BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|58218977 adropin [Homo sapiens] (76 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|58218977 adropin [Homo sapiens] 161 9e-41 gi|62000702 diacylglycerol kinase kappa [Homo sapiens] 31 0.19 gi|169214048 PREDICTED: hypothetical protein [Homo sapiens] 31 0.25 gi|89057602 PREDICTED: hypothetical protein [Homo sapiens] 31 0.25 gi|37551995 PREDICTED: hypothetical protein [Homo sapiens] 31 0.25 gi|218505798 protocadherin 15 isoform CD1-10 precursor [Homo sap... 30 0.32 gi|218505783 protocadherin 15 isoform CD1-8 precursor [Homo sapi... 30 0.32 gi|218505781 protocadherin 15 isoform CD1-7 precursor [Homo sapi... 30 0.32 gi|13540513 oxysterol binding protein 2 isoform a [Homo sapiens] 30 0.32 gi|109948265 solute carrier family 35, member A2 isoform c [Homo... 30 0.32 gi|54792146 tripartite motif-containing 47 [Homo sapiens] 30 0.32 gi|5032211 solute carrier family 35, member A2 isoform a [Homo s... 30 0.32 gi|39995093 parathyroid hormone-like hormone isoform 1 prepropro... 30 0.42 gi|39995091 parathyroid hormone-like hormone isoform 1 prepropro... 30 0.42 gi|39995089 parathyroid hormone-like hormone isoform 2 prepropro... 30 0.42 gi|4506269 parathyroid hormone-like hormone isoform 2 preproprot... 30 0.42 gi|4505349 necdin [Homo sapiens] 30 0.42 gi|239750235 PREDICTED: hypothetical protein [Homo sapiens] 30 0.42 gi|239744535 PREDICTED: hypothetical protein XP_002343184 [Homo ... 30 0.42 gi|56550039 myeloid/lymphoid or mixed-lineage leukemia protein [... 30 0.55 gi|32481209 mitogen-activated protein kinase-activated protein k... 29 0.72 gi|10863901 mitogen-activated protein kinase-activated protein k... 29 0.72 gi|32261318 unc-5 homolog B [Homo sapiens] 29 0.72 gi|115387123 protocadherin 15 isoform CD1-4 precursor [Homo sapi... 29 0.72 gi|218505793 protocadherin 15 isoform CD3-2 precursor [Homo sapi... 29 0.72 gi|218505791 protocadherin 15 isoform CD3-1 precursor [Homo sapi... 29 0.72 gi|218505789 protocadherin 15 isoform CD2-2 precursor [Homo sapi... 29 0.72 gi|218505787 protocadherin 15 isoform CD2-1 precursor [Homo sapi... 29 0.72 gi|218505785 protocadherin 15 isoform CD1-9 precursor [Homo sapi... 29 0.72 gi|218505779 protocadherin 15 isoform CD1-6 precursor [Homo sapi... 29 0.72 >gi|58218977 adropin [Homo sapiens] Length = 76 Score = 161 bits (408), Expect = 9e-41 Identities = 76/76 (100%), Positives = 76/76 (100%) Query: 1 MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKA 60 MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKA Sbjct: 1 MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKA 60 Query: 61 PPPQKPSHEGSYLLQP 76 PPPQKPSHEGSYLLQP Sbjct: 61 PPPQKPSHEGSYLLQP 76 >gi|62000702 diacylglycerol kinase kappa [Homo sapiens] Length = 1271 Score = 31.2 bits (69), Expect = 0.19 Identities = 13/20 (65%), Positives = 14/20 (70%) Query: 44 LSESSPNSSPGPCPEKAPPP 63 LSE+SP P PCPE AP P Sbjct: 46 LSEASPEPIPEPCPELAPGP 65 >gi|169214048 PREDICTED: hypothetical protein [Homo sapiens] Length = 881 Score = 30.8 bits (68), Expect = 0.25 Identities = 14/36 (38%), Positives = 20/36 (55%) Query: 2 GAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSR 37 G +S GA+ IV L+G LL + ++LC C R Sbjct: 769 GPTLSHGAIAGIVLGSLLGLALLAVLLLLCICCLCR 804 >gi|89057602 PREDICTED: hypothetical protein [Homo sapiens] Length = 881 Score = 30.8 bits (68), Expect = 0.25 Identities = 14/36 (38%), Positives = 20/36 (55%) Query: 2 GAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSR 37 G +S GA+ IV L+G LL + ++LC C R Sbjct: 769 GPTLSHGAIAGIVLGSLLGLALLAVLLLLCICCLCR 804 >gi|37551995 PREDICTED: hypothetical protein [Homo sapiens] Length = 867 Score = 30.8 bits (68), Expect = 0.25 Identities = 14/36 (38%), Positives = 20/36 (55%) Query: 2 GAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSR 37 G +S GA+ IV L+G LL + ++LC C R Sbjct: 769 GPTLSHGAIAGIVLGSLLGLALLAVLLLLCICCLCR 804 >gi|218505798 protocadherin 15 isoform CD1-10 precursor [Homo sapiens] Length = 1932 Score = 30.4 bits (67), Expect = 0.32 Identities = 18/74 (24%), Positives = 40/74 (54%), Gaps = 4/74 (5%) Query: 6 SQGALIAIVCNGLVGFLLLLLWVILCW----ACHSRSADVDSLSESSPNSSPGPCPEKAP 61 ++GAL+A+ ++ + +L V++ + A +++A + + ++ + P P P AP Sbjct: 1351 TEGALLALAFIIILCCIPAILVVLVSYRQRQAECTKTARIQAALPAAKPAVPAPAPVAAP 1410 Query: 62 PPQKPSHEGSYLLQ 75 PP P G++L + Sbjct: 1411 PPPPPPPPGAHLYE 1424 Score = 26.6 bits (57), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Query: 49 PNSSPGPCPEKAPPPQKP 66 PN SP CP PPP P Sbjct: 1715 PNISPSACPLPPPPPISP 1732 >gi|218505783 protocadherin 15 isoform CD1-8 precursor [Homo sapiens] Length = 1915 Score = 30.4 bits (67), Expect = 0.32 Identities = 18/74 (24%), Positives = 40/74 (54%), Gaps = 4/74 (5%) Query: 6 SQGALIAIVCNGLVGFLLLLLWVILCW----ACHSRSADVDSLSESSPNSSPGPCPEKAP 61 ++GAL+A+ ++ + +L V++ + A +++A + + ++ + P P P AP Sbjct: 1336 TEGALLALAFIIILCCIPAILVVLVSYRQRQAECTKTARIQAALPAAKPAVPAPAPVAAP 1395 Query: 62 PPQKPSHEGSYLLQ 75 PP P G++L + Sbjct: 1396 PPPPPPPPGAHLYE 1409 Score = 26.6 bits (57), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Query: 49 PNSSPGPCPEKAPPPQKP 66 PN SP CP PPP P Sbjct: 1698 PNISPSACPLPPPPPISP 1715 >gi|218505781 protocadherin 15 isoform CD1-7 precursor [Homo sapiens] Length = 1952 Score = 30.4 bits (67), Expect = 0.32 Identities = 18/74 (24%), Positives = 40/74 (54%), Gaps = 4/74 (5%) Query: 6 SQGALIAIVCNGLVGFLLLLLWVILCW----ACHSRSADVDSLSESSPNSSPGPCPEKAP 61 ++GAL+A+ ++ + +L V++ + A +++A + + ++ + P P P AP Sbjct: 1373 TEGALLALAFIIILCCIPAILVVLVSYRQRQAECTKTARIQAALPAAKPAVPAPAPVAAP 1432 Query: 62 PPQKPSHEGSYLLQ 75 PP P G++L + Sbjct: 1433 PPPPPPPPGAHLYE 1446 Score = 26.6 bits (57), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Query: 49 PNSSPGPCPEKAPPPQKP 66 PN SP CP PPP P Sbjct: 1735 PNISPSACPLPPPPPISP 1752 >gi|13540513 oxysterol binding protein 2 isoform a [Homo sapiens] Length = 916 Score = 30.4 bits (67), Expect = 0.32 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Query: 15 CNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQK 65 C G L L V+ C +CH+ + + S S S P P P+ P P++ Sbjct: 13 CGGRSRGLSSLFTVVPCLSCHTAAPGM-SASTSGSGPEPKPQPQPVPEPER 62 >gi|109948265 solute carrier family 35, member A2 isoform c [Homo sapiens] Length = 393 Score = 30.4 bits (67), Expect = 0.32 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 5/35 (14%) Query: 47 SSPNSSPGPC-----PEKAPPPQKPSHEGSYLLQP 76 S+ S+ GPC P + PPPQ SH G + +P Sbjct: 350 SASASASGPCVHQQPPGQPPPPQLSSHRGDLITEP 384 >gi|54792146 tripartite motif-containing 47 [Homo sapiens] Length = 638 Score = 30.4 bits (67), Expect = 0.32 Identities = 14/33 (42%), Positives = 16/33 (48%) Query: 35 HSRSADVDSLSESSPNSSPGPCPEKAPPPQKPS 67 H+ S + S P S PGP P AP P PS Sbjct: 71 HTLSELLQLRQGSGPGSGPGPAPALAPEPSAPS 103 >gi|5032211 solute carrier family 35, member A2 isoform a [Homo sapiens] Length = 396 Score = 30.4 bits (67), Expect = 0.32 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 5/35 (14%) Query: 47 SSPNSSPGPC-----PEKAPPPQKPSHEGSYLLQP 76 S+ S+ GPC P + PPPQ SH G + +P Sbjct: 350 SASASASGPCVHQQPPGQPPPPQLSSHRGDLITEP 384 >gi|39995093 parathyroid hormone-like hormone isoform 1 preproprotein [Homo sapiens] Length = 177 Score = 30.0 bits (66), Expect = 0.42 Identities = 15/38 (39%), Positives = 20/38 (52%) Query: 38 SADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQ 75 +A++ + SE SPNS P P + P EG YL Q Sbjct: 69 TAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQ 106 >gi|39995091 parathyroid hormone-like hormone isoform 1 preproprotein [Homo sapiens] Length = 177 Score = 30.0 bits (66), Expect = 0.42 Identities = 15/38 (39%), Positives = 20/38 (52%) Query: 38 SADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQ 75 +A++ + SE SPNS P P + P EG YL Q Sbjct: 69 TAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQ 106 >gi|39995089 parathyroid hormone-like hormone isoform 2 preproprotein [Homo sapiens] Length = 175 Score = 30.0 bits (66), Expect = 0.42 Identities = 15/38 (39%), Positives = 20/38 (52%) Query: 38 SADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQ 75 +A++ + SE SPNS P P + P EG YL Q Sbjct: 69 TAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQ 106 >gi|4506269 parathyroid hormone-like hormone isoform 2 preproprotein [Homo sapiens] Length = 175 Score = 30.0 bits (66), Expect = 0.42 Identities = 15/38 (39%), Positives = 20/38 (52%) Query: 38 SADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQ 75 +A++ + SE SPNS P P + P EG YL Q Sbjct: 69 TAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQ 106 >gi|4505349 necdin [Homo sapiens] Length = 321 Score = 30.0 bits (66), Expect = 0.42 Identities = 12/23 (52%), Positives = 14/23 (60%) Query: 48 SPNSSPGPCPEKAPPPQKPSHEG 70 SP P P+ APPPQ P+ EG Sbjct: 43 SPPLGPTAAPQAAPPPQAPNDEG 65 >gi|239750235 PREDICTED: hypothetical protein [Homo sapiens] Length = 257 Score = 30.0 bits (66), Expect = 0.42 Identities = 19/50 (38%), Positives = 23/50 (46%) Query: 22 LLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGS 71 L L L++ L S + S S SSP+SSP PPP PS S Sbjct: 162 LFLPLFIPLFLLPSSSPSSSSSPSYSSPSSSPSSSSPLPPPPPPPSFSSS 211 >gi|239744535 PREDICTED: hypothetical protein XP_002343184 [Homo sapiens] Length = 257 Score = 30.0 bits (66), Expect = 0.42 Identities = 19/50 (38%), Positives = 23/50 (46%) Query: 22 LLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGS 71 L L L++ L S + S S SSP+SSP PPP PS S Sbjct: 162 LFLPLFIPLFLLPSSSPSSSSSPSYSSPSSSPSSSSPLPPPPPPPSFSSS 211 >gi|56550039 myeloid/lymphoid or mixed-lineage leukemia protein [Homo sapiens] Length = 3969 Score = 29.6 bits (65), Expect = 0.55 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Query: 41 VDSLSESSPNSSPGPCPEKA---PPPQKPSHEGS 71 VDS + +P++ P P+K+ PPP+KP E S Sbjct: 1238 VDSSQKPTPSAREDPAPKKSSSEPPPRKPVEEKS 1271 >gi|32481209 mitogen-activated protein kinase-activated protein kinase 2 isoform 2 [Homo sapiens] Length = 400 Score = 29.3 bits (64), Expect = 0.72 Identities = 13/24 (54%), Positives = 14/24 (58%) Query: 44 LSESSPNSSPGPCPEKAPPPQKPS 67 LS S S P P P APPPQ P+ Sbjct: 2 LSNSQGQSPPVPFPAPAPPPQPPT 25 >gi|10863901 mitogen-activated protein kinase-activated protein kinase 2 isoform 1 [Homo sapiens] Length = 370 Score = 29.3 bits (64), Expect = 0.72 Identities = 13/24 (54%), Positives = 14/24 (58%) Query: 44 LSESSPNSSPGPCPEKAPPPQKPS 67 LS S S P P P APPPQ P+ Sbjct: 2 LSNSQGQSPPVPFPAPAPPPQPPT 25 >gi|32261318 unc-5 homolog B [Homo sapiens] Length = 945 Score = 29.3 bits (64), Expect = 0.72 Identities = 16/38 (42%), Positives = 19/38 (50%) Query: 24 LLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAP 61 LLL ++LCW A DS SE P+S P E P Sbjct: 11 LLLALLLCWDPRLSQAGTDSGSEVLPDSFPSAPAEPLP 48 >gi|115387123 protocadherin 15 isoform CD1-4 precursor [Homo sapiens] Length = 1955 Score = 29.3 bits (64), Expect = 0.72 Identities = 18/77 (23%), Positives = 40/77 (51%), Gaps = 7/77 (9%) Query: 6 SQGALIAIVCNGLVGFLLLLLWVILCW-------ACHSRSADVDSLSESSPNSSPGPCPE 58 ++GAL+A+ ++ + +L V++ + A +++A + + ++ + P P P Sbjct: 1373 TEGALLALAFIIILCCIPAILVVLVSYRQFKVRQAECTKTARIQAALPAAKPAVPAPAPV 1432 Query: 59 KAPPPQKPSHEGSYLLQ 75 APPP P G++L + Sbjct: 1433 AAPPPPPPPPPGAHLYE 1449 Score = 26.6 bits (57), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Query: 49 PNSSPGPCPEKAPPPQKP 66 PN SP CP PPP P Sbjct: 1738 PNISPSACPLPPPPPISP 1755 >gi|218505793 protocadherin 15 isoform CD3-2 precursor [Homo sapiens] Length = 1677 Score = 29.3 bits (64), Expect = 0.72 Identities = 18/77 (23%), Positives = 40/77 (51%), Gaps = 7/77 (9%) Query: 6 SQGALIAIVCNGLVGFLLLLLWVILCW-------ACHSRSADVDSLSESSPNSSPGPCPE 58 ++GAL+A+ ++ + +L V++ + A +++A + + ++ + P P P Sbjct: 1373 TEGALLALAFIIILCCIPAILVVLVSYRQFKVRQAECTKTARIQAALPAAKPAVPAPAPV 1432 Query: 59 KAPPPQKPSHEGSYLLQ 75 APPP P G++L + Sbjct: 1433 AAPPPPPPPPPGAHLYE 1449 >gi|218505791 protocadherin 15 isoform CD3-1 precursor [Homo sapiens] Length = 1682 Score = 29.3 bits (64), Expect = 0.72 Identities = 18/77 (23%), Positives = 40/77 (51%), Gaps = 7/77 (9%) Query: 6 SQGALIAIVCNGLVGFLLLLLWVILCW-------ACHSRSADVDSLSESSPNSSPGPCPE 58 ++GAL+A+ ++ + +L V++ + A +++A + + ++ + P P P Sbjct: 1378 TEGALLALAFIIILCCIPAILVVLVSYRQFKVRQAECTKTARIQAALPAAKPAVPAPAPV 1437 Query: 59 KAPPPQKPSHEGSYLLQ 75 APPP P G++L + Sbjct: 1438 AAPPPPPPPPPGAHLYE 1454 >gi|218505789 protocadherin 15 isoform CD2-2 precursor [Homo sapiens] Length = 1539 Score = 29.3 bits (64), Expect = 0.72 Identities = 18/77 (23%), Positives = 40/77 (51%), Gaps = 7/77 (9%) Query: 6 SQGALIAIVCNGLVGFLLLLLWVILCW-------ACHSRSADVDSLSESSPNSSPGPCPE 58 ++GAL+A+ ++ + +L V++ + A +++A + + ++ + P P P Sbjct: 1373 TEGALLALAFIIILCCIPAILVVLVSYRQFKVRQAECTKTARIQAALPAAKPAVPAPAPV 1432 Query: 59 KAPPPQKPSHEGSYLLQ 75 APPP P G++L + Sbjct: 1433 AAPPPPPPPPPGAHLYE 1449 >gi|218505787 protocadherin 15 isoform CD2-1 precursor [Homo sapiens] Length = 1790 Score = 29.3 bits (64), Expect = 0.72 Identities = 18/77 (23%), Positives = 40/77 (51%), Gaps = 7/77 (9%) Query: 6 SQGALIAIVCNGLVGFLLLLLWVILCW-------ACHSRSADVDSLSESSPNSSPGPCPE 58 ++GAL+A+ ++ + +L V++ + A +++A + + ++ + P P P Sbjct: 1385 TEGALLALAFIIILCCIPAILVVLVSYRQFKVRQAECTKTARIQAALPAAKPAVPAPAPV 1444 Query: 59 KAPPPQKPSHEGSYLLQ 75 APPP P G++L + Sbjct: 1445 AAPPPPPPPPPGAHLYE 1461 >gi|218505785 protocadherin 15 isoform CD1-9 precursor [Homo sapiens] Length = 1935 Score = 29.3 bits (64), Expect = 0.72 Identities = 18/77 (23%), Positives = 40/77 (51%), Gaps = 7/77 (9%) Query: 6 SQGALIAIVCNGLVGFLLLLLWVILCW-------ACHSRSADVDSLSESSPNSSPGPCPE 58 ++GAL+A+ ++ + +L V++ + A +++A + + ++ + P P P Sbjct: 1351 TEGALLALAFIIILCCIPAILVVLVSYRQFKVRQAECTKTARIQAALPAAKPAVPAPAPV 1410 Query: 59 KAPPPQKPSHEGSYLLQ 75 APPP P G++L + Sbjct: 1411 AAPPPPPPPPPGAHLYE 1427 Score = 26.6 bits (57), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Query: 49 PNSSPGPCPEKAPPPQKP 66 PN SP CP PPP P Sbjct: 1718 PNISPSACPLPPPPPISP 1735 >gi|218505779 protocadherin 15 isoform CD1-6 precursor [Homo sapiens] Length = 1886 Score = 29.3 bits (64), Expect = 0.72 Identities = 18/77 (23%), Positives = 40/77 (51%), Gaps = 7/77 (9%) Query: 6 SQGALIAIVCNGLVGFLLLLLWVILCW-------ACHSRSADVDSLSESSPNSSPGPCPE 58 ++GAL+A+ ++ + +L V++ + A +++A + + ++ + P P P Sbjct: 1302 TEGALLALAFIIILCCIPAILVVLVSYRQFKVRQAECTKTARIQAALPAAKPAVPAPAPV 1361 Query: 59 KAPPPQKPSHEGSYLLQ 75 APPP P G++L + Sbjct: 1362 AAPPPPPPPPPGAHLYE 1378 Score = 26.6 bits (57), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Query: 49 PNSSPGPCPEKAPPPQKP 66 PN SP CP PPP P Sbjct: 1669 PNISPSACPLPPPPPISP 1686 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.318 0.135 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,048,185 Number of Sequences: 37866 Number of extensions: 198775 Number of successful extensions: 3206 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 54 Number of HSP's that attempted gapping in prelim test: 2926 Number of HSP's gapped (non-prelim): 310 length of query: 76 length of database: 18,247,518 effective HSP length: 48 effective length of query: 28 effective length of database: 16,429,950 effective search space: 460038600 effective search space used: 460038600 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.