BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|15826850 hematopoietic cell signal transducer isoform 1 precursor [Homo sapiens] (93 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|15826850 hematopoietic cell signal transducer isoform 1 precu... 187 2e-48 gi|56117854 hematopoietic cell signal transducer isoform 2 precu... 180 2e-46 gi|38158005 TYRO protein tyrosine kinase binding protein isoform... 31 0.19 gi|4507755 TYRO protein tyrosine kinase binding protein isoform ... 31 0.19 gi|4506321 protein tyrosine phosphatase, receptor type, N precur... 31 0.19 gi|4757886 pituitary tumor-transforming gene 1 protein-interacti... 30 0.55 gi|45505130 TAO kinase 2 isoform 2 [Homo sapiens] 28 1.2 gi|115387099 brain-specific angiogenesis inhibitor 2 [Homo sapiens] 28 1.6 gi|239745032 PREDICTED: hypothetical protein XP_002343336 [Homo ... 27 2.7 gi|134304838 eukaryotic translation initiation factor 2-alpha ki... 27 2.7 gi|48976054 hypothetical protein LOC79886 [Homo sapiens] 27 2.7 gi|198386341 signal-regulatory protein beta 2 isoform 2 [Homo sa... 27 2.7 gi|171906611 signal-regulatory protein beta 2 isoform 1 [Homo sa... 27 2.7 gi|62912472 leucine-rich repeat-containing G protein-coupled rec... 27 2.7 gi|62912470 leucine-rich repeat-containing G protein-coupled rec... 27 2.7 gi|62912474 leucine-rich repeat-containing G protein-coupled rec... 27 2.7 gi|4507157 sortilin-related receptor containing LDLR class A rep... 27 3.5 gi|32698864 hypothetical protein LOC149466 [Homo sapiens] 27 3.5 gi|154146199 sal-like 3 [Homo sapiens] 27 4.6 gi|17975768 ephrin receptor EphB3 precursor [Homo sapiens] 27 4.6 gi|5174419 caseinolytic peptidase, ATP-dependent, proteolytic su... 26 6.0 gi|4504417 major histocompatibility complex, class I-related [Ho... 26 6.0 gi|239751796 PREDICTED: hypothetical protein XP_002348004 [Homo ... 26 6.0 gi|239746287 PREDICTED: hypothetical protein XP_002343724 [Homo ... 26 6.0 gi|30794216 tripartite motif-containing 56 [Homo sapiens] 26 6.0 gi|145309320 forkhead box Q1 [Homo sapiens] 26 7.9 gi|91199550 CD68 antigen isoform B [Homo sapiens] 26 7.9 gi|91199548 CD68 antigen isoform A [Homo sapiens] 26 7.9 gi|11641269 dipeptidase 2 precursor [Homo sapiens] 26 7.9 >gi|15826850 hematopoietic cell signal transducer isoform 1 precursor [Homo sapiens] Length = 93 Score = 187 bits (474), Expect = 2e-48 Identities = 93/93 (100%), Positives = 93/93 (100%) Query: 1 MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVA 60 MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVA Sbjct: 1 MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVA 60 Query: 61 SLLIVGAVFLCARPRRSPAQEDGKVYINMPGRG 93 SLLIVGAVFLCARPRRSPAQEDGKVYINMPGRG Sbjct: 61 SLLIVGAVFLCARPRRSPAQEDGKVYINMPGRG 93 >gi|56117854 hematopoietic cell signal transducer isoform 2 precursor [Homo sapiens] Length = 92 Score = 180 bits (457), Expect = 2e-46 Identities = 92/93 (98%), Positives = 92/93 (98%), Gaps = 1/93 (1%) Query: 1 MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVA 60 MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVA Sbjct: 1 MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVA 60 Query: 61 SLLIVGAVFLCARPRRSPAQEDGKVYINMPGRG 93 SLLIVGAVFLCARPRRSPAQ DGKVYINMPGRG Sbjct: 61 SLLIVGAVFLCARPRRSPAQ-DGKVYINMPGRG 92 >gi|38158005 TYRO protein tyrosine kinase binding protein isoform 2 precursor [Homo sapiens] Length = 112 Score = 31.2 bits (69), Expect = 0.19 Identities = 27/74 (36%), Positives = 35/74 (47%), Gaps = 9/74 (12%) Query: 10 LLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVF 69 LLLLP+ A S L CS C ++S +LAG+V D V ++LI AV+ Sbjct: 10 LLLLPLLLAV------SGLRPVQAQAQSDCS-CSTVSPGVLAGIVMGDLVLTVLIALAVY 62 Query: 70 LCAR--PRRSPAQE 81 R PR A E Sbjct: 63 FLGRLVPRGRGAAE 76 >gi|4507755 TYRO protein tyrosine kinase binding protein isoform 1 precursor [Homo sapiens] Length = 113 Score = 31.2 bits (69), Expect = 0.19 Identities = 27/74 (36%), Positives = 35/74 (47%), Gaps = 9/74 (12%) Query: 10 LLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVF 69 LLLLP+ A S L CS C ++S +LAG+V D V ++LI AV+ Sbjct: 10 LLLLPLLLAV------SGLRPVQAQAQSDCS-CSTVSPGVLAGIVMGDLVLTVLIALAVY 62 Query: 70 LCAR--PRRSPAQE 81 R PR A E Sbjct: 63 FLGRLVPRGRGAAE 76 >gi|4506321 protein tyrosine phosphatase, receptor type, N precursor [Homo sapiens] Length = 979 Score = 31.2 bits (69), Expect = 0.19 Identities = 23/55 (41%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Query: 19 QTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFLCAR 73 QT G+R A P T+ S S S+ L L VA VA LL+ AV LC R Sbjct: 551 QTGVGQREEAAAVLPQTAHSTSPMRSVLLTL----VALAGVAGLLVALAVALCVR 601 >gi|4757886 pituitary tumor-transforming gene 1 protein-interacting protein precursor [Homo sapiens] Length = 180 Score = 29.6 bits (65), Expect = 0.55 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 5/38 (13%) Query: 5 GHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGC 42 G L LLL+PVAAAQ PG S T+ +C C Sbjct: 19 GAALLLLLIPVAAAQEPPGAACS-----QNTNKTCEEC 51 >gi|45505130 TAO kinase 2 isoform 2 [Homo sapiens] Length = 1235 Score = 28.5 bits (62), Expect = 1.2 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 4/64 (6%) Query: 7 ILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSG----CGSLSLPLLAGLVAADAVASL 62 +L LLLLP+ AAQ G +++L A G G + C +L LP L+ A A Sbjct: 968 LLLLLLLPLLAAQGGGGLQAALLALEVGLVGLGASYLLLCTALHLPSSLFLLLAQGTALG 1027 Query: 63 LIVG 66 ++G Sbjct: 1028 AVLG 1031 >gi|115387099 brain-specific angiogenesis inhibitor 2 [Homo sapiens] Length = 1585 Score = 28.1 bits (61), Expect = 1.6 Identities = 12/24 (50%), Positives = 17/24 (70%) Query: 39 CSGCGSLSLPLLAGLVAADAVASL 62 CS CG++ PLL+ A +A+ASL Sbjct: 1131 CSACGAVPSPLLSSASARNAMASL 1154 >gi|239745032 PREDICTED: hypothetical protein XP_002343336 [Homo sapiens] Length = 828 Score = 27.3 bits (59), Expect = 2.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Query: 12 LLPVAAAQTTPGERSSLPAFYPGTSGSCSGCG 43 L AA P S + GTSG C GCG Sbjct: 789 LCTTGAAPPPPASASFVGISCAGTSGGCDGCG 820 >gi|134304838 eukaryotic translation initiation factor 2-alpha kinase 3 [Homo sapiens] Length = 1116 Score = 27.3 bits (59), Expect = 2.7 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Query: 7 ILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLV-AADAVAS 61 +L LLLL +AA G LPA T+ + G G+ + P A V AA AVA+ Sbjct: 15 LLLLLLLGLAARTVAAGRARGLPA---PTAEAAFGLGAAAAPTSATRVPAAGAVAA 67 >gi|48976054 hypothetical protein LOC79886 [Homo sapiens] Length = 361 Score = 27.3 bits (59), Expect = 2.7 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 3/29 (10%) Query: 16 AAAQTTPGERSSLPAFYPGTSGSCSGCGS 44 AAA P +PA G+SGS SGCGS Sbjct: 20 AAALAAP---DIVPALASGSSGSTSGCGS 45 >gi|198386341 signal-regulatory protein beta 2 isoform 2 [Homo sapiens] Length = 244 Score = 27.3 bits (59), Expect = 2.7 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 6/52 (11%) Query: 33 PGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFLCARPRRSPAQEDGK 84 P T S +G + P++ GL A A LL + A RRSP QED K Sbjct: 181 PATEMSPTGLLVVFAPVVLGLKAITLAALLLAL------ATSRRSPGQEDVK 226 >gi|171906611 signal-regulatory protein beta 2 isoform 1 [Homo sapiens] Length = 342 Score = 27.3 bits (59), Expect = 2.7 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 6/52 (11%) Query: 33 PGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFLCARPRRSPAQEDGK 84 P T S +G + P++ GL A A LL + A RRSP QED K Sbjct: 279 PATEMSPTGLLVVFAPVVLGLKAITLAALLLAL------ATSRRSPGQEDVK 324 >gi|62912472 leucine-rich repeat-containing G protein-coupled receptor 6 isoform 2 [Homo sapiens] Length = 915 Score = 27.3 bits (59), Expect = 2.7 Identities = 29/79 (36%), Positives = 36/79 (45%), Gaps = 4/79 (5%) Query: 4 LGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLL 63 LG +LLL +AA Q + S + A+ S G L LAGL AA +AS+ Sbjct: 599 LGSEASVLLLTLAAVQCSVSV-SCVRAYGKSPSLGSVRAGVLGCLALAGLAAALPLASVG 657 Query: 64 IVGAVFLC---ARPRRSPA 79 GA LC A P PA Sbjct: 658 EYGASPLCLPYAPPEGQPA 676 >gi|62912470 leucine-rich repeat-containing G protein-coupled receptor 6 isoform 1 [Homo sapiens] Length = 967 Score = 27.3 bits (59), Expect = 2.7 Identities = 29/79 (36%), Positives = 36/79 (45%), Gaps = 4/79 (5%) Query: 4 LGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLL 63 LG +LLL +AA Q + S + A+ S G L LAGL AA +AS+ Sbjct: 651 LGSEASVLLLTLAAVQCSVSV-SCVRAYGKSPSLGSVRAGVLGCLALAGLAAALPLASVG 709 Query: 64 IVGAVFLC---ARPRRSPA 79 GA LC A P PA Sbjct: 710 EYGASPLCLPYAPPEGQPA 728 >gi|62912474 leucine-rich repeat-containing G protein-coupled receptor 6 isoform 3 [Homo sapiens] Length = 828 Score = 27.3 bits (59), Expect = 2.7 Identities = 29/79 (36%), Positives = 36/79 (45%), Gaps = 4/79 (5%) Query: 4 LGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLL 63 LG +LLL +AA Q + S + A+ S G L LAGL AA +AS+ Sbjct: 512 LGSEASVLLLTLAAVQCSVSV-SCVRAYGKSPSLGSVRAGVLGCLALAGLAAALPLASVG 570 Query: 64 IVGAVFLC---ARPRRSPA 79 GA LC A P PA Sbjct: 571 EYGASPLCLPYAPPEGQPA 589 >gi|4507157 sortilin-related receptor containing LDLR class A repeats preproprotein [Homo sapiens] Length = 2214 Score = 26.9 bits (58), Expect = 3.5 Identities = 17/57 (29%), Positives = 24/57 (42%), Gaps = 14/57 (24%) Query: 20 TTPGERSSLPAFYPGTSGSC--------------SGCGSLSLPLLAGLVAADAVASL 62 +TPG + LP +Y +SG+C G + PLLA + AA L Sbjct: 1412 STPGPSTCLPNYYRCSSGTCVMDTWVCDGYRDCADGSDEEACPLLANVTAASTPTQL 1468 >gi|32698864 hypothetical protein LOC149466 [Homo sapiens] Length = 113 Score = 26.9 bits (58), Expect = 3.5 Identities = 24/69 (34%), Positives = 29/69 (42%), Gaps = 11/69 (15%) Query: 22 PGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAV--FLCAR----PR 75 P E + A PG G G+ + P+L G V V SLLI A LC R R Sbjct: 11 PSELPTASAVAPGP-----GTGARAWPVLVGFVLGAVVLSLLIALAAKCHLCRRYHASYR 65 Query: 76 RSPAQEDGK 84 P E G+ Sbjct: 66 HRPLPETGR 74 >gi|154146199 sal-like 3 [Homo sapiens] Length = 1300 Score = 26.6 bits (57), Expect = 4.6 Identities = 25/79 (31%), Positives = 30/79 (37%), Gaps = 2/79 (2%) Query: 2 IHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGC--GSLSLPLLAGLVAADAV 59 IH ++ + VA Q P S PA P G G +LPL AG AA Sbjct: 217 IHQLQLIEQIRSQVALMQRPPPRPSLSPAAAPSAPGPAPSQLPGLAALPLSAGAPAAAIA 276 Query: 60 ASLLIVGAVFLCARPRRSP 78 S A F A+P P Sbjct: 277 GSGPAAPAAFEGAQPLSRP 295 >gi|17975768 ephrin receptor EphB3 precursor [Homo sapiens] Length = 998 Score = 26.6 bits (57), Expect = 4.6 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Query: 27 SLPAFYPGTSGSCSGCGSLS--LPLLAGLVAADAVASLLIVGAVFLCARPRR 76 S PA + TS SG L LPL+ G A V + +V +C R +R Sbjct: 535 SRPAEFETTSERGSGAQQLQEQLPLIVGSATAGLVFVVAVVVIAIVCLRKQR 586 >gi|5174419 caseinolytic peptidase, ATP-dependent, proteolytic subunit precursor [Homo sapiens] Length = 277 Score = 26.2 bits (56), Expect = 6.0 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 4/35 (11%) Query: 57 DAVASLLIVGAVFLCARPRRSPAQEDGKVYINMPG 91 D+VASL+I +FL + + P +YIN PG Sbjct: 93 DSVASLVIAQLLFLQSESNKKPIH----MYINSPG 123 >gi|4504417 major histocompatibility complex, class I-related [Homo sapiens] Length = 341 Score = 26.2 bits (56), Expect = 6.0 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Query: 44 SLSLPLLAGLVAADAVASLLIVGAVFLCARPRRSPAQEDGKVYINMPGR 92 S ++PL+ V+ V +++ G L R R P +++G +Y+ P R Sbjct: 295 SETIPLVMKAVSGSIVLVIVLAGVGVLVWR--RRPREQNGAIYLPTPDR 341 >gi|239751796 PREDICTED: hypothetical protein XP_002348004 [Homo sapiens] Length = 291 Score = 26.2 bits (56), Expect = 6.0 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Query: 25 RSSLPAFYPGTSGSCSGCGSLSL-PLLAGLVA-ADAVASLLIVGAVF 69 R+ LP PG+S G + SL P +AG A V L+V A+F Sbjct: 34 RTELPEHSPGSSSQVPGAAAHSLRPYIAGAGAGCQLVLQQLLVEAIF 80 >gi|239746287 PREDICTED: hypothetical protein XP_002343724 [Homo sapiens] Length = 291 Score = 26.2 bits (56), Expect = 6.0 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Query: 25 RSSLPAFYPGTSGSCSGCGSLSL-PLLAGLVA-ADAVASLLIVGAVF 69 R+ LP PG+S G + SL P +AG A V L+V A+F Sbjct: 34 RTELPEHSPGSSSQVPGAAAHSLRPYIAGAGAGCQLVLQQLLVEAIF 80 >gi|30794216 tripartite motif-containing 56 [Homo sapiens] Length = 755 Score = 26.2 bits (56), Expect = 6.0 Identities = 18/51 (35%), Positives = 22/51 (43%) Query: 15 VAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIV 65 VA Q +R SL Y GT GC S+ L VA A A L ++ Sbjct: 523 VADEQNRALKRFSLNGDYKGTVPVPEGCSPCSVAALQSAVAFSASARLYLI 573 >gi|145309320 forkhead box Q1 [Homo sapiens] Length = 403 Score = 25.8 bits (55), Expect = 7.9 Identities = 14/36 (38%), Positives = 18/36 (50%) Query: 13 LPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLP 48 +P AAA E + A PG G+ SG G+ S P Sbjct: 78 IPAAAAAAVVAEGAEAGAAGPGAGGAGSGEGARSKP 113 >gi|91199550 CD68 antigen isoform B [Homo sapiens] Length = 327 Score = 25.8 bits (55), Expect = 7.9 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 5/46 (10%) Query: 34 GTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFLCARPRRSPA 79 G S SC S+ LPL+ GL+ +A +LI + RR P+ Sbjct: 282 GQSFSCPSDRSILLPLIIGLILLGLLALVLIAFCII-----RRRPS 322 >gi|91199548 CD68 antigen isoform A [Homo sapiens] Length = 354 Score = 25.8 bits (55), Expect = 7.9 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 5/46 (10%) Query: 34 GTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFLCARPRRSPA 79 G S SC S+ LPL+ GL+ +A +LI + RR P+ Sbjct: 309 GQSFSCPSDRSILLPLIIGLILLGLLALVLIAFCII-----RRRPS 349 >gi|11641269 dipeptidase 2 precursor [Homo sapiens] Length = 486 Score = 25.8 bits (55), Expect = 7.9 Identities = 20/54 (37%), Positives = 24/54 (44%), Gaps = 10/54 (18%) Query: 7 ILFLLLLPVAAAQTTPGERSSLPAF-------YPGTSGSCSGCGSLSLPLLAGL 53 +L LLL PV A TTPG +L PGT + +LS P GL Sbjct: 22 LLLLLLQPVTCAYTTPGPPRALTTLGAPRAHTMPGTYAPST---TLSSPSTQGL 72 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.323 0.140 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,088,438 Number of Sequences: 37866 Number of extensions: 162605 Number of successful extensions: 558 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 19 Number of HSP's that attempted gapping in prelim test: 547 Number of HSP's gapped (non-prelim): 30 length of query: 93 length of database: 18,247,518 effective HSP length: 64 effective length of query: 29 effective length of database: 15,824,094 effective search space: 458898726 effective search space used: 458898726 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.