PE   PG  + +V+A D D G N ++ 
Sbjct: 444 PPLNQSAMLFIKVKDENDNAPVF-TQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKIN 502

Query: 510 YSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQ 569
           Y L P A    FS+D  +G++T    LD E E +    ++A D G+PPL S+ TV V++ 
Sbjct: 503 YLLGPDAPPE-FSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSII 561

Query: 570 DVNDNEPQFQRTFYNASLPEG-TQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPP 628
           D NDN P F    YN  +PE   + GT  L +T TD D G    ++ S+        +  
Sbjct: 562 DQNDNSPVFTHNEYNFYVPENLPRHGTVGL-ITVTDPDYGDNSAVTLSI-----LDENDD 615

Query: 629 FRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMVYVKVFLS--DENDNPPQFY 686
           F ID+ +G +    + DR++   S+ F V A DGG +      KV ++  D NDN P F 
Sbjct: 616 FTIDSQTGVIRPNISFDREK-QESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFI 674

Query: 687 PREYAASISAQSP---PGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLT 743
                 S     P   PGT V ++ A D D G +  + Y I+ GN+  LF +D+++G +T
Sbjct: 675 VPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNIT 734

Query: 744 V 744
           +
Sbjct: 735 L 735



 Score =  272 bits (696), Expect = 4e-72
 Identities = 206/665 (30%), Positives = 320/665 (48%), Gaps = 39/665 (5%)

Query: 1418 RLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLL 1477
            RL++++  ++D N++AP F    + +++PEN    +  YT  A+     G N    Y L+
Sbjct: 121  RLVKIRFLIEDINDNAPLFPATVINISIPENSAINSK-YTLPAAVDPDVGINGVQNYELI 179

Query: 1478 RQEPPVPALRLDARTG----ALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSAR 1533
            + +       ++   G     L   + LDRE     ++ V+  D       +R++    +
Sbjct: 180  KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVED---GGFPQRSSTAILQ 236

Query: 1534 VFVTDENDNAPVFASPS-RVRLPEDQPPGPAALHVVARDPDLGEAARVSYR----LASGG 1588
            V VTD NDN PVF      V +PE+ P G +   + A D D+GE A++ +     +++  
Sbjct: 237  VSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIA 296

Query: 1589 DGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPT 1648
               F L+++TG +++  PLDRE+   H L V+ASD G  P  A  ++ V+V DVND  P+
Sbjct: 297  RRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPS 354

Query: 1649 FQQQ------EYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSESFSLDP---D 1699
               +        +V+L EN P  T +  +  TD D   NG+VT        F L P   +
Sbjct: 355  IDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN 414

Query: 1700 TGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLE 1759
              +L T   LD E  +E  + + A D G PP      + + V+DEND+AP F  + +++ 
Sbjct: 415  QFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVS 474

Query: 1760 VPEGQDPQ-TLTMLRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVE 1818
            +PE   P   LT + A D D G N ++ Y +L  D    F LD  +G    ++ LDRE E
Sbjct: 475  IPENNSPGIQLTKVSAMDADSGPNAKINY-LLGPDAPPEFSLDCRTGMLTVVKKLDREKE 533

Query: 1819 PAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQ 1878
              +   I A+D G P L++ + + V+++D ND++P F    Y+  VPE++P    +  + 
Sbjct: 534  DKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLIT 593

Query: 1879 AHDPDAGANGHVTYYLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAG 1938
              DPD G N  VT  +       F ++  +G +R   + DRE+  SYTF V A DG    
Sbjct: 594  VTDPDYGDNSAVTLSI-LDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVS 652

Query: 1939 PLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANAS 1998
              S++  VTI V DVND+ P F   P         PS +  T+    + A D D G NA 
Sbjct: 653  -RSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVI-AVDNDTGMNAE 710

Query: 1999 ILYRLAGTPPPGTT-----VDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGV 2053
            + Y + G    G T     +D  TG I +             + + A DLG+P  S   V
Sbjct: 711  VRYSIVG----GNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP-DSLFSV 765

Query: 2054 IIVGL 2058
            +IV L
Sbjct: 766  VIVNL 770



 Score =  246 bits (628), Expect = 3e-64
 Identities = 217/767 (28%), Positives = 343/767 (44%), Gaps = 64/767 (8%)

Query: 1445 LPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGAL-SAPRGLDR 1503
            +PEN   G  L     S        + ++++L+ +   VP +R++  TG + +    +DR
Sbjct: 34   MPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDR 93

Query: 1504 ETTPA-------LLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVF-ASPSRVRLP 1555
            E   A           VE    P    R     V  R  + D NDNAP+F A+   + +P
Sbjct: 94   EKLCAGIPRDEHCFYEVEVAILPDEIFRL----VKIRFLIEDINDNAPLFPATVINISIP 149

Query: 1556 EDQPPGPAALHVVARDPDLGEAARVSYRLASGGD--GHFRLHSSTG----ALSVVRPLDR 1609
            E+           A DPD+G     +Y L    +  G   + +  G     L V + LDR
Sbjct: 150  ENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDR 209

Query: 1610 EQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLL 1669
            E++  +V+ V   D G P RS+T +L VSV D ND  P F++ E  V + EN P GTS+ 
Sbjct: 210  EEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVT 269

Query: 1670 TLRATDPDVGANGQVTY------GGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYA 1723
             L ATD D+G N ++ +        ++   F L+  TG++T    LDREE     L V A
Sbjct: 270  QLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLA 329

Query: 1724 QDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHL------SLEVPEGQDPQT-LTMLRASD 1776
             D G  P      V V V D ND+ P+    ++      ++ + E     T + ++  +D
Sbjct: 330  SDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTD 387

Query: 1777 PDVGANGQLQYRILDGDP-------SGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARD 1829
             D   NG++        P       S  F+L+ A+        LD E    + +++ A D
Sbjct: 388  KDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAA-------YLDYESTKEYAIKLLAAD 440

Query: 1830 GGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGH 1889
             G+P L+ + +L + V D ND+AP F     +V +PE+   G  L ++ A D D+G N  
Sbjct: 441  AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAK 500

Query: 1890 VTYYLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTIT 1949
            + Y LG      F L+  +G L     LDRE+   Y F++ A D     PL++ V+V ++
Sbjct: 501  INYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVP-PLTSNVTVFVS 559

Query: 1950 VRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPP 2009
            + D ND++P F  +     +P   P   T  L   T    D D G N+++   +      
Sbjct: 560  IIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVT----DPDYGDNSAVTLSIL-DEND 614

Query: 2010 GTTVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRF- 2068
              T+DS TG IR   S           ++ A D GR +RS++  + + +    +  P F 
Sbjct: 615  DFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFI 674

Query: 2069 --PRASSEATIRENAPPGTPIVSPRAV-HAGGTNGPITYSILSGNEKGTFSIQPSTGAIT 2125
              P   S   +  +  PGT +    AV +  G N  + YSI+ GN +  F+I   TG IT
Sbjct: 675  VPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNIT 734

Query: 2126 VRSAEGLDFEVSPRLRLVLQAESGG----AFAFTVLTLTLQDANDNA 2168
            +   E  D       R++++A   G     F+  ++ L + ++  NA
Sbjct: 735  L--MEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNA 779



 Score =  238 bits (608), Expect = 6e-62
 Identities = 188/655 (28%), Positives = 299/655 (45%), Gaps = 36/655 (5%)

Query: 1323 DLAERDPAAPVPVV-LTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFAL 1381
            D+ +  P  P  V+ +++     +     L +   P+    G   Y L+   +  G   +
Sbjct: 131  DINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVI 190

Query: 1382 DAASG----RLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFA 1437
            +   G    +L + + LD E    +       +G     +    +QV V D N++ P F 
Sbjct: 191  ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFK 250

Query: 1438 RDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVP--ALRLDARTGAL 1495
               + +++PEN   G ++    A+DAD  G N+ + +        +      L+A TG +
Sbjct: 251  ETEIEVSIPENAPVGTSVTQLHATDAD-IGENAKIHFSFSNLVSNIARRLFHLNATTGLI 309

Query: 1496 SAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAP-------VFAS 1548
            +    LDRE TP   LLV A+D          AR    V VTD NDN P       V   
Sbjct: 310  TIKEPLDREETPNHKLLVLASD-----GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPV 364

Query: 1549 PSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGHFRLH---SSTGALSVVR 1605
               V L E+ P       +   D D     RV+    +  +  FRL    S+   L    
Sbjct: 365  NDTVVLSENIPLNTKIALITVTDKDADHNGRVT--CFTDHEIPFRLRPVFSNQFLLETAA 422

Query: 1606 PLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPG 1665
             LD E   E+ + ++A+D G PP + + +L + V D ND AP F Q   +V + ENN PG
Sbjct: 423  YLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPG 482

Query: 1666 TSLLTLRATDPDVGANGQVTY--GGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYA 1723
              L  + A D D G N ++ Y  G  +   FSLD  TG+LT ++ LDRE++++   T+ A
Sbjct: 483  IQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILA 542

Query: 1724 QDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQ-TLTMLRASDPDVGAN 1782
            +D G PP  ++VTV V++ D+ND++P F     +  VPE      T+ ++  +DPD G N
Sbjct: 543  KDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDN 602

Query: 1783 GQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLT 1842
              +   ILD +    F +D  +G        DRE + ++   ++A DGG+ + S++  +T
Sbjct: 603  SAVTLSILDENDD--FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVT 660

Query: 1843 VTVLDANDHAPAFPVP----AYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTY-YLGAG 1897
            + V+D ND+ P F VP    +Y + +P   P GT++ Q+ A D D G N  V Y  +G  
Sbjct: 661  INVVDVNDNKPVFIVPPSNCSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRYSIVGGN 719

Query: 1898 TAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRD 1952
            T   F ++  +G +      D      +   V A D      L + V V + V +
Sbjct: 720  TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNE 774



 Score =  236 bits (601), Expect = 4e-61
 Identities = 197/672 (29%), Positives = 306/672 (45%), Gaps = 44/672 (6%)

Query: 2152 FAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLA 2211
            F    +   ++D NDNAP F        +PE+  +        A D D G  G  +Y L 
Sbjct: 120  FRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELI 179

Query: 2212 ASQPARGLFHVDPTTGTITTTAILDREIWAETR----LVLMATDRGSPALVGSATLTVMV 2267
             SQ   GL  ++   G      I+ +E+  E +    + +   D G P    +A L V V
Sbjct: 180  KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSV 239

Query: 2268 IDTNDNRPTIPQ-PWELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSG-----PQDP 2321
             DTNDN P   +   E+ + E+A +G+ + Q+   D D G       S S       +  
Sbjct: 240  TDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRL 299

Query: 2322 FSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGP-HEGRANLTVLVEDVNDNAPAFSQSL 2380
            F +    G +++  PLD E+   ++L +LA DG     RA + V V DVNDN P+     
Sbjct: 300  FHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRY 359

Query: 2381 Y------QVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTLFTI 2434
                    V+L E+ P  + I  ++ TD+D+  NG ++         F + P     F +
Sbjct: 360  IVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRLRPVFSNQFLL 418

Query: 2435 VGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTED 2494
                 L ++ +    + L A D G P     A + ++++D+ND+AP FT S   V++ E+
Sbjct: 419  ETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPEN 478

Query: 2495 LPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCL 2554
              PG  L  + A DAD S  +A ++Y ++  +    F L+ R               G L
Sbjct: 479  NSPGIQLTKVSAMDAD-SGPNAKINY-LLGPDAPPEFSLDCR--------------TGML 522

Query: 2555 VLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPED 2614
             +++ LD E   +Y  T+ A D G PP +S V V V+++D NDN PVFT   Y   VPE+
Sbjct: 523  TVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN 582

Query: 2615 TPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQ 2674
             P    +  +  +D D G +  V  T+S  D +  F +D  +G +R   + D E Q  + 
Sbjct: 583  LPRHGTVGLITVTDPDYGDNSAV--TLSILDENDDFTIDSQTGVIRPNISFDREKQESYT 640

Query: 2675 LVVQAADPAG-AHFALAPVTIEVQDVNDHGPAF---PLNLLSTSVAENQPPGTLVTTLHA 2730
              V+A D    +  + A VTI V DVND+ P F   P N     V  +  PGT+V  + A
Sbjct: 641  FYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIA 700

Query: 2731 IDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAADA 2790
            +D D G    +RYS++    G   R+ FA++  TG +      D       R+LV A D 
Sbjct: 701  VDNDTGMNAEVRYSIV----GGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDL 756

Query: 2791 GNLSASVTVSVL 2802
            G   +  +V ++
Sbjct: 757  GQPDSLFSVVIV 768



 Score =  230 bits (586), Expect = 2e-59
 Identities = 203/702 (28%), Positives = 315/702 (44%), Gaps = 47/702 (6%)

Query: 1639 VADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSES-FSLD 1697
            + D+ND AP F     ++ + EN+   +      A DPDVG NG   Y  + S++ F LD
Sbjct: 129  IEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLD 188

Query: 1698 ----PDTGVLTTL---RALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPT 1750
                P+   +  L   + LDREE++   + V  +D G P + +   ++V+V D ND+ P 
Sbjct: 189  VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPV 248

Query: 1751 FGSAHLSLEVPEGQDPQT-LTMLRASDPDVGANGQLQY---RILDGDPSGAFVLDLASGE 1806
            F    + + +PE     T +T L A+D D+G N ++ +    ++       F L+  +G 
Sbjct: 249  FKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGL 308

Query: 1807 FGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAY------ 1860
                 PLDRE  P  +L + A DGG     A +L+ VT  D ND+ P+  +         
Sbjct: 309  ITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVND 366

Query: 1861 SVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGE---LRTAAAL 1917
            +V + E++P  T +  +   D DA  NG VT +        F L P       L TAA L
Sbjct: 367  TVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIP--FRLRPVFSNQFLLETAAYL 424

Query: 1918 DREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFS 1977
            D E    Y   + A D A   PL+ +  + I V+D ND+AP F  S + + +P      +
Sbjct: 425  DYESTKEYAIKLLAAD-AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPEN----N 479

Query: 1978 TPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLF 2037
            +P + L  + A D D+G NA I Y L    PP  ++D  TG + V +  +     D+ LF
Sbjct: 480  SPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKK-LDREKEDKYLF 538

Query: 2038 -IVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPP-GTPIVSPRAVHA 2095
             I+A D G P  ++   + V +  + +  P F        + EN P  GT  +       
Sbjct: 539  TILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPD 598

Query: 2096 GGTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFT 2155
             G N  +T SIL  N+   F+I   TG I  R     D E        ++AE GG  + +
Sbjct: 599  YGDNSAVTLSILDENDD--FTIDSQTGVI--RPNISFDREKQESYTFYVKAEDGGRVSRS 654

Query: 2156 V---LTLTLQDANDNAPRFLRP----HYVAFLPESRPLEGPLLQVEADDLDQGSGGQISY 2208
                +T+ + D NDN P F+ P     Y   LP + P    + QV A D D G   ++ Y
Sbjct: 655  SSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRY 713

Query: 2209 SLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVI 2268
            S+      R LF +D  TG IT     D       R+++ A D G P  + S  +  + +
Sbjct: 714  SIVGGN-TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFV 772

Query: 2269 DTNDNRPTIPQPWELRVSEDALL-GSEIAQVTGNDVDSGPVL 2309
            + +    T+      + +E  +   +EIA V+    D   +L
Sbjct: 773  NESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSDYVKIL 814



 Score =  229 bits (583), Expect = 4e-59
 Identities = 212/740 (28%), Positives = 326/740 (44%), Gaps = 51/740 (6%)

Query: 627  PPFRIDAHSGDVCTTRT-LDRDQ-------GPSSFDFTVTAVDGGGLKSMVYVKVFLSDE 678
            P  RI+  +G++ TT   +DR++           F     A+    +  +V ++  + D 
Sbjct: 73   PLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDI 132

Query: 679  NDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLD-- 736
            NDN P F       SI   S   +      A DPD G +G  +Y ++   S  +F LD  
Sbjct: 133  NDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELI--KSQNIFGLDVI 190

Query: 737  -----EQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFE 791
                 ++   L V   L R       +++  EDGG  Q   +A + +S+       P+F+
Sbjct: 191  ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFK 250

Query: 792  QLQYVFSVPEDVAPGTSVGIVQAHNPP-GRLAPVTLSLSG---GDPRGLFSLDAVSGLLQ 847
            + +   S+PE+   GTSV  + A +   G  A +  S S       R LF L+A +GL+ 
Sbjct: 251  ETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLIT 310

Query: 848  TLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAP------EDTV 901
               PLDRE       L + +  G+ PA A+  V V   DVNDN P+           DTV
Sbjct: 311  IKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVNDTV 368

Query: 902  LLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRP---LGP 958
            +L  N    T I  +   D D+  N RVT          F + P   +  L+     L  
Sbjct: 369  VLSENIPLNTKIALITVTDKDADHNGRVT--CFTDHEIPFRLRPVFSNQFLLETAAYLDY 426

Query: 959  SGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQ 1018
                 + ++L A D G PP      L + V+D      AP F      V +P   + G Q
Sbjct: 427  ESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDN--APVFTQSFVTVSIPENNSPGIQ 484

Query: 1019 VLQVQAQAPDGGP---ITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAV 1075
            + +V A   D GP   I Y L  + A   F L+ ++G L V   LDRE ++ Y+  ++A 
Sbjct: 485  LTKVSAMDADSGPNAKINYLLGPD-APPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAK 543

Query: 1076 SGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSG 1135
                  L   T   TV VSI++QN++SP  + +     V EN P   +VG +  TD D G
Sbjct: 544  DNGVPPL---TSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYG 600

Query: 1136 PNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTG 1195
             N  +T S+   ++D   F I  QTG +    + DRE+Q SY   V+ +DGG   RS++ 
Sbjct: 601  DNSAVTLSILDENDD---FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSA 657

Query: 1196 TVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYT 1255
             V + V+D+NDN P F+         L   V     PGT+V  + A D D G N  + Y+
Sbjct: 658  KVTINVVDVNDNKPVFIVPPSNCSYEL---VLPSTNPGTVVFQVIAVDNDTGMNAEVRYS 714

Query: 1256 LTGPGS-ELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLL-VQVLP 1313
            + G  + +LF++   +G +         +   + + + A+D G P    S+ ++ + V  
Sbjct: 715  IVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNE 774

Query: 1314 SARLAEPPPDLAERDPAAPV 1333
            S   A    +L  +   APV
Sbjct: 775  SVTNATLINELVRKSTEAPV 794



 Score =  227 bits (579), Expect = 1e-58
 Identities = 198/649 (30%), Positives = 294/649 (45%), Gaps = 57/649 (8%)

Query: 2063 ERGPRFPRASSEATIRENAPPGTPIVSPRAVHAG-GTNGPITYSIL-SGNEKGTFSIQPS 2120
            +  P FP      +I EN+   +    P AV    G NG   Y ++ S N  G   I+  
Sbjct: 134  DNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETP 193

Query: 2121 TGAITVRSA--EGLDFEVSPRLRLVLQAESGG---AFAFTVLTLTLQDANDNAPRFLRPH 2175
             G    +    + LD E      + ++ E GG     +  +L +++ D NDN P F    
Sbjct: 194  EGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETE 253

Query: 2176 YVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLA--ASQPARGLFHVDPTTGTITTTA 2233
                +PE+ P+   + Q+ A D D G   +I +S +   S  AR LFH++ TTG IT   
Sbjct: 254  IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE 313

Query: 2234 ILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTI-------PQPWELRVS 2286
             LDRE     +L+++A+D G   +   A + V V D NDN P+I       P    + +S
Sbjct: 314  PLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLS 371

Query: 2287 EDALLGSEIAQVTGNDVDS---GPVLWYVLSPSGPQDPFSVGRYGGRVSL---TGPLDFE 2340
            E+  L ++IA +T  D D+   G V  +    +  + PF +        L      LD+E
Sbjct: 372  ENIPLNTKIALITVTDKDADHNGRVTCF----TDHEIPFRLRPVFSNQFLLETAAYLDYE 427

Query: 2341 QCDRYQLQLLAHDG---PHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILS 2397
                Y ++LLA D    P    A L + V+D NDNAP F+QS   V + E+  PG  +  
Sbjct: 428  STKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTK 487

Query: 2398 VSATDRDSGANGHISYHLASPADG-FSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARD 2456
            VSA D DSG N  I+Y L   A   FS+D   G L  +     L  +        + A+D
Sbjct: 488  VSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVK---KLDREKEDKYLFTILAKD 544

Query: 2457 HGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHA 2516
            +G P   +  TV V + DQND++P FT + Y   V E+LP   T+  +  TD D    ++
Sbjct: 545  NGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYG-DNS 603

Query: 2517 AVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAAD 2576
            AV  SI+  N       +  +     S                 D E    Y   V A D
Sbjct: 604  AVTLSILDENDDFTIDSQTGVIRPNIS----------------FDREKQESYTFYVKAED 647

Query: 2577 RGQPPQSSVVPVTVTVLDVNDNPPVF----TRASYRVTVPEDTPVGAELLHVEASDADPG 2632
             G+  +SS   VT+ V+DVNDN PVF    +  SY + +P   P G  +  V A D D G
Sbjct: 648  GGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNP-GTVVFQVIAVDNDTG 706

Query: 2633 PHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAAD 2681
             +  VR+++  G+   LF +D+ +G + L    D      H+++V+A D
Sbjct: 707  MNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKAND 755



 Score =  198 bits (504), Expect = 6e-50
 Identities = 181/695 (26%), Positives = 304/695 (43%), Gaps = 43/695 (6%)

Query: 524  DPTSGIITTAASLDYELE----PQPQLIVVATDGGLPP--LASSATVSVALQDVNDNEPQ 577
            + T  I TT A +D E      P+ +      +  + P  +     +   ++D+NDN P 
Sbjct: 79   EDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPL 138

Query: 578  FQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGD 637
            F  T  N S+PE +   + +    A D D G  G+ +Y L       G     I+   GD
Sbjct: 139  FPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDV--IETPEGD 196

Query: 638  ----VCTTRTLDRDQGPSSFDFTVTAVDGG--GLKSMVYVKVFLSDENDNPPQFYPREYA 691
                +   + LDR++   ++   V   DGG     S   ++V ++D NDN P F   E  
Sbjct: 197  KMPQLIVQKELDREE-KDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIE 255

Query: 692  ASISAQSPPGTAVLRLRAHDPDQGSHGRLSY---HILAGNSPPLFTLDEQSGLLTVAWPL 748
             SI   +P GT+V +L A D D G + ++ +   ++++  +  LF L+  +GL+T+  PL
Sbjct: 256  VSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPL 315

Query: 749  ARRANSVVQLEIGAEDGGGLQAEPSARVDISIV----PGTPTPPIFEQLQYVFSVPEDVA 804
             R      +L + A DGG + A     V+++ V    P      I   +     + E++ 
Sbjct: 316  DREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIP 375

Query: 805  PGTSVGIVQA------HNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLG 858
              T + ++        HN  GR   VT       P  L  + +   LL+T   LD E   
Sbjct: 376  LNTKIALITVTDKDADHN--GR---VTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTK 430

Query: 859  PVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRA 918
                  + A +G PP    A + + + D NDN+P F     TV +P N +PG  +  + A
Sbjct: 431  EYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSA 490

Query: 919  LDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPR 978
            +D DSG N+++ + L       F++D  TG + +++ L       +   + A+D G PP 
Sbjct: 491  MDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPL 550

Query: 979  TSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPD-GGPITYHLA 1037
            TS+  + V V  +     +P F    Y   +P        V  +    PD G      L+
Sbjct: 551  TSN--VTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLS 608

Query: 1038 AEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILN 1097
                +  F ++ Q+G +    + DRE QE Y   V A  G +     ++ +A V +++++
Sbjct: 609  ILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRV---SRSSSAKVTINVVD 665

Query: 1098 QNEHSPRLSEDP---TFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAF 1154
             N++ P     P   ++  V  +  PGT V +V A D D+G N  + YS+         F
Sbjct: 666  VNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVG-GNTRDLF 724

Query: 1155 RIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSP 1189
             I  +TG +T ++  D      +++LV+  D G P
Sbjct: 725  AIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759



 Score =  189 bits (480), Expect = 4e-47
 Identities = 190/701 (27%), Positives = 304/701 (43%), Gaps = 88/701 (12%)

Query: 2219 LFHVDPTTGTITTT-AILDRE-----------IWAETRLVLMATDRGSPALVGSATLTVM 2266
            L  ++  TG I TT A +DRE            + E  + ++  +     +     +  +
Sbjct: 74   LIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDE-----IFRLVKIRFL 128

Query: 2267 VIDTNDNRPTIPQPW-ELRVSEDALLGSEIAQVTGNDVDSG--PVLWYVLSPSGPQDPFS 2323
            + D NDN P  P     + + E++ + S+       D D G   V  Y L  S  Q+ F 
Sbjct: 129  IEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS--QNIFG 186

Query: 2324 V-------GRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVL---VEDVNDNA 2373
            +       G    ++ +   LD E+ D Y +++   DG    R++  +L   V D NDN 
Sbjct: 187  LDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNH 246

Query: 2374 PAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFS--VDPNNGTL 2431
            P F ++  +V + E+ P G+++  + ATD D G N  I +  ++     +  +   N T 
Sbjct: 247  PVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATT 306

Query: 2432 FTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHY---- 2487
              I     L  + +    +++ A D G     ARA V V + D ND+ PS  + +     
Sbjct: 307  GLITIKEPLDREETPNHKLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPV 364

Query: 2488 --RVAVTEDLPPGSTLLTLEATDADGS---RSHAAVDYSIISGNWGRVFQLEPRLAEAGE 2542
               V ++E++P  + +  +  TD D     R     D+ I        F+L P  +    
Sbjct: 365  NDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEI-------PFRLRPVFSNQ-- 415

Query: 2543 SAGPGPRALGCLVLLEP---LDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNP 2599
                         LLE    LD+ES  +Y + + AAD G+PP +    + + V D NDN 
Sbjct: 416  ------------FLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNA 463

Query: 2600 PVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTL 2659
            PVFT++   V++PE+   G +L  V A DAD GP+  + + +    P   F LD  +G L
Sbjct: 464  PVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPE-FSLDCRTGML 522

Query: 2660 RLAHALDCETQARHQLVVQAADPAGAHFALAPVTIEVQ--DVNDHGPAFPLNLLSTSVAE 2717
             +   LD E + ++   + A D  G     + VT+ V   D ND+ P F  N  +  V E
Sbjct: 523  TVVKKLDREKEDKYLFTILAKD-NGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPE 581

Query: 2718 NQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEH 2777
            N P    V  +   D D G    +  S+L+        + F ++S TG +R  + FD E 
Sbjct: 582  NLPRHGTVGLITVTDPDYGDNSAVTLSILDE------NDDFTIDSQTGVIRPNISFDREK 635

Query: 2778 TESFRLLVGAADAGNLSASVTVSVLVTGEDEYD--PVFLAP----AFHFQVPEGARRGHS 2831
             ES+   V A D G +S S +  V +   D  D  PVF+ P    ++   +P     G  
Sbjct: 636  QESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLP-STNPGTV 694

Query: 2832 LGHVQATDEDGGADGLVLYSL--ATSSPYFGINQTTGALYL 2870
            +  V A D D G +  V YS+    +   F I+Q TG + L
Sbjct: 695  VFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITL 735



 Score =  181 bits (458), Expect = 1e-44
 Identities = 161/580 (27%), Positives = 251/580 (43%), Gaps = 44/580 (7%)

Query: 47  LDLQIDEEQPAGTLIGDISA-GLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTAR 105
           +++ I E  P GT +  + A     G  A + +  S    +       ++  +G++    
Sbjct: 254 IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE 313

Query: 106 VLDREQRDRYRFTAVTPDG----ATVEVTVRVADINDHAPAFP------QARAALQVPEH 155
            LDRE+   ++   +  DG    A   V V V D+ND+ P+             + + E+
Sbjct: 314 PLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSEN 373

Query: 156 TAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDR 215
               T+  L    D DA   G        +     FRL     P  +    L     LD 
Sbjct: 374 IPLNTKIALITVTDKDADHNGRVTCFTDHE---IPFRLR----PVFSNQFLLETAAYLDY 426

Query: 216 ENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVL 275
           E+   Y ++L A D G PP    A+L + + D ND+AP F QS     + E+ +PG  + 
Sbjct: 427 ESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLT 486

Query: 276 QVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQAR 335
           +V A DAD+G N  + Y +     +    FS+D  TG+L + + LD E+   +   + A+
Sbjct: 487 KVSAMDADSGPNAKINYLLG---PDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAK 543

Query: 336 DGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDD 395
           D G  P   +  V V + D NDN P    +F   + +  V E  P    V  I+V+DPD 
Sbjct: 544 DNGVPPLTSNVTVFVSIIDQNDNSP----VFTHNEYNFYVPENLPRHGTVGLITVTDPDY 599

Query: 396 GDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPLRAE 455
           GD + V +S+      F + +Q  VI         DRE++++Y   V A D G     + 
Sbjct: 600 GDNSAVTLSILDENDDFTIDSQTGVIRPNI---SFDREKQESYTFYVKAEDGGRVSRSSS 656

Query: 456 AAFVLHVTDVNDNAPAFDRQLYRPEPLP-EVALP----GSFVVRVTARDPDQGTNGQVTY 510
           A   ++V DVNDN P F   +  P     E+ LP    G+ V +V A D D G N +V Y
Sbjct: 657 AKVTINVVDVNDNKPVF---IVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRY 713

Query: 511 SLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQD 570
           S+  G     F+ID  +G IT     D       +++V A D G P     +  SV + +
Sbjct: 714 SIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP----DSLFSVVIVN 769

Query: 571 VNDNEPQFQRTFYNASLPEGTQ----PGTCFLQVTATDAD 606
           +  NE     T  N  + + T+    P T    V++  +D
Sbjct: 770 LFVNESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSD 809



 Score =  177 bits (450), Expect = 1e-43
 Identities = 165/617 (26%), Positives = 258/617 (41%), Gaps = 46/617 (7%)

Query: 1847 DANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYL--GAGTAGAFLL 1904
            D ND+AP FP    ++ +PE+    +      A DPD G NG   Y L       G  ++
Sbjct: 131  DINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVI 190

Query: 1905 EPSSGE----LRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTF 1960
            E   G+    L     LDRE+  +Y   V   DG      ST + + ++V D ND+ P F
Sbjct: 191  ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAI-LQVSVTDTNDNHPVF 249

Query: 1961 PTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTT----VDSY 2016
              + + + +P   P  ++ T     L A D D G NA I +  +            +++ 
Sbjct: 250  KETEIEVSIPENAPVGTSVT----QLHATDADIGENAKIHFSFSNLVSNIARRLFHLNAT 305

Query: 2017 TGEIRVARSPVALGPRDRVLFIVATDLG-RPARSATGVIIVGLQGEAERGPRFP------ 2069
            TG I +          +  L ++A+D G  PAR+   +++V +    +  P         
Sbjct: 306  TGLITIKEPLDREETPNHKLLVLASDGGLMPARA---MVLVNVTDVNDNVPSIDIRYIVN 362

Query: 2070 RASSEATIRENAPPGTPIVSPRAVHAGGT-NGPITYSILSGNEKGTFSIQPS-TGAITVR 2127
              +    + EN P  T I            NG +T      + +  F ++P  +    + 
Sbjct: 363  PVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFT---DHEIPFRLRPVFSNQFLLE 419

Query: 2128 SAEGLDFEVSPRLRLVLQAESGGAFAFT---VLTLTLQDANDNAPRFLRPHYVAFLPESR 2184
            +A  LD+E +    + L A   G        +L + ++D NDNAP F +      +PE+ 
Sbjct: 420  TAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENN 479

Query: 2185 PLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETR 2244
                 L +V A D D G   +I+Y L    P    F +D  TG +T    LDRE   +  
Sbjct: 480  SPGIQLTKVSAMDADSGPNAKINYLLGPDAPPE--FSLDCRTGMLTVVKKLDREKEDKYL 537

Query: 2245 LVLMATDRGSPALVGSATLTVMVIDTNDNRPTIP-QPWELRVSEDALLGSEIAQVTGNDV 2303
              ++A D G P L  + T+ V +ID NDN P      +   V E+      +  +T  D 
Sbjct: 538  FTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDP 597

Query: 2304 DSGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGR---A 2360
            D G      LS     D F++    G +      D E+ + Y   + A DG    R   A
Sbjct: 598  DYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSA 657

Query: 2361 NLTVLVEDVNDNAPAF----SQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHL- 2415
             +T+ V DVNDN P F    S   Y+ ++L  T PG+ +  V A D D+G N  + Y + 
Sbjct: 658  KVTINVVDVNDNKPVFIVPPSNCSYE-LVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIV 716

Query: 2416 -ASPADGFSVDPNNGTL 2431
              +  D F++D   G +
Sbjct: 717  GGNTRDLFAIDQETGNI 733


>gi|14589920 protocadherin 11 X-linked isoform c [Homo sapiens]
          Length = 1347

 Score =  330 bits (845), Expect = 2e-89
 Identities = 240/721 (33%), Positives = 361/721 (50%), Gaps = 42/721 (5%)

Query: 51  IDEEQPAGTLIGDISAGL-----PAGTAAPLMYFISAQEGSGVGTDLAIDEHSG-VVRTA 104
           I EE P   LIGD+   L     P  +    M F    +   V   + I+E +G +  T 
Sbjct: 30  IREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPL-IRIEEDTGEIFTTG 88

Query: 105 RVLDREQ------RDRYRF----TAVTPDGATVEVTVR--VADINDHAPAFPQARAALQV 152
             +DRE+      RD + F     A+ PD     V +R  + DIND+AP FP     + +
Sbjct: 89  ARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISI 148

Query: 153 PEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGE 212
           PE++A  ++Y L  A D D G  G Q Y L    +   F L+    P+G  +P+L+V  E
Sbjct: 149 PENSAINSKYTLPAAVDPDVGINGVQNYELIK--SQNIFGLDVIETPEGDKMPQLIVQKE 206

Query: 213 LDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGS 272
           LDRE +  Y+++++  DGG P R + A+L V++ D ND+ P F ++     + E+   G+
Sbjct: 207 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGT 266

Query: 273 PVLQVFASDADAGVNGAVTYEINRRQSE-GDGPFSIDAHTGLLQLERPLDFEQRRVHELV 331
            V Q+ A+DAD G N  + +  +   S      F ++A TGL+ ++ PLD E+   H+L+
Sbjct: 267 SVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLL 326

Query: 332 VQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFL--SADGSPQVSEAAPPGQLVARIS 389
           V A DGG  P    A V V+V D NDN PS+ + ++    + +  +SE  P    +A I+
Sbjct: 327 VLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALIT 384

Query: 390 VSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGS 449
           V+D D      V    +  E  F L    S  +L+  A  LD E    Y +++ A D+G 
Sbjct: 385 VTDKDADHNGRVTCFTD-HEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGK 443

Query: 450 PPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVT 509
           PPL   A   + V D NDNAP F  Q +    +PE   PG  + +V+A D D G N ++ 
Sbjct: 444 PPLNQSAMLFIKVKDENDNAPVF-TQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKIN 502

Query: 510 YSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQ 569
           Y L P A    FS+D  +G++T    LD E E +    ++A D G+PPL S+ TV V++ 
Sbjct: 503 YLLGPDAPPE-FSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSII 561

Query: 570 DVNDNEPQFQRTFYNASLPEG-TQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPP 628
           D NDN P F    YN  +PE   + GT  L +T TD D G    ++ S+        +  
Sbjct: 562 DQNDNSPVFTHNEYNFYVPENLPRHGTVGL-ITVTDPDYGDNSAVTLSI-----LDENDD 615

Query: 629 FRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMVYVKVFLS--DENDNPPQFY 686
           F ID+ +G +    + DR++   S+ F V A DGG +      KV ++  D NDN P F 
Sbjct: 616 FTIDSQTGVIRPNISFDREK-QESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFI 674

Query: 687 PREYAASISAQSP---PGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLT 743
                 S     P   PGT V ++ A D D G +  + Y I+ GN+  LF +D+++G +T
Sbjct: 675 VPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNIT 734

Query: 744 V 744
           +
Sbjct: 735 L 735



 Score =  272 bits (696), Expect = 4e-72
 Identities = 206/665 (30%), Positives = 320/665 (48%), Gaps = 39/665 (5%)

Query: 1418 RLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLL 1477
            RL++++  ++D N++AP F    + +++PEN    +  YT  A+     G N    Y L+
Sbjct: 121  RLVKIRFLIEDINDNAPLFPATVINISIPENSAINSK-YTLPAAVDPDVGINGVQNYELI 179

Query: 1478 RQEPPVPALRLDARTG----ALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSAR 1533
            + +       ++   G     L   + LDRE     ++ V+  D       +R++    +
Sbjct: 180  KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVED---GGFPQRSSTAILQ 236

Query: 1534 VFVTDENDNAPVFASPS-RVRLPEDQPPGPAALHVVARDPDLGEAARVSYR----LASGG 1588
            V VTD NDN PVF      V +PE+ P G +   + A D D+GE A++ +     +++  
Sbjct: 237  VSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIA 296

Query: 1589 DGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPT 1648
               F L+++TG +++  PLDRE+   H L V+ASD G  P  A  ++ V+V DVND  P+
Sbjct: 297  RRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPS 354

Query: 1649 FQQQ------EYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSESFSLDP---D 1699
               +        +V+L EN P  T +  +  TD D   NG+VT        F L P   +
Sbjct: 355  IDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN 414

Query: 1700 TGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLE 1759
              +L T   LD E  +E  + + A D G PP      + + V+DEND+AP F  + +++ 
Sbjct: 415  QFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVS 474

Query: 1760 VPEGQDPQ-TLTMLRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVE 1818
            +PE   P   LT + A D D G N ++ Y +L  D    F LD  +G    ++ LDRE E
Sbjct: 475  IPENNSPGIQLTKVSAMDADSGPNAKINY-LLGPDAPPEFSLDCRTGMLTVVKKLDREKE 533

Query: 1819 PAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQ 1878
              +   I A+D G P L++ + + V+++D ND++P F    Y+  VPE++P    +  + 
Sbjct: 534  DKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLIT 593

Query: 1879 AHDPDAGANGHVTYYLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAG 1938
              DPD G N  VT  +       F ++  +G +R   + DRE+  SYTF V A DG    
Sbjct: 594  VTDPDYGDNSAVTLSI-LDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVS 652

Query: 1939 PLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANAS 1998
              S++  VTI V DVND+ P F   P         PS +  T+    + A D D G NA 
Sbjct: 653  -RSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVI-AVDNDTGMNAE 710

Query: 1999 ILYRLAGTPPPGTT-----VDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGV 2053
            + Y + G    G T     +D  TG I +             + + A DLG+P  S   V
Sbjct: 711  VRYSIVG----GNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP-DSLFSV 765

Query: 2054 IIVGL 2058
            +IV L
Sbjct: 766  VIVNL 770



 Score =  246 bits (628), Expect = 3e-64
 Identities = 217/767 (28%), Positives = 343/767 (44%), Gaps = 64/767 (8%)

Query: 1445 LPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGAL-SAPRGLDR 1503
            +PEN   G  L     S        + ++++L+ +   VP +R++  TG + +    +DR
Sbjct: 34   MPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDR 93

Query: 1504 ETTPA-------LLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVF-ASPSRVRLP 1555
            E   A           VE    P    R     V  R  + D NDNAP+F A+   + +P
Sbjct: 94   EKLCAGIPRDEHCFYEVEVAILPDEIFRL----VKIRFLIEDINDNAPLFPATVINISIP 149

Query: 1556 EDQPPGPAALHVVARDPDLGEAARVSYRLASGGD--GHFRLHSSTG----ALSVVRPLDR 1609
            E+           A DPD+G     +Y L    +  G   + +  G     L V + LDR
Sbjct: 150  ENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDR 209

Query: 1610 EQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLL 1669
            E++  +V+ V   D G P RS+T +L VSV D ND  P F++ E  V + EN P GTS+ 
Sbjct: 210  EEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVT 269

Query: 1670 TLRATDPDVGANGQVTY------GGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYA 1723
             L ATD D+G N ++ +        ++   F L+  TG++T    LDREE     L V A
Sbjct: 270  QLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLA 329

Query: 1724 QDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHL------SLEVPEGQDPQT-LTMLRASD 1776
             D G  P      V V V D ND+ P+    ++      ++ + E     T + ++  +D
Sbjct: 330  SDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTD 387

Query: 1777 PDVGANGQLQYRILDGDP-------SGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARD 1829
             D   NG++        P       S  F+L+ A+        LD E    + +++ A D
Sbjct: 388  KDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAA-------YLDYESTKEYAIKLLAAD 440

Query: 1830 GGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGH 1889
             G+P L+ + +L + V D ND+AP F     +V +PE+   G  L ++ A D D+G N  
Sbjct: 441  AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAK 500

Query: 1890 VTYYLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTIT 1949
            + Y LG      F L+  +G L     LDRE+   Y F++ A D     PL++ V+V ++
Sbjct: 501  INYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVP-PLTSNVTVFVS 559

Query: 1950 VRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPP 2009
            + D ND++P F  +     +P   P   T  L   T    D D G N+++   +      
Sbjct: 560  IIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVT----DPDYGDNSAVTLSIL-DEND 614

Query: 2010 GTTVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRF- 2068
              T+DS TG IR   S           ++ A D GR +RS++  + + +    +  P F 
Sbjct: 615  DFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFI 674

Query: 2069 --PRASSEATIRENAPPGTPIVSPRAV-HAGGTNGPITYSILSGNEKGTFSIQPSTGAIT 2125
              P   S   +  +  PGT +    AV +  G N  + YSI+ GN +  F+I   TG IT
Sbjct: 675  VPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNIT 734

Query: 2126 VRSAEGLDFEVSPRLRLVLQAESGG----AFAFTVLTLTLQDANDNA 2168
            +   E  D       R++++A   G     F+  ++ L + ++  NA
Sbjct: 735  L--MEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNA 779



 Score =  238 bits (608), Expect = 6e-62
 Identities = 188/655 (28%), Positives = 299/655 (45%), Gaps = 36/655 (5%)

Query: 1323 DLAERDPAAPVPVV-LTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFAL 1381
            D+ +  P  P  V+ +++     +     L +   P+    G   Y L+   +  G   +
Sbjct: 131  DINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVI 190

Query: 1382 DAASG----RLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFA 1437
            +   G    +L + + LD E    +       +G     +    +QV V D N++ P F 
Sbjct: 191  ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFK 250

Query: 1438 RDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVP--ALRLDARTGAL 1495
               + +++PEN   G ++    A+DAD  G N+ + +        +      L+A TG +
Sbjct: 251  ETEIEVSIPENAPVGTSVTQLHATDAD-IGENAKIHFSFSNLVSNIARRLFHLNATTGLI 309

Query: 1496 SAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAP-------VFAS 1548
            +    LDRE TP   LLV A+D          AR    V VTD NDN P       V   
Sbjct: 310  TIKEPLDREETPNHKLLVLASD-----GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPV 364

Query: 1549 PSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGHFRLH---SSTGALSVVR 1605
               V L E+ P       +   D D     RV+    +  +  FRL    S+   L    
Sbjct: 365  NDTVVLSENIPLNTKIALITVTDKDADHNGRVT--CFTDHEIPFRLRPVFSNQFLLETAA 422

Query: 1606 PLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPG 1665
             LD E   E+ + ++A+D G PP + + +L + V D ND AP F Q   +V + ENN PG
Sbjct: 423  YLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPG 482

Query: 1666 TSLLTLRATDPDVGANGQVTY--GGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYA 1723
              L  + A D D G N ++ Y  G  +   FSLD  TG+LT ++ LDRE++++   T+ A
Sbjct: 483  IQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILA 542

Query: 1724 QDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQ-TLTMLRASDPDVGAN 1782
            +D G PP  ++VTV V++ D+ND++P F     +  VPE      T+ ++  +DPD G N
Sbjct: 543  KDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDN 602

Query: 1783 GQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLT 1842
              +   ILD +    F +D  +G        DRE + ++   ++A DGG+ + S++  +T
Sbjct: 603  SAVTLSILDENDD--FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVT 660

Query: 1843 VTVLDANDHAPAFPVP----AYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTY-YLGAG 1897
            + V+D ND+ P F VP    +Y + +P   P GT++ Q+ A D D G N  V Y  +G  
Sbjct: 661  INVVDVNDNKPVFIVPPSNCSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRYSIVGGN 719

Query: 1898 TAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRD 1952
            T   F ++  +G +      D      +   V A D      L + V V + V +
Sbjct: 720  TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNE 774



 Score =  236 bits (601), Expect = 4e-61
 Identities = 197/672 (29%), Positives = 306/672 (45%), Gaps = 44/672 (6%)

Query: 2152 FAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLA 2211
            F    +   ++D NDNAP F        +PE+  +        A D D G  G  +Y L 
Sbjct: 120  FRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELI 179

Query: 2212 ASQPARGLFHVDPTTGTITTTAILDREIWAETR----LVLMATDRGSPALVGSATLTVMV 2267
             SQ   GL  ++   G      I+ +E+  E +    + +   D G P    +A L V V
Sbjct: 180  KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSV 239

Query: 2268 IDTNDNRPTIPQ-PWELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSG-----PQDP 2321
             DTNDN P   +   E+ + E+A +G+ + Q+   D D G       S S       +  
Sbjct: 240  TDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRL 299

Query: 2322 FSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGP-HEGRANLTVLVEDVNDNAPAFSQSL 2380
            F +    G +++  PLD E+   ++L +LA DG     RA + V V DVNDN P+     
Sbjct: 300  FHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRY 359

Query: 2381 Y------QVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTLFTI 2434
                    V+L E+ P  + I  ++ TD+D+  NG ++         F + P     F +
Sbjct: 360  IVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRLRPVFSNQFLL 418

Query: 2435 VGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTED 2494
                 L ++ +    + L A D G P     A + ++++D+ND+AP FT S   V++ E+
Sbjct: 419  ETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPEN 478

Query: 2495 LPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCL 2554
              PG  L  + A DAD S  +A ++Y ++  +    F L+ R               G L
Sbjct: 479  NSPGIQLTKVSAMDAD-SGPNAKINY-LLGPDAPPEFSLDCR--------------TGML 522

Query: 2555 VLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPED 2614
             +++ LD E   +Y  T+ A D G PP +S V V V+++D NDN PVFT   Y   VPE+
Sbjct: 523  TVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN 582

Query: 2615 TPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQ 2674
             P    +  +  +D D G +  V  T+S  D +  F +D  +G +R   + D E Q  + 
Sbjct: 583  LPRHGTVGLITVTDPDYGDNSAV--TLSILDENDDFTIDSQTGVIRPNISFDREKQESYT 640

Query: 2675 LVVQAADPAG-AHFALAPVTIEVQDVNDHGPAF---PLNLLSTSVAENQPPGTLVTTLHA 2730
              V+A D    +  + A VTI V DVND+ P F   P N     V  +  PGT+V  + A
Sbjct: 641  FYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIA 700

Query: 2731 IDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAADA 2790
            +D D G    +RYS++    G   R+ FA++  TG +      D       R+LV A D 
Sbjct: 701  VDNDTGMNAEVRYSIV----GGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDL 756

Query: 2791 GNLSASVTVSVL 2802
            G   +  +V ++
Sbjct: 757  GQPDSLFSVVIV 768



 Score =  230 bits (586), Expect = 2e-59
 Identities = 203/702 (28%), Positives = 315/702 (44%), Gaps = 47/702 (6%)

Query: 1639 VADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSES-FSLD 1697
            + D+ND AP F     ++ + EN+   +      A DPDVG NG   Y  + S++ F LD
Sbjct: 129  IEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLD 188

Query: 1698 ----PDTGVLTTL---RALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPT 1750
                P+   +  L   + LDREE++   + V  +D G P + +   ++V+V D ND+ P 
Sbjct: 189  VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPV 248

Query: 1751 FGSAHLSLEVPEGQDPQT-LTMLRASDPDVGANGQLQY---RILDGDPSGAFVLDLASGE 1806
            F    + + +PE     T +T L A+D D+G N ++ +    ++       F L+  +G 
Sbjct: 249  FKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGL 308

Query: 1807 FGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAY------ 1860
                 PLDRE  P  +L + A DGG     A +L+ VT  D ND+ P+  +         
Sbjct: 309  ITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVND 366

Query: 1861 SVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGE---LRTAAAL 1917
            +V + E++P  T +  +   D DA  NG VT +        F L P       L TAA L
Sbjct: 367  TVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIP--FRLRPVFSNQFLLETAAYL 424

Query: 1918 DREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFS 1977
            D E    Y   + A D A   PL+ +  + I V+D ND+AP F  S + + +P      +
Sbjct: 425  DYESTKEYAIKLLAAD-AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPEN----N 479

Query: 1978 TPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLF 2037
            +P + L  + A D D+G NA I Y L    PP  ++D  TG + V +  +     D+ LF
Sbjct: 480  SPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKK-LDREKEDKYLF 538

Query: 2038 -IVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPP-GTPIVSPRAVHA 2095
             I+A D G P  ++   + V +  + +  P F        + EN P  GT  +       
Sbjct: 539  TILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPD 598

Query: 2096 GGTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFT 2155
             G N  +T SIL  N+   F+I   TG I  R     D E        ++AE GG  + +
Sbjct: 599  YGDNSAVTLSILDENDD--FTIDSQTGVI--RPNISFDREKQESYTFYVKAEDGGRVSRS 654

Query: 2156 V---LTLTLQDANDNAPRFLRP----HYVAFLPESRPLEGPLLQVEADDLDQGSGGQISY 2208
                +T+ + D NDN P F+ P     Y   LP + P    + QV A D D G   ++ Y
Sbjct: 655  SSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRY 713

Query: 2209 SLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVI 2268
            S+      R LF +D  TG IT     D       R+++ A D G P  + S  +  + +
Sbjct: 714  SIVGGN-TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFV 772

Query: 2269 DTNDNRPTIPQPWELRVSEDALL-GSEIAQVTGNDVDSGPVL 2309
            + +    T+      + +E  +   +EIA V+    D   +L
Sbjct: 773  NESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSDYVKIL 814



 Score =  229 bits (583), Expect = 4e-59
 Identities = 212/740 (28%), Positives = 326/740 (44%), Gaps = 51/740 (6%)

Query: 627  PPFRIDAHSGDVCTTRT-LDRDQ-------GPSSFDFTVTAVDGGGLKSMVYVKVFLSDE 678
            P  RI+  +G++ TT   +DR++           F     A+    +  +V ++  + D 
Sbjct: 73   PLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDI 132

Query: 679  NDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLD-- 736
            NDN P F       SI   S   +      A DPD G +G  +Y ++   S  +F LD  
Sbjct: 133  NDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELI--KSQNIFGLDVI 190

Query: 737  -----EQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFE 791
                 ++   L V   L R       +++  EDGG  Q   +A + +S+       P+F+
Sbjct: 191  ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFK 250

Query: 792  QLQYVFSVPEDVAPGTSVGIVQAHNPP-GRLAPVTLSLSG---GDPRGLFSLDAVSGLLQ 847
            + +   S+PE+   GTSV  + A +   G  A +  S S       R LF L+A +GL+ 
Sbjct: 251  ETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLIT 310

Query: 848  TLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAP------EDTV 901
               PLDRE       L + +  G+ PA A+  V V   DVNDN P+           DTV
Sbjct: 311  IKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVNDTV 368

Query: 902  LLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRP---LGP 958
            +L  N    T I  +   D D+  N RVT          F + P   +  L+     L  
Sbjct: 369  VLSENIPLNTKIALITVTDKDADHNGRVT--CFTDHEIPFRLRPVFSNQFLLETAAYLDY 426

Query: 959  SGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQ 1018
                 + ++L A D G PP      L + V+D      AP F      V +P   + G Q
Sbjct: 427  ESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDN--APVFTQSFVTVSIPENNSPGIQ 484

Query: 1019 VLQVQAQAPDGGP---ITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAV 1075
            + +V A   D GP   I Y L  + A   F L+ ++G L V   LDRE ++ Y+  ++A 
Sbjct: 485  LTKVSAMDADSGPNAKINYLLGPD-APPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAK 543

Query: 1076 SGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSG 1135
                  L   T   TV VSI++QN++SP  + +     V EN P   +VG +  TD D G
Sbjct: 544  DNGVPPL---TSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYG 600

Query: 1136 PNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTG 1195
             N  +T S+   ++D   F I  QTG +    + DRE+Q SY   V+ +DGG   RS++ 
Sbjct: 601  DNSAVTLSILDENDD---FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSA 657

Query: 1196 TVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYT 1255
             V + V+D+NDN P F+         L   V     PGT+V  + A D D G N  + Y+
Sbjct: 658  KVTINVVDVNDNKPVFIVPPSNCSYEL---VLPSTNPGTVVFQVIAVDNDTGMNAEVRYS 714

Query: 1256 LTGPGS-ELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLL-VQVLP 1313
            + G  + +LF++   +G +         +   + + + A+D G P    S+ ++ + V  
Sbjct: 715  IVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNE 774

Query: 1314 SARLAEPPPDLAERDPAAPV 1333
            S   A    +L  +   APV
Sbjct: 775  SVTNATLINELVRKSTEAPV 794



 Score =  227 bits (579), Expect = 1e-58
 Identities = 198/649 (30%), Positives = 294/649 (45%), Gaps = 57/649 (8%)

Query: 2063 ERGPRFPRASSEATIRENAPPGTPIVSPRAVHAG-GTNGPITYSIL-SGNEKGTFSIQPS 2120
            +  P FP      +I EN+   +    P AV    G NG   Y ++ S N  G   I+  
Sbjct: 134  DNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETP 193

Query: 2121 TGAITVRSA--EGLDFEVSPRLRLVLQAESGG---AFAFTVLTLTLQDANDNAPRFLRPH 2175
             G    +    + LD E      + ++ E GG     +  +L +++ D NDN P F    
Sbjct: 194  EGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETE 253

Query: 2176 YVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLA--ASQPARGLFHVDPTTGTITTTA 2233
                +PE+ P+   + Q+ A D D G   +I +S +   S  AR LFH++ TTG IT   
Sbjct: 254  IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE 313

Query: 2234 ILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTI-------PQPWELRVS 2286
             LDRE     +L+++A+D G   +   A + V V D NDN P+I       P    + +S
Sbjct: 314  PLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLS 371

Query: 2287 EDALLGSEIAQVTGNDVDS---GPVLWYVLSPSGPQDPFSVGRYGGRVSL---TGPLDFE 2340
            E+  L ++IA +T  D D+   G V  +    +  + PF +        L      LD+E
Sbjct: 372  ENIPLNTKIALITVTDKDADHNGRVTCF----TDHEIPFRLRPVFSNQFLLETAAYLDYE 427

Query: 2341 QCDRYQLQLLAHDG---PHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILS 2397
                Y ++LLA D    P    A L + V+D NDNAP F+QS   V + E+  PG  +  
Sbjct: 428  STKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTK 487

Query: 2398 VSATDRDSGANGHISYHLASPADG-FSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARD 2456
            VSA D DSG N  I+Y L   A   FS+D   G L  +     L  +        + A+D
Sbjct: 488  VSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVK---KLDREKEDKYLFTILAKD 544

Query: 2457 HGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHA 2516
            +G P   +  TV V + DQND++P FT + Y   V E+LP   T+  +  TD D    ++
Sbjct: 545  NGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYG-DNS 603

Query: 2517 AVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAAD 2576
            AV  SI+  N       +  +     S                 D E    Y   V A D
Sbjct: 604  AVTLSILDENDDFTIDSQTGVIRPNIS----------------FDREKQESYTFYVKAED 647

Query: 2577 RGQPPQSSVVPVTVTVLDVNDNPPVF----TRASYRVTVPEDTPVGAELLHVEASDADPG 2632
             G+  +SS   VT+ V+DVNDN PVF    +  SY + +P   P G  +  V A D D G
Sbjct: 648  GGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNP-GTVVFQVIAVDNDTG 706

Query: 2633 PHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAAD 2681
             +  VR+++  G+   LF +D+ +G + L    D      H+++V+A D
Sbjct: 707  MNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKAND 755



 Score =  198 bits (504), Expect = 6e-50
 Identities = 181/695 (26%), Positives = 304/695 (43%), Gaps = 43/695 (6%)

Query: 524  DPTSGIITTAASLDYELE----PQPQLIVVATDGGLPP--LASSATVSVALQDVNDNEPQ 577
            + T  I TT A +D E      P+ +      +  + P  +     +   ++D+NDN P 
Sbjct: 79   EDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPL 138

Query: 578  FQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGD 637
            F  T  N S+PE +   + +    A D D G  G+ +Y L       G     I+   GD
Sbjct: 139  FPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDV--IETPEGD 196

Query: 638  ----VCTTRTLDRDQGPSSFDFTVTAVDGG--GLKSMVYVKVFLSDENDNPPQFYPREYA 691
                +   + LDR++   ++   V   DGG     S   ++V ++D NDN P F   E  
Sbjct: 197  KMPQLIVQKELDREE-KDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIE 255

Query: 692  ASISAQSPPGTAVLRLRAHDPDQGSHGRLSY---HILAGNSPPLFTLDEQSGLLTVAWPL 748
             SI   +P GT+V +L A D D G + ++ +   ++++  +  LF L+  +GL+T+  PL
Sbjct: 256  VSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPL 315

Query: 749  ARRANSVVQLEIGAEDGGGLQAEPSARVDISIV----PGTPTPPIFEQLQYVFSVPEDVA 804
             R      +L + A DGG + A     V+++ V    P      I   +     + E++ 
Sbjct: 316  DREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIP 375

Query: 805  PGTSVGIVQA------HNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLG 858
              T + ++        HN  GR   VT       P  L  + +   LL+T   LD E   
Sbjct: 376  LNTKIALITVTDKDADHN--GR---VTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTK 430

Query: 859  PVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRA 918
                  + A +G PP    A + + + D NDN+P F     TV +P N +PG  +  + A
Sbjct: 431  EYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSA 490

Query: 919  LDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPR 978
            +D DSG N+++ + L       F++D  TG + +++ L       +   + A+D G PP 
Sbjct: 491  MDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPL 550

Query: 979  TSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPD-GGPITYHLA 1037
            TS+  + V V  +     +P F    Y   +P        V  +    PD G      L+
Sbjct: 551  TSN--VTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLS 608

Query: 1038 AEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILN 1097
                +  F ++ Q+G +    + DRE QE Y   V A  G +     ++ +A V +++++
Sbjct: 609  ILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRV---SRSSSAKVTINVVD 665

Query: 1098 QNEHSPRLSEDP---TFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAF 1154
             N++ P     P   ++  V  +  PGT V +V A D D+G N  + YS+         F
Sbjct: 666  VNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVG-GNTRDLF 724

Query: 1155 RIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSP 1189
             I  +TG +T ++  D      +++LV+  D G P
Sbjct: 725  AIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759



 Score =  189 bits (480), Expect = 4e-47
 Identities = 190/701 (27%), Positives = 304/701 (43%), Gaps = 88/701 (12%)

Query: 2219 LFHVDPTTGTITTT-AILDRE-----------IWAETRLVLMATDRGSPALVGSATLTVM 2266
            L  ++  TG I TT A +DRE            + E  + ++  +     +     +  +
Sbjct: 74   LIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDE-----IFRLVKIRFL 128

Query: 2267 VIDTNDNRPTIPQPW-ELRVSEDALLGSEIAQVTGNDVDSG--PVLWYVLSPSGPQDPFS 2323
            + D NDN P  P     + + E++ + S+       D D G   V  Y L  S  Q+ F 
Sbjct: 129  IEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS--QNIFG 186

Query: 2324 V-------GRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVL---VEDVNDNA 2373
            +       G    ++ +   LD E+ D Y +++   DG    R++  +L   V D NDN 
Sbjct: 187  LDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNH 246

Query: 2374 PAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFS--VDPNNGTL 2431
            P F ++  +V + E+ P G+++  + ATD D G N  I +  ++     +  +   N T 
Sbjct: 247  PVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATT 306

Query: 2432 FTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHY---- 2487
              I     L  + +    +++ A D G     ARA V V + D ND+ PS  + +     
Sbjct: 307  GLITIKEPLDREETPNHKLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPV 364

Query: 2488 --RVAVTEDLPPGSTLLTLEATDADGS---RSHAAVDYSIISGNWGRVFQLEPRLAEAGE 2542
               V ++E++P  + +  +  TD D     R     D+ I        F+L P  +    
Sbjct: 365  NDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEI-------PFRLRPVFSNQ-- 415

Query: 2543 SAGPGPRALGCLVLLEP---LDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNP 2599
                         LLE    LD+ES  +Y + + AAD G+PP +    + + V D NDN 
Sbjct: 416  ------------FLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNA 463

Query: 2600 PVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTL 2659
            PVFT++   V++PE+   G +L  V A DAD GP+  + + +    P   F LD  +G L
Sbjct: 464  PVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPE-FSLDCRTGML 522

Query: 2660 RLAHALDCETQARHQLVVQAADPAGAHFALAPVTIEVQ--DVNDHGPAFPLNLLSTSVAE 2717
             +   LD E + ++   + A D  G     + VT+ V   D ND+ P F  N  +  V E
Sbjct: 523  TVVKKLDREKEDKYLFTILAKD-NGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPE 581

Query: 2718 NQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEH 2777
            N P    V  +   D D G    +  S+L+        + F ++S TG +R  + FD E 
Sbjct: 582  NLPRHGTVGLITVTDPDYGDNSAVTLSILDE------NDDFTIDSQTGVIRPNISFDREK 635

Query: 2778 TESFRLLVGAADAGNLSASVTVSVLVTGEDEYD--PVFLAP----AFHFQVPEGARRGHS 2831
             ES+   V A D G +S S +  V +   D  D  PVF+ P    ++   +P     G  
Sbjct: 636  QESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLP-STNPGTV 694

Query: 2832 LGHVQATDEDGGADGLVLYSL--ATSSPYFGINQTTGALYL 2870
            +  V A D D G +  V YS+    +   F I+Q TG + L
Sbjct: 695  VFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITL 735



 Score =  181 bits (458), Expect = 1e-44
 Identities = 161/580 (27%), Positives = 251/580 (43%), Gaps = 44/580 (7%)

Query: 47  LDLQIDEEQPAGTLIGDISA-GLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTAR 105
           +++ I E  P GT +  + A     G  A + +  S    +       ++  +G++    
Sbjct: 254 IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE 313

Query: 106 VLDREQRDRYRFTAVTPDG----ATVEVTVRVADINDHAPAFP------QARAALQVPEH 155
            LDRE+   ++   +  DG    A   V V V D+ND+ P+             + + E+
Sbjct: 314 PLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSEN 373

Query: 156 TAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDR 215
               T+  L    D DA   G        +     FRL     P  +    L     LD 
Sbjct: 374 IPLNTKIALITVTDKDADHNGRVTCFTDHE---IPFRLR----PVFSNQFLLETAAYLDY 426

Query: 216 ENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVL 275
           E+   Y ++L A D G PP    A+L + + D ND+AP F QS     + E+ +PG  + 
Sbjct: 427 ESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLT 486

Query: 276 QVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQAR 335
           +V A DAD+G N  + Y +     +    FS+D  TG+L + + LD E+   +   + A+
Sbjct: 487 KVSAMDADSGPNAKINYLLG---PDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAK 543

Query: 336 DGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDD 395
           D G  P   +  V V + D NDN P    +F   + +  V E  P    V  I+V+DPD 
Sbjct: 544 DNGVPPLTSNVTVFVSIIDQNDNSP----VFTHNEYNFYVPENLPRHGTVGLITVTDPDY 599

Query: 396 GDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPLRAE 455
           GD + V +S+      F + +Q  VI         DRE++++Y   V A D G     + 
Sbjct: 600 GDNSAVTLSILDENDDFTIDSQTGVIRPNI---SFDREKQESYTFYVKAEDGGRVSRSSS 656

Query: 456 AAFVLHVTDVNDNAPAFDRQLYRPEPLP-EVALP----GSFVVRVTARDPDQGTNGQVTY 510
           A   ++V DVNDN P F   +  P     E+ LP    G+ V +V A D D G N +V Y
Sbjct: 657 AKVTINVVDVNDNKPVF---IVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRY 713

Query: 511 SLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQD 570
           S+  G     F+ID  +G IT     D       +++V A D G P     +  SV + +
Sbjct: 714 SIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP----DSLFSVVIVN 769

Query: 571 VNDNEPQFQRTFYNASLPEGTQ----PGTCFLQVTATDAD 606
           +  NE     T  N  + + T+    P T    V++  +D
Sbjct: 770 LFVNESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSD 809



 Score =  177 bits (450), Expect = 1e-43
 Identities = 165/617 (26%), Positives = 258/617 (41%), Gaps = 46/617 (7%)

Query: 1847 DANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYL--GAGTAGAFLL 1904
            D ND+AP FP    ++ +PE+    +      A DPD G NG   Y L       G  ++
Sbjct: 131  DINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVI 190

Query: 1905 EPSSGE----LRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTF 1960
            E   G+    L     LDRE+  +Y   V   DG      ST + + ++V D ND+ P F
Sbjct: 191  ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAI-LQVSVTDTNDNHPVF 249

Query: 1961 PTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTT----VDSY 2016
              + + + +P   P  ++ T     L A D D G NA I +  +            +++ 
Sbjct: 250  KETEIEVSIPENAPVGTSVT----QLHATDADIGENAKIHFSFSNLVSNIARRLFHLNAT 305

Query: 2017 TGEIRVARSPVALGPRDRVLFIVATDLG-RPARSATGVIIVGLQGEAERGPRFP------ 2069
            TG I +          +  L ++A+D G  PAR+   +++V +    +  P         
Sbjct: 306  TGLITIKEPLDREETPNHKLLVLASDGGLMPARA---MVLVNVTDVNDNVPSIDIRYIVN 362

Query: 2070 RASSEATIRENAPPGTPIVSPRAVHAGGT-NGPITYSILSGNEKGTFSIQPS-TGAITVR 2127
              +    + EN P  T I            NG +T      + +  F ++P  +    + 
Sbjct: 363  PVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFT---DHEIPFRLRPVFSNQFLLE 419

Query: 2128 SAEGLDFEVSPRLRLVLQAESGGAFAFT---VLTLTLQDANDNAPRFLRPHYVAFLPESR 2184
            +A  LD+E +    + L A   G        +L + ++D NDNAP F +      +PE+ 
Sbjct: 420  TAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENN 479

Query: 2185 PLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETR 2244
                 L +V A D D G   +I+Y L    P    F +D  TG +T    LDRE   +  
Sbjct: 480  SPGIQLTKVSAMDADSGPNAKINYLLGPDAPPE--FSLDCRTGMLTVVKKLDREKEDKYL 537

Query: 2245 LVLMATDRGSPALVGSATLTVMVIDTNDNRPTIP-QPWELRVSEDALLGSEIAQVTGNDV 2303
              ++A D G P L  + T+ V +ID NDN P      +   V E+      +  +T  D 
Sbjct: 538  FTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDP 597

Query: 2304 DSGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGR---A 2360
            D G      LS     D F++    G +      D E+ + Y   + A DG    R   A
Sbjct: 598  DYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSA 657

Query: 2361 NLTVLVEDVNDNAPAF----SQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHL- 2415
             +T+ V DVNDN P F    S   Y+ ++L  T PG+ +  V A D D+G N  + Y + 
Sbjct: 658  KVTINVVDVNDNKPVFIVPPSNCSYE-LVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIV 716

Query: 2416 -ASPADGFSVDPNNGTL 2431
              +  D F++D   G +
Sbjct: 717  GGNTRDLFAIDQETGNI 733


>gi|14589918 protocadherin 11 X-linked isoform b precursor [Homo
           sapiens]
          Length = 1025

 Score =  330 bits (845), Expect = 2e-89
 Identities = 240/721 (33%), Positives = 361/721 (50%), Gaps = 42/721 (5%)

Query: 51  IDEEQPAGTLIGDISAGL-----PAGTAAPLMYFISAQEGSGVGTDLAIDEHSG-VVRTA 104
           I EE P   LIGD+   L     P  +    M F    +   V   + I+E +G +  T 
Sbjct: 30  IREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPL-IRIEEDTGEIFTTG 88

Query: 105 RVLDREQ------RDRYRF----TAVTPDGATVEVTVR--VADINDHAPAFPQARAALQV 152
             +DRE+      RD + F     A+ PD     V +R  + DIND+AP FP     + +
Sbjct: 89  ARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISI 148

Query: 153 PEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGE 212
           PE++A  ++Y L  A D D G  G Q Y L    +   F L+    P+G  +P+L+V  E
Sbjct: 149 PENSAINSKYTLPAAVDPDVGINGVQNYELIK--SQNIFGLDVIETPEGDKMPQLIVQKE 206

Query: 213 LDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGS 272
           LDRE +  Y+++++  DGG P R + A+L V++ D ND+ P F ++     + E+   G+
Sbjct: 207 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGT 266

Query: 273 PVLQVFASDADAGVNGAVTYEINRRQSE-GDGPFSIDAHTGLLQLERPLDFEQRRVHELV 331
            V Q+ A+DAD G N  + +  +   S      F ++A TGL+ ++ PLD E+   H+L+
Sbjct: 267 SVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLL 326

Query: 332 VQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFL--SADGSPQVSEAAPPGQLVARIS 389
           V A DGG  P    A V V+V D NDN PS+ + ++    + +  +SE  P    +A I+
Sbjct: 327 VLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALIT 384

Query: 390 VSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGS 449
           V+D D      V    +  E  F L    S  +L+  A  LD E    Y +++ A D+G 
Sbjct: 385 VTDKDADHNGRVTCFTD-HEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGK 443

Query: 450 PPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVT 509
           PPL   A   + V D NDNAP F  Q +    +PE   PG  + +V+A D D G N ++ 
Sbjct: 444 PPLNQSAMLFIKVKDENDNAPVF-TQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKIN 502

Query: 510 YSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQ 569
           Y L P A    FS+D  +G++T    LD E E +    ++A D G+PPL S+ TV V++ 
Sbjct: 503 YLLGPDAPPE-FSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSII 561

Query: 570 DVNDNEPQFQRTFYNASLPEG-TQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPP 628
           D NDN P F    YN  +PE   + GT  L +T TD D G    ++ S+        +  
Sbjct: 562 DQNDNSPVFTHNEYNFYVPENLPRHGTVGL-ITVTDPDYGDNSAVTLSI-----LDENDD 615

Query: 629 FRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMVYVKVFLS--DENDNPPQFY 686
           F ID+ +G +    + DR++   S+ F V A DGG +      KV ++  D NDN P F 
Sbjct: 616 FTIDSQTGVIRPNISFDREK-QESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFI 674

Query: 687 PREYAASISAQSP---PGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLT 743
                 S     P   PGT V ++ A D D G +  + Y I+ GN+  LF +D+++G +T
Sbjct: 675 VPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNIT 734

Query: 744 V 744
           +
Sbjct: 735 L 735



 Score =  272 bits (696), Expect = 4e-72
 Identities = 206/665 (30%), Positives = 320/665 (48%), Gaps = 39/665 (5%)

Query: 1418 RLLRVQVQVQDENEHAPAFARDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLL 1477
            RL++++  ++D N++AP F    + +++PEN    +  YT  A+     G N    Y L+
Sbjct: 121  RLVKIRFLIEDINDNAPLFPATVINISIPENSAINSK-YTLPAAVDPDVGINGVQNYELI 179

Query: 1478 RQEPPVPALRLDARTG----ALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSAR 1533
            + +       ++   G     L   + LDRE     ++ V+  D       +R++    +
Sbjct: 180  KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVED---GGFPQRSSTAILQ 236

Query: 1534 VFVTDENDNAPVFASPS-RVRLPEDQPPGPAALHVVARDPDLGEAARVSYR----LASGG 1588
            V VTD NDN PVF      V +PE+ P G +   + A D D+GE A++ +     +++  
Sbjct: 237  VSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIA 296

Query: 1589 DGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPT 1648
               F L+++TG +++  PLDRE+   H L V+ASD G  P  A  ++ V+V DVND  P+
Sbjct: 297  RRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPS 354

Query: 1649 FQQQ------EYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSESFSLDP---D 1699
               +        +V+L EN P  T +  +  TD D   NG+VT        F L P   +
Sbjct: 355  IDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN 414

Query: 1700 TGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLE 1759
              +L T   LD E  +E  + + A D G PP      + + V+DEND+AP F  + +++ 
Sbjct: 415  QFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVS 474

Query: 1760 VPEGQDPQ-TLTMLRASDPDVGANGQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVE 1818
            +PE   P   LT + A D D G N ++ Y +L  D    F LD  +G    ++ LDRE E
Sbjct: 475  IPENNSPGIQLTKVSAMDADSGPNAKINY-LLGPDAPPEFSLDCRTGMLTVVKKLDREKE 533

Query: 1819 PAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQ 1878
              +   I A+D G P L++ + + V+++D ND++P F    Y+  VPE++P    +  + 
Sbjct: 534  DKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLIT 593

Query: 1879 AHDPDAGANGHVTYYLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAG 1938
              DPD G N  VT  +       F ++  +G +R   + DRE+  SYTF V A DG    
Sbjct: 594  VTDPDYGDNSAVTLSI-LDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVS 652

Query: 1939 PLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANAS 1998
              S++  VTI V DVND+ P F   P         PS +  T+    + A D D G NA 
Sbjct: 653  -RSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVI-AVDNDTGMNAE 710

Query: 1999 ILYRLAGTPPPGTT-----VDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGV 2053
            + Y + G    G T     +D  TG I +             + + A DLG+P  S   V
Sbjct: 711  VRYSIVG----GNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP-DSLFSV 765

Query: 2054 IIVGL 2058
            +IV L
Sbjct: 766  VIVNL 770



 Score =  246 bits (628), Expect = 3e-64
 Identities = 217/767 (28%), Positives = 343/767 (44%), Gaps = 64/767 (8%)

Query: 1445 LPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGAL-SAPRGLDR 1503
            +PEN   G  L     S        + ++++L+ +   VP +R++  TG + +    +DR
Sbjct: 34   MPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDR 93

Query: 1504 ETTPA-------LLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVF-ASPSRVRLP 1555
            E   A           VE    P    R     V  R  + D NDNAP+F A+   + +P
Sbjct: 94   EKLCAGIPRDEHCFYEVEVAILPDEIFRL----VKIRFLIEDINDNAPLFPATVINISIP 149

Query: 1556 EDQPPGPAALHVVARDPDLGEAARVSYRLASGGD--GHFRLHSSTG----ALSVVRPLDR 1609
            E+           A DPD+G     +Y L    +  G   + +  G     L V + LDR
Sbjct: 150  ENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDR 209

Query: 1610 EQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLL 1669
            E++  +V+ V   D G P RS+T +L VSV D ND  P F++ E  V + EN P GTS+ 
Sbjct: 210  EEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVT 269

Query: 1670 TLRATDPDVGANGQVTY------GGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYA 1723
             L ATD D+G N ++ +        ++   F L+  TG++T    LDREE     L V A
Sbjct: 270  QLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLA 329

Query: 1724 QDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHL------SLEVPEGQDPQT-LTMLRASD 1776
             D G  P      V V V D ND+ P+    ++      ++ + E     T + ++  +D
Sbjct: 330  SDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTD 387

Query: 1777 PDVGANGQLQYRILDGDP-------SGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARD 1829
             D   NG++        P       S  F+L+ A+        LD E    + +++ A D
Sbjct: 388  KDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAA-------YLDYESTKEYAIKLLAAD 440

Query: 1830 GGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGH 1889
             G+P L+ + +L + V D ND+AP F     +V +PE+   G  L ++ A D D+G N  
Sbjct: 441  AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAK 500

Query: 1890 VTYYLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTIT 1949
            + Y LG      F L+  +G L     LDRE+   Y F++ A D     PL++ V+V ++
Sbjct: 501  INYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVP-PLTSNVTVFVS 559

Query: 1950 VRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPP 2009
            + D ND++P F  +     +P   P   T  L   T    D D G N+++   +      
Sbjct: 560  IIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVT----DPDYGDNSAVTLSIL-DEND 614

Query: 2010 GTTVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRF- 2068
              T+DS TG IR   S           ++ A D GR +RS++  + + +    +  P F 
Sbjct: 615  DFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFI 674

Query: 2069 --PRASSEATIRENAPPGTPIVSPRAV-HAGGTNGPITYSILSGNEKGTFSIQPSTGAIT 2125
              P   S   +  +  PGT +    AV +  G N  + YSI+ GN +  F+I   TG IT
Sbjct: 675  VPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNIT 734

Query: 2126 VRSAEGLDFEVSPRLRLVLQAESGG----AFAFTVLTLTLQDANDNA 2168
            +   E  D       R++++A   G     F+  ++ L + ++  NA
Sbjct: 735  L--MEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNA 779



 Score =  238 bits (608), Expect = 6e-62
 Identities = 188/655 (28%), Positives = 299/655 (45%), Gaps = 36/655 (5%)

Query: 1323 DLAERDPAAPVPVV-LTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFAL 1381
            D+ +  P  P  V+ +++     +     L +   P+    G   Y L+   +  G   +
Sbjct: 131  DINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVI 190

Query: 1382 DAASG----RLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFA 1437
            +   G    +L + + LD E    +       +G     +    +QV V D N++ P F 
Sbjct: 191  ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFK 250

Query: 1438 RDPLALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVP--ALRLDARTGAL 1495
               + +++PEN   G ++    A+DAD  G N+ + +        +      L+A TG +
Sbjct: 251  ETEIEVSIPENAPVGTSVTQLHATDAD-IGENAKIHFSFSNLVSNIARRLFHLNATTGLI 309

Query: 1496 SAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAP-------VFAS 1548
            +    LDRE TP   LLV A+D          AR    V VTD NDN P       V   
Sbjct: 310  TIKEPLDREETPNHKLLVLASD-----GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPV 364

Query: 1549 PSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGHFRLH---SSTGALSVVR 1605
               V L E+ P       +   D D     RV+    +  +  FRL    S+   L    
Sbjct: 365  NDTVVLSENIPLNTKIALITVTDKDADHNGRVT--CFTDHEIPFRLRPVFSNQFLLETAA 422

Query: 1606 PLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPG 1665
             LD E   E+ + ++A+D G PP + + +L + V D ND AP F Q   +V + ENN PG
Sbjct: 423  YLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPG 482

Query: 1666 TSLLTLRATDPDVGANGQVTY--GGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYA 1723
              L  + A D D G N ++ Y  G  +   FSLD  TG+LT ++ LDRE++++   T+ A
Sbjct: 483  IQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILA 542

Query: 1724 QDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQ-TLTMLRASDPDVGAN 1782
            +D G PP  ++VTV V++ D+ND++P F     +  VPE      T+ ++  +DPD G N
Sbjct: 543  KDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDN 602

Query: 1783 GQLQYRILDGDPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLT 1842
              +   ILD +    F +D  +G        DRE + ++   ++A DGG+ + S++  +T
Sbjct: 603  SAVTLSILDENDD--FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVT 660

Query: 1843 VTVLDANDHAPAFPVP----AYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTY-YLGAG 1897
            + V+D ND+ P F VP    +Y + +P   P GT++ Q+ A D D G N  V Y  +G  
Sbjct: 661  INVVDVNDNKPVFIVPPSNCSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRYSIVGGN 719

Query: 1898 TAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRD 1952
            T   F ++  +G +      D      +   V A D      L + V V + V +
Sbjct: 720  TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNE 774



 Score =  236 bits (601), Expect = 4e-61
 Identities = 197/672 (29%), Positives = 306/672 (45%), Gaps = 44/672 (6%)

Query: 2152 FAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLA 2211
            F    +   ++D NDNAP F        +PE+  +        A D D G  G  +Y L 
Sbjct: 120  FRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELI 179

Query: 2212 ASQPARGLFHVDPTTGTITTTAILDREIWAETR----LVLMATDRGSPALVGSATLTVMV 2267
             SQ   GL  ++   G      I+ +E+  E +    + +   D G P    +A L V V
Sbjct: 180  KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSV 239

Query: 2268 IDTNDNRPTIPQ-PWELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSG-----PQDP 2321
             DTNDN P   +   E+ + E+A +G+ + Q+   D D G       S S       +  
Sbjct: 240  TDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRL 299

Query: 2322 FSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGP-HEGRANLTVLVEDVNDNAPAFSQSL 2380
            F +    G +++  PLD E+   ++L +LA DG     RA + V V DVNDN P+     
Sbjct: 300  FHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRY 359

Query: 2381 Y------QVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTLFTI 2434
                    V+L E+ P  + I  ++ TD+D+  NG ++         F + P     F +
Sbjct: 360  IVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRLRPVFSNQFLL 418

Query: 2435 VGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTED 2494
                 L ++ +    + L A D G P     A + ++++D+ND+AP FT S   V++ E+
Sbjct: 419  ETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPEN 478

Query: 2495 LPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCL 2554
              PG  L  + A DAD S  +A ++Y ++  +    F L+ R               G L
Sbjct: 479  NSPGIQLTKVSAMDAD-SGPNAKINY-LLGPDAPPEFSLDCR--------------TGML 522

Query: 2555 VLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPED 2614
             +++ LD E   +Y  T+ A D G PP +S V V V+++D NDN PVFT   Y   VPE+
Sbjct: 523  TVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN 582

Query: 2615 TPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQ 2674
             P    +  +  +D D G +  V  T+S  D +  F +D  +G +R   + D E Q  + 
Sbjct: 583  LPRHGTVGLITVTDPDYGDNSAV--TLSILDENDDFTIDSQTGVIRPNISFDREKQESYT 640

Query: 2675 LVVQAADPAG-AHFALAPVTIEVQDVNDHGPAF---PLNLLSTSVAENQPPGTLVTTLHA 2730
              V+A D    +  + A VTI V DVND+ P F   P N     V  +  PGT+V  + A
Sbjct: 641  FYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIA 700

Query: 2731 IDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAADA 2790
            +D D G    +RYS++    G   R+ FA++  TG +      D       R+LV A D 
Sbjct: 701  VDNDTGMNAEVRYSIV----GGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDL 756

Query: 2791 GNLSASVTVSVL 2802
            G   +  +V ++
Sbjct: 757  GQPDSLFSVVIV 768



 Score =  230 bits (586), Expect = 2e-59
 Identities = 203/702 (28%), Positives = 315/702 (44%), Gaps = 47/702 (6%)

Query: 1639 VADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSES-FSLD 1697
            + D+ND AP F     ++ + EN+   +      A DPDVG NG   Y  + S++ F LD
Sbjct: 129  IEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLD 188

Query: 1698 ----PDTGVLTTL---RALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPT 1750
                P+   +  L   + LDREE++   + V  +D G P + +   ++V+V D ND+ P 
Sbjct: 189  VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPV 248

Query: 1751 FGSAHLSLEVPEGQDPQT-LTMLRASDPDVGANGQLQY---RILDGDPSGAFVLDLASGE 1806
            F    + + +PE     T +T L A+D D+G N ++ +    ++       F L+  +G 
Sbjct: 249  FKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGL 308

Query: 1807 FGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAY------ 1860
                 PLDRE  P  +L + A DGG     A +L+ VT  D ND+ P+  +         
Sbjct: 309  ITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVND 366

Query: 1861 SVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGE---LRTAAAL 1917
            +V + E++P  T +  +   D DA  NG VT +        F L P       L TAA L
Sbjct: 367  TVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIP--FRLRPVFSNQFLLETAAYL 424

Query: 1918 DREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFS 1977
            D E    Y   + A D A   PL+ +  + I V+D ND+AP F  S + + +P      +
Sbjct: 425  DYESTKEYAIKLLAAD-AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPEN----N 479

Query: 1978 TPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLF 2037
            +P + L  + A D D+G NA I Y L    PP  ++D  TG + V +  +     D+ LF
Sbjct: 480  SPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKK-LDREKEDKYLF 538

Query: 2038 -IVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPP-GTPIVSPRAVHA 2095
             I+A D G P  ++   + V +  + +  P F        + EN P  GT  +       
Sbjct: 539  TILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPD 598

Query: 2096 GGTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFT 2155
             G N  +T SIL  N+   F+I   TG I  R     D E        ++AE GG  + +
Sbjct: 599  YGDNSAVTLSILDENDD--FTIDSQTGVI--RPNISFDREKQESYTFYVKAEDGGRVSRS 654

Query: 2156 V---LTLTLQDANDNAPRFLRP----HYVAFLPESRPLEGPLLQVEADDLDQGSGGQISY 2208
                +T+ + D NDN P F+ P     Y   LP + P    + QV A D D G   ++ Y
Sbjct: 655  SSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRY 713

Query: 2209 SLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVI 2268
            S+      R LF +D  TG IT     D       R+++ A D G P  + S  +  + +
Sbjct: 714  SIVGGN-TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFV 772

Query: 2269 DTNDNRPTIPQPWELRVSEDALL-GSEIAQVTGNDVDSGPVL 2309
            + +    T+      + +E  +   +EIA V+    D   +L
Sbjct: 773  NESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSDYVKIL 814



 Score =  229 bits (583), Expect = 4e-59
 Identities = 212/740 (28%), Positives = 326/740 (44%), Gaps = 51/740 (6%)

Query: 627  PPFRIDAHSGDVCTTRT-LDRDQ-------GPSSFDFTVTAVDGGGLKSMVYVKVFLSDE 678
            P  RI+  +G++ TT   +DR++           F     A+    +  +V ++  + D 
Sbjct: 73   PLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDI 132

Query: 679  NDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLD-- 736
            NDN P F       SI   S   +      A DPD G +G  +Y ++   S  +F LD  
Sbjct: 133  NDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELI--KSQNIFGLDVI 190

Query: 737  -----EQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFE 791
                 ++   L V   L R       +++  EDGG  Q   +A + +S+       P+F+
Sbjct: 191  ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFK 250

Query: 792  QLQYVFSVPEDVAPGTSVGIVQAHNPP-GRLAPVTLSLSG---GDPRGLFSLDAVSGLLQ 847
            + +   S+PE+   GTSV  + A +   G  A +  S S       R LF L+A +GL+ 
Sbjct: 251  ETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLIT 310

Query: 848  TLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAP------EDTV 901
               PLDRE       L + +  G+ PA A+  V V   DVNDN P+           DTV
Sbjct: 311  IKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVNDTV 368

Query: 902  LLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRP---LGP 958
            +L  N    T I  +   D D+  N RVT          F + P   +  L+     L  
Sbjct: 369  VLSENIPLNTKIALITVTDKDADHNGRVT--CFTDHEIPFRLRPVFSNQFLLETAAYLDY 426

Query: 959  SGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQ 1018
                 + ++L A D G PP      L + V+D      AP F      V +P   + G Q
Sbjct: 427  ESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDN--APVFTQSFVTVSIPENNSPGIQ 484

Query: 1019 VLQVQAQAPDGGP---ITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAV 1075
            + +V A   D GP   I Y L  + A   F L+ ++G L V   LDRE ++ Y+  ++A 
Sbjct: 485  LTKVSAMDADSGPNAKINYLLGPD-APPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAK 543

Query: 1076 SGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSG 1135
                  L   T   TV VSI++QN++SP  + +     V EN P   +VG +  TD D G
Sbjct: 544  DNGVPPL---TSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYG 600

Query: 1136 PNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTG 1195
             N  +T S+   ++D   F I  QTG +    + DRE+Q SY   V+ +DGG   RS++ 
Sbjct: 601  DNSAVTLSILDENDD---FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSA 657

Query: 1196 TVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYT 1255
             V + V+D+NDN P F+         L   V     PGT+V  + A D D G N  + Y+
Sbjct: 658  KVTINVVDVNDNKPVFIVPPSNCSYEL---VLPSTNPGTVVFQVIAVDNDTGMNAEVRYS 714

Query: 1256 LTGPGS-ELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLL-VQVLP 1313
            + G  + +LF++   +G +         +   + + + A+D G P    S+ ++ + V  
Sbjct: 715  IVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNE 774

Query: 1314 SARLAEPPPDLAERDPAAPV 1333
            S   A    +L  +   APV
Sbjct: 775  SVTNATLINELVRKSTEAPV 794



 Score =  227 bits (579), Expect = 1e-58
 Identities = 198/649 (30%), Positives = 294/649 (45%), Gaps = 57/649 (8%)

Query: 2063 ERGPRFPRASSEATIRENAPPGTPIVSPRAVHAG-GTNGPITYSIL-SGNEKGTFSIQPS 2120
            +  P FP      +I EN+   +    P AV    G NG   Y ++ S N  G   I+  
Sbjct: 134  DNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETP 193

Query: 2121 TGAITVRSA--EGLDFEVSPRLRLVLQAESGG---AFAFTVLTLTLQDANDNAPRFLRPH 2175
             G    +    + LD E      + ++ E GG     +  +L +++ D NDN P F    
Sbjct: 194  EGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETE 253

Query: 2176 YVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLA--ASQPARGLFHVDPTTGTITTTA 2233
                +PE+ P+   + Q+ A D D G   +I +S +   S  AR LFH++ TTG IT   
Sbjct: 254  IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE 313

Query: 2234 ILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTI-------PQPWELRVS 2286
             LDRE     +L+++A+D G   +   A + V V D NDN P+I       P    + +S
Sbjct: 314  PLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLS 371

Query: 2287 EDALLGSEIAQVTGNDVDS---GPVLWYVLSPSGPQDPFSVGRYGGRVSL---TGPLDFE 2340
            E+  L ++IA +T  D D+   G V  +    +  + PF +        L      LD+E
Sbjct: 372  ENIPLNTKIALITVTDKDADHNGRVTCF----TDHEIPFRLRPVFSNQFLLETAAYLDYE 427

Query: 2341 QCDRYQLQLLAHDG---PHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILS 2397
                Y ++LLA D    P    A L + V+D NDNAP F+QS   V + E+  PG  +  
Sbjct: 428  STKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTK 487

Query: 2398 VSATDRDSGANGHISYHLASPADG-FSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARD 2456
            VSA D DSG N  I+Y L   A   FS+D   G L  +     L  +        + A+D
Sbjct: 488  VSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVK---KLDREKEDKYLFTILAKD 544

Query: 2457 HGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHA 2516
            +G P   +  TV V + DQND++P FT + Y   V E+LP   T+  +  TD D    ++
Sbjct: 545  NGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYG-DNS 603

Query: 2517 AVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAAD 2576
            AV  SI+  N       +  +     S                 D E    Y   V A D
Sbjct: 604  AVTLSILDENDDFTIDSQTGVIRPNIS----------------FDREKQESYTFYVKAED 647

Query: 2577 RGQPPQSSVVPVTVTVLDVNDNPPVF----TRASYRVTVPEDTPVGAELLHVEASDADPG 2632
             G+  +SS   VT+ V+DVNDN PVF    +  SY + +P   P G  +  V A D D G
Sbjct: 648  GGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNP-GTVVFQVIAVDNDTG 706

Query: 2633 PHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAAD 2681
             +  VR+++  G+   LF +D+ +G + L    D      H+++V+A D
Sbjct: 707  MNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKAND 755



 Score =  198 bits (504), Expect = 6e-50
 Identities = 181/695 (26%), Positives = 304/695 (43%), Gaps = 43/695 (6%)

Query: 524  DPTSGIITTAASLDYELE----PQPQLIVVATDGGLPP--LASSATVSVALQDVNDNEPQ 577
            + T  I TT A +D E      P+ +      +  + P  +     +   ++D+NDN P 
Sbjct: 79   EDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPL 138

Query: 578  FQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGD 637
            F  T  N S+PE +   + +    A D D G  G+ +Y L       G     I+   GD
Sbjct: 139  FPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDV--IETPEGD 196

Query: 638  ----VCTTRTLDRDQGPSSFDFTVTAVDGG--GLKSMVYVKVFLSDENDNPPQFYPREYA 691
                +   + LDR++   ++   V   DGG     S   ++V ++D NDN P F   E  
Sbjct: 197  KMPQLIVQKELDREE-KDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIE 255

Query: 692  ASISAQSPPGTAVLRLRAHDPDQGSHGRLSY---HILAGNSPPLFTLDEQSGLLTVAWPL 748
             SI   +P GT+V +L A D D G + ++ +   ++++  +  LF L+  +GL+T+  PL
Sbjct: 256  VSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPL 315

Query: 749  ARRANSVVQLEIGAEDGGGLQAEPSARVDISIV----PGTPTPPIFEQLQYVFSVPEDVA 804
             R      +L + A DGG + A     V+++ V    P      I   +     + E++ 
Sbjct: 316  DREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIP 375

Query: 805  PGTSVGIVQA------HNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLG 858
              T + ++        HN  GR   VT       P  L  + +   LL+T   LD E   
Sbjct: 376  LNTKIALITVTDKDADHN--GR---VTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTK 430

Query: 859  PVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRA 918
                  + A +G PP    A + + + D NDN+P F     TV +P N +PG  +  + A
Sbjct: 431  EYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSA 490

Query: 919  LDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPR 978
            +D DSG N+++ + L       F++D  TG + +++ L       +   + A+D G PP 
Sbjct: 491  MDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPL 550

Query: 979  TSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPD-GGPITYHLA 1037
            TS+  + V V  +     +P F    Y   +P        V  +    PD G      L+
Sbjct: 551  TSN--VTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLS 608

Query: 1038 AEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILN 1097
                +  F ++ Q+G +    + DRE QE Y   V A  G +     ++ +A V +++++
Sbjct: 609  ILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRV---SRSSSAKVTINVVD 665

Query: 1098 QNEHSPRLSEDP---TFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAF 1154
             N++ P     P   ++  V  +  PGT V +V A D D+G N  + YS+         F
Sbjct: 666  VNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVG-GNTRDLF 724

Query: 1155 RIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSP 1189
             I  +TG +T ++  D      +++LV+  D G P
Sbjct: 725  AIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759



 Score =  189 bits (480), Expect = 4e-47
 Identities = 190/701 (27%), Positives = 304/701 (43%), Gaps = 88/701 (12%)

Query: 2219 LFHVDPTTGTITTT-AILDRE-----------IWAETRLVLMATDRGSPALVGSATLTVM 2266
            L  ++  TG I TT A +DRE            + E  + ++  +     +     +  +
Sbjct: 74   LIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDE-----IFRLVKIRFL 128

Query: 2267 VIDTNDNRPTIPQPW-ELRVSEDALLGSEIAQVTGNDVDSG--PVLWYVLSPSGPQDPFS 2323
            + D NDN P  P     + + E++ + S+       D D G   V  Y L  S  Q+ F 
Sbjct: 129  IEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS--QNIFG 186

Query: 2324 V-------GRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVL---VEDVNDNA 2373
            +       G    ++ +   LD E+ D Y +++   DG    R++  +L   V D NDN 
Sbjct: 187  LDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNH 246

Query: 2374 PAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFS--VDPNNGTL 2431
            P F ++  +V + E+ P G+++  + ATD D G N  I +  ++     +  +   N T 
Sbjct: 247  PVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATT 306

Query: 2432 FTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHY---- 2487
              I     L  + +    +++ A D G     ARA V V + D ND+ PS  + +     
Sbjct: 307  GLITIKEPLDREETPNHKLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPV 364

Query: 2488 --RVAVTEDLPPGSTLLTLEATDADGS---RSHAAVDYSIISGNWGRVFQLEPRLAEAGE 2542
               V ++E++P  + +  +  TD D     R     D+ I        F+L P  +    
Sbjct: 365  NDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEI-------PFRLRPVFSNQ-- 415

Query: 2543 SAGPGPRALGCLVLLEP---LDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNP 2599
                         LLE    LD+ES  +Y + + AAD G+PP +    + + V D NDN 
Sbjct: 416  ------------FLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNA 463

Query: 2600 PVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTL 2659
            PVFT++   V++PE+   G +L  V A DAD GP+  + + +    P   F LD  +G L
Sbjct: 464  PVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPE-FSLDCRTGML 522

Query: 2660 RLAHALDCETQARHQLVVQAADPAGAHFALAPVTIEVQ--DVNDHGPAFPLNLLSTSVAE 2717
             +   LD E + ++   + A D  G     + VT+ V   D ND+ P F  N  +  V E
Sbjct: 523  TVVKKLDREKEDKYLFTILAKD-NGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPE 581

Query: 2718 NQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEH 2777
            N P    V  +   D D G    +  S+L+        + F ++S TG +R  + FD E 
Sbjct: 582  NLPRHGTVGLITVTDPDYGDNSAVTLSILDE------NDDFTIDSQTGVIRPNISFDREK 635

Query: 2778 TESFRLLVGAADAGNLSASVTVSVLVTGEDEYD--PVFLAP----AFHFQVPEGARRGHS 2831
             ES+   V A D G +S S +  V +   D  D  PVF+ P    ++   +P     G  
Sbjct: 636  QESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLP-STNPGTV 694

Query: 2832 LGHVQATDEDGGADGLVLYSL--ATSSPYFGINQTTGALYL 2870
            +  V A D D G +  V YS+    +   F I+Q TG + L
Sbjct: 695  VFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITL 735



 Score =  181 bits (458), Expect = 1e-44
 Identities = 161/580 (27%), Positives = 251/580 (43%), Gaps = 44/580 (7%)

Query: 47  LDLQIDEEQPAGTLIGDISA-GLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTAR 105
           +++ I E  P GT +  + A     G  A + +  S    +       ++  +G++    
Sbjct: 254 IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE 313

Query: 106 VLDREQRDRYRFTAVTPDG----ATVEVTVRVADINDHAPAFP------QARAALQVPEH 155
            LDRE+   ++   +  DG    A   V V V D+ND+ P+             + + E+
Sbjct: 314 PLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSEN 373

Query: 156 TAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDR 215
               T+  L    D DA   G        +     FRL     P  +    L     LD 
Sbjct: 374 IPLNTKIALITVTDKDADHNGRVTCFTDHE---IPFRLR----PVFSNQFLLETAAYLDY 426

Query: 216 ENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVL 275
           E+   Y ++L A D G PP    A+L + + D ND+AP F QS     + E+ +PG  + 
Sbjct: 427 ESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLT 486

Query: 276 QVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQAR 335
           +V A DAD+G N  + Y +     +    FS+D  TG+L + + LD E+   +   + A+
Sbjct: 487 KVSAMDADSGPNAKINYLLG---PDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAK 543

Query: 336 DGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDD 395
           D G  P   +  V V + D NDN P    +F   + +  V E  P    V  I+V+DPD 
Sbjct: 544 DNGVPPLTSNVTVFVSIIDQNDNSP----VFTHNEYNFYVPENLPRHGTVGLITVTDPDY 599

Query: 396 GDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPLRAE 455
           GD + V +S+      F + +Q  VI         DRE++++Y   V A D G     + 
Sbjct: 600 GDNSAVTLSILDENDDFTIDSQTGVIRPNI---SFDREKQESYTFYVKAEDGGRVSRSSS 656

Query: 456 AAFVLHVTDVNDNAPAFDRQLYRPEPLP-EVALP----GSFVVRVTARDPDQGTNGQVTY 510
           A   ++V DVNDN P F   +  P     E+ LP    G+ V +V A D D G N +V Y
Sbjct: 657 AKVTINVVDVNDNKPVF---IVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRY 713

Query: 511 SLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQD 570
           S+  G     F+ID  +G IT     D       +++V A D G P     +  SV + +
Sbjct: 714 SIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP----DSLFSVVIVN 769

Query: 571 VNDNEPQFQRTFYNASLPEGTQ----PGTCFLQVTATDAD 606
           +  NE     T  N  + + T+    P T    V++  +D
Sbjct: 770 LFVNESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSD 809



 Score =  177 bits (450), Expect = 1e-43
 Identities = 165/617 (26%), Positives = 258/617 (41%), Gaps = 46/617 (7%)

Query: 1847 DANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYL--GAGTAGAFLL 1904
            D ND+AP FP    ++ +PE+    +      A DPD G NG   Y L       G  ++
Sbjct: 131  DINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVI 190

Query: 1905 EPSSGE----LRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTF 1960
            E   G+    L     LDRE+  +Y   V   DG      ST + + ++V D ND+ P F
Sbjct: 191  ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAI-LQVSVTDTNDNHPVF 249

Query: 1961 PTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTT----VDSY 2016
              + + + +P   P  ++ T     L A D D G NA I +  +            +++ 
Sbjct: 250  KETEIEVSIPENAPVGTSVT----QLHATDADIGENAKIHFSFSNLVSNIARRLFHLNAT 305

Query: 2017 TGEIRVARSPVALGPRDRVLFIVATDLG-RPARSATGVIIVGLQGEAERGPRFP------ 2069
            TG I +          +  L ++A+D G  PAR+   +++V +    +  P         
Sbjct: 306  TGLITIKEPLDREETPNHKLLVLASDGGLMPARA---MVLVNVTDVNDNVPSIDIRYIVN 362

Query: 2070 RASSEATIRENAPPGTPIVSPRAVHAGGT-NGPITYSILSGNEKGTFSIQPS-TGAITVR 2127
              +    + EN P  T I            NG +T      + +  F ++P  +    + 
Sbjct: 363  PVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFT---DHEIPFRLRPVFSNQFLLE 419

Query: 2128 SAEGLDFEVSPRLRLVLQAESGGAFAFT---VLTLTLQDANDNAPRFLRPHYVAFLPESR 2184
            +A  LD+E +    + L A   G        +L + ++D NDNAP F +      +PE+ 
Sbjct: 420  TAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENN 479

Query: 2185 PLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETR 2244
                 L +V A D D G   +I+Y L    P    F +D  TG +T    LDRE   +  
Sbjct: 480  SPGIQLTKVSAMDADSGPNAKINYLLGPDAPPE--FSLDCRTGMLTVVKKLDREKEDKYL 537

Query: 2245 LVLMATDRGSPALVGSATLTVMVIDTNDNRPTIP-QPWELRVSEDALLGSEIAQVTGNDV 2303
              ++A D G P L  + T+ V +ID NDN P      +   V E+      +  +T  D 
Sbjct: 538  FTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDP 597

Query: 2304 DSGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGR---A 2360
            D G      LS     D F++    G +      D E+ + Y   + A DG    R   A
Sbjct: 598  DYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSA 657

Query: 2361 NLTVLVEDVNDNAPAF----SQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHL- 2415
             +T+ V DVNDN P F    S   Y+ ++L  T PG+ +  V A D D+G N  + Y + 
Sbjct: 658  KVTINVVDVNDNKPVFIVPPSNCSYE-LVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIV 716

Query: 2416 -ASPADGFSVDPNNGTL 2431
              +  D F++D   G +
Sbjct: 717  GGNTRDLFAIDQETGNI 733


>gi|14589946 protocadherin 11 Y-linked isoform c [Homo sapiens]
          Length = 1340

 Score =  327 bits (838), Expect = 1e-88
 Identities = 239/721 (33%), Positives = 362/721 (50%), Gaps = 42/721 (5%)

Query: 51  IDEEQPAGTLIGDISAGL-----PAGTAAPLMYFISAQEGSGVGTDLAIDEHSG-VVRTA 104
           I EE P   LIG++   L     P  +    M F    +   V   + I+E +G +  T 
Sbjct: 62  IREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPL-IRIEEDTGEIFTTG 120

Query: 105 RVLDREQ------RDRYRF----TAVTPDGATVEVTVR--VADINDHAPAFPQARAALQV 152
             +DRE+      RD + F     A+ PD     V +R  + DIND+AP FP     + +
Sbjct: 121 ARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISI 180

Query: 153 PEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGE 212
           PE++A  ++Y L  A D D G  G Q Y L    +   F L+    P+G  +P+L+V  E
Sbjct: 181 PENSAINSKYTLPAAVDPDVGINGVQNYELIK--SQNIFGLDVIETPEGDKMPQLIVQKE 238

Query: 213 LDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGS 272
           LDRE +  Y+++++  DGG P R + A+L V++ D ND+ P F ++     + E+   G+
Sbjct: 239 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGT 298

Query: 273 PVLQVFASDADAGVNGAVTYEINRRQSE-GDGPFSIDAHTGLLQLERPLDFEQRRVHELV 331
            V Q+ A+DAD G N  + +  +   S      F ++A TGL+ ++ PLD E+   H+L+
Sbjct: 299 SVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLL 358

Query: 332 VQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFL--SADGSPQVSEAAPPGQLVARIS 389
           V A DGG  P    A V V+V D NDN PS+ + ++    + +  +SE  P    +A I+
Sbjct: 359 VLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALIT 416

Query: 390 VSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGS 449
           V+D D      V    +  E  F L    S  +L+  A  LD E    Y +++ A D+G 
Sbjct: 417 VTDKDADHNGRVTCFTD-HEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGK 475

Query: 450 PPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVT 509
           PPL   A   + V D NDNAP F  Q +    +PE   PG  +++V+A D D G N ++ 
Sbjct: 476 PPLNQSAMLFIKVKDENDNAPVF-TQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEIN 534

Query: 510 YSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQ 569
           Y L P A    FS+D  +G++T    LD E E +    ++A D G+PPL S+ TV V++ 
Sbjct: 535 YLLGPDAPPE-FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSII 593

Query: 570 DVNDNEPQFQRTFYNASLPEG-TQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPP 628
           D NDN P F    Y   +PE   + GT  L +T TD D G    ++ S+        +  
Sbjct: 594 DQNDNSPVFTHNEYKFYVPENLPRHGTVGL-ITVTDPDYGDNSAVTLSI-----LDENDD 647

Query: 629 FRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMVYVKVFLS--DENDNPPQFY 686
           F ID+ +G +    + DR++   S+ F V A DGG +      KV ++  D NDN P F 
Sbjct: 648 FTIDSQTGVIRPNISFDREK-QESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFI 706

Query: 687 PREYAASISAQSP---PGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLT 743
              Y  S     P   PGT V ++ A D D G +  + Y I+ GN+  LF +D+++G +T
Sbjct: 707 VPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNIT 766

Query: 744 V 744
           +
Sbjct: 767 L 767



 Score =  248 bits (632), Expect = 9e-65
 Identities = 217/767 (28%), Positives = 345/767 (44%), Gaps = 64/767 (8%)

Query: 1445 LPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGAL-SAPRGLDR 1503
            +PEN   G  L     S        + ++++L+ +   VP +R++  TG + +    +DR
Sbjct: 66   IPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDR 125

Query: 1504 ETTPA-------LLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVF-ASPSRVRLP 1555
            E   A           VE    P    R     V  R  + D NDNAP+F A+   + +P
Sbjct: 126  EKLCAGIPRDEHCFYEVEVAILPDEIFRL----VKIRFLIEDINDNAPLFPATVINISIP 181

Query: 1556 EDQPPGPAALHVVARDPDLGEAARVSYRLASGGD--GHFRLHSSTG----ALSVVRPLDR 1609
            E+           A DPD+G     +Y L    +  G   + +  G     L V + LDR
Sbjct: 182  ENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDR 241

Query: 1610 EQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLL 1669
            E++  +V+ V   D G P RS+T +L VSV D ND  P F++ E  V + EN P GTS+ 
Sbjct: 242  EEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVT 301

Query: 1670 TLRATDPDVGANGQVTYG------GVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYA 1723
             L ATD D+G N ++ +        ++   F L+  TG++T    LDREE     L V A
Sbjct: 302  QLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLA 361

Query: 1724 QDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHL------SLEVPEGQDPQT-LTMLRASD 1776
             D G  P    V V V   D ND+ P+    ++      ++ + E     T + ++  +D
Sbjct: 362  SDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTD 419

Query: 1777 PDVGANGQLQYRILDGDP-------SGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARD 1829
             D   NG++        P       S  F+L+ A+        LD E    + +++ A D
Sbjct: 420  KDADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAY-------LDYESTKEYAIKLLAAD 472

Query: 1830 GGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGH 1889
             G+P L+ + +L + V D ND+AP F     +V +PE+   G  L+++ A D D+G N  
Sbjct: 473  AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAE 532

Query: 1890 VTYYLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTIT 1949
            + Y LG      F L+  +G L     LDRE+   Y F++ A D     PL++ V+V ++
Sbjct: 533  INYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVP-PLTSNVTVFVS 591

Query: 1950 VRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPP 2009
            + D ND++P F  +  +  +P   P   T  L   T    D D G N+++   +      
Sbjct: 592  IIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVT----DPDYGDNSAVTLSIL-DEND 646

Query: 2010 GTTVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRF- 2068
              T+DS TG IR   S           ++ A D GR +RS++  + + +    +  P F 
Sbjct: 647  DFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFI 706

Query: 2069 --PRASSEATIRENAPPGTPIVSPRAV-HAGGTNGPITYSILSGNEKGTFSIQPSTGAIT 2125
              P   S   +  +  PGT +    AV +  G N  + YSI+ GN +  F+I   TG IT
Sbjct: 707  VPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNIT 766

Query: 2126 VRSAEGLDFEVSPRLRLVLQAESGG----AFAFTVLTLTLQDANDNA 2168
            +   E  D       R++++A   G     F+  ++ L + ++  NA
Sbjct: 767  L--MEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNA 811



 Score =  242 bits (617), Expect = 5e-63
 Identities = 198/672 (29%), Positives = 309/672 (45%), Gaps = 44/672 (6%)

Query: 2152 FAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLA 2211
            F    +   ++D NDNAP F        +PE+  +        A D D G  G  +Y L 
Sbjct: 152  FRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELI 211

Query: 2212 ASQPARGLFHVDPTTGTITTTAILDREIWAETR----LVLMATDRGSPALVGSATLTVMV 2267
             SQ   GL  ++   G      I+ +E+  E +    + +   D G P    +A L V V
Sbjct: 212  KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSV 271

Query: 2268 IDTNDNRPTIPQ-PWELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSG-----PQDP 2321
             DTNDN P   +   E+ + E+A +G+ + Q+   D D G       S S       +  
Sbjct: 272  TDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRL 331

Query: 2322 FSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGP-HEGRANLTVLVEDVNDNAPAFSQSL 2380
            F +    G +++  PLD E+   ++L +LA DG     RA + V V DVNDN P+     
Sbjct: 332  FHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRY 391

Query: 2381 Y------QVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTLFTI 2434
                    V+L E+ P  + I  ++ TD+D+  NG ++         F + P     F +
Sbjct: 392  IVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRLRPVFSNQFLL 450

Query: 2435 VGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTED 2494
                 L ++ +    + L A D G P     A + ++++D+ND+AP FT S   V++ E+
Sbjct: 451  ENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPEN 510

Query: 2495 LPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCL 2554
              PG  L+ + ATDAD S  +A ++Y ++  +    F L+              R  G L
Sbjct: 511  NSPGIQLMKVSATDAD-SGPNAEINY-LLGPDAPPEFSLD--------------RRTGML 554

Query: 2555 VLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPED 2614
             +++ LD E   +Y  T+ A D G PP +S V V V+++D NDN PVFT   Y+  VPE+
Sbjct: 555  TVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPEN 614

Query: 2615 TPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQ 2674
             P    +  +  +D D G +  V  T+S  D +  F +D  +G +R   + D E Q  + 
Sbjct: 615  LPRHGTVGLITVTDPDYGDNSAV--TLSILDENDDFTIDSQTGVIRPNISFDREKQESYT 672

Query: 2675 LVVQAADPAG-AHFALAPVTIEVQDVNDHGPAF---PLNLLSTSVAENQPPGTLVTTLHA 2730
              V+A D    +  + A VTI V DVND+ P F   P N     V  +  PGT+V  + A
Sbjct: 673  FYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIA 732

Query: 2731 IDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAADA 2790
            +D D G    +RYS++    G   R+ FA++  TG +      D       R+LV A D 
Sbjct: 733  VDNDTGMNAEVRYSIV----GGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDL 788

Query: 2791 GNLSASVTVSVL 2802
            G   +  +V ++
Sbjct: 789  GQPDSLFSVVIV 800



 Score =  231 bits (588), Expect = 1e-59
 Identities = 199/649 (30%), Positives = 296/649 (45%), Gaps = 57/649 (8%)

Query: 2063 ERGPRFPRASSEATIRENAPPGTPIVSPRAVHAG-GTNGPITYSIL-SGNEKGTFSIQPS 2120
            +  P FP      +I EN+   +    P AV    G NG   Y ++ S N  G   I+  
Sbjct: 166  DNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETP 225

Query: 2121 TGAITVRSA--EGLDFEVSPRLRLVLQAESGG---AFAFTVLTLTLQDANDNAPRFLRPH 2175
             G    +    + LD E      + ++ E GG     +  +L +++ D NDN P F    
Sbjct: 226  EGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETE 285

Query: 2176 YVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLA--ASQPARGLFHVDPTTGTITTTA 2233
                +PE+ P+   + Q+ A D D G   +I +S +   S  AR LFH++ TTG IT   
Sbjct: 286  IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE 345

Query: 2234 ILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTI-------PQPWELRVS 2286
             LDRE     +L+++A+D G   +   A + V V D NDN P+I       P    + +S
Sbjct: 346  PLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLS 403

Query: 2287 EDALLGSEIAQVTGNDVDS---GPVLWYVLSPSGPQDPFSVGRYGGRVSL---TGPLDFE 2340
            E+  L ++IA +T  D D+   G V  +    +  + PF +        L      LD+E
Sbjct: 404  ENIPLNTKIALITVTDKDADHNGRVTCF----TDHEIPFRLRPVFSNQFLLENAAYLDYE 459

Query: 2341 QCDRYQLQLLAHDG---PHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILS 2397
                Y ++LLA D    P    A L + V+D NDNAP F+QS   V + E+  PG  ++ 
Sbjct: 460  STKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMK 519

Query: 2398 VSATDRDSGANGHISYHLASPADG-FSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARD 2456
            VSATD DSG N  I+Y L   A   FS+D   G L  +     L  +        + A+D
Sbjct: 520  VSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVK---KLDREKEDKYLFTILAKD 576

Query: 2457 HGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHA 2516
            +G P   +  TV V + DQND++P FT + Y+  V E+LP   T+  +  TD D    ++
Sbjct: 577  NGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYG-DNS 635

Query: 2517 AVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAAD 2576
            AV  SI+  N       +  +     S                 D E    Y   V A D
Sbjct: 636  AVTLSILDENDDFTIDSQTGVIRPNIS----------------FDREKQESYTFYVKAED 679

Query: 2577 RGQPPQSSVVPVTVTVLDVNDNPPVFT----RASYRVTVPEDTPVGAELLHVEASDADPG 2632
             G+  +SS   VT+ V+DVNDN PVF       SY + +P   P G  +  V A D D G
Sbjct: 680  GGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNP-GTVVFQVIAVDNDTG 738

Query: 2633 PHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAAD 2681
             +  VR+++  G+   LF +D+ +G + L    D      H+++V+A D
Sbjct: 739  MNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKAND 787



 Score =  228 bits (582), Expect = 6e-59
 Identities = 203/702 (28%), Positives = 313/702 (44%), Gaps = 47/702 (6%)

Query: 1639 VADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSES-FSLD 1697
            + D+ND AP F     ++ + EN+   +      A DPDVG NG   Y  + S++ F LD
Sbjct: 161  IEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLD 220

Query: 1698 ----PDTGVLTTL---RALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPT 1750
                P+   +  L   + LDREE++   + V  +D G P + +   ++V+V D ND+ P 
Sbjct: 221  VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPV 280

Query: 1751 FGSAHLSLEVPEGQDPQT-LTMLRASDPDVGANGQLQY---RILDGDPSGAFVLDLASGE 1806
            F    + + +PE     T +T L A+D D+G N ++ +    ++       F L+  +G 
Sbjct: 281  FKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGL 340

Query: 1807 FGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAY------ 1860
                 PLDRE  P  +L + A DGG     A +L+ VT  D ND+ P+  +         
Sbjct: 341  ITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVND 398

Query: 1861 SVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGE---LRTAAAL 1917
            +V + E++P  T +  +   D DA  NG VT +        F L P       L  AA L
Sbjct: 399  TVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIP--FRLRPVFSNQFLLENAAYL 456

Query: 1918 DREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFS 1977
            D E    Y   + A D A   PL+ +  + I V+D ND+AP F  S + + +P      +
Sbjct: 457  DYESTKEYAIKLLAAD-AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPEN----N 511

Query: 1978 TPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLF 2037
            +P + L  + A D D+G NA I Y L    PP  ++D  TG + V +  +     D+ LF
Sbjct: 512  SPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKK-LDREKEDKYLF 570

Query: 2038 -IVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPP-GTPIVSPRAVHA 2095
             I+A D G P  ++   + V +  + +  P F     +  + EN P  GT  +       
Sbjct: 571  TILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPD 630

Query: 2096 GGTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFT 2155
             G N  +T SIL  N+   F+I   TG I  R     D E        ++AE GG  + +
Sbjct: 631  YGDNSAVTLSILDENDD--FTIDSQTGVI--RPNISFDREKQESYTFYVKAEDGGRVSRS 686

Query: 2156 V---LTLTLQDANDNAPRFLRP----HYVAFLPESRPLEGPLLQVEADDLDQGSGGQISY 2208
                +T+ + D NDN P F+ P     Y   LP + P    + QV A D D G   ++ Y
Sbjct: 687  SSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRY 745

Query: 2209 SLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSP-ALVGSATLTVMV 2267
            S+      R LF +D  TG IT     D       R+++ A D G P +L     + + V
Sbjct: 746  SIVGGN-TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFV 804

Query: 2268 IDTNDNRPTIPQPWELRVSEDALLGSEIAQVTGNDVDSGPVL 2309
             ++  N   I +     +       +EIA V+    D   +L
Sbjct: 805  NESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKIL 846



 Score =  227 bits (578), Expect = 2e-58
 Identities = 204/705 (28%), Positives = 313/705 (44%), Gaps = 50/705 (7%)

Query: 627  PPFRIDAHSGDVCTTRT-LDRDQ-------GPSSFDFTVTAVDGGGLKSMVYVKVFLSDE 678
            P  RI+  +G++ TT   +DR++           F     A+    +  +V ++  + D 
Sbjct: 105  PLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDI 164

Query: 679  NDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLD-- 736
            NDN P F       SI   S   +      A DPD G +G  +Y ++   S  +F LD  
Sbjct: 165  NDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELI--KSQNIFGLDVI 222

Query: 737  -----EQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFE 791
                 ++   L V   L R       +++  EDGG  Q   +A + +S+       P+F+
Sbjct: 223  ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFK 282

Query: 792  QLQYVFSVPEDVAPGTSVGIVQAHNPP-GRLAPVTLSLSG---GDPRGLFSLDAVSGLLQ 847
            + +   S+PE+   GTSV  + A +   G  A +  S S       R LF L+A +GL+ 
Sbjct: 283  ETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLIT 342

Query: 848  TLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAP------EDTV 901
               PLDRE       L + +  G+ PA A+  V V   DVNDN P+           DTV
Sbjct: 343  IKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVNDTV 400

Query: 902  LLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRP---LGP 958
            +L  N    T I  +   D D+  N RVT          F + P   +  L+     L  
Sbjct: 401  VLSENIPLNTKIALITVTDKDADHNGRVT--CFTDHEIPFRLRPVFSNQFLLENAAYLDY 458

Query: 959  SGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQ 1018
                 + ++L A D G PP      L + V+D      AP F      V +P   + G Q
Sbjct: 459  ESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDN--APVFTQSFVTVSIPENNSPGIQ 516

Query: 1019 VLQVQAQAPDGGP---ITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAV 1075
            +++V A   D GP   I Y L  + A   F L+ ++G L V   LDRE ++ Y+  ++A 
Sbjct: 517  LMKVSATDADSGPNAEINYLLGPD-APPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAK 575

Query: 1076 SGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSG 1135
                  L   T   TV VSI++QN++SP  + +     V EN P   +VG +  TD D G
Sbjct: 576  DNGVPPL---TSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYG 632

Query: 1136 PNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTG 1195
             N  +T S+   ++D   F I  QTG +    + DRE+Q SY   V+ +DGG   RS++ 
Sbjct: 633  DNSAVTLSILDENDD---FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSA 689

Query: 1196 TVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYT 1255
             V + V+D+NDN P F+         L   V     PGT+V  + A D D G N  + Y+
Sbjct: 690  KVTINVVDVNDNKPVFIVPPYNYSYEL---VLPSTNPGTVVFQVIAVDNDTGMNAEVRYS 746

Query: 1256 LTGPGS-ELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSP 1299
            + G  + +LF++   +G +         +   + + + A+D G P
Sbjct: 747  IVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 791



 Score =  207 bits (528), Expect = 1e-52
 Identities = 214/751 (28%), Positives = 319/751 (42%), Gaps = 97/751 (12%)

Query: 1136 PNGRLTYSLQ----QLSEDSKAFRIHPQTGEV-TTLQTLDREQQSS---------YQLLV 1181
            PN  LT ++Q      + D    RI   TGE+ TT   +DRE+  +         Y++ V
Sbjct: 85   PNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEV 144

Query: 1182 QVQDGGSPPRSTTGTVHVAVL--DLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTL 1239
             +      P      V +  L  D+NDN+P F          + I +P+     +  T  
Sbjct: 145  AIL-----PDEIFRLVKIRFLIEDINDNAPLFPATV------INISIPENSAINSKYTLP 193

Query: 1240 QAKDPDEGENGTILYTLTGPGSELFSLH-------PHSGELLTAAPLIRAERPHYVLTLS 1292
             A DPD G NG   Y L      +F L            +L+    L R E+  YV+ + 
Sbjct: 194  AAVDPDVGINGVQNYELI-KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVK 252

Query: 1293 AHDQGSPPRSASLQLLVQVL------PSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLR 1346
              D G P RS++  L V V       P  +  E    + E  P       L  T A+   
Sbjct: 253  VEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDAD--- 309

Query: 1347 PGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALT 1406
                       E A +      LV        F L+A +G + +  PLD E  P  + L 
Sbjct: 310  ---------IGENAKIHFSFSNLVSNI-ARRLFHLNATTGLITIKEPLDREETPNHKLLV 359

Query: 1407 VRAEGPGGAGARLLRVQVQVQDENEHAPAF--------ARDPLALA--LPENPEPGAALY 1456
            + ++G G   AR + V V V D N++ P+           D + L+  +P N +   AL 
Sbjct: 360  LASDG-GLMPARAM-VLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTK--IALI 415

Query: 1457 TFRASDADGPG-----PNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPAL-- 1509
            T    DAD  G      + ++ +RL     PV + +      A      LD E+T     
Sbjct: 416  TVTDKDADHNGRVTCFTDHEIPFRLR----PVFSNQFLLENAAY-----LDYESTKEYAI 466

Query: 1510 -LLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFA-SPSRVRLPEDQPPGPAALHV 1567
             LL  +A   P N S     +V       DENDNAPVF  S   V +PE+  PG   + V
Sbjct: 467  KLLAADAGKPPLNQSAMLFIKVK------DENDNAPVFTQSFVTVSIPENNSPGIQLMKV 520

Query: 1568 VARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSP 1627
             A D D G  A ++Y L       F L   TG L+VV+ LDRE+  +++ T++A D+G P
Sbjct: 521  SATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVP 580

Query: 1628 PRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYG 1687
            P ++   + VS+ D ND +P F   EY   + EN P   ++  +  TDPD G N  VT  
Sbjct: 581  PLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLS 640

Query: 1688 GV-SSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDEND 1746
             +  ++ F++D  TGV+    + DRE+QE     V A+D G   + +   V + V D ND
Sbjct: 641  ILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVND 700

Query: 1747 HAPTF----GSAHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILDGDPSGAFVLDL 1802
            + P F     +    L +P       +  + A D D G N +++Y I+ G+    F +D 
Sbjct: 701  NKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQ 760

Query: 1803 ASGEFGTMRPLDREVEPAFQLRIEARDGGQP 1833
             +G    M   D       ++ ++A D GQP
Sbjct: 761  ETGNITLMEKCDVTDLGLHRVLVKANDLGQP 791



 Score =  196 bits (498), Expect = 3e-49
 Identities = 180/695 (25%), Positives = 302/695 (43%), Gaps = 43/695 (6%)

Query: 524  DPTSGIITTAASLDYELE----PQPQLIVVATDGGLPP--LASSATVSVALQDVNDNEPQ 577
            + T  I TT A +D E      P+ +      +  + P  +     +   ++D+NDN P 
Sbjct: 111  EDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPL 170

Query: 578  FQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGD 637
            F  T  N S+PE +   + +    A D D G  G+ +Y L       G     I+   GD
Sbjct: 171  FPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDV--IETPEGD 228

Query: 638  ----VCTTRTLDRDQGPSSFDFTVTAVDGG--GLKSMVYVKVFLSDENDNPPQFYPREYA 691
                +   + LDR++   ++   V   DGG     S   ++V ++D NDN P F   E  
Sbjct: 229  KMPQLIVQKELDREE-KDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIE 287

Query: 692  ASISAQSPPGTAVLRLRAHDPDQGSHGRLSY---HILAGNSPPLFTLDEQSGLLTVAWPL 748
             SI   +P GT+V +L A D D G + ++ +   ++++  +  LF L+  +GL+T+  PL
Sbjct: 288  VSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPL 347

Query: 749  ARRANSVVQLEIGAEDGGGLQAEPSARVDISIV----PGTPTPPIFEQLQYVFSVPEDVA 804
             R      +L + A DGG + A     V+++ V    P      I   +     + E++ 
Sbjct: 348  DREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIP 407

Query: 805  PGTSVGIVQA------HNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLG 858
              T + ++        HN  GR   VT       P  L  + +   LL+    LD E   
Sbjct: 408  LNTKIALITVTDKDADHN--GR---VTCFTDHEIPFRLRPVFSNQFLLENAAYLDYESTK 462

Query: 859  PVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRA 918
                  + A +G PP    A + + + D NDN+P F     TV +P N +PG  +  + A
Sbjct: 463  EYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSA 522

Query: 919  LDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPR 978
             D DSG N+ + + L       F++D  TG + +++ L       +   + A+D G PP 
Sbjct: 523  TDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPL 582

Query: 979  TSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPD-GGPITYHLA 1037
            TS+  + V V  +     +P F    Y+  +P        V  +    PD G      L+
Sbjct: 583  TSN--VTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLS 640

Query: 1038 AEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILN 1097
                +  F ++ Q+G +    + DRE QE Y   V A  G +     ++ +A V +++++
Sbjct: 641  ILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRV---SRSSSAKVTINVVD 697

Query: 1098 QNEHSPRLSEDP---TFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAF 1154
             N++ P     P   ++  V  +  PGT V +V A D D+G N  + YS+         F
Sbjct: 698  VNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVG-GNTRDLF 756

Query: 1155 RIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSP 1189
             I  +TG +T ++  D      +++LV+  D G P
Sbjct: 757  AIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 791



 Score =  195 bits (495), Expect = 7e-49
 Identities = 190/700 (27%), Positives = 305/700 (43%), Gaps = 86/700 (12%)

Query: 2219 LFHVDPTTGTITTT-AILDRE-----------IWAETRLVLMATDRGSPALVGSATLTVM 2266
            L  ++  TG I TT A +DRE            + E  + ++  +     +     +  +
Sbjct: 106  LIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDE-----IFRLVKIRFL 160

Query: 2267 VIDTNDNRPTIPQPW-ELRVSEDALLGSEIAQVTGNDVDSG--PVLWYVLSPSGPQDPFS 2323
            + D NDN P  P     + + E++ + S+       D D G   V  Y L  S  Q+ F 
Sbjct: 161  IEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS--QNIFG 218

Query: 2324 V-------GRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVL---VEDVNDNA 2373
            +       G    ++ +   LD E+ D Y +++   DG    R++  +L   V D NDN 
Sbjct: 219  LDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNH 278

Query: 2374 PAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFS--VDPNNGTL 2431
            P F ++  +V + E+ P G+++  + ATD D G N  I +  ++     +  +   N T 
Sbjct: 279  PVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATT 338

Query: 2432 FTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHY---- 2487
              I     L  + +    +++ A D G     ARA V V + D ND+ PS  + +     
Sbjct: 339  GLITIKEPLDREETPNHKLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPV 396

Query: 2488 --RVAVTEDLPPGSTLLTLEATDADGS---RSHAAVDYSIISGNWGRVFQLEPRLAEAGE 2542
               V ++E++P  + +  +  TD D     R     D+ I        F+L P  +    
Sbjct: 397  NDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEI-------PFRLRPVFSNQ-- 447

Query: 2543 SAGPGPRALGCLVLLEP---LDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNP 2599
                         LLE    LD+ES  +Y + + AAD G+PP +    + + V D NDN 
Sbjct: 448  ------------FLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNA 495

Query: 2600 PVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTL 2659
            PVFT++   V++PE+   G +L+ V A+DAD GP+  + + +    P   F LD  +G L
Sbjct: 496  PVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPE-FSLDRRTGML 554

Query: 2660 RLAHALDCETQARHQLVVQAADPAGAHFALAPVTIEVQ--DVNDHGPAFPLNLLSTSVAE 2717
             +   LD E + ++   + A D  G     + VT+ V   D ND+ P F  N     V E
Sbjct: 555  TVVKKLDREKEDKYLFTILAKD-NGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPE 613

Query: 2718 NQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEH 2777
            N P    V  +   D D G    +  S+L+        + F ++S TG +R  + FD E 
Sbjct: 614  NLPRHGTVGLITVTDPDYGDNSAVTLSILDE------NDDFTIDSQTGVIRPNISFDREK 667

Query: 2778 TESFRLLVGAADAGNLSASVTVSVLVTGEDEYD--PVFLAPAFHFQ---VPEGARRGHSL 2832
             ES+   V A D G +S S +  V +   D  D  PVF+ P +++    V      G  +
Sbjct: 668  QESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVV 727

Query: 2833 GHVQATDEDGGADGLVLYSL--ATSSPYFGINQTTGALYL 2870
              V A D D G +  V YS+    +   F I+Q TG + L
Sbjct: 728  FQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITL 767



 Score =  181 bits (460), Expect = 8e-45
 Identities = 160/577 (27%), Positives = 248/577 (42%), Gaps = 38/577 (6%)

Query: 47  LDLQIDEEQPAGTLIGDISA-GLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTAR 105
           +++ I E  P GT +  + A     G  A + +  S    +       ++  +G++    
Sbjct: 286 IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE 345

Query: 106 VLDREQRDRYRFTAVTPDG----ATVEVTVRVADINDHAPAFP------QARAALQVPEH 155
            LDRE+   ++   +  DG    A   V V V D+ND+ P+             + + E+
Sbjct: 346 PLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSEN 405

Query: 156 TAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDR 215
               T+  L    D DA   G        +     FRL     P  +    L     LD 
Sbjct: 406 IPLNTKIALITVTDKDADHNGRVTCFTDHE---IPFRLR----PVFSNQFLLENAAYLDY 458

Query: 216 ENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVL 275
           E+   Y ++L A D G PP    A+L + + D ND+AP F QS     + E+ +PG  ++
Sbjct: 459 ESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLM 518

Query: 276 QVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQAR 335
           +V A+DAD+G N  + Y +     +    FS+D  TG+L + + LD E+   +   + A+
Sbjct: 519 KVSATDADSGPNAEINYLLG---PDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAK 575

Query: 336 DGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDD 395
           D G  P   +  V V + D NDN P    +F   +    V E  P    V  I+V+DPD 
Sbjct: 576 DNGVPPLTSNVTVFVSIIDQNDNSP----VFTHNEYKFYVPENLPRHGTVGLITVTDPDY 631

Query: 396 GDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPLRAE 455
           GD + V +S+      F + +Q  VI         DRE++++Y   V A D G     + 
Sbjct: 632 GDNSAVTLSILDENDDFTIDSQTGVIRPNI---SFDREKQESYTFYVKAEDGGRVSRSSS 688

Query: 456 AAFVLHVTDVNDNAPAF--DRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLA 513
           A   ++V DVNDN P F      Y  E +     PG+ V +V A D D G N +V YS+ 
Sbjct: 689 AKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIV 748

Query: 514 PGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVND 573
            G     F+ID  +G IT     D       +++V A D G P     +  SV + ++  
Sbjct: 749 GGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP----DSLFSVVIVNLFV 804

Query: 574 NEPQFQRTFYN----ASLPEGTQPGTCFLQVTATDAD 606
           NE     T  N     S+     P T    V++  +D
Sbjct: 805 NESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSD 841



 Score =  181 bits (459), Expect = 1e-44
 Identities = 169/668 (25%), Positives = 281/668 (42%), Gaps = 57/668 (8%)

Query: 875  FAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLL 934
            F + ++R L++D+NDN+P FPA    + +P N+A  +      A+DPD G+N    + L+
Sbjct: 152  FRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELI 211

Query: 935  AGGG--GAFTVDPTTG----HVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVV 988
                  G   ++   G     + + + L       + ++++  DGG P R+S   L+V V
Sbjct: 212  KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSV 271

Query: 989  QDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGPITY------HLAAEGAS 1042
             D  T    P F      V +P     GT V Q+ A   D G          +L +  A 
Sbjct: 272  TD--TNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIAR 329

Query: 1043 SPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHS 1102
              F L   +G + ++  LDRE    + L V+A  G     G     A V V++ + N++ 
Sbjct: 330  RLFHLNATTGLITIKEPLDREETPNHKLLVLASDG-----GLMPARAMVLVNVTDVNDNV 384

Query: 1103 P----RLSEDPT--FLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRI 1156
            P    R   +P    + ++EN P  T +  +  TD+D+  NGR+T      ++    FR+
Sbjct: 385  PSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC----FTDHEIPFRL 440

Query: 1157 HPQTGEVTTLQT---LDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQ 1213
             P       L+    LD E    Y + +   D G PP + +  + + V D NDN+P F Q
Sbjct: 441  RPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQ 500

Query: 1214 ASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHSGEL 1273
            +       + + +P+   PG  +  + A D D G N  I Y L       FSL   +G L
Sbjct: 501  SF------VTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGML 554

Query: 1274 LTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPV 1333
                 L R +   Y+ T+ A D G PP ++++ + V ++      +  P     +    V
Sbjct: 555  TVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQ---NDNSPVFTHNEYKFYV 611

Query: 1334 PVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAASGRLYLARP 1393
            P  L      GL       +V  P+     A+T +++   D    F +D+ +G +     
Sbjct: 612  PENLPRHGTVGLI------TVTDPDYGDNSAVTLSIL---DENDDFTIDSQTGVIRPNIS 662

Query: 1394 LDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDP----LALALPENP 1449
             D E    +       +G   + +   +V + V D N++ P F   P      L LP + 
Sbjct: 663  FDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLP-ST 721

Query: 1450 EPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPAL 1509
             PG  ++   A D D  G N++VRY ++          +D  TG ++     D       
Sbjct: 722  NPGTVVFQVIAVDND-TGMNAEVRYSIVGGNTR-DLFAIDQETGNITLMEKCDVTDLGLH 779

Query: 1510 LLLVEATD 1517
             +LV+A D
Sbjct: 780  RVLVKAND 787



 Score =  181 bits (459), Expect = 1e-44
 Identities = 164/616 (26%), Positives = 258/616 (41%), Gaps = 44/616 (7%)

Query: 1847 DANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYL--GAGTAGAFLL 1904
            D ND+AP FP    ++ +PE+    +      A DPD G NG   Y L       G  ++
Sbjct: 163  DINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVI 222

Query: 1905 EPSSGE----LRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTF 1960
            E   G+    L     LDRE+  +Y   V   DG      ST + + ++V D ND+ P F
Sbjct: 223  ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAI-LQVSVTDTNDNHPVF 281

Query: 1961 PTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTT----VDSY 2016
              + + + +P   P  ++ T     L A D D G NA I +  +            +++ 
Sbjct: 282  KETEIEVSIPENAPVGTSVT----QLHATDADIGENAKIHFSFSNLVSNIARRLFHLNAT 337

Query: 2017 TGEIRVARSPVALGPRDRVLFIVATDLG-RPARSATGVIIVGLQGEAERGPRFP------ 2069
            TG I +          +  L ++A+D G  PAR+   +++V +    +  P         
Sbjct: 338  TGLITIKEPLDREETPNHKLLVLASDGGLMPARA---MVLVNVTDVNDNVPSIDIRYIVN 394

Query: 2070 RASSEATIRENAPPGTPIVSPRAVHAGGT-NGPITYSILSGNEKGTFSIQPS-TGAITVR 2127
              +    + EN P  T I            NG +T      + +  F ++P  +    + 
Sbjct: 395  PVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFT---DHEIPFRLRPVFSNQFLLE 451

Query: 2128 SAEGLDFEVSPRLRLVLQAESGGAFAFT---VLTLTLQDANDNAPRFLRPHYVAFLPESR 2184
            +A  LD+E +    + L A   G        +L + ++D NDNAP F +      +PE+ 
Sbjct: 452  NAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENN 511

Query: 2185 PLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETR 2244
                 L++V A D D G   +I+Y L    P    F +D  TG +T    LDRE   +  
Sbjct: 512  SPGIQLMKVSATDADSGPNAEINYLLGPDAPPE--FSLDRRTGMLTVVKKLDREKEDKYL 569

Query: 2245 LVLMATDRGSPALVGSATLTVMVIDTNDNRPTIP-QPWELRVSEDALLGSEIAQVTGNDV 2303
              ++A D G P L  + T+ V +ID NDN P      ++  V E+      +  +T  D 
Sbjct: 570  FTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDP 629

Query: 2304 DSGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGR---A 2360
            D G      LS     D F++    G +      D E+ + Y   + A DG    R   A
Sbjct: 630  DYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSA 689

Query: 2361 NLTVLVEDVNDNAPAFSQSLYQV---MLLEHTPPGSAILSVSATDRDSGANGHISYHL-- 2415
             +T+ V DVNDN P F    Y     ++L  T PG+ +  V A D D+G N  + Y +  
Sbjct: 690  KVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVG 749

Query: 2416 ASPADGFSVDPNNGTL 2431
             +  D F++D   G +
Sbjct: 750  GNTRDLFAIDQETGNI 765


>gi|14589944 protocadherin 11 Y-linked isoform b [Homo sapiens]
          Length = 1048

 Score =  327 bits (838), Expect = 1e-88
 Identities = 239/721 (33%), Positives = 362/721 (50%), Gaps = 42/721 (5%)

Query: 51  IDEEQPAGTLIGDISAGL-----PAGTAAPLMYFISAQEGSGVGTDLAIDEHSG-VVRTA 104
           I EE P   LIG++   L     P  +    M F    +   V   + I+E +G +  T 
Sbjct: 62  IREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPL-IRIEEDTGEIFTTG 120

Query: 105 RVLDREQ------RDRYRF----TAVTPDGATVEVTVR--VADINDHAPAFPQARAALQV 152
             +DRE+      RD + F     A+ PD     V +R  + DIND+AP FP     + +
Sbjct: 121 ARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISI 180

Query: 153 PEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGE 212
           PE++A  ++Y L  A D D G  G Q Y L    +   F L+    P+G  +P+L+V  E
Sbjct: 181 PENSAINSKYTLPAAVDPDVGINGVQNYELIK--SQNIFGLDVIETPEGDKMPQLIVQKE 238

Query: 213 LDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGS 272
           LDRE +  Y+++++  DGG P R + A+L V++ D ND+ P F ++     + E+   G+
Sbjct: 239 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGT 298

Query: 273 PVLQVFASDADAGVNGAVTYEINRRQSE-GDGPFSIDAHTGLLQLERPLDFEQRRVHELV 331
            V Q+ A+DAD G N  + +  +   S      F ++A TGL+ ++ PLD E+   H+L+
Sbjct: 299 SVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLL 358

Query: 332 VQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFL--SADGSPQVSEAAPPGQLVARIS 389
           V A DGG  P    A V V+V D NDN PS+ + ++    + +  +SE  P    +A I+
Sbjct: 359 VLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALIT 416

Query: 390 VSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGS 449
           V+D D      V    +  E  F L    S  +L+  A  LD E    Y +++ A D+G 
Sbjct: 417 VTDKDADHNGRVTCFTD-HEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGK 475

Query: 450 PPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVT 509
           PPL   A   + V D NDNAP F  Q +    +PE   PG  +++V+A D D G N ++ 
Sbjct: 476 PPLNQSAMLFIKVKDENDNAPVF-TQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEIN 534

Query: 510 YSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQ 569
           Y L P A    FS+D  +G++T    LD E E +    ++A D G+PPL S+ TV V++ 
Sbjct: 535 YLLGPDAPPE-FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSII 593

Query: 570 DVNDNEPQFQRTFYNASLPEG-TQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPP 628
           D NDN P F    Y   +PE   + GT  L +T TD D G    ++ S+        +  
Sbjct: 594 DQNDNSPVFTHNEYKFYVPENLPRHGTVGL-ITVTDPDYGDNSAVTLSI-----LDENDD 647

Query: 629 FRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMVYVKVFLS--DENDNPPQFY 686
           F ID+ +G +    + DR++   S+ F V A DGG +      KV ++  D NDN P F 
Sbjct: 648 FTIDSQTGVIRPNISFDREK-QESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFI 706

Query: 687 PREYAASISAQSP---PGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLT 743
              Y  S     P   PGT V ++ A D D G +  + Y I+ GN+  LF +D+++G +T
Sbjct: 707 VPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNIT 766

Query: 744 V 744
           +
Sbjct: 767 L 767



 Score =  248 bits (632), Expect = 9e-65
 Identities = 217/767 (28%), Positives = 345/767 (44%), Gaps = 64/767 (8%)

Query: 1445 LPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGAL-SAPRGLDR 1503
            +PEN   G  L     S        + ++++L+ +   VP +R++  TG + +    +DR
Sbjct: 66   IPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDR 125

Query: 1504 ETTPA-------LLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVF-ASPSRVRLP 1555
            E   A           VE    P    R     V  R  + D NDNAP+F A+   + +P
Sbjct: 126  EKLCAGIPRDEHCFYEVEVAILPDEIFRL----VKIRFLIEDINDNAPLFPATVINISIP 181

Query: 1556 EDQPPGPAALHVVARDPDLGEAARVSYRLASGGD--GHFRLHSSTG----ALSVVRPLDR 1609
            E+           A DPD+G     +Y L    +  G   + +  G     L V + LDR
Sbjct: 182  ENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDR 241

Query: 1610 EQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLL 1669
            E++  +V+ V   D G P RS+T +L VSV D ND  P F++ E  V + EN P GTS+ 
Sbjct: 242  EEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVT 301

Query: 1670 TLRATDPDVGANGQVTYG------GVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYA 1723
             L ATD D+G N ++ +        ++   F L+  TG++T    LDREE     L V A
Sbjct: 302  QLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLA 361

Query: 1724 QDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHL------SLEVPEGQDPQT-LTMLRASD 1776
             D G  P    V V V   D ND+ P+    ++      ++ + E     T + ++  +D
Sbjct: 362  SDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTD 419

Query: 1777 PDVGANGQLQYRILDGDP-------SGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARD 1829
             D   NG++        P       S  F+L+ A+        LD E    + +++ A D
Sbjct: 420  KDADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAY-------LDYESTKEYAIKLLAAD 472

Query: 1830 GGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGH 1889
             G+P L+ + +L + V D ND+AP F     +V +PE+   G  L+++ A D D+G N  
Sbjct: 473  AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAE 532

Query: 1890 VTYYLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTIT 1949
            + Y LG      F L+  +G L     LDRE+   Y F++ A D     PL++ V+V ++
Sbjct: 533  INYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVP-PLTSNVTVFVS 591

Query: 1950 VRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPP 2009
            + D ND++P F  +  +  +P   P   T  L   T    D D G N+++   +      
Sbjct: 592  IIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVT----DPDYGDNSAVTLSIL-DEND 646

Query: 2010 GTTVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRF- 2068
              T+DS TG IR   S           ++ A D GR +RS++  + + +    +  P F 
Sbjct: 647  DFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFI 706

Query: 2069 --PRASSEATIRENAPPGTPIVSPRAV-HAGGTNGPITYSILSGNEKGTFSIQPSTGAIT 2125
              P   S   +  +  PGT +    AV +  G N  + YSI+ GN +  F+I   TG IT
Sbjct: 707  VPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNIT 766

Query: 2126 VRSAEGLDFEVSPRLRLVLQAESGG----AFAFTVLTLTLQDANDNA 2168
            +   E  D       R++++A   G     F+  ++ L + ++  NA
Sbjct: 767  L--MEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNA 811



 Score =  242 bits (617), Expect = 5e-63
 Identities = 198/672 (29%), Positives = 309/672 (45%), Gaps = 44/672 (6%)

Query: 2152 FAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLA 2211
            F    +   ++D NDNAP F        +PE+  +        A D D G  G  +Y L 
Sbjct: 152  FRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELI 211

Query: 2212 ASQPARGLFHVDPTTGTITTTAILDREIWAETR----LVLMATDRGSPALVGSATLTVMV 2267
             SQ   GL  ++   G      I+ +E+  E +    + +   D G P    +A L V V
Sbjct: 212  KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSV 271

Query: 2268 IDTNDNRPTIPQ-PWELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSG-----PQDP 2321
             DTNDN P   +   E+ + E+A +G+ + Q+   D D G       S S       +  
Sbjct: 272  TDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRL 331

Query: 2322 FSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGP-HEGRANLTVLVEDVNDNAPAFSQSL 2380
            F +    G +++  PLD E+   ++L +LA DG     RA + V V DVNDN P+     
Sbjct: 332  FHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRY 391

Query: 2381 Y------QVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNNGTLFTI 2434
                    V+L E+ P  + I  ++ TD+D+  NG ++         F + P     F +
Sbjct: 392  IVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRLRPVFSNQFLL 450

Query: 2435 VGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTED 2494
                 L ++ +    + L A D G P     A + ++++D+ND+AP FT S   V++ E+
Sbjct: 451  ENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPEN 510

Query: 2495 LPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCL 2554
              PG  L+ + ATDAD S  +A ++Y ++  +    F L+              R  G L
Sbjct: 511  NSPGIQLMKVSATDAD-SGPNAEINY-LLGPDAPPEFSLD--------------RRTGML 554

Query: 2555 VLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPED 2614
             +++ LD E   +Y  T+ A D G PP +S V V V+++D NDN PVFT   Y+  VPE+
Sbjct: 555  TVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPEN 614

Query: 2615 TPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQ 2674
             P    +  +  +D D G +  V  T+S  D +  F +D  +G +R   + D E Q  + 
Sbjct: 615  LPRHGTVGLITVTDPDYGDNSAV--TLSILDENDDFTIDSQTGVIRPNISFDREKQESYT 672

Query: 2675 LVVQAADPAG-AHFALAPVTIEVQDVNDHGPAF---PLNLLSTSVAENQPPGTLVTTLHA 2730
              V+A D    +  + A VTI V DVND+ P F   P N     V  +  PGT+V  + A
Sbjct: 673  FYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIA 732

Query: 2731 IDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAADA 2790
            +D D G    +RYS++    G   R+ FA++  TG +      D       R+LV A D 
Sbjct: 733  VDNDTGMNAEVRYSIV----GGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDL 788

Query: 2791 GNLSASVTVSVL 2802
            G   +  +V ++
Sbjct: 789  GQPDSLFSVVIV 800



 Score =  231 bits (588), Expect = 1e-59
 Identities = 199/649 (30%), Positives = 296/649 (45%), Gaps = 57/649 (8%)

Query: 2063 ERGPRFPRASSEATIRENAPPGTPIVSPRAVHAG-GTNGPITYSIL-SGNEKGTFSIQPS 2120
            +  P FP      +I EN+   +    P AV    G NG   Y ++ S N  G   I+  
Sbjct: 166  DNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETP 225

Query: 2121 TGAITVRSA--EGLDFEVSPRLRLVLQAESGG---AFAFTVLTLTLQDANDNAPRFLRPH 2175
             G    +    + LD E      + ++ E GG     +  +L +++ D NDN P F    
Sbjct: 226  EGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETE 285

Query: 2176 YVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLA--ASQPARGLFHVDPTTGTITTTA 2233
                +PE+ P+   + Q+ A D D G   +I +S +   S  AR LFH++ TTG IT   
Sbjct: 286  IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE 345

Query: 2234 ILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTI-------PQPWELRVS 2286
             LDRE     +L+++A+D G   +   A + V V D NDN P+I       P    + +S
Sbjct: 346  PLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLS 403

Query: 2287 EDALLGSEIAQVTGNDVDS---GPVLWYVLSPSGPQDPFSVGRYGGRVSL---TGPLDFE 2340
            E+  L ++IA +T  D D+   G V  +    +  + PF +        L      LD+E
Sbjct: 404  ENIPLNTKIALITVTDKDADHNGRVTCF----TDHEIPFRLRPVFSNQFLLENAAYLDYE 459

Query: 2341 QCDRYQLQLLAHDG---PHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILS 2397
                Y ++LLA D    P    A L + V+D NDNAP F+QS   V + E+  PG  ++ 
Sbjct: 460  STKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMK 519

Query: 2398 VSATDRDSGANGHISYHLASPADG-FSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARD 2456
            VSATD DSG N  I+Y L   A   FS+D   G L  +     L  +        + A+D
Sbjct: 520  VSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVK---KLDREKEDKYLFTILAKD 576

Query: 2457 HGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHA 2516
            +G P   +  TV V + DQND++P FT + Y+  V E+LP   T+  +  TD D    ++
Sbjct: 577  NGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYG-DNS 635

Query: 2517 AVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAAD 2576
            AV  SI+  N       +  +     S                 D E    Y   V A D
Sbjct: 636  AVTLSILDENDDFTIDSQTGVIRPNIS----------------FDREKQESYTFYVKAED 679

Query: 2577 RGQPPQSSVVPVTVTVLDVNDNPPVFT----RASYRVTVPEDTPVGAELLHVEASDADPG 2632
             G+  +SS   VT+ V+DVNDN PVF       SY + +P   P G  +  V A D D G
Sbjct: 680  GGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNP-GTVVFQVIAVDNDTG 738

Query: 2633 PHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAAD 2681
             +  VR+++  G+   LF +D+ +G + L    D      H+++V+A D
Sbjct: 739  MNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKAND 787



 Score =  228 bits (582), Expect = 6e-59
 Identities = 203/702 (28%), Positives = 313/702 (44%), Gaps = 47/702 (6%)

Query: 1639 VADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSES-FSLD 1697
            + D+ND AP F     ++ + EN+   +      A DPDVG NG   Y  + S++ F LD
Sbjct: 161  IEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLD 220

Query: 1698 ----PDTGVLTTL---RALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPT 1750
                P+   +  L   + LDREE++   + V  +D G P + +   ++V+V D ND+ P 
Sbjct: 221  VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPV 280

Query: 1751 FGSAHLSLEVPEGQDPQT-LTMLRASDPDVGANGQLQY---RILDGDPSGAFVLDLASGE 1806
            F    + + +PE     T +T L A+D D+G N ++ +    ++       F L+  +G 
Sbjct: 281  FKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGL 340

Query: 1807 FGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAY------ 1860
                 PLDRE  P  +L + A DGG     A +L+ VT  D ND+ P+  +         
Sbjct: 341  ITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVND 398

Query: 1861 SVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGE---LRTAAAL 1917
            +V + E++P  T +  +   D DA  NG VT +        F L P       L  AA L
Sbjct: 399  TVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIP--FRLRPVFSNQFLLENAAYL 456

Query: 1918 DREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFS 1977
            D E    Y   + A D A   PL+ +  + I V+D ND+AP F  S + + +P      +
Sbjct: 457  DYESTKEYAIKLLAAD-AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPEN----N 511

Query: 1978 TPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLF 2037
            +P + L  + A D D+G NA I Y L    PP  ++D  TG + V +  +     D+ LF
Sbjct: 512  SPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKK-LDREKEDKYLF 570

Query: 2038 -IVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPP-GTPIVSPRAVHA 2095
             I+A D G P  ++   + V +  + +  P F     +  + EN P  GT  +       
Sbjct: 571  TILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPD 630

Query: 2096 GGTNGPITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFT 2155
             G N  +T SIL  N+   F+I   TG I  R     D E        ++AE GG  + +
Sbjct: 631  YGDNSAVTLSILDENDD--FTIDSQTGVI--RPNISFDREKQESYTFYVKAEDGGRVSRS 686

Query: 2156 V---LTLTLQDANDNAPRFLRP----HYVAFLPESRPLEGPLLQVEADDLDQGSGGQISY 2208
                +T+ + D NDN P F+ P     Y   LP + P    + QV A D D G   ++ Y
Sbjct: 687  SSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRY 745

Query: 2209 SLAASQPARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSP-ALVGSATLTVMV 2267
            S+      R LF +D  TG IT     D       R+++ A D G P +L     + + V
Sbjct: 746  SIVGGN-TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFV 804

Query: 2268 IDTNDNRPTIPQPWELRVSEDALLGSEIAQVTGNDVDSGPVL 2309
             ++  N   I +     +       +EIA V+    D   +L
Sbjct: 805  NESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKIL 846



 Score =  227 bits (578), Expect = 2e-58
 Identities = 204/705 (28%), Positives = 313/705 (44%), Gaps = 50/705 (7%)

Query: 627  PPFRIDAHSGDVCTTRT-LDRDQ-------GPSSFDFTVTAVDGGGLKSMVYVKVFLSDE 678
            P  RI+  +G++ TT   +DR++           F     A+    +  +V ++  + D 
Sbjct: 105  PLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDI 164

Query: 679  NDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLD-- 736
            NDN P F       SI   S   +      A DPD G +G  +Y ++   S  +F LD  
Sbjct: 165  NDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELI--KSQNIFGLDVI 222

Query: 737  -----EQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFE 791
                 ++   L V   L R       +++  EDGG  Q   +A + +S+       P+F+
Sbjct: 223  ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFK 282

Query: 792  QLQYVFSVPEDVAPGTSVGIVQAHNPP-GRLAPVTLSLSG---GDPRGLFSLDAVSGLLQ 847
            + +   S+PE+   GTSV  + A +   G  A +  S S       R LF L+A +GL+ 
Sbjct: 283  ETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLIT 342

Query: 848  TLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAP------EDTV 901
               PLDRE       L + +  G+ PA A+  V V   DVNDN P+           DTV
Sbjct: 343  IKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVNDTV 400

Query: 902  LLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRP---LGP 958
            +L  N    T I  +   D D+  N RVT          F + P   +  L+     L  
Sbjct: 401  VLSENIPLNTKIALITVTDKDADHNGRVT--CFTDHEIPFRLRPVFSNQFLLENAAYLDY 458

Query: 959  SGGPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQ 1018
                 + ++L A D G PP      L + V+D      AP F      V +P   + G Q
Sbjct: 459  ESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDN--APVFTQSFVTVSIPENNSPGIQ 516

Query: 1019 VLQVQAQAPDGGP---ITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAV 1075
            +++V A   D GP   I Y L  + A   F L+ ++G L V   LDRE ++ Y+  ++A 
Sbjct: 517  LMKVSATDADSGPNAEINYLLGPD-APPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAK 575

Query: 1076 SGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSG 1135
                  L   T   TV VSI++QN++SP  + +     V EN P   +VG +  TD D G
Sbjct: 576  DNGVPPL---TSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYG 632

Query: 1136 PNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTG 1195
             N  +T S+   ++D   F I  QTG +    + DRE+Q SY   V+ +DGG   RS++ 
Sbjct: 633  DNSAVTLSILDENDD---FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSA 689

Query: 1196 TVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYT 1255
             V + V+D+NDN P F+         L   V     PGT+V  + A D D G N  + Y+
Sbjct: 690  KVTINVVDVNDNKPVFIVPPYNYSYEL---VLPSTNPGTVVFQVIAVDNDTGMNAEVRYS 746

Query: 1256 LTGPGS-ELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSP 1299
            + G  + +LF++   +G +         +   + + + A+D G P
Sbjct: 747  IVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 791



 Score =  207 bits (528), Expect = 1e-52
 Identities = 214/751 (28%), Positives = 319/751 (42%), Gaps = 97/751 (12%)

Query: 1136 PNGRLTYSLQ----QLSEDSKAFRIHPQTGEV-TTLQTLDREQQSS---------YQLLV 1181
            PN  LT ++Q      + D    RI   TGE+ TT   +DRE+  +         Y++ V
Sbjct: 85   PNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEV 144

Query: 1182 QVQDGGSPPRSTTGTVHVAVL--DLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTL 1239
             +      P      V +  L  D+NDN+P F          + I +P+     +  T  
Sbjct: 145  AIL-----PDEIFRLVKIRFLIEDINDNAPLFPATV------INISIPENSAINSKYTLP 193

Query: 1240 QAKDPDEGENGTILYTLTGPGSELFSLH-------PHSGELLTAAPLIRAERPHYVLTLS 1292
             A DPD G NG   Y L      +F L            +L+    L R E+  YV+ + 
Sbjct: 194  AAVDPDVGINGVQNYELI-KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVK 252

Query: 1293 AHDQGSPPRSASLQLLVQVL------PSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLR 1346
              D G P RS++  L V V       P  +  E    + E  P       L  T A+   
Sbjct: 253  VEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDAD--- 309

Query: 1347 PGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAASGRLYLARPLDFEAGPPWRALT 1406
                       E A +      LV        F L+A +G + +  PLD E  P  + L 
Sbjct: 310  ---------IGENAKIHFSFSNLVSNI-ARRLFHLNATTGLITIKEPLDREETPNHKLLV 359

Query: 1407 VRAEGPGGAGARLLRVQVQVQDENEHAPAF--------ARDPLALA--LPENPEPGAALY 1456
            + ++G G   AR + V V V D N++ P+           D + L+  +P N +   AL 
Sbjct: 360  LASDG-GLMPARAM-VLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTK--IALI 415

Query: 1457 TFRASDADGPG-----PNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPAL-- 1509
            T    DAD  G      + ++ +RL     PV + +      A      LD E+T     
Sbjct: 416  TVTDKDADHNGRVTCFTDHEIPFRLR----PVFSNQFLLENAAY-----LDYESTKEYAI 466

Query: 1510 -LLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFA-SPSRVRLPEDQPPGPAALHV 1567
             LL  +A   P N S     +V       DENDNAPVF  S   V +PE+  PG   + V
Sbjct: 467  KLLAADAGKPPLNQSAMLFIKVK------DENDNAPVFTQSFVTVSIPENNSPGIQLMKV 520

Query: 1568 VARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSP 1627
             A D D G  A ++Y L       F L   TG L+VV+ LDRE+  +++ T++A D+G P
Sbjct: 521  SATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVP 580

Query: 1628 PRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYG 1687
            P ++   + VS+ D ND +P F   EY   + EN P   ++  +  TDPD G N  VT  
Sbjct: 581  PLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLS 640

Query: 1688 GV-SSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAVEDEND 1746
             +  ++ F++D  TGV+    + DRE+QE     V A+D G   + +   V + V D ND
Sbjct: 641  ILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVND 700

Query: 1747 HAPTF----GSAHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILDGDPSGAFVLDL 1802
            + P F     +    L +P       +  + A D D G N +++Y I+ G+    F +D 
Sbjct: 701  NKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQ 760

Query: 1803 ASGEFGTMRPLDREVEPAFQLRIEARDGGQP 1833
             +G    M   D       ++ ++A D GQP
Sbjct: 761  ETGNITLMEKCDVTDLGLHRVLVKANDLGQP 791



 Score =  196 bits (498), Expect = 3e-49
 Identities = 180/695 (25%), Positives = 302/695 (43%), Gaps = 43/695 (6%)

Query: 524  DPTSGIITTAASLDYELE----PQPQLIVVATDGGLPP--LASSATVSVALQDVNDNEPQ 577
            + T  I TT A +D E      P+ +      +  + P  +     +   ++D+NDN P 
Sbjct: 111  EDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPL 170

Query: 578  FQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGD 637
            F  T  N S+PE +   + +    A D D G  G+ +Y L       G     I+   GD
Sbjct: 171  FPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDV--IETPEGD 228

Query: 638  ----VCTTRTLDRDQGPSSFDFTVTAVDGG--GLKSMVYVKVFLSDENDNPPQFYPREYA 691
                +   + LDR++   ++   V   DGG     S   ++V ++D NDN P F   E  
Sbjct: 229  KMPQLIVQKELDREE-KDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIE 287

Query: 692  ASISAQSPPGTAVLRLRAHDPDQGSHGRLSY---HILAGNSPPLFTLDEQSGLLTVAWPL 748
             SI   +P GT+V +L A D D G + ++ +   ++++  +  LF L+  +GL+T+  PL
Sbjct: 288  VSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPL 347

Query: 749  ARRANSVVQLEIGAEDGGGLQAEPSARVDISIV----PGTPTPPIFEQLQYVFSVPEDVA 804
             R      +L + A DGG + A     V+++ V    P      I   +     + E++ 
Sbjct: 348  DREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIP 407

Query: 805  PGTSVGIVQA------HNPPGRLAPVTLSLSGGDPRGLFSLDAVSGLLQTLRPLDRELLG 858
              T + ++        HN  GR   VT       P  L  + +   LL+    LD E   
Sbjct: 408  LNTKIALITVTDKDADHN--GR---VTCFTDHEIPFRLRPVFSNQFLLENAAYLDYESTK 462

Query: 859  PVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRA 918
                  + A +G PP    A + + + D NDN+P F     TV +P N +PG  +  + A
Sbjct: 463  EYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSA 522

Query: 919  LDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGGSPPR 978
             D DSG N+ + + L       F++D  TG + +++ L       +   + A+D G PP 
Sbjct: 523  TDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPL 582

Query: 979  TSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPD-GGPITYHLA 1037
            TS+  + V V  +     +P F    Y+  +P        V  +    PD G      L+
Sbjct: 583  TSN--VTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLS 640

Query: 1038 AEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILN 1097
                +  F ++ Q+G +    + DRE QE Y   V A  G +     ++ +A V +++++
Sbjct: 641  ILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRV---SRSSSAKVTINVVD 697

Query: 1098 QNEHSPRLSEDP---TFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAF 1154
             N++ P     P   ++  V  +  PGT V +V A D D+G N  + YS+         F
Sbjct: 698  VNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVG-GNTRDLF 756

Query: 1155 RIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSP 1189
             I  +TG +T ++  D      +++LV+  D G P
Sbjct: 757  AIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 791



 Score =  195 bits (495), Expect = 7e-49
 Identities = 190/700 (27%), Positives = 305/700 (43%), Gaps = 86/700 (12%)

Query: 2219 LFHVDPTTGTITTT-AILDRE-----------IWAETRLVLMATDRGSPALVGSATLTVM 2266
            L  ++  TG I TT A +DRE            + E  + ++  +     +     +  +
Sbjct: 106  LIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDE-----IFRLVKIRFL 160

Query: 2267 VIDTNDNRPTIPQPW-ELRVSEDALLGSEIAQVTGNDVDSG--PVLWYVLSPSGPQDPFS 2323
            + D NDN P  P     + + E++ + S+       D D G   V  Y L  S  Q+ F 
Sbjct: 161  IEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS--QNIFG 218

Query: 2324 V-------GRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVL---VEDVNDNA 2373
            +       G    ++ +   LD E+ D Y +++   DG    R++  +L   V D NDN 
Sbjct: 219  LDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNH 278

Query: 2374 PAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFS--VDPNNGTL 2431
            P F ++  +V + E+ P G+++  + ATD D G N  I +  ++     +  +   N T 
Sbjct: 279  PVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATT 338

Query: 2432 FTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHY---- 2487
              I     L  + +    +++ A D G     ARA V V + D ND+ PS  + +     
Sbjct: 339  GLITIKEPLDREETPNHKLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPV 396

Query: 2488 --RVAVTEDLPPGSTLLTLEATDADGS---RSHAAVDYSIISGNWGRVFQLEPRLAEAGE 2542
               V ++E++P  + +  +  TD D     R     D+ I        F+L P  +    
Sbjct: 397  NDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEI-------PFRLRPVFSNQ-- 447

Query: 2543 SAGPGPRALGCLVLLEP---LDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNP 2599
                         LLE    LD+ES  +Y + + AAD G+PP +    + + V D NDN 
Sbjct: 448  ------------FLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNA 495

Query: 2600 PVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFTVSSGDPSGLFELDESSGTL 2659
            PVFT++   V++PE+   G +L+ V A+DAD GP+  + + +    P   F LD  +G L
Sbjct: 496  PVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPE-FSLDRRTGML 554

Query: 2660 RLAHALDCETQARHQLVVQAADPAGAHFALAPVTIEVQ--DVNDHGPAFPLNLLSTSVAE 2717
             +   LD E + ++   + A D  G     + VT+ V   D ND+ P F  N     V E
Sbjct: 555  TVVKKLDREKEDKYLFTILAKD-NGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPE 613

Query: 2718 NQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEH 2777
            N P    V  +   D D G    +  S+L+        + F ++S TG +R  + FD E 
Sbjct: 614  NLPRHGTVGLITVTDPDYGDNSAVTLSILDE------NDDFTIDSQTGVIRPNISFDREK 667

Query: 2778 TESFRLLVGAADAGNLSASVTVSVLVTGEDEYD--PVFLAPAFHFQ---VPEGARRGHSL 2832
             ES+   V A D G +S S +  V +   D  D  PVF+ P +++    V      G  +
Sbjct: 668  QESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVV 727

Query: 2833 GHVQATDEDGGADGLVLYSL--ATSSPYFGINQTTGALYL 2870
              V A D D G +  V YS+    +   F I+Q TG + L
Sbjct: 728  FQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITL 767



 Score =  181 bits (460), Expect = 8e-45
 Identities = 160/577 (27%), Positives = 248/577 (42%), Gaps = 38/577 (6%)

Query: 47  LDLQIDEEQPAGTLIGDISA-GLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTAR 105
           +++ I E  P GT +  + A     G  A + +  S    +       ++  +G++    
Sbjct: 286 IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE 345

Query: 106 VLDREQRDRYRFTAVTPDG----ATVEVTVRVADINDHAPAFP------QARAALQVPEH 155
            LDRE+   ++   +  DG    A   V V V D+ND+ P+             + + E+
Sbjct: 346 PLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSEN 405

Query: 156 TAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDR 215
               T+  L    D DA   G        +     FRL     P  +    L     LD 
Sbjct: 406 IPLNTKIALITVTDKDADHNGRVTCFTDHE---IPFRLR----PVFSNQFLLENAAYLDY 458

Query: 216 ENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVL 275
           E+   Y ++L A D G PP    A+L + + D ND+AP F QS     + E+ +PG  ++
Sbjct: 459 ESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLM 518

Query: 276 QVFASDADAGVNGAVTYEINRRQSEGDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQAR 335
           +V A+DAD+G N  + Y +     +    FS+D  TG+L + + LD E+   +   + A+
Sbjct: 519 KVSATDADSGPNAEINYLLG---PDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAK 575

Query: 336 DGGAHPELGSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDD 395
           D G  P   +  V V + D NDN P    +F   +    V E  P    V  I+V+DPD 
Sbjct: 576 DNGVPPLTSNVTVFVSIIDQNDNSP----VFTHNEYKFYVPENLPRHGTVGLITVTDPDY 631

Query: 396 GDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPLRAE 455
           GD + V +S+      F + +Q  VI         DRE++++Y   V A D G     + 
Sbjct: 632 GDNSAVTLSILDENDDFTIDSQTGVIRPNI---SFDREKQESYTFYVKAEDGGRVSRSSS 688

Query: 456 AAFVLHVTDVNDNAPAF--DRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLA 513
           A   ++V DVNDN P F      Y  E +     PG+ V +V A D D G N +V YS+ 
Sbjct: 689 AKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIV 748

Query: 514 PGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVND 573
            G     F+ID  +G IT     D       +++V A D G P     +  SV + ++  
Sbjct: 749 GGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP----DSLFSVVIVNLFV 804

Query: 574 NEPQFQRTFYN----ASLPEGTQPGTCFLQVTATDAD 606
           NE     T  N     S+     P T    V++  +D
Sbjct: 805 NESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSD 841



 Score =  181 bits (459), Expect = 1e-44
 Identities = 169/668 (25%), Positives = 281/668 (42%), Gaps = 57/668 (8%)

Query: 875  FAVARVRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLL 934
            F + ++R L++D+NDN+P FPA    + +P N+A  +      A+DPD G+N    + L+
Sbjct: 152  FRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELI 211

Query: 935  AGGG--GAFTVDPTTG----HVRLMRPLGPSGGPAHELELEARDGGSPPRTSHFRLRVVV 988
                  G   ++   G     + + + L       + ++++  DGG P R+S   L+V V
Sbjct: 212  KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSV 271

Query: 989  QDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQVQAQAPDGGPITY------HLAAEGAS 1042
             D  T    P F      V +P     GT V Q+ A   D G          +L +  A 
Sbjct: 272  TD--TNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIAR 329

Query: 1043 SPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHS 1102
              F L   +G + ++  LDRE    + L V+A  G     G     A V V++ + N++ 
Sbjct: 330  RLFHLNATTGLITIKEPLDREETPNHKLLVLASDG-----GLMPARAMVLVNVTDVNDNV 384

Query: 1103 P----RLSEDPT--FLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLSEDSKAFRI 1156
            P    R   +P    + ++EN P  T +  +  TD+D+  NGR+T      ++    FR+
Sbjct: 385  PSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC----FTDHEIPFRL 440

Query: 1157 HPQTGEVTTLQT---LDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQ 1213
             P       L+    LD E    Y + +   D G PP + +  + + V D NDN+P F Q
Sbjct: 441  RPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQ 500

Query: 1214 ASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSLHPHSGEL 1273
            +       + + +P+   PG  +  + A D D G N  I Y L       FSL   +G L
Sbjct: 501  SF------VTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGML 554

Query: 1274 LTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPV 1333
                 L R +   Y+ T+ A D G PP ++++ + V ++      +  P     +    V
Sbjct: 555  TVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQ---NDNSPVFTHNEYKFYV 611

Query: 1334 PVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAASGRLYLARP 1393
            P  L      GL       +V  P+     A+T +++   D    F +D+ +G +     
Sbjct: 612  PENLPRHGTVGLI------TVTDPDYGDNSAVTLSIL---DENDDFTIDSQTGVIRPNIS 662

Query: 1394 LDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDP----LALALPENP 1449
             D E    +       +G   + +   +V + V D N++ P F   P      L LP + 
Sbjct: 663  FDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLP-ST 721

Query: 1450 EPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPAL 1509
             PG  ++   A D D  G N++VRY ++          +D  TG ++     D       
Sbjct: 722  NPGTVVFQVIAVDND-TGMNAEVRYSIVGGNTR-DLFAIDQETGNITLMEKCDVTDLGLH 779

Query: 1510 LLLVEATD 1517
             +LV+A D
Sbjct: 780  RVLVKAND 787



 Score =  181 bits (459), Expect = 1e-44
 Identities = 164/616 (26%), Positives = 258/616 (41%), Gaps = 44/616 (7%)

Query: 1847 DANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYL--GAGTAGAFLL 1904
            D ND+AP FP    ++ +PE+    +      A DPD G NG   Y L       G  ++
Sbjct: 163  DINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVI 222

Query: 1905 EPSSGE----LRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTF 1960
            E   G+    L     LDRE+  +Y   V   DG      ST + + ++V D ND+ P F
Sbjct: 223  ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAI-LQVSVTDTNDNHPVF 281

Query: 1961 PTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTT----VDSY 2016
              + + + +P   P  ++ T     L A D D G NA I +  +            +++ 
Sbjct: 282  KETEIEVSIPENAPVGTSVT----QLHATDADIGENAKIHFSFSNLVSNIARRLFHLNAT 337

Query: 2017 TGEIRVARSPVALGPRDRVLFIVATDLG-RPARSATGVIIVGLQGEAERGPRFP------ 2069
            TG I +          +  L ++A+D G  PAR+   +++V +    +  P         
Sbjct: 338  TGLITIKEPLDREETPNHKLLVLASDGGLMPARA---MVLVNVTDVNDNVPSIDIRYIVN 394

Query: 2070 RASSEATIRENAPPGTPIVSPRAVHAGGT-NGPITYSILSGNEKGTFSIQPS-TGAITVR 2127
              +    + EN P  T I            NG +T      + +  F ++P  +    + 
Sbjct: 395  PVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFT---DHEIPFRLRPVFSNQFLLE 451

Query: 2128 SAEGLDFEVSPRLRLVLQAESGGAFAFT---VLTLTLQDANDNAPRFLRPHYVAFLPESR 2184
            +A  LD+E +    + L A   G        +L + ++D NDNAP F +      +PE+ 
Sbjct: 452  NAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENN 511

Query: 2185 PLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPTTGTITTTAILDREIWAETR 2244
                 L++V A D D G   +I+Y L    P    F +D  TG +T    LDRE   +  
Sbjct: 512  SPGIQLMKVSATDADSGPNAEINYLLGPDAPPE--FSLDRRTGMLTVVKKLDREKEDKYL 569

Query: 2245 LVLMATDRGSPALVGSATLTVMVIDTNDNRPTIP-QPWELRVSEDALLGSEIAQVTGNDV 2303
              ++A D G P L  + T+ V +ID NDN P      ++  V E+      +  +T  D 
Sbjct: 570  FTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDP 629

Query: 2304 DSGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGR---A 2360
            D G      LS     D F++    G +      D E+ + Y   + A DG    R   A
Sbjct: 630  DYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSA 689

Query: 2361 NLTVLVEDVNDNAPAFSQSLYQV---MLLEHTPPGSAILSVSATDRDSGANGHISYHL-- 2415
             +T+ V DVNDN P F    Y     ++L  T PG+ +  V A D D+G N  + Y +  
Sbjct: 690  KVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVG 749

Query: 2416 ASPADGFSVDPNNGTL 2431
             +  D F++D   G +
Sbjct: 750  GNTRDLFAIDQETGNI 765


>gi|14589942 protocadherin 11 Y-linked isoform a [Homo sapiens]
          Length = 1037

 Score =  327 bits (838), Expect = 1e-88
 Identities = 239/721 (33%), Positives = 362/721 (50%), Gaps = 42/721 (5%)

Query: 51  IDEEQPAGTLIGDISAGL-----PAGTAAPLMYFISAQEGSGVGTDLAIDEHSG-VVRTA 104
           I EE P   LIG++   L     P  +    M F    +   V   + I+E +G +  T 
Sbjct: 51  IREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPL-IRIEEDTGEIFTTG 109

Query: 105 RVLDREQ------RDRYRF----TAVTPDGATVEVTVR--VADINDHAPAFPQARAALQV 152
             +DRE+      RD + F     A+ PD     V +R  + DIND+AP FP     + +
Sbjct: 110 ARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISI 169

Query: 153 PEHTAFGTRYPLEPARDADAGRLGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGE 212
           PE++A  ++Y L  A D D G  G Q Y L    +   F L+    P+G  +P+L+V  E
Sbjct: 170 PENSAINSKYTLPAAVDPDVGINGVQNYELIK--SQNIFGLDVIETPEGDKMPQLIVQKE 227

Query: 213 LDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGS 272
           LDRE +  Y+++++  DGG P R + A+L V++ D ND+ P F ++     + E+   G+
Sbjct: 228 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGT 287

Query: 273 PVLQVFASDADAGVNGAVTYEINRRQSE-GDGPFSIDAHTGLLQLERPLDFEQRRVHELV 331
            V Q+ A+DAD G N  + +  +   S      F ++A TGL+ ++ PLD E+   H+L+
Sbjct: 288 SVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLL 347

Query: 332 VQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIFL--SADGSPQVSEAAPPGQLVARIS 389
           V A DGG  P    A V V+V D NDN PS+ + ++    + +  +SE  P    +A I+
Sbjct: 348 VLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALIT 405

Query: 390 VSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGS 449
           V+D D      V    +  E  F L    S  +L+  A  LD E    Y +++ A D+G 
Sbjct: 406 VTDKDADHNGRVTCFTD-HEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGK 464

Query: 450 PPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVT 509
           PPL   A   + V D NDNAP F  Q +    +PE   PG  +++V+A D D G N ++ 
Sbjct: 465 PPLNQSAMLFIKVKDENDNAPVF-TQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEIN 523

Query: 510 YSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQ 569
           Y L P A    FS+D  +G++T    LD E E +    ++A D G+PPL S+ TV V++ 
Sbjct: 524 YLLGPDAPPE-FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSII 582

Query: 570 DVNDNEPQFQRTFYNASLPEG-TQPGTCFLQVTATDADSGPFGLLSYSLGAGLGSSGSPP 628
           D NDN P F    Y   +PE   + GT  L +T TD D G    ++ S+        +  
Sbjct: 583 DQNDNSPVFTHNEYKFYVPENLPRHGTVGL-ITVTDPDYGDNSAVTLSI-----LDENDD 636

Query: 629 FRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGGGLKSMVYVKVFLS--DENDNPPQFY 686
           F ID+ +G +    + DR++   S+ F V A DGG +      KV ++  D NDN P F 
Sbjct: 637 FTIDSQTGVIRPNISFDREK-QESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFI 695

Query: 687 PREYAASISAQSP---PGTAVLRLRAHDPDQGSHGRLSYHILAGNSPPLFTLDEQSGLLT 743
              Y  S     P   PGT V ++ A D D G +  + Y I+ GN+  LF +D+++G +T
Sbjct: 696 VPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNIT 755

Query: 744 V 744
           +
Sbjct: 756 L 756



 Score =  248 bits (632), Expect = 9e-65
 Identities = 217/767 (28%), Positives = 345/767 (44%), Gaps = 64/767 (8%)

Query: 1445 LPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGAL-SAPRGLDR 1503
            +PEN   G  L     S        + ++++L+ +   VP +R++  TG + +    +DR
Sbjct: 55   IPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDR 114

Query: 1504 ETTPA-------LLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVF-ASPSRVRLP 1555
            E   A           VE    P    R     V  R  + D NDNAP+F A+   + +P
Sbjct: 115  EKLCAGIPRDEHCFYEVEVAILPDEIFRL----VKIRFLIEDINDNAPLFPATVINISIP 170

Query: 1556 EDQPPGPAALHVVARDPDLGEAARVSYRLASGGD--GHFRLHSSTG----ALSVVRPLDR 1609
            E+           A DPD+G     +Y L    +  G   + +  G     L V + LDR
Sbjct: 171  ENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDR 230

Query: 1610 EQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLL 1669
            E++  +V+ V   D G P RS+T +L VSV D ND  P F++ E  V + EN P GTS+ 
Sbjct: 231  EEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVT 290

Query: 1670 TLRATDPDVGANGQVTYG------GVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYA 1723
             L ATD D+G N ++ +        ++   F L+  TG++T    LDREE     L V A
Sbjct: 291  QLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLA 350

Query: 1724 QDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHL------SLEVPEGQDPQT-LTMLRASD 1776
             D G  P    V V V   D ND+ P+    ++      ++ + E     T + ++  +D
Sbjct: 351  SDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTD 408

Query: 1777 PDVGANGQLQYRILDGDP-------SGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARD 1829
             D   NG++        P       S  F+L+ A+        LD E    + +++ A D
Sbjct: 409  KDADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAY-------LDYESTKEYAIKLLAAD 461

Query: 1830 GGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGH 1889
             G+P L+ + +L + V D ND+AP F     +V +PE+   G  L+++ A D D+G N  
Sbjct: 462  AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAE 521

Query: 1890 VTYYLGAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTIT 1949
            + Y LG      F L+  +G L     LDRE+   Y F++ A D     PL++ V+V ++
Sbjct: 522  INYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVP-PLTSNVTVFVS 580

Query: 1950 VRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPP 2009
            + D ND++P F  +  +  +P   P   T  L   T    D D G N+++   +      
Sbjct: 581  IIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVT----DPDYGDNSAVTLSIL-DEND 635

Query: 2010 GTTVDSYTGEIRVARSPVALGPRDRVLFIVATDLGRPARSATGVIIVGLQGEAERGPRF- 2068
              T+DS TG IR   S           ++ A D GR +RS++  + + +    +  P F 
Sbjct: 636  DFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFI 695

Query: 2069 --PRASSEATIRENAPPGTPIVSPRAV-HAGGTNGPITYSILSGNEKGTFSIQPSTGAIT 2125
              P   S   +  +  PGT +    AV +  G N  + YSI+ GN +  F+I   TG IT
Sbjct: 696  VPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNIT 755

Query: 2126 VRSAEGLDFEVSPRLRLVLQAESGG----AFAFTVLTLTLQDANDNA 2168
            +   E  D       R++++A   G     F+  ++ L + ++  NA
Sbjct: 756  L--MEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNA 800



 Score =  242 bits (617), Expect = 5e-63
 Identities = 198/672 (29%), Positives = 309/672 (45%), Gaps = 44/672 (6%)

Query: 2152 FAFTVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLA 2211
            F    +   ++D NDNAP F        +PE+  +        A D D G  G  +Y L 
Sbjct: 141  FRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELI 200

Query: 2212 ASQPARGLFHVDPTTGTITTTAILDREIWAETR----LVLMATDRGSPALVGSATLTVMV 2267
             SQ   GL  ++   G      I+ +E+  E +    + +   D G P    +A L V V
Sbjct: 201  KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSV 260

Query: 2268 IDTNDNRPTIPQ-PWELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSG-----PQDP 2321
             DTNDN P   +   E+ + E+A +G+ + Q+