Guide to the Human Genome
Home | Table of Contents | Search text | Search genes | Search sequences | Purchase | FAQ | Blog | Help

Search of human proteins with 156104903

BLASTP 2.2.11 [Jun-05-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|156104903 myomesin 2 [Homo sapiens]
         (1465 letters)

Database: hs.faa 
           37,866 sequences; 18,247,518 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|156104903 myomesin 2 [Homo sapiens]                               2974   0.0  
gi|140560917 myomesin 1 isoform b [Homo sapiens]                     1341   0.0  
gi|155969693 myomesin family, member 3 [Homo sapiens]                1118   0.0  
gi|140560919 myomesin 1 isoform a [Homo sapiens]                      862   0.0  
gi|110349719 titin isoform N2-A [Homo sapiens]                        269   1e-71
gi|110349717 titin isoform novex-2 [Homo sapiens]                     269   1e-71
gi|110349713 titin isoform novex-1 [Homo sapiens]                     269   1e-71
gi|110349715 titin isoform N2-B [Homo sapiens]                        269   1e-71
gi|253970427 immunoglobulin superfamily, member 22 [Homo sapiens]     168   3e-41
gi|148839296 immunoglobulin-like and fibronectin type III domain...   154   8e-37
gi|46049110 myosin binding protein C, slow type isoform 4 [Homo ...   137   8e-32
gi|46049125 myosin binding protein C, slow type isoform 2 [Homo ...   137   8e-32
gi|45976288 myosin binding protein C, slow type isoform 1 [Homo ...   137   8e-32
gi|133908641 myosin binding protein C, fast type [Homo sapiens]       132   2e-30
gi|222352127 sidekick 2 [Homo sapiens]                                129   3e-29
gi|148596957 myosin binding protein C, cardiac [Homo sapiens]         126   1e-28
gi|46049119 myosin binding protein C, slow type isoform 3 [Homo ...   125   3e-28
gi|193083163 roundabout, axon guidance receptor, homolog 2 isofo...   110   8e-24
gi|61888896 roundabout, axon guidance receptor, homolog 2 isofor...   110   8e-24
gi|48476182 roundabout, axon guidance receptor, homolog 3 [Homo ...   107   1e-22
gi|224994173 roundabout 1 isoform d [Homo sapiens]                    101   5e-21
gi|224994171 roundabout 1 isoform c [Homo sapiens]                    101   5e-21
gi|239748173 PREDICTED: similar to roundabout 1 isoform 1 [Homo ...   101   5e-21
gi|239748171 PREDICTED: similar to roundabout 1 isoform 2 [Homo ...   101   5e-21
gi|119220552 sidekick 1 [Homo sapiens]                                100   1e-20
gi|19743806 roundabout 1 isoform b [Homo sapiens]                     100   2e-20
gi|4506569 roundabout 1 isoform a [Homo sapiens]                      100   2e-20
gi|104487006 protein tyrosine phosphatase, receptor type, sigma ...    97   1e-19
gi|157311649 neogenin homolog 1 [Homo sapiens]                         97   1e-19
gi|104487297 protein tyrosine phosphatase, receptor type, sigma ...    92   3e-18

>gi|156104903 myomesin 2 [Homo sapiens]
          Length = 1465

 Score = 2974 bits (7709), Expect = 0.0
 Identities = 1465/1465 (100%), Positives = 1465/1465 (100%)

Query: 1    MSLVTVPFYQKRHRHFDQSYRNIQTRYLLDEYASKKRASTQASSQKSLSQRSSSQRASSQ 60
            MSLVTVPFYQKRHRHFDQSYRNIQTRYLLDEYASKKRASTQASSQKSLSQRSSSQRASSQ
Sbjct: 1    MSLVTVPFYQKRHRHFDQSYRNIQTRYLLDEYASKKRASTQASSQKSLSQRSSSQRASSQ 60

Query: 61   TSLGGTICRVCAKRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHLEEDVHLARS 120
            TSLGGTICRVCAKRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHLEEDVHLARS
Sbjct: 61   TSLGGTICRVCAKRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHLEEDVHLARS 120

Query: 121  QARDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVWERMSVKLCFTVQGF 180
            QARDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVWERMSVKLCFTVQGF
Sbjct: 121  QARDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVWERMSVKLCFTVQGF 180

Query: 181  PTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVST 240
            PTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVST
Sbjct: 181  PTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVST 240

Query: 241  NAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCT 300
            NAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCT
Sbjct: 241  NAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCT 300

Query: 301  MLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSR 360
            MLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSR
Sbjct: 301  MLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSR 360

Query: 361  GGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVD 420
            GGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVD
Sbjct: 361  GGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVD 420

Query: 421  RCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDP 480
            RCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDP
Sbjct: 421  RCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDP 480

Query: 481  LDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKD 540
            LDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKD
Sbjct: 481  LDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKD 540

Query: 541  PLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEIT 600
            PLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEIT
Sbjct: 541  PLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEIT 600

Query: 601  SPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCN 660
            SPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCN
Sbjct: 601  SPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCN 660

Query: 661  HKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLL 720
            HKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLL
Sbjct: 661  HKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLL 720

Query: 721  NCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSL 780
            NCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSL
Sbjct: 721  NCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSL 780

Query: 781  YEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSG 840
            YEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSG
Sbjct: 781  YEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSG 840

Query: 841  SSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSD 900
            SSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSD
Sbjct: 841  SSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSD 900

Query: 901  TSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIET 960
            TSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIET
Sbjct: 901  TSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIET 960

Query: 961  VGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKS 1020
            VGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKS
Sbjct: 961  VGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKS 1020

Query: 1021 ELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGIIEMVMDRF 1080
            ELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGIIEMVMDRF
Sbjct: 1021 ELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGIIEMVMDRF 1080

Query: 1081 SIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDV 1140
            SIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDV
Sbjct: 1081 SIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDV 1140

Query: 1141 TEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNLERGICELLIPKLSKKDHGEYKA 1200
            TEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNLERGICELLIPKLSKKDHGEYKA
Sbjct: 1141 TEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNLERGICELLIPKLSKKDHGEYKA 1200

Query: 1201 TLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEM 1260
            TLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEM
Sbjct: 1201 TLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEM 1260

Query: 1261 KVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSG 1320
            KVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSG
Sbjct: 1261 KVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSG 1320

Query: 1321 QAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFK 1380
            QAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFK
Sbjct: 1321 QAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFK 1380

Query: 1381 NDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKHGE 1440
            NDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKHGE
Sbjct: 1381 NDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKHGE 1440

Query: 1441 KIPDMAPPQQAKPKLIPASASAAGQ 1465
            KIPDMAPPQQAKPKLIPASASAAGQ
Sbjct: 1441 KIPDMAPPQQAKPKLIPASASAAGQ 1465


>gi|140560917 myomesin 1 isoform b [Homo sapiens]
          Length = 1589

 Score = 1341 bits (3470), Expect = 0.0
 Identities = 676/1446 (46%), Positives = 950/1446 (65%), Gaps = 30/1446 (2%)

Query: 6    VPFYQKRHRHFDQSYRNIQTRYLLDEYASKKRASTQASSQKSLSQRSSSQRASSQTSLGG 65
            VP +  R +H        + R  + E A+        +S++ ++  S    AS QT+   
Sbjct: 138  VPIFSGRQKHVSGITDTEEER--IKEAAAYIAQRNLLASEEGITT-SKQSTASKQTT--- 191

Query: 66   TICRVCAKRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHL---EEDVHLARSQA 122
                      S Q    +++ +  QS  +    A RQ  +S+ A     +E+    +S+ 
Sbjct: 192  ---------ASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRK 242

Query: 123  ---RDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVWERMSVKLCFTVQG 179
               R+K ++ ++++ +E+   +     E+ +  APE +++ RSHTVWE+ +VKL  ++ G
Sbjct: 243  VVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAG 302

Query: 180  FPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVS 239
            +P P V WYK+   I   A PGKY IES YG+HTLEIN  DF+DTA Y A A N  G++S
Sbjct: 303  WPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELS 362

Query: 240  TNAAVVVRRFRGDEEPFRSVGLPIGLPLS-SMIPY---THFDVQFLEKFGVTFRREGETV 295
              A+VVV+R++G+ +  R       +PLS  + PY   + F++ F +KF V+F REGET+
Sbjct: 363  AYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETM 422

Query: 296  TLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTL 355
            +L C +++TP++K  QP  +WYR+ V L  SKW +  +   +A+L+FSHL+K+DEGLYT+
Sbjct: 423  SLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTI 482

Query: 356  RIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVM 415
            R+        +SA++FVRDAD  + GAP AP+D++C +AN+DY+I++WK P     SP++
Sbjct: 483  RVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPIL 542

Query: 416  GYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAV 475
            GYF+D+CEVGT++W QCND PVK  ++PVTGL EGRSYIFRVRAVN  GI  PSRVS+ V
Sbjct: 543  GYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPV 602

Query: 476  AALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPT 535
            AALDP +  RL++          I  ++   +  VPGPPT +  +E +R+YVVLSW+PP 
Sbjct: 603  AALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPG 662

Query: 536  PRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSE 595
             RG + +MYF+EK   G+ +WQRVN +  V+SPR+A+FDL EGKSY FRV  +N  G+ E
Sbjct: 663  QRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGE 722

Query: 596  PSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNL 655
            PSE T      D   +P APG+++ SRNT TSVVV W+  K  ++L+GYY++  VAG+  
Sbjct: 723  PSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGK 782

Query: 656  WEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPY 715
            WEPCN+ P+  +RF  HGL TG+ YIFRV+AVNA G+SE SQ+S+ I+V+AA+  PS P 
Sbjct: 783  WEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPC 842

Query: 716  GITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHK---NWHEVNSSPSKPTILTV 772
             IT L     SM LGWK P   GG+ I GYY++ REV       W E N          +
Sbjct: 843  DITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKI 902

Query: 773  DGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVML 832
              L E  +Y+F++AA+N+AG+G PS  SE FKCE WT+  PGP + L   EVR  SLV+ 
Sbjct: 903  SNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQ 962

Query: 833  WKAPVYSGSSPVSGYFVDFREEDAGE--WITVNQTTTANRYLKVSDLQQGKTYVFRVRAV 890
            WK PV+SG +PV+GYFVD +E  A E  W  +N+    N YLKV  L++G +YVFRVRA+
Sbjct: 963  WKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAI 1022

Query: 891  NANGVGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEI 950
            N  GVGKPSD + PV+ E RPGTKE+   VD+ G I L F+C +MT  S+F+W K Y   
Sbjct: 1023 NQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVST 1082

Query: 951  SDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNE 1010
             D  R ++E+ G+ +K+  K+   +DLG YS  V+DTDG++SS+++D EEL+RL+ALS+E
Sbjct: 1083 EDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHE 1142

Query: 1011 IKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKAT 1070
             K PT+P+KSELA EI +KG+VRFW+QAE LS +A   +I N++E+ +   +++  D+ T
Sbjct: 1143 HKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNT 1202

Query: 1071 GIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGP 1130
            GIIEM M++   E+EGTYT Q+ DGKA + S++VL+GD FK + +EAEFQR+E++RKQGP
Sbjct: 1203 GIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGP 1262

Query: 1131 HFAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNLERGICELLIPKL 1190
            HF EYL W+VT EC V L CKVAN KKET   W KD+     +   + + GIC LLI + 
Sbjct: 1263 HFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEF 1322

Query: 1191 SKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLKVLCTPEGIRLQ 1250
            SKKD G Y+  LKDDRG+D S L++  + + ++++ + +    SA+ LK+  T EGI+L 
Sbjct: 1323 SKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLY 1382

Query: 1251 CFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKD 1310
             F+ Y+ +++KVNW H  + I  S+ ++ G + E  WLQI EPT  DKGKY  E+FDGK 
Sbjct: 1383 SFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKT 1442

Query: 1311 NHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFG 1370
             HQ+++DLSGQA+DEA+AEFQ+ K AA AEKNR R++GGLPDVVTI EGK LNLTC V+G
Sbjct: 1443 GHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWG 1502

Query: 1371 NPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYGGEKID 1430
            +P PEV W KN++ +   +H ++K E  +    TI GV++ DSGKY + +KNKYG E  D
Sbjct: 1503 DPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSD 1562

Query: 1431 VTVSVY 1436
             TVSV+
Sbjct: 1563 FTVSVF 1568



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 18/87 (20%)

Query: 4  VTVPFYQKRHRHFDQSYRNIQTRYLLDEYASKKR-------ASTQASSQKSLSQR----- 51
          +++PFYQ+ H+H+D SYRN   R  +  Y  +K+        ST  SS+ S + R     
Sbjct: 1  MSLPFYQRCHQHYDLSYRNKDVRSTVSHYQREKKRSAVYTQGSTAYSSRSSAAHRRESEA 60

Query: 52 ------SSSQRASSQTSLGGTICRVCA 72
                SSSQ+ +SQ +L   + R  A
Sbjct: 61 FRRASASSSQQQASQHALSSEVSRKAA 87


>gi|155969693 myomesin family, member 3 [Homo sapiens]
          Length = 1437

 Score = 1118 bits (2892), Expect = 0.0
 Identities = 600/1420 (42%), Positives = 860/1420 (60%), Gaps = 27/1420 (1%)

Query: 30   DEYASKKRASTQASSQKSLSQRSSSQRASSQTSLGGTICRVCAKRVSTQEDEEQENRSRY 89
            +E   +++ S +  S        SS+     ++    +    A   S++   E + R + 
Sbjct: 30   EEQKEERQHSLRMGSSVRRRTFRSSEEEHEFSAADYALAAALALTASSELSWEAQLRRQT 89

Query: 90   QSLVAAYGEAKRQRFLSELAHLEEDVHLARSQARDKLDKYAIQQMMEDKLAWERHTFEER 149
             ++       KR  F ++    E          R + D   +++  E+K+   +   E  
Sbjct: 90   SAVELEERGQKRVGFGNDWERTEIAFLQTHRLLRQRRDWKTLRRRTEEKVQEAKELRELC 149

Query: 150  ISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLIC-QAAEPGKYRIESN 208
              R P   + LRSH VWE  +V L  TVQ  P P V WYK+ + I  +    GKYRI +N
Sbjct: 150  YGRGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNN 209

Query: 209  YGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLS 268
            YG+ +LEI R   +D+ATY+    NAHGQ S+ A V+VR + G +  F S         S
Sbjct: 210  YGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFK----RS 265

Query: 269  SMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKW 328
            +  P     V+F       F RE E  +L C  L + D+   +   +W+RD  LL+ S+ 
Sbjct: 266  TFGP----SVEFTSVLKPVFAREKEPFSLSC--LFSEDVLDAES-IQWFRDGSLLRSSRR 318

Query: 329  TKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMD 388
             K+ + + QASL  S  +K+DEGLY +R+ S  G  + S ++ VRDA+    GAPG+P++
Sbjct: 319  RKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLN 378

Query: 389  LQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLF 448
            ++C D NRD +I+TW PP+ T  +P+  Y ++RC+  +  W+ C++AP   C+ P+ GL 
Sbjct: 379  VRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLV 438

Query: 449  EGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDA 508
            EG+SY FRVRA++  G S PS+ S+ V   D    RR   +  +   +I I  D  E   
Sbjct: 439  EGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTV 498

Query: 509  QVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSP 568
             +P PPT VHASEI   YVVL+WE P+PR + PL Y +EKSV+GSG+W+ +++++ VRSP
Sbjct: 499  TIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSP 558

Query: 569  RYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSV 628
            R+AV DL + KSYVFRV + N++GLS+PSE + PI  +        P +V A R+T+TSV
Sbjct: 559  RFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSV 618

Query: 629  VVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVN 688
             + WD P  + +LLGYY+     GT+ W+  N+KPI   RF V GL TG++Y F V++V+
Sbjct: 619  SLTWD-PVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVS 677

Query: 689  AVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLD 748
              G+ E+S  ++ I+V+ AL  PS PYG  LLNC  + M +GWK PK  GG  ILGY+LD
Sbjct: 678  EAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLD 737

Query: 749  KREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAW 808
            + +    +WH VN  P    +  V  L EG  YEF+  A N AG+GE S PS  F+C+ W
Sbjct: 738  QHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEW 797

Query: 809  TMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTA 868
            TMP+PGP YD+   EVR TSLV+ W+ P+Y G+ PV+GY V F+EE + +W  V     +
Sbjct: 798  TMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPIS 857

Query: 869  NRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYL 928
              +L+VSDLQ GK+YVF+V+A+N+ G+G+PS  ++PVL+E +PG  EI  GVDE+G IYL
Sbjct: 858  GTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEVGVDEEGFIYL 917

Query: 929  GFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTD 988
             F+  E  D+S+F W K Y+   D +R KIE   + SK+ LK P  EDLGTYSV V+D D
Sbjct: 918  AFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDAD 977

Query: 989  -GVSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASY 1047
              +S+S  L  EELE+L  LS+EI+NP I L S    +I ++G VR WL+ E LSP A  
Sbjct: 978  EDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAEL 1037

Query: 1048 RFIINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIG 1107
              I N++E+  S   +I  D+  G++E+++   S E++G+YT Q+ DGKAK+Q +L L+ 
Sbjct: 1038 HLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVD 1097

Query: 1108 DAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWL--- 1164
            D F  +L +A+ +R+++ RKQGP+F   L W VTE+C+V+L CKV NTKKET F+W    
Sbjct: 1098 DDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQR 1157

Query: 1165 --KDDVLYETETLPNLERGICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDD 1222
                D  Y+ ET      G   L I +LSKKD G Y+A + DDRG+D +IL++ G   D 
Sbjct: 1158 AEMPDGQYDPET------GTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDA 1211

Query: 1223 MILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDE-MKVNWCHKDAKISSSEHMRIGG 1281
            +   + R+   SA+PLK+  T EGIR+   +KY+  E MK  W HKD ++ S + +R G 
Sbjct: 1212 IFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGT 1271

Query: 1282 SEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEK 1341
            + +  WL I +P + DKGKYT EI  GK+  Q S DLSGQAF++A AE Q+ K  A  EK
Sbjct: 1272 TLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEK 1331

Query: 1342 NRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYV 1401
            NR +++ GLPDV TIME KTL LTC V G+P PE+ W KNDQ +   + + ++V   + V
Sbjct: 1332 NRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTE-V 1390

Query: 1402 SMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKHGEK 1441
            ++TI+ V SEDSG+Y + +KNKYG E   VT+SV+KHG++
Sbjct: 1391 TITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDE 1430


>gi|140560919 myomesin 1 isoform a [Homo sapiens]
          Length = 1685

 Score =  862 bits (2228), Expect = 0.0
 Identities = 469/1084 (43%), Positives = 652/1084 (60%), Gaps = 61/1084 (5%)

Query: 370  LFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNW 429
            + V + +P     PG P DL   +A R YV+++WKPP       +M YFV++CE GT NW
Sbjct: 625  IIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENW 683

Query: 430  VQCN-DAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQA 488
             + N + PVK  ++ +  L EG+SY FRVR  NSAG+  PS  ++     D LD      
Sbjct: 684  QRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD------ 737

Query: 489  VHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEK 548
                                 +P  P  +  S  +   VV+SWE  +   K+ + Y+IE 
Sbjct: 738  ---------------------IPKAPGKIIPSRNTDTSVVVSWEE-SKDAKELVGYYIEA 775

Query: 549  SVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQ-- 606
            SV GSG W+  N    V+  R+    L+ G+SY+FRV + N  GLSE S+ +  I+ +  
Sbjct: 776  SVAGSGKWEPCN-NNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAA 834

Query: 607  -------DVT-VVPSAPGRVLASRNTKTSVVVQWDRPKHEED-LLGYYVDCCVAGTNLWE 657
                   DV   +   PG + ASR      V +   P  ++D LLG   +          
Sbjct: 835  IGGGVSPDVCPALSDEPGGLTASRGR----VHEASPPTFQKDALLGSKPNKPSL------ 884

Query: 658  PCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGI 717
            P + + +G         T  E+     +     G S+    SD +K +     PS P  I
Sbjct: 885  PSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSK----SDPLKKKTDRAPPSPPCDI 940

Query: 718  TLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHK---NWHEVNSSPSKPTILTVDG 774
            T L     SM LGWK P   GG+ I GYY++ REV       W E N          +  
Sbjct: 941  TCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISN 1000

Query: 775  LTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWK 834
            L E  +Y+F++AA+N+AG+G PS  SE FKCE WT+  PGP + L   EVR  SLV+ WK
Sbjct: 1001 LKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWK 1060

Query: 835  APVYSGSSPVSGYFVDFREEDAGE--WITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNA 892
             PV+SG +PV+GYFVD +E  A E  W  +N+    N YLKV  L++G +YVFRVRA+N 
Sbjct: 1061 PPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQ 1120

Query: 893  NGVGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISD 952
             GVGKPSD + PV+ E RPGTKE+   VD+ G I L F+C +MT  S+F+W K Y    D
Sbjct: 1121 AGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTED 1180

Query: 953  DERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIK 1012
              R ++E+ G+ +K+  K+   +DLG YS  V+DTDG++SS+++D EEL+RL+ALS+E K
Sbjct: 1181 SPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHK 1240

Query: 1013 NPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGI 1072
             PT+P+KSELA EI +KG+VRFW+QAE LS +A   +I N++E+ +   +++  D+ TGI
Sbjct: 1241 FPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGI 1300

Query: 1073 IEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHF 1132
            IEM M++   E+EGTYT Q+ DGKA + S++VL+GD FK + +EAEFQR+E++RKQGPHF
Sbjct: 1301 IEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHF 1360

Query: 1133 AEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNLERGICELLIPKLSK 1192
             EYL W+VT EC V L CKVAN KKET   W KD+     +   + + GIC LLI + SK
Sbjct: 1361 VEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSK 1420

Query: 1193 KDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLKVLCTPEGIRLQCF 1252
            KD G Y+  LKDDRG+D S L++  + + ++++ + +    SA+ LK+  T EGI+L  F
Sbjct: 1421 KDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSF 1480

Query: 1253 MKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNH 1312
            + Y+ +++KVNW H  + I  S+ ++ G + E  WLQI EPT  DKGKY  E+FDGK  H
Sbjct: 1481 VTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGH 1540

Query: 1313 QRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNP 1372
            Q+++DLSGQA+DEA+AEFQ+ K AA AEKNR R++GGLPDVVTI EGK LNLTC V+G+P
Sbjct: 1541 QKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDP 1600

Query: 1373 DPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYGGEKIDVT 1432
             PEV W KN++ +   +H ++K E  +    TI GV++ DSGKY + +KNKYG E  D T
Sbjct: 1601 PPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFT 1660

Query: 1433 VSVY 1436
            VSV+
Sbjct: 1661 VSVF 1664



 Score =  667 bits (1720), Expect = 0.0
 Identities = 465/1502 (30%), Positives = 750/1502 (49%), Gaps = 131/1502 (8%)

Query: 6    VPFYQKRHRHFDQSYRNIQTRYLLDEYASKKRASTQASSQKSLSQRSSSQRASSQTSLGG 65
            VP +  R +H        + R  + E A+        +S++ ++  S    AS QT+   
Sbjct: 138  VPIFSGRQKHVSGITDTEEER--IKEAAAYIAQRNLLASEEGITT-SKQSTASKQTT--- 191

Query: 66   TICRVCAKRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHL---EEDVHLARSQA 122
                      S Q    +++ +  QS  +    A RQ  +S+ A     +E+    +S+ 
Sbjct: 192  ---------ASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRK 242

Query: 123  ---RDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVWERMSVKLCFTVQG 179
               R+K ++ ++++ +E+   +     E+ +  APE +++ RSHTVWE+ +VKL  ++ G
Sbjct: 243  VVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAG 302

Query: 180  FPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVS 239
            +P P V WYK+   I   A PGKY IES YG+HTLEIN  DF+DTA Y A A N  G++S
Sbjct: 303  WPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELS 362

Query: 240  TNAAVVVRRFRGDEEPFRSVGLPIGLPLS-SMIPY---THFDVQFLEKFGVTFRREGETV 295
              A+VVV+R++G+ +  R       +PLS  + PY   + F++ F +KF V+F REGET+
Sbjct: 363  AYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETM 422

Query: 296  TLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTL 355
            +L C +++TP++K  QP  +WYR+ V L  SKW +  +   +A+L+FSHL+K+DEGLYT+
Sbjct: 423  SLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTI 482

Query: 356  RIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVM 415
            R+        +SA++FVRDAD  + GAP AP+D++C +AN+DY+I++WK P     SP++
Sbjct: 483  RVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPIL 542

Query: 416  GYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAV 475
            GYF+D+CEVGT++W QCND PVK  ++PVTGL EGRSYIFRVRAVN  GI  PSRVS+ V
Sbjct: 543  GYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPV 602

Query: 476  AALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPT 535
            AALDP +  RL++          I  ++   +  VPGPPT +  +E +R+YVVLSW+PP 
Sbjct: 603  AALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPG 662

Query: 536  PRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSE 595
             RG + +MYF+EK   G+ +WQRVN +  V+SPR+A+FDL EGKSY FRV  +N  G+ E
Sbjct: 663  QRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGE 722

Query: 596  PSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNL 655
            PSE T      D   +P APG+++ SRNT TSVVV W+  K  ++L+GYY++  VAG+  
Sbjct: 723  PSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGK 782

Query: 656  WEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAAL------- 708
            WEPCN+ P+  +RF  HGL TG+ YIFRV+AVNA G+SE SQ+S+ I+V+AA+       
Sbjct: 783  WEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPD 842

Query: 709  ---TVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPS 765
                +   P G+T      H  +     P       +LG                 S P+
Sbjct: 843  VCPALSDEPGGLTASRGRVHEAS-----PPTFQKDALLG-----------------SKPN 880

Query: 766  KPTILTVD---GLTEGS----LYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYD 818
            KP++ +     G TE S      + ++         +    S+  K +    P P P  D
Sbjct: 881  KPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAP-PSPPCD 939

Query: 819  LTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFRE---EDAGEWITVNQTTTANRYLKVS 875
            +T  E    S+V+ WK P   G + ++GY+V++RE      G+W   N    +    K+S
Sbjct: 940  ITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKIS 999

Query: 876  DLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVE----ARPG-TKEISAGVDEQGNIYLGF 930
            +L++   Y F+V A+N  G+G PS  SE    E    A PG    +      + ++ L +
Sbjct: 1000 NLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQW 1059

Query: 931  DCQEMTDASQFT--WCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTD 988
                 +  +  T  +    E  + +++++         +YLK    ++  +Y   V    
Sbjct: 1060 KPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVR--- 1116

Query: 989  GVSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYR 1048
             ++ + V  P +      L+  +   T P   E+   + D G +    + + ++P + + 
Sbjct: 1117 AINQAGVGKPSD------LAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFS 1170

Query: 1049 FIINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGD 1108
            +  +   VS  +  R++ +      +M      +++ G Y+  + D    + S L+    
Sbjct: 1171 W--SKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLI---- 1224

Query: 1109 AFKTVLEEAEFQRKEFLRKQGPH----FAEYLHWDVTEECEVRLVCKV----ANTKKETV 1160
                  +E E +R   L  +           L  ++ E+ +VR   +      N K   +
Sbjct: 1225 ------DEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYI 1278

Query: 1161 FKWLKDDVLYETETLPNLER--GICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGK 1218
            F   + ++    +   +++R  GI E+ + KL  +D G Y   L+D +  + S + + G 
Sbjct: 1279 FN--EKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGD 1336

Query: 1219 VYDDMILA--------MSRVCGKSASPLKVLCTPE-GIRLQCFMKYFTDEMKVNWCHKDA 1269
            V+  +           + +        L    T E  + L+C +     E  + W   + 
Sbjct: 1337 VFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDER 1396

Query: 1270 KISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAE 1329
            +IS  E  +    + +  L I E ++KD G Y   + D +   +  L L  +AF E   E
Sbjct: 1397 EISVDE--KHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMME 1454

Query: 1330 FQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSE 1389
              +  A +  +            + +  EG  L    T +   D +V W  N   I+ S+
Sbjct: 1455 VCKKIALSATDLK----------IQSTAEGIQLYSFVTYYVE-DLKVNWSHNGSAIRYSD 1503

Query: 1390 HFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQ 1449
                 V   + + + I   T  D GKY + + +   G +  V +S   + E   +    +
Sbjct: 1504 RVKTGV-TGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLK 1562

Query: 1450 QA 1451
            QA
Sbjct: 1563 QA 1564



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 18/87 (20%)

Query: 4  VTVPFYQKRHRHFDQSYRNIQTRYLLDEYASKKR-------ASTQASSQKSLSQR----- 51
          +++PFYQ+ H+H+D SYRN   R  +  Y  +K+        ST  SS+ S + R     
Sbjct: 1  MSLPFYQRCHQHYDLSYRNKDVRSTVSHYQREKKRSAVYTQGSTAYSSRSSAAHRRESEA 60

Query: 52 ------SSSQRASSQTSLGGTICRVCA 72
                SSSQ+ +SQ +L   + R  A
Sbjct: 61 FRRASASSSQQQASQHALSSEVSRKAA 87


>gi|110349719 titin isoform N2-A [Homo sapiens]
          Length = 33423

 Score =  269 bits (688), Expect = 1e-71
 Identities = 229/865 (26%), Positives = 373/865 (43%), Gaps = 101/865 (11%)

Query: 153   APEILVRLR---SHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNY 209
             APEI + ++     TV     ++L  TV G P P + W K   ++ Q     +  IE+  
Sbjct: 13687 APEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDK---RITIENVP 13743

Query: 210   GVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSS 269
                T+ I  +   DT TY   A N  G+ +    V V                    L  
Sbjct: 13744 KKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV--------------------LDK 13783

Query: 270   MIPYTHFDVQFL--EKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESK 327
               P   FD+  +  E   +T+    +    K T  V    +R      W++    +K++ 
Sbjct: 13784 PGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVE--RRATDSEVWHKLSSTVKDTN 13841

Query: 328   WTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVT----GAP 383
             +              + L  + E ++ +   +  GV +         A P+        P
Sbjct: 13842 FKA------------TKLIPNKEYIFRVAAENMYGVGEPV------QASPITAKYQFDPP 13883

Query: 384   GAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYP 443
             G P  L+  D  +D V +TW  P+    SP+ GY+V+R +  T+ WV+CN  PVK   Y 
Sbjct: 13884 GPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYR 13943

Query: 444   VTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDD 503
             V GL   + Y FRV A N AG  +PS+ ++ +   DP+D                     
Sbjct: 13944 VKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPID--------------------- 13982

Query: 504   LEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPL-MYFIEKSVVGSGSWQRVNAQ 562
                    P PP      ++ +  V L+W  P   G   +  Y IE    G+  W RV   
Sbjct: 13983 ------PPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRV--A 14034

Query: 563   TAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASR 622
               V + ++ +  LMEG+ Y FRV + N+ G SEPSE + P+  ++    PS P  +    
Sbjct: 14035 EGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVIN 14094

Query: 623   NTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQY 680
              TK +  ++W  P+ +    +  Y V+        W+  +   +   +  V  LT G  Y
Sbjct: 14095 ITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVD-TTVKDTKCTVTPLTEGSLY 14153

Query: 681   IFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGS 740
             +FRV A NA+G S+ ++  D +  +   T P  PY + +++     + L W+ PK  GG 
Sbjct: 14154 VFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGR 14213

Query: 741   PILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPS 800
             PI  Y ++K+E     W +   +        V  + EG+  +F++ A N AG+G PS+P+
Sbjct: 14214 PIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPT 14273

Query: 801   EHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWI 860
             E    E  T P P P  DL   +     + + WK P  +G SP+ GY V+       +W+
Sbjct: 14274 EILSIEDPTSP-PSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWM 14332

Query: 861   TVNQTTTANRYLKVSD-LQQGKTYVFRVRAVNANGVGKPSDTSEPVLV---EARP----G 912
              VN     +   KV + +   K YV RVRAVNA GV +PS+ SE V+    + +P     
Sbjct: 14333 RVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLE 14392

Query: 913   TKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNP 972
             T +I     E+ +I + F    +   S   W K  +E+   +R  ++   DH   +L+ P
Sbjct: 14393 THDIIVIEGEKLSIPVPFRAVPVPTVS---WHKDGKEVKASDRLTMK--NDHISAHLEVP 14447

Query: 973   D--KEDLGTYSVSVSDTDGVSSSFV 995
                + D G Y++++ +  G +++ +
Sbjct: 14448 KSVRADAGIYTITLENKLGSATASI 14472



 Score =  268 bits (685), Expect = 3e-71
 Identities = 209/769 (27%), Positives = 337/769 (43%), Gaps = 83/769 (10%)

Query: 272   PYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKM 331
             P    DV+ L    V   + G  + L  T+   P+     P+  W + D++LK+ K   +
Sbjct: 13688 PEIFLDVKLLAGLTV---KAGTKIELPATVTGKPE-----PKITWTKADMILKQDKRITI 13739

Query: 332   FFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQC 391
                  +++++     + D G Y +  V+  G +     + V D        PG P     
Sbjct: 13740 ENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDK-------PGPPAAFDI 13792

Query: 392   HDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGR 451
              D   +  ++TW PP     S +  Y V+R    +  W + + + VK   +  T L   +
Sbjct: 13793 TDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLS-STVKDTNFKATKLIPNK 13851

Query: 452   SYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVP 511
              YIFRV A N  G+  P + S   A                       YQ D       P
Sbjct: 13852 EYIFRVAAENMYGVGEPVQASPITAK----------------------YQFD------PP 13883

Query: 512   GPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRY 570
             GPPT +  S+I+++ V L+W  P   G  P+  Y++E+    +  W R N +  V+   Y
Sbjct: 13884 GPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCN-KMPVKDTTY 13942

Query: 571   AVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVV 630
              V  L   K Y FRVL+ N  G  +PS+ T PI  +D    P  PG+       KTSV +
Sbjct: 13943 RVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRL 14002

Query: 631   QWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVN 688
              W +P+H+    +  Y ++    GT+ W     + +   + ++ GL  G++Y FRV+AVN
Sbjct: 14003 NWTKPEHDGGAKIESYVIEMLKTGTDEWVRV-AEGVPTTQHLLPGLMEGQEYSFRVRAVN 14061

Query: 689   AVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLD 748
               G SE S+ SD +  +  L  PS P  + ++N   ++  L W VP+  GGSPI  Y ++
Sbjct: 14062 KAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVE 14121

Query: 749   KREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAW 808
             KR+V  K W  V+++  K T  TV  LTEGSLY F++AA N  G  + ++  +    +  
Sbjct: 14122 KRDVRRKGWQTVDTT-VKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKD- 14179

Query: 809   TMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTA 868
             T   PGP Y L   +V    + + W+ P   G  P+  Y ++ +E     W+   +T   
Sbjct: 14180 TFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGP 14239

Query: 869   NRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVE--ARPGTKEISAGVDEQGNI 926
             +   +V+D+ +G    F+VRA N  GVG PS+ +E + +E    P +  +   V + G  
Sbjct: 14240 DCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRK 14299

Query: 927   YLGFDCQ---------------EMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKN 971
             ++    +               EM       W +       D +FK+E            
Sbjct: 14300 HIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEG--------VV 14351

Query: 972   PDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKS 1020
             PDKE    Y + V   + +    V +P E+   +   +    PTI L++
Sbjct: 14352 PDKE----YVLRVRAVNAIG---VSEPSEISENVVAKDPDCKPTIDLET 14393



 Score =  231 bits (588), Expect = 5e-60
 Identities = 228/871 (26%), Positives = 358/871 (41%), Gaps = 147/871 (16%)

Query: 164   TVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDD 223
             TV    +V L  TV G P P V W KDG+L+ + AE  K  ++ N  + TLE+   +  D
Sbjct: 19306 TVKAGTNVCLDATVFGKPMPTVSWKKDGTLL-KPAEGIKMAMQRN--LCTLELFSVNRKD 19362

Query: 224   TATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEK 283
             +  Y+  A N+ G  S    + V      ++P    G P  + ++ M         + ++
Sbjct: 19363 SGDYTITAENSSGSKSATIKLKVL-----DKP----GPPASVKINKM---------YSDR 19404

Query: 284   FGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFS 343
               +++    E    + T  +    +  +P               W ++       S S  
Sbjct: 19405 AMLSWEPPLEDGGSEITNYIVDKRETSRPN--------------WAQVSATVPITSCSVE 19450

Query: 344   HLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDA------DPLVTGAPGAPMDLQCHDANRD 397
              L +  E  + +   ++ GV D    +F   A      DP     PG        +  +D
Sbjct: 19451 KLIEGHEYQFRICAENKYGVGDP---VFTEPAIAKNPYDP-----PGRCDPPVISNITKD 19502

Query: 398   YVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRV 457
             ++ V+WKPP     SP+ GY +++ E    NW + N  P+       TGL EG  Y FRV
Sbjct: 19503 HMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRV 19562

Query: 458   RAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGV 517
              A+N AG  +PS  S A  A DP                              PGPP   
Sbjct: 19563 TAINKAGPGKPSDASKAAYARDP---------------------------QYPPGPPAFP 19595

Query: 518   HASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLM 576
                + +R+ V LSW  P   G  P++ Y +E     S +W R N    ++  R+ V  LM
Sbjct: 19596 KVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLM 19655

Query: 577   EGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV------- 629
             E   Y FRV + N+ G S+PS++      +D+ + P      L +   KT ++       
Sbjct: 19656 EDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGE---LDADLRKTLILRAGVTMR 19712

Query: 630   ------------VQWDRPK-HEEDLLGYYVDCCVAGTNL-WEPCNHKPIGYNRFVVHGLT 675
                         + W +P  +  D +G  +      T L  E  N    G          
Sbjct: 19713 LYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAG---------- 19762

Query: 676   TGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPK 735
                +YI  ++  N+ G  E +    V+KV   L  P  P  +T+      S  + W+ P 
Sbjct: 19763 ---KYILTLE--NSCGKKEYTI---VVKV---LDTPGPPVNVTVKEISKDSAYVTWEPPI 19811

Query: 736   FSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGE 795
               GGSPI+ Y + KR+   K+W  V +  SK T   V  L EG  Y F++ A N  GIG+
Sbjct: 19812 IDGGSPIINYVVQKRDAERKSWSTVTTECSK-TSFRVANLEEGKSYFFRVFAENEYGIGD 19870

Query: 796   PSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREED 855
             P +  +  K        PGP  DL    V  +S  + WK P   G S + GY VDF  E+
Sbjct: 19871 PGETRDAVKAS----QTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTEE 19926

Query: 856   AGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKE 915
               +W  V ++ +     K  DL +GK Y FRV A N NG G PS+    + V AR     
Sbjct: 19927 -NKWQRVMKSLSLQYSAK--DLTEGKEYTFRVSAENENGEGTPSE----ITVVARDDV-- 19977

Query: 916   ISAGVDEQGNIYLGFDCQEMTD-----------ASQFTWCKSYEEISDDERFKIETVGDH 964
             ++  +D +G   L +  +E ++           A   +W K  + ++ D R  +E+   +
Sbjct: 19978 VAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVN 20037

Query: 965   SKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
             + L + +  K D G Y++++ +  G     +
Sbjct: 20038 TTLIVYDCQKSDAGKYTITLKNVAGTKEGTI 20068



 Score =  226 bits (575), Expect = 2e-58
 Identities = 233/937 (24%), Positives = 390/937 (41%), Gaps = 106/937 (11%)

Query: 167   ERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTAT 226
             E++S+ + F  +  P P V W+KDG    +     +  +++++    LE+ ++   D   
Sbjct: 14402 EKLSIPVPF--RAVPVPTVSWHKDGK---EVKASDRLTMKNDHISAHLEVPKSVRADAGI 14456

Query: 227   YSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGV 286
             Y+    N  G  + +  V V                IGLP     P        + K   
Sbjct: 14457 YTITLENKLGSATASINVKV----------------IGLPG----PCKDIKASDITKSSC 14496

Query: 287   TFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLH 346
                 E            TP L  V  R E  R         +  +  GE + S +   L 
Sbjct: 14497 KLTWEPPEFDGG-----TPILHYVLERREAGR-------RTYIPVMSGENKLSWTVKDLI 14544

Query: 347   KDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTG----APGAPMDLQCHDANRDYVIVT 402
              + E  + ++ V++ G  +     ++   +P++       P  P+D++ H+   + + +T
Sbjct: 14545 PNGEYFFRVKAVNKVGGGE-----YIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTIT 14599

Query: 403   WKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNS 462
             WKPP     S +MGY +++   G   W +CN+  V I  Y   GL EG+ Y FRVRA N+
Sbjct: 14600 WKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENA 14659

Query: 463   AGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPP----TGVH 518
             AGIS PSR +    A+DP+D  +   V L    E+    D++  DA + G P    T + 
Sbjct: 14660 AGISEPSRATPPTKAVDPIDAPK---VILRTSLEVK-RGDEIALDASISGSPYPTITWIK 14715

Query: 519   ASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSP-RYAVFDLME 577
                +     +     P  R +   +   E  V+     QR++   + +   +  V D + 
Sbjct: 14716 DENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLT--QRLSIDNSKKGESQLRVRDSLR 14773

Query: 578   GKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKH 637
                 ++ +   N HG+++     S +        P  P   +     KTSV+ +W+ P  
Sbjct: 14774 PDHGLYMIKVENDHGIAKAPCTVSVLDT------PGPPINFVFEDIRKTSVLCKWEPPLD 14827

Query: 638   E--EDLLGYYVDCCVAGTNLWEPCNH-----KPIGYNRFVVHGLTTGEQYIFRVKAVNAV 690
             +   +++ Y ++      +  +P +        + + ++ V  L  G++Y+FRV+A N  
Sbjct: 14828 DGGSEIINYTLE----KKDKTKPDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRF 14883

Query: 691   GMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKR 750
             G         ++  +     P  P    + +   +SM + W  PK   GSPILGY+L+KR
Sbjct: 14884 GPGPPCVSKPLV-AKDPFGPPDAPDKPIVEDVTSNSMLVKWNEPK-DNGSPILGYWLEKR 14941

Query: 751   EVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTM 810
             EV+  +W  VN S        VDGL EG  Y F++ A N AG G+ S PS+  K     +
Sbjct: 14942 EVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDP-KTAHDPI 15000

Query: 811   PEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANR 870
               PGP       +   T++ + W+ P ++G   + GYFVD +     EW    +     R
Sbjct: 15001 SPPGPPIP-RVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVR 15059

Query: 871   YLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGF 930
                V ++++G  Y  RV AVNA G G P +T +PV V        +   V  +G I +  
Sbjct: 15060 QYTVKEIREGADYKLRVSAVNAAGEGPPGET-QPVTVAEPQEPPAVELDVSVKGGIQIMA 15118

Query: 931   DCQEMTDA-------SQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVS 983
                    A           W K   E+ D +R  I+ VG  S+L +K+  ++D G Y ++
Sbjct: 15119 GKTLRIPAVVTGRPVPTKVWTKEEGEL-DKDRVVIDNVGTKSELIIKDALRKDHGRYVIT 15177

Query: 984   VSDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSP 1043
              +++ G  S F     E+        ++  P + LK  +      K  +  W   E    
Sbjct: 15178 ATNSCG--SKFAAARVEV-------FDVPGPVLDLKPVVTNR---KMCLLNWSDPEDDGG 15225

Query: 1044  DASYRFIINDREV------SDSEIHRIKCDKATGIIE 1074
                  FII  ++          E  R KCD  TG++E
Sbjct: 15226 SEITGFIIERKDAKMHTWRQPIETERSKCD-ITGLLE 15261



 Score =  218 bits (554), Expect = 4e-56
 Identities = 194/813 (23%), Positives = 330/813 (40%), Gaps = 104/813 (12%)

Query: 328   WTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPM 387
             WT +       SL  + L + +E ++ +  V++ GV +      V   +P V   PG P 
Sbjct: 23766 WTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVL--PGPPK 23823

Query: 388   DLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGL 447
              L+  +  +D + V W  P++   S ++GY V++ +     W++CN   +   +  VTGL
Sbjct: 23824 SLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGL 23883

Query: 448   FEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGD 507
              E   Y FRV A N+AG+  PS  +    A DP+                          
Sbjct: 23884 TEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFK------------------------ 23919

Query: 508   AQVPGPPTGVHASEISRNYVVLSWEPPT-PRGKDPLMYFIEKSVVGSGSWQRVNAQTAVR 566
                PGPPT  H  + ++N + L+W  P    G + L Y +E        WQ V  QT +R
Sbjct: 23920 ---PGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLR 23976

Query: 567   SPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQD----------------VTV 610
               R+ +  L E + Y  RV + N+ GL E + +   ++ +D                + V
Sbjct: 23977 VTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVV 24036

Query: 611   VPSAPGRVLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFV 670
                   R+      + +  + W R +      G + D              K + Y +  
Sbjct: 24037 RAGGSARIHIPFKGRPTPEITWSREE------GEFTDKVQI---------EKGVNYTQLS 24081

Query: 671   VHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLG 730
             +      +   + +K  N+ G      +S  + V+  L  P  P  + +      S  L 
Sbjct: 24082 IDNCDRNDAGKYILKLENSSG-----SKSAFVTVKV-LDTPGPPQNLAVKEVRKDSAFLV 24135

Query: 731   WKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNL 790
             W+ P   GG+ +  Y +DKRE   K +  V+S  SK T   V+ LTEG++Y F++ A N 
Sbjct: 24136 WEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSK-TSFKVENLTEGAIYYFRVMAENE 24194

Query: 791   AGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVD 850
              G+G P +  +  K        P P   +T  +V  TS  ++W+ P + G S V GY V+
Sbjct: 24195 FGVGVPVETVDAVKAAE----PPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVE 24250

Query: 851   FREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVE-- 908
              + +   +W  V ++   N    V+ L  G+ Y FRV+A N  G   P     PV+ +  
Sbjct: 24251 MQPKGTEKWSIVAESKVCNAV--VTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDL 24308

Query: 909   -ARPGTK------EISAGVDEQGNI-YLGFDCQEMTDASQFTWCKSYEEISDDERFKIET 960
               +P  K       I AG D +  I  +G            +W K  E +    R  +E 
Sbjct: 24309 TIQPSLKLPFNTYSIQAGEDLKIEIPVIG------RPRPNISWVKDGEPLKQTTRVNVEE 24362

Query: 961   VGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIKNPTI-PLK 1019
                 + L++K  +K+D G Y+V+ +++ G ++         E L  +  E   P + P++
Sbjct: 24363 TATSTVLHIKEGNKDDFGKYTVTATNSAGTAT---------ENLSVIVLEKPGPPVGPVR 24413

Query: 1020  SELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGIIEMVMDR 1079
              +   E+     V  W    +        +I+  R+ + +  H +    A   I++   +
Sbjct: 24414 FD---EVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLK 24470

Query: 1080  FSIENEGTYTVQIHDGK-AKSQSSLVLIGDAFK 1111
                E +     +   GK A   S  V++   FK
Sbjct: 24471 TGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFK 24503



 Score =  216 bits (551), Expect = 1e-55
 Identities = 213/874 (24%), Positives = 350/874 (40%), Gaps = 152/874 (17%)

Query: 164   TVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDD 223
             T+    S++L  +V G P PV+ W K G  +   A      I++      L +++ +  D
Sbjct: 29457 TIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAI-----IDTTESYSLLIVDKVNRYD 29511

Query: 224   TATYSAVATNAHGQVSTNAAVVVRRFRGD-------EEPFRSVGLPIGLP-LSSMIPYTH 275
                Y+  A N  G+ S    V V    G        E    SV +   +P +    P  +
Sbjct: 29512 AGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNN 29571

Query: 276   FDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGE 335
             + V+  E     F+    TVT KC+  +      V+    ++R   +L E+      +G 
Sbjct: 29572 YIVEKREAAMRAFK----TVTTKCSKTLYRISGLVEGTMYYFR---VLPEN-----IYGI 29619

Query: 336   GQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDAN 395
             G+   +   +                                LV+  P  P  L+  D  
Sbjct: 29620 GEPCETSDAV--------------------------------LVSEVPLVPAKLEVVDVT 29647

Query: 396   RDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIF 455
             +  V + W+ P     S + GY ++ C+ GT  W++       + ++ VT L EG  Y+F
Sbjct: 29648 KSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLF 29707

Query: 456   RVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVP-GPP 514
             R+RA N  G+S P    + V A+   DLR L  + L    +  I+         VP G P
Sbjct: 29708 RIRAQNEKGVSEPR---ETVTAVTVQDLRVLPTIDLSTMPQKTIH---------VPAGRP 29755

Query: 515   TGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFD 574
               +      R     SW            +F    +  S   +RV  +T  +  +  + +
Sbjct: 29756 VELVIPIAGRPPPAASW------------FFAGSKLRES---ERVTVETHTKVAKLTIRE 29800

Query: 575   LMEGKSYVFRVLSANRHG----------LSEPSEITSPIQAQDVTVVPSAPGRVLASRNT 624
                  +  + +   N  G          L +P   T PI+  ++                
Sbjct: 29801 TTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDA-------------- 29846

Query: 625   KTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIF 682
              TS+ + W+ P+ +    L GY V+   A    W P +   +  + F    LT G +Y+F
Sbjct: 29847 -TSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSES-VTRSTFKFTRLTEGNEYVF 29904

Query: 683   RVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPI 742
             RV A N  G+    Q S+VI+ ++++ +P  P  + + +     MTL W  P+  GGS +
Sbjct: 29905 RVAATNRFGIGSYLQ-SEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQV 29963

Query: 743   LGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEH 802
              GY ++++EV    W  VN  P   T     GLTEG  YE ++ A+N  G G+PS PS+ 
Sbjct: 29964 TGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKP 30023

Query: 803   FKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITV 862
                     P PG   +    +   TS+ + W  P   G S V+GY ++ ++ D  EW   
Sbjct: 30024 IVAMDPIAP-PGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKC 30082

Query: 863   NQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISAGVDE 922
             N T T  R   ++ L QG  Y FRV A NA G G+P++          PGT +++  ++ 
Sbjct: 30083 NTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEV---------PGTVKVTEMLE- 30132

Query: 923   QGNIYLGFDCQEMTDASQFT---------------------WCKSYEEISDDERFKIETV 961
                 Y  ++  E      F                      W K  ++IS  +R  I T 
Sbjct: 30133 ----YPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDIS--KRAMIATS 30186

Query: 962   GDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
               H++L +K  D+ D GTY + + +  G  + ++
Sbjct: 30187 ETHTELVIKEADRGDSGTYDLVLENKCGKKAVYI 30220



 Score =  216 bits (549), Expect = 2e-55
 Identities = 172/613 (28%), Positives = 259/613 (42%), Gaps = 54/613 (8%)

Query: 302   LVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRG 361
             ++ P     +P A W   D +L+     KM      A L  S   + D+G+YTL++ +R 
Sbjct: 13414 ILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENR- 13472

Query: 362   GVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDR 421
              V   S      + D  V   P AP +L+  D  +D V +TW+PP+    SP+ GY V++
Sbjct: 13473 -VKTISG-----EIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEK 13526

Query: 422   CEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPL 481
              EV    W +  D  V   ++ V  L +G+ Y+F+V A N  G   P+ V + V    P 
Sbjct: 13527 REVSRKTWTKVMDF-VTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTP- 13584

Query: 482   DLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDP 541
                                       A VP PP  V   + + N + L+W+PP   G   
Sbjct: 13585 --------------------------ATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSR 13618

Query: 542   LM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEIT 600
             +  Y +E+   GS  W  V     V   +  V  L EGK Y +RV + NR G S+PS  T
Sbjct: 13619 IKGYIVERCPRGSDKW--VACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPT 13676

Query: 601   SPIQAQDVTVVPS--APGRVLASRNTKTSVVVQWDRP---KHEEDLLGYYVDCCVAGTNL 655
               IQA D    P      ++LA    K    ++       K E  +     D  +     
Sbjct: 13677 EEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKR 13736

Query: 656   WEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPY 715
                 N         V    +    YI  ++AVN  G +    E +V      L  P  P 
Sbjct: 13737 ITIENVPKKSTVTIVDSKRSDTGTYI--IEAVNVCGRATAVVEVNV------LDKPGPPA 13788

Query: 716   GITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGL 775
                + +    S  L W  P+  GGS I  Y +++R    + WH++ SS  K T      L
Sbjct: 13789 AFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKL-SSTVKDTNFKATKL 13847

Query: 776   TEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKA 835
                  Y F++AA N+ G+GEP   S       +    PGP   L   ++   ++ + W  
Sbjct: 13848 IPNKEYIFRVAAENMYGVGEPVQASP--ITAKYQFDPPGPPTRLEPSDITKDAVTLTWCE 13905

Query: 836   PVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGV 895
             P   G SP++GY+V+  + D  +W+  N+    +   +V  L   K Y FRV A N  G 
Sbjct: 13906 PDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGP 13965

Query: 896   GKPSDTSEPVLVE 908
             GKPS ++EP+L++
Sbjct: 13966 GKPSKSTEPILIK 13978



 Score =  207 bits (526), Expect = 8e-53
 Identities = 199/842 (23%), Positives = 329/842 (39%), Gaps = 127/842 (15%)

Query: 177   VQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHG 236
             ++G P P V W KDG  + + A   +  I+S     TL +      D   Y    +N  G
Sbjct: 24731 IRGKPIPDVVWSKDGKELEETA--ARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGG 24788

Query: 237   QVSTNAAVVVRRFRGDEE-PFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETV 295
               S    V V    G  E P +  G+                                  
Sbjct: 24789 TKSIPITVKVLDRPGPPEGPLKVTGV---------------------------------T 24815

Query: 296   TLKCTMLVTPDLKRVQPRAEWYRDDVLLKES----KWTKMFFGEGQASLSFSHLHKDDEG 351
               KC +   P L+        Y   ++ K       WT++       +   + L   +E 
Sbjct: 24816 AEKCYLAWNPPLQDGGANISHY---IIEKRETSRLSWTQVSTEVQALNYKVTKLLPGNEY 24872

Query: 352   LYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTE 411
             ++ +  V++ G+ +      V   +P     PG P   +     +D ++VTW  P     
Sbjct: 24873 IFRVMAVNKYGIGEPLESGPVTACNPYKP--PGPPSTPEVSAITKDSMVVTWARPVDDGG 24930

Query: 412   SPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRV 471
             + + GY +++ +     W +CN   +   +  VTGL EG SY FRV A N+AG+  PS  
Sbjct: 24931 TEIEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEP 24990

Query: 472   SDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSW 531
             S    A D                  A+Y          PGPP+    ++ SR+ V L+W
Sbjct: 24991 SVFYRACD------------------ALYP---------PGPPSNPKVTDTSRSSVSLAW 25023

Query: 532   EPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANR 590
               P   G  P+  Y +E     +  W      T ++  ++ V  L E   Y FR+ + N 
Sbjct: 25024 SKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINS 25083

Query: 591   HGLSEPSEITSPIQAQD----------------VTVVPSAPGRVLASRNTKTSVVVQWDR 634
              G+ EP+ +   + AQ+                V +  SA  R+  +   +    V+W++
Sbjct: 25084 EGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEK 25143

Query: 635   PKHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSE 694
                 E +L       V  +            +   V+  +T  +   + +   N      
Sbjct: 25144 A---EGILTDRAQIEVTSS------------FTMLVIDNVTRFDSGRYNLTLEN------ 25182

Query: 695   NSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHH 754
             NS           L  PS P  +T+      S+TL W+ P   GG+ I  Y ++KRE   
Sbjct: 25183 NSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTR 25242

Query: 755   KNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPG 814
             K +  + ++ +K T   ++ L EG  Y F++ A N  GIG P++ +E  K     +P PG
Sbjct: 25243 KAYATITNNCTK-TTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEPPLP-PG 25300

Query: 815   PAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKV 874
                 +T  +V   +  + W+ P   G S ++GY V+ + + + +W T  Q  T      +
Sbjct: 25301 ---RVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLE--ATI 25355

Query: 875   SDLQQGKTYVFRVRAVNANGVGKPSDTSEPVL---VEARPGTK----EISAGVDEQGNIY 927
             S L  G+ YVFRV AVN  G   P     PV+   +E +P  +      +    EQ  I 
Sbjct: 25356 SGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKID 25415

Query: 928   LGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDT 987
             + F  +     +   W K  + + +  R  + +    + L +K   KED+GTY + VS++
Sbjct: 25416 VPFKGRPQATVN---WRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNS 25472

Query: 988   DG 989
              G
Sbjct: 25473 AG 25474



 Score =  206 bits (525), Expect = 1e-52
 Identities = 201/762 (26%), Positives = 307/762 (40%), Gaps = 95/762 (12%)

Query: 154   PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
             P + +   ++++     +K+   V G P P + W KDG  + Q     +  +E       
Sbjct: 24312 PSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTT---RVNVEETATSTV 24368

Query: 214   LEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPY 273
             L I   + DD   Y+  ATN+ G  + N +V+V      E+P    G P+G      + +
Sbjct: 24369 LHIKEGNKDDFGKYTVTATNSAGTATENLSVIVL-----EKP----GPPVG-----PVRF 24414

Query: 274   THFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFF 333
                   F     V    E    T  C +      KR      W+     +          
Sbjct: 24415 DEVSADF-----VVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATV---------- 24459

Query: 334   GEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPL-VTGAPGAPMDLQCH 392
                + ++  + L    E  + +   +R G S       V    P    G PG P      
Sbjct: 24460 --ARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGTPF---VT 24514

Query: 393   DANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRS 452
               ++D ++V W  P     + ++GY +++ E  +  WV+ N  P++  K+  TGL EG  
Sbjct: 24515 SISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLE 24574

Query: 453   YIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPG 512
             Y F+V A N  GI +PS+VS+   A DP D                              
Sbjct: 24575 YEFKVSAENIVGIGKPSKVSECFVARDPCD------------------------------ 24604

Query: 513   PPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYA 571
             PP    A  I+RN V L W+ P   G   +  Y +EK  +  G W + +  T V    + 
Sbjct: 24605 PPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASF-TNVLETEFT 24663

Query: 572   VFDLMEGKSYVFRVLSANRHG-LSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVV 630
             V  L+E + Y FRV++ N  G  SEPS+ +  I A+D      AP   L  +     VV 
Sbjct: 24664 VSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEI---DAPNASLDPKYKDVIVVH 24720

Query: 631   QWDRPKHEEDLLGYYVDCCV---AGTNLWEPCNH----KPIGYNRFVVHGL--TTGEQYI 681
               +    E D+ G  +   V    G  L E          I     VV     T G QYI
Sbjct: 24721 AGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYI 24780

Query: 682   FRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYG-ITLLNCDGHSMTLGWKVPKFSGGS 740
              ++  V          +S  I V+  L  P  P G + +         L W  P   GG+
Sbjct: 24781 LKLSNVGGT-------KSIPITVK-VLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGA 24832

Query: 741   PILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPS 800
              I  Y ++KRE    +W +V S+  +     V  L  G+ Y F++ AVN  GIGEP +  
Sbjct: 24833 NISHYIIEKRETSRLSWTQV-STEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESG 24891

Query: 801   EHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWI 860
                 C  +    PGP        +   S+V+ W  PV  G + + GY ++ R+++   W 
Sbjct: 24892 PVTACNPY--KPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWT 24949

Query: 861   TVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTS 902
               N+ T  +  L+V+ L +G +Y FRV A NA GVG+PS+ S
Sbjct: 24950 KCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPS 24991



 Score =  206 bits (525), Expect = 1e-52
 Identities = 205/865 (23%), Positives = 323/865 (37%), Gaps = 151/865 (17%)

Query: 170   SVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSA 229
             S+++   VQG P P V W+KDG    +  +     I    G  +L +  A  D    Y+ 
Sbjct: 27975 SLRIKALVQGRPVPRVTWFKDG---VEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTV 28031

Query: 230   VATNAHGQVSTNAAVVVRRFRGDEE-PFRSVGLP-------IGLPLSS-MIPYTHFDVQF 280
              A NA G       V V+   G    P R   +           PL+    P TH+ ++ 
Sbjct: 28032 EAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEK 28091

Query: 281   LEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASL 340
              E    T R     +  KC       +K +      +R   + K        FG G+   
Sbjct: 28092 RE----TSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNK--------FGVGRPL- 28138

Query: 341   SFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTG----APGAPMDLQCHDANR 396
                                              D+DP+V       P AP   +  +   
Sbjct: 28139 ---------------------------------DSDPVVAQIQYTVPDAPGIPEPSNITG 28165

Query: 397   DYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQC-NDAPVKICKYPVTGLFEGRSYIF 455
             + + +TW  P +   S +  Y ++R E  +  WV+  +  P+   ++ VTGL EG  Y F
Sbjct: 28166 NSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEF 28225

Query: 456   RVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPT 515
              V A N+AG+   S +S  +   +P++                            PGPPT
Sbjct: 28226 HVMAENAAGVGPASGISRLIKCREPVN---------------------------PPGPPT 28258

Query: 516   GVHASEISRNYVVLSWEPPT-PRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFD 574
              V  ++ S+  V L W  P    G + + Y IE      G W +VNA+  V++ RY V D
Sbjct: 28259 VVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKT-RYTVTD 28317

Query: 575   LMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPS----------------APGRV 618
             L  G+ Y FRV + N  G  +  E+T  I+A D    P                 A  R+
Sbjct: 28318 LQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRL 28377

Query: 619   LASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGE 678
               +   + +    W +P     L           T   E CN    G     V   +  +
Sbjct: 28378 FIAYQGRPTPTAVWSKPDSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSK 28437

Query: 679   QYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSG 738
                F VK                      L  P  P  IT  +    S TL W  P   G
Sbjct: 28438 SITFTVKV---------------------LDTPGPPGPITFKDVTRGSATLMWDAPLLDG 28476

Query: 739   GSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSD 798
             G+ I  Y ++KRE   ++W  ++   ++  I  V+ L EG  Y F+++AVN  G+GEP +
Sbjct: 28477 GARIHHYVVEKREASRRSWQVISEKCTRQ-IFKVNDLAEGVPYYFRVSAVNEYGVGEPYE 28535

Query: 799   PSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGE 858
               E          +P P   L   +   +S V+ W  P + G S ++GY ++ R++ +  
Sbjct: 28536 MPEPIVATE----QPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDF 28591

Query: 859   WITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISA 918
             W+    T        V  L +   Y FRV+A N  G  +P +    V+++      +I  
Sbjct: 28592 WVEAGHTKQLT--FTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKE----PQIEP 28645

Query: 919   GVDEQGNIYLGFDCQEMTD-----------ASQFTWCKSYEEISDDERFKIETVGDHSKL 967
               D  G       C+  +            A + TW      + + +R  I T  D + L
Sbjct: 28646 TADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTL 28705

Query: 968   YLKNPDKEDLGTYSVSVSDTDGVSS 992
              +K+  + D G Y +++ +T GV +
Sbjct: 28706 TVKDSMRGDSGRYFLTLENTAGVKT 28730



 Score =  206 bits (523), Expect = 2e-52
 Identities = 163/604 (26%), Positives = 252/604 (41%), Gaps = 58/604 (9%)

Query: 311   QPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFL 370
             +P+  W++D+  + E   T +       +L      + D G Y   +V          F 
Sbjct: 16847 KPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYC--VVVENSTGSRKGFC 16904

Query: 371   FVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWV 430
              V   D    G P  P+     +  +DY++++WKPP     S +  Y +++ EVG + W+
Sbjct: 16905 QVNVVDR--PGPPVGPVSFD--EVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWM 16960

Query: 431   QCNDAPVKI-CKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAV 489
                 A  K  CK  V+ L EG+ YIFR+ A N  GIS P  VSD++ A D          
Sbjct: 16961 PVTSASAKTTCK--VSKLLEGKDYIFRIHAENLYGISDPL-VSDSMKAKDRF-------- 17009

Query: 490   HLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKS 549
                                +VP  P     +E++++  +++W  P   GK    Y +EK 
Sbjct: 17010 -------------------RVPDAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKR 17050

Query: 550   VVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVT 609
                S  W RV         ++ V DL+EG  Y FRV + N  G+ +PS  + P+ A+D  
Sbjct: 17051 ETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPI 17110

Query: 610   VVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKP--IG 665
               PS P    A   T  SV + W  P+H+    +LGY V+    G   W   NH P    
Sbjct: 17111 AKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCP 17170

Query: 666   YNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGH 725
               ++ V GL  G+ Y FRV AVNA G S+ +   + + V+  L  P       +      
Sbjct: 17171 ETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHI 17230

Query: 726   SMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKI 785
              +    ++     G P       K +               PT   +D    GS  E + 
Sbjct: 17231 KVGDTLRLSAIIKGVPFPKVTWKKED------------RDAPTKARIDVTPVGSKLEIRN 17278

Query: 786   AAVNLAGI----GEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGS 841
             AA    GI     E    S+    +   + +PGP  DL   E+R  S  + WK P+  G 
Sbjct: 17279 AAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGG 17338

Query: 842   SPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDT 901
             S ++ Y V+ R+  + +W  ++ T+    +     L +G  Y+FRV A N  G G   +T
Sbjct: 17339 SVITNYVVERRDVASAQWSPLSATSKKKSHF-AKHLNEGNQYLFRVAAENQYGRGPFVET 17397

Query: 902   SEPV 905
              +P+
Sbjct: 17398 PKPI 17401



 Score =  204 bits (520), Expect = 4e-52
 Identities = 208/851 (24%), Positives = 344/851 (40%), Gaps = 108/851 (12%)

Query: 171   VKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLE------INRADFDDT 224
             +++   ++G PTP   W  DG    +A + G + I  +  + T E      I       T
Sbjct: 15828 IRIPAVIKGRPTPKSSWEFDGKAK-KAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHT 15886

Query: 225   ATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKF 284
               YS  A N  GQ + N  V V    G  +  +   +  G                    
Sbjct: 15887 GKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRG-------------------- 15926

Query: 285   GVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSH 344
                      +  L   M   PD         +  +   +    WTK+    G  +     
Sbjct: 15927 ---------SCRLSWKM---PDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPD 15974

Query: 345   LHKDDEGLYTLRIVSRGGVSDHSAFLFVRDA-DPLVTGAPGAPMDLQCHDANRDYVIVTW 403
             L  + +  + +R  +R G+      +    A DP+    P  P+ L+     ++ V ++W
Sbjct: 15975 LLSEQQYFFRVRAENRFGIGPPVETIQRTTARDPIYP--PDPPIKLKIGLITKNTVHLSW 16032

Query: 404   KPPNTTTESPVMGYFVDRCE---VGTNN--WVQCNDAPVKICKYPVTGLFEGRSYIFRVR 458
             KPP     SPV  Y V+       GT    W QCN   V+  ++ V  L EG  Y FRV+
Sbjct: 16033 KPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVK 16092

Query: 459   AVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGD--AQVPGPPTG 516
             AVN+AG+S+PS      A + P D +R         KE    ++    +  A++ G P  
Sbjct: 16093 AVNAAGVSKPS------ATVGPCDCQRPDMPPSIDLKEFMEVEEGTNVNIVAKIKGVP-- 16144

Query: 517   VHASEISRNYVVLSW---EPPTPRGKDPLMY--FIEKSVVGSGSWQRVNAQTAVRSPRYA 571
                      +  L+W    P  P  K+P++Y   + K VV       +       +  Y 
Sbjct: 16145 ---------FPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYT 16195

Query: 572   VFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQ 631
             +   +       + +  N   L  P     PI+ + V+                  + + 
Sbjct: 16196 I-TAVNNLGTASKEMRLNV--LGRPGPPVGPIKFESVSA---------------DQMTLS 16237

Query: 632   WDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNA 689
             W  PK +    +  Y ++   A    W   + +P     + +  L  G +Y+FR+ A N 
Sbjct: 16238 WFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECT-YTIPKLLEGHEYVFRIMAQNK 16296

Query: 690   VGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDK 749
              G+ E   +S+    +   +VP  P   T+ +   +SMT+ W+ P++ GGSP+ GY+L+ 
Sbjct: 16297 YGIGE-PLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEM 16355

Query: 750   REVHHKNWHEVNSSPSKPTIL----TVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
             ++   K W  VN  P K   L     V GL EGS Y+F++ A+N AG+G  S PS+    
Sbjct: 16356 KDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATA 16415

Query: 806   EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQT 865
                  P PGP +     +   +S  + W  P+  G S V+GY V+++EE   EW      
Sbjct: 16416 RDPIAP-PGPPFP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDK 16473

Query: 866   TTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEAR--PGTKEISAGVDEQ 923
                   L V+ L++G  Y FRVRAVN  G+G+P + ++ + ++ R      ++ A V ++
Sbjct: 16474 EVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDR 16533

Query: 924   GNIYLGFDCQEMTDAS-----QFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLG 978
               ++ G   + +   S       TW  +  E +  +   IET    S + +KN  +   G
Sbjct: 16534 IVVHAGGVIRIIAYVSGKPPPTVTW--NMNERTLPQEATIETTAISSSMVIKNCQRSHQG 16591

Query: 979   TYSVSVSDTDG 989
              YS+   +  G
Sbjct: 16592 VYSLLAKNEAG 16602



 Score =  203 bits (516), Expect = 1e-51
 Identities = 211/854 (24%), Positives = 339/854 (39%), Gaps = 152/854 (17%)

Query: 177   VQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFD-----------DTA 225
             V G P P ++W KDG  +               G   LEI  ADF            D+ 
Sbjct: 21485 VSGRPPPTMEWSKDGKEL--------------EGTAKLEIKIADFSTNLVNKDSTRRDSG 21530

Query: 226   TYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFG 285
              Y+  ATN  G       V V    G  E           PL+                 
Sbjct: 21531 AYTLTATNPGGFAKHIFNVKVLDRPGPPEG----------PLA----------------- 21563

Query: 286   VTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESK---WTKMFFGEGQASLSF 342
             VT     E  + KC +   P L     + + Y   V  +E+    WT +        L  
Sbjct: 21564 VT-----EVTSEKCVLSWFPPLDDGGAKIDHYI--VQKRETSRLAWTNVASEVQVTKLKV 21616

Query: 343   SHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVT 402
             + L K +E ++ +  V++ GV +      V   +P   G P  P + +     +D ++V 
Sbjct: 21617 TKLLKGNEYIFRVMAVNKYGVGEPLESEPVLAVNPY--GPPDPPKNPEVTTITKDSMVVC 21674

Query: 403   WKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNS 462
             W  P++   S ++ Y V+R +     W++CN   +   +Y V+GL EG  Y FR+ A N+
Sbjct: 21675 WGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENA 21734

Query: 463   AGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEI 522
             AGIS PS  S    A D                   +++         PGPP      + 
Sbjct: 21735 AGISAPSPTSPFYKACD------------------TVFK---------PGPPGNPRVLDT 21767

Query: 523   SRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSY 581
             SR+ + ++W  P   G   +  Y +E ++     WQ V     +++  Y +  L E + Y
Sbjct: 21768 SRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEY 21827

Query: 582   VFRVLSANRHGLSEPSEITSPIQAQD----------------VTVVPSAPGRVLASRNTK 625
               R+ + N  GL EP+ +    +A+D                VT+      R+      +
Sbjct: 21828 KIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGR 21887

Query: 626   TSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVK 685
              +  V+W R  H E L    ++   + T L           NRF         +YI  V+
Sbjct: 21888 PAPEVKWARD-HGESLDKASIESTSSYTLLIVG------NVNRF------DSGKYILTVE 21934

Query: 686   AVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGY 745
                    + +  +S  + V+  L  P  P  + +      S+TL W  P   GGS I  Y
Sbjct: 21935 -------NSSGSKSAFVNVRV-LDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNY 21986

Query: 746   YLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
              ++KRE   K +  V ++  K T   VD L EG  Y F++ A N  GIG P++ +E  K 
Sbjct: 21987 IVEKRESTRKAYSTVATNCHK-TSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKA 22045

Query: 806   EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQT 865
                 +P PG    +T  +V   S+ + W+ P + G S + GY V+ + + + +W T    
Sbjct: 22046 SERPLP-PGK---ITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATC--A 22099

Query: 866   TTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARP---------GTKEI 916
             T       ++ L QG+ Y FRV A N  G+  P   S PV+ +             T  +
Sbjct: 22100 TVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTV 22159

Query: 917   SAGVDEQGNI-YLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKE 975
              AG D + ++ ++G            TW K    +    R   E+  ++S L +K+  +E
Sbjct: 22160 LAGEDLKVDVPFIG------RPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACRE 22213

Query: 976   DLGTYSVSVSDTDG 989
             D+G Y V ++++ G
Sbjct: 22214 DVGHYVVKLTNSAG 22227



 Score =  200 bits (508), Expect = 1e-50
 Identities = 212/862 (24%), Positives = 330/862 (38%), Gaps = 118/862 (13%)

Query: 165   VWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVH----TLEINRAD 220
             V E  +V +   ++G P P + W+K         EP  Y    N  V     TL I ++ 
Sbjct: 16128 VEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSR 16187

Query: 221   FDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQF 280
               DT  Y+  A N  G  S    + V             G P+G P+        F+   
Sbjct: 16188 RSDTGLYTITAVNNLGTASKEMRLNV---------LGRPGPPVG-PIK-------FESVS 16230

Query: 281   LEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASL 340
              ++  +++    +    K T  V    KR   R  W       KE  +T     EG    
Sbjct: 16231 ADQMTLSWFPPKDDGGSKITNYVIE--KREANRKTWVHVSSEPKECTYTIPKLLEGHE-- 16286

Query: 341   SFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVI 400
                         Y  RI+++             +    +   PGAP         R+ + 
Sbjct: 16287 ------------YVFRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMT 16334

Query: 401   VTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKIC----KYPVTGLFEGRSYIFR 456
             V W+ P     SPV GY+++  +  +  W + N  P+K       Y VTGL EG  Y FR
Sbjct: 16335 VNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFR 16394

Query: 457   VRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTG 516
             V A+N+AG+   S  SD   A DP+                             PGPP  
Sbjct: 16395 VYAINAAGVGPASLPSDPATARDPI---------------------------APPGPPFP 16427

Query: 517   VHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDL 575
                ++ +++   L W PP   G   +  Y +E    G   W++      VR  +  V  L
Sbjct: 16428 -KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEK-GKDKEVRGTKLVVTGL 16485

Query: 576   MEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPS--------------APG--RVL 619
              EG  Y FRV + N  G+ EP E+T  I+ +D  V P               A G  R++
Sbjct: 16486 KEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRII 16545

Query: 620   ASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQ 679
             A  + K    V W+  +             ++ + + + C                   Q
Sbjct: 16546 AYVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVIKNCQRS---------------HQ 16590

Query: 680   YIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGG 739
              ++ + A N  G  + +   DV+ V   +  P   + +T  +C      L W  P+  GG
Sbjct: 16591 GVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCK-----LTWFSPEDDGG 16645

Query: 740   SPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDP 799
             SPI  Y ++KRE   + W  V  + ++    TV GL +G  Y F+IAA N  G+G   + 
Sbjct: 16646 SPITNYVIEKRESDRRAWTPVTYTVTRQNA-TVQGLIQGKAYFFRIAAENSIGMGPFVET 16704

Query: 800   SEHFKC-EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGE 858
             SE     E  T+PE     DL   EV   ++ + W  P Y G S +  Y ++ R     +
Sbjct: 16705 SEALVIREPITVPERPE--DLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEK 16762

Query: 859   WITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISA 918
             +  V      +R   V  L++G TY +RV AVN  G GKPS  ++P+  +       +  
Sbjct: 16763 FHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHL 16822

Query: 919   GVDEQGNIYLGFDCQEMTDA------SQFTWCKSYEEISDDERFKIETVGDHSKLYLKNP 972
                ++  I +G +   +T         + +W K   ++ +D+R  I+T      L     
Sbjct: 16823 DFRDKLTIRVG-EAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKA 16881

Query: 973   DKEDLGTYSVSVSDTDGVSSSF 994
              + D G Y V V ++ G    F
Sbjct: 16882 KRSDSGKYCVVVENSTGSRKGF 16903



 Score =  199 bits (506), Expect = 2e-50
 Identities = 202/839 (24%), Positives = 329/839 (39%), Gaps = 101/839 (12%)

Query: 170   SVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSA 229
             +V+    ++G P P  +W  DGS I        Y +E++     L I      DT  Y  
Sbjct: 17527 TVRFPAIIRGVPVPTAKWTTDGSEI---KTDEHYTVETDNFSSVLTIKNCLRRDTGEYQI 17583

Query: 230   VATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFR 289
               +NA G  +    + V    G          P G       P    DV           
Sbjct: 17584 TVSNAAGSKTVAVHLTVLDVPGP---------PTG-------PINILDVT---------- 17617

Query: 290   REGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDD 349
              E  T++ +      P      P   +  +    ++  W  +  G  +  L   HL K  
Sbjct: 17618 PEHMTISWQ-----PPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGC 17672

Query: 350   EGLYTLRIVSRGGVSDHSAFLFVRDADPLVT----GAPGAPMDLQCHDANRDYVIVTWKP 405
             E ++ +R  ++ GV          D+ P V       P  P      D   +   V+W  
Sbjct: 17673 EYVFRVRAENKIGVGPPL------DSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTL 17726

Query: 406   PNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGI 465
             P +   SP+ GY+++R EV T  WV+ N  P+   K+ VTGL+EG +Y FRV A N AG+
Sbjct: 17727 PKSDGGSPITGYYMERREV-TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGL 17785

Query: 466   SRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRN 525
             S+PS  SD + A  P+                           + PGPP      + SR 
Sbjct: 17786 SKPSPSSDPIKACRPI---------------------------KPPGPPINPKLKDKSRE 17818

Query: 526   YVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFR 584
                L W  P   G  P++ Y +E    G+  W R+N    +R   + V  L+EG  Y FR
Sbjct: 17819 TADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFR 17878

Query: 585   VLSANRHGLSEPSEITSPIQAQDVTVVPSAP-----GRVLASRNTKTSVVVQWDRPKHEE 639
             + +AN  G  EP E+   + A+D+   P          V+  R  +T  ++   + + E 
Sbjct: 17879 IKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEP 17938

Query: 640   DLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQES 699
             D+        +      +     P    +          +YI     ++A   S ++Q S
Sbjct: 17939 DITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYI-----ISAKNSSGHAQGS 17993

Query: 700   DVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHE 759
              ++ V   L  P     + + N    + T+ W+ P  +GGS I  + ++ R+ + K W  
Sbjct: 17994 AIVNV---LDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSI 18050

Query: 760   VNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDL 819
             V S  +K  I     L   + Y F++ A N  G+G P+  ++        +  PG   +L
Sbjct: 18051 VASDVTKRLIKA--NLLANNEYYFRVCAENKVGVG-PTIETKTPILAINPIDRPGEPENL 18107

Query: 820   TFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQ 879
                +   T + + W+ P Y G SP   Y V+ R + + +W  V++ +    +  V    +
Sbjct: 18108 HIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVE 18167

Query: 880   GKTYVFRVRAVNANG---------VGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGF 930
              + Y FRV+  N  G         V    D  +PVL     G   + AG  +   +  G 
Sbjct: 18168 NQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAG--DTIRLEAGV 18225

Query: 931   DCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
               +   + + +T  K   +++   R KI+T  D SK  L    + D G Y V+ ++T G
Sbjct: 18226 RGKPFPEVA-WTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAG 18283



 Score =  198 bits (503), Expect = 4e-50
 Identities = 178/670 (26%), Positives = 280/670 (41%), Gaps = 68/670 (10%)

Query: 254   EPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPR 313
             EP  S G PI +      P    DV+F +   V   + GE + +   +   P      P 
Sbjct: 25770 EPSESTG-PIIVKDDVEPPRVMMDVKFRDVIVV---KAGEVLKINADIAGRP-----LPV 25820

Query: 314   AEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVR 373
               W +D + ++E   T++   +    L+     + D G Y L + +  G    +    V 
Sbjct: 25821 ISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVL 25880

Query: 374   DADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCN 433
             D      G P  P+++    A +    ++W  P     + +  Y V++ E     W  C 
Sbjct: 25881 DK----PGPPAGPLEINGLTAEK--CSLSWGRPQEDGGADIDYYIVEKRETSHLAWTIC- 25933

Query: 434   DAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEG 493
             +  +++    VT L +G  YIFRV  VN  G+  P   S A+ ALDP             
Sbjct: 25934 EGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLE-SVAIKALDPF------------ 25980

Query: 494   EKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVG 552
                             VP PPT +  + +++  + L W  P   G   +  Y IE+    
Sbjct: 25981 ---------------TVPSPPTSLEITSVTKESMTLCWSRPESDGGSEISGYIIERREKN 26025

Query: 553   SGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVP 612
             S  W RVN +  V   R     L EG  Y +RV + N  GLS PSE +  I+A+D   +P
Sbjct: 26026 SLRWVRVN-KKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLP 26084

Query: 613   SAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFV 670
             S P +     + KT++ + W +P  +    + GY V+   +    W+       G   + 
Sbjct: 26085 SPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTSIQSLRG-TEYT 26143

Query: 671   VHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVP----SHPYGITLLNCDGHS 726
             + GLTTG +Y+FRVK+VN VG S+ S  SD    +     P          TL+   G S
Sbjct: 26144 ISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGAS 26203

Query: 727   MTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIA 786
              T+   VP    G P+      K +   +    V+++ S+ T LT++        ++ + 
Sbjct: 26204 FTM--TVP--FRGRPVPNVLWSKPDTDLRTRAYVDTTDSR-TSLTIENANRNDSGKYTLT 26258

Query: 787   AVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSG 846
               N+         +         +  PGP  ++T  +V   S V+ W  P   G +PV  
Sbjct: 26259 IQNVLS-------AASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKN 26311

Query: 847   YFVDFREEDAGEWITVNQTTTANRY-LKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPV 905
             Y ++ RE     W++V  T   NR   KV++LQ+G  Y FRV   N  GVG P++T E V
Sbjct: 26312 YHIEKREASKKAWVSV--TNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGV 26369

Query: 906   LVEARPGTKE 915
              +  +P   E
Sbjct: 26370 KITEKPSPPE 26379



 Score =  196 bits (497), Expect = 2e-49
 Identities = 206/843 (24%), Positives = 341/843 (40%), Gaps = 125/843 (14%)

Query: 170   SVKLCFTVQGFPTPVVQWYKD------GSLICQAAEPGKYRIESNYGVHTLEINRADFDD 223
             SVKL   + G P P ++WYKD       +L+C         +E+   + ++ I  AD  +
Sbjct: 26889 SVKLRAGISGKPAPTIEWYKDDKELQTNALVC---------VENTTDLASILIKDADRLN 26939

Query: 224   TATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEK 283
             +  Y     NA G  S    V +    G          P G P+        F     EK
Sbjct: 26940 SGCYELKLRNAMGSASATIRVQILDKPG----------PPGGPIE-------FKTVTAEK 26982

Query: 284   FGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFS 343
               + +R   +    K T  +    KR   R  W      L+E              ++ +
Sbjct: 26983 ITLLWRPPADDGGAKITHYIVE--KRETSRVVWSMVSEHLEE------------CIITTT 27028

Query: 344   HLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVT-GAPGAPMDLQCHDANRDYVIVT 402
              + K +E ++ +R V++ G+ +      V   +  VT G PG P   +     ++ + V 
Sbjct: 27029 KIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIP---EVTKITKNSMTVV 27085

Query: 403   WKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNS 462
             W  P     S + GYF+++ +  +  W +     ++  +  VTGL E   Y +RV AVN+
Sbjct: 27086 WSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNA 27145

Query: 463   AGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEI 522
             AG    S  S+   A DP+D                            PGPP  +  ++ 
Sbjct: 27146 AGQGPFSEPSEFYKAADPID---------------------------PPGPPAKIRIADS 27178

Query: 523   SRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSY 581
             +++ + L W  P   G   +  Y +E        W  V+ +  VR+  Y V +L  G +Y
Sbjct: 27179 TKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNY 27238

Query: 582   VFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAP------GRVLASRNTKTSVVVQWD-R 634
              FRV + N  G  EP E+  P+QA+D+   P           V+A       V++ +  R
Sbjct: 27239 YFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGR 27298

Query: 635   P------KHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVN 688
             P      + +E  LG      +  T+         +  N        TG+ YI  ++  N
Sbjct: 27299 PPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRN-------DTGK-YILTIE--N 27348

Query: 689   AVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLD 748
              VG  ++S  S  +KV   L  P+    + + +    ++TL W  P   GGSPI+ Y ++
Sbjct: 27349 GVGEPKSSTVS--VKV---LDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIE 27403

Query: 749   KREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAW 808
             KR+   + W  V+   S  +   +D L+E + + F++ A N  GIGEP + +E  K    
Sbjct: 27404 KRDATKRTWSVVSHKCSSTSFKLID-LSEKTPFFFRVLAENEIGIGEPCETTEPVKAAE- 27461

Query: 809   TMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTA 868
                 P P  DL+  +   TS+++ W  P + G S ++ Y V+ + +    W     + T 
Sbjct: 27462 ---VPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGISKTC 27518

Query: 869   NRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISAGVDEQG---- 924
                ++VS L++     FRV A N  G+  P  T  P+ V+    T E+    D  G    
Sbjct: 27519 E--IEVSQLKEQSVLEFRVFAKNEKGLSDPV-TIGPITVKELIITPEVDLS-DIPGAQVT 27574

Query: 925   -----NIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGT 979
                  N++L    +     S  +W K    + + E  +     +   L +KN  KE  G 
Sbjct: 27575 VRIGHNVHLELPYKGKPKPS-ISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGK 27633

Query: 980   YSV 982
             Y+V
Sbjct: 27634 YTV 27636



 Score =  194 bits (493), Expect = 5e-49
 Identities = 199/802 (24%), Positives = 323/802 (40%), Gaps = 126/802 (15%)

Query: 302   LVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRG 361
             L  P   R  P  +W + D  ++++    +       SL   ++++ D G YTL + +  
Sbjct: 22962 LFVPIKGRPTPEVKWGKVDGEIRDAAIIDVT--SSFTSLVLDNVNRYDSGKYTLTLENSS 23019

Query: 362   GVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDR 421
             G    SAF+ VR  D      P  P++L+  +  +D V +TW+PP     S +  Y V++
Sbjct: 23020 GTK--SAFVTVRVLD-----TPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEK 23072

Query: 422   CEVGTNNWVQCNDAPVKIC---KYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAAL 478
              E    ++     A V  C    + +  L EG SY FRV A N  GI  P++ +D +   
Sbjct: 23073 REATRKSYA----AVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKV- 23127

Query: 479   DPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRG 538
                                          A+VP PP  +   +++RN V LSW  P   G
Sbjct: 23128 -----------------------------AEVPQPPGKITVDDVTRNSVSLSWTKPEHDG 23158

Query: 539   KDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPS 597
                ++ Y +E     S  W        V+S +  + +L +G+ Y+FRV++ N  G S+P 
Sbjct: 23159 GSKIIQYIVEMQAKHSEKWSEC---ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPR 23215

Query: 598   EITSPIQAQDVTVVPS-----APGRVLASRNTKTSVVVQWDRPKHE----------EDLL 642
              +  PI A+D+ + P      +   V   ++ K  V +   RPK            +   
Sbjct: 23216 SLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPIS-GRPKPTITWTKDGLPLKQTT 23274

Query: 643   GYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVI 702
                V   +  T L     HK              G QY   +   N VG    S E    
Sbjct: 23275 RINVTDSLDLTTLSIKETHK------------DDGGQY--GITVANVVGQKTASIEI--- 23317

Query: 703   KVQAALTVPSHPYG-ITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVN 761
                  L  P  P G +   +    S+TL W  P ++GG  I  Y + KR+     W  V+
Sbjct: 23318 ---VTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVS 23374

Query: 762   SSPSKPTILTVDGLTEGSLYEFKIAAVNLAG--IGEPSDPSEHFKCEAWTMPEPGPAYDL 819
             ++ ++ T L V  L  G+ Y+F+I A N  G      SDP        +   EPGP    
Sbjct: 23375 ATVAR-TTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPI----VAQYPYKEPGPPGTP 23429

Query: 820   TFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQ 879
                 +   S+V+ W  PV +G SPV GY ++ +E ++  W  VN+T   +   K  +L++
Sbjct: 23430 FATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEE 23489

Query: 880   GKTYVFRVRAVNANGVGK---------------PSDTSEPVLVEARPGTKEISAGVDEQG 924
             G  Y FRV A N  GVGK               P  T EP++V+    T + +  V + G
Sbjct: 23490 GIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEPIMVKRNEITLQWTKPVYDGG 23549

Query: 925   NIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSV 984
             ++  G+   E  D     W K+      + +F +  + +  +   +   K   G  S   
Sbjct: 23550 SMITGY-IVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPS 23608

Query: 985   SDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAE-HLSP 1043
               T  +++                +E++ P I +  +    I       F L+A+ H  P
Sbjct: 23609 DSTGPITA---------------KDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKP 23653

Query: 1044  DASYRFIINDREVSDSEIHRIK 1065
               +  ++  D+E+ +S    IK
Sbjct: 23654 LPTIEWLRGDKEIEESARCEIK 23675



 Score =  193 bits (490), Expect = 1e-48
 Identities = 206/864 (23%), Positives = 336/864 (38%), Gaps = 147/864 (17%)

Query: 171   VKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAV 230
             +K+   + G P PV+ W KDG    +  E  +  I S      L +      DT  Y   
Sbjct: 25807 LKINADIAGRPLPVISWAKDG---IEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLT 25863

Query: 231   ATNAHG--QVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTF 288
               N  G   V+ N  V+       ++P    G P G                LE  G+T 
Sbjct: 25864 LKNVAGTRSVAVNCKVL-------DKP----GPPAGP---------------LEINGLTA 25897

Query: 289   RREGETVTLKCTMLVTPDLKRVQPRAEWYRD-DVLLKESK------WTKMFFGEGQ-ASL 340
                      KC+      L   +P+ +   D D  + E +      WT +  GE Q  S 
Sbjct: 25898 E--------KCS------LSWGRPQEDGGADIDYYIVEKRETSHLAWT-ICEGELQMTSC 25942

Query: 341   SFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVI 400
               + L K +E ++ +  V++ GV +    + ++  DP    +P  P  L+     ++ + 
Sbjct: 25943 KVTKLLKGNEYIFRVTGVNKYGVGEPLESVAIKALDPFTVPSP--PTSLEITSVTKESMT 26000

Query: 401   VTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAV 460
             + W  P +   S + GY ++R E  +  WV+ N  PV   +   TGL EG  Y +RV A 
Sbjct: 26001 LCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAE 26060

Query: 461   NSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHAS 520
             N+AG+S PS  S  + A DP+ L                           P PP+     
Sbjct: 26061 NAAGLSLPSETSPLIRAEDPVFL---------------------------PSPPSKPKIV 26093

Query: 521   EISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGK 579
             +  +  + ++W  P   G  P+  Y +E        W+   +  ++R   Y +  L  G 
Sbjct: 26094 DSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWK--TSIQSLRGTEYTISGLTTGA 26151

Query: 580   SYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV---------- 629
              YVFRV S N+ G S+PS+ + P  A++    P      + S   KT +V          
Sbjct: 26152 EYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFD---IDSEMRKTLIVKAGASFTMTV 26208

Query: 630   ---------VQWDRPKHEEDL-LGYYVDCCVAGTNLW-EPCNHKPIGYNRFVVHGLTTGE 678
                      V W +P  + DL    YVD   + T+L  E  N    G     +  + +  
Sbjct: 26209 PFRGRPVPNVLWSKP--DTDLRTRAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAA 26266

Query: 679   QYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSG 738
                  VK                      L  P  P  IT+ +    S  L W VP+  G
Sbjct: 26267 SLTLVVK---------------------VLDTPGPPTNITVQDVTKESAVLSWDVPENDG 26305

Query: 739   GSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSD 798
             G+P+  Y+++KRE   K W  V ++ ++ +   V  L EG++Y F+++  N  G+G P++
Sbjct: 26306 GAPVKNYHIEKREASKKAWVSVTNNCNRLS-YKVTNLQEGAIYYFRVSGENEFGVGIPAE 26364

Query: 799   PSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGE 858
               E  K       +P P   L    +   S+ + W  P + G S +  Y V+  E+    
Sbjct: 26365 TKEGVK----ITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKN 26420

Query: 859   WITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISA 918
             W  V      + +  VS L++   Y FRV A N  G+  P +   PVL++ +    EI  
Sbjct: 26421 W--VKCAVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDM 26478

Query: 919   GVDEQGNIYLGFDCQEMTD-------ASQFTWCKSYEEISDDERFKIETVGDHSKLYLKN 971
                    +Y+        D         + T  +    +    RF  E   ++  + LK 
Sbjct: 26479 KNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKE 26538

Query: 972   PDKEDLGTYSVSVSDTDGVSSSFV 995
                 D G Y ++ +++ G + +F+
Sbjct: 26539 SVTADAGRYEITAANSSGTTKAFI 26562



 Score =  192 bits (489), Expect = 2e-48
 Identities = 159/642 (24%), Positives = 274/642 (42%), Gaps = 79/642 (12%)

Query: 379   VTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVK 438
             +T  P  P  L     ++D V +TW  P     S ++ Y V+  E G  NWV+C  A  K
Sbjct: 26371 ITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKC--AVAK 26428

Query: 439   ICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIA 498
                + V+GL E   Y FRV A N AG+S P  +   V   + L+   +   +        
Sbjct: 26429 STHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYV 26488

Query: 499   IYQDDLEGDAQVPGPPTGVHASEISRNYVVL--SWEPPTPRGKDPLMYFIEKSVVGSGSW 556
                 +L+ D  + G P  +    +SR+ V L  +    T    + L   +++SV      
Sbjct: 26489 RAGSNLKVDIPISGKP--LPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGR 26546

Query: 557   QRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPG 616
               + A  +  +           K+++  V+      L  P   T P+   D+T       
Sbjct: 26547 YEITAANSSGTT----------KAFINIVV------LDRPGPPTGPVVISDIT------- 26583

Query: 617   RVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGL 674
                     + SV ++W+ PK++    +  Y +      T +W   +   +      V  L
Sbjct: 26584 --------EESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVS-ATVARTMMKVMKL 26634

Query: 675   TTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVP 734
             TTGE+Y FR+KA N  G+S++  +S  + V+   T P  P    + N    S+T+GW  P
Sbjct: 26635 TTGEEYQFRIKAENRFGISDHI-DSACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEP 26693

Query: 735   KFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIG 794
               +GGS ++GY+L+ ++ +   W + N    + T   V  ++ G +YEF++ A N AG+G
Sbjct: 26694 VSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVG 26753

Query: 795   EPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREE 854
             +PS PSE        +    P  ++   ++   S+ + W+ P + G S ++GY V+ R+ 
Sbjct: 26754 KPSHPSE----PVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDL 26809

Query: 855   DAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANG-VGKPSDTSEPV-------- 905
               G W   + T        +S L Q   Y FRV A NA G +  PS+   P+        
Sbjct: 26810 PDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGG 26869

Query: 906   -----------LVEARPGTK-EISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDD 953
                        +V+ R GT  ++ AG+  +              A    W K  +E+  +
Sbjct: 26870 PVIDLPLEYTEVVKYRAGTSVKLRAGISGK-------------PAPTIEWYKDDKELQTN 26916

Query: 954   ERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
                 +E   D + + +K+ D+ + G Y + + +  G +S+ +
Sbjct: 26917 ALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATI 26958



 Score =  191 bits (485), Expect = 4e-48
 Identities = 214/857 (24%), Positives = 337/857 (39%), Gaps = 113/857 (13%)

Query: 177   VQGFPTPVVQWYKDGSLI---CQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATN 233
             V G P P ++W K+ ++I     A +  K  +  +     L I +A  +D  TY+  A+N
Sbjct: 15422 VTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASN 15481

Query: 234   AHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGE 293
               G V  N  V         E +     P  L ++        D++  E   +T+    +
Sbjct: 15482 RLGSVFRNVHV---------EVYDRPSPPRNLAVT--------DIK-AESCYLTWDAPLD 15523

Query: 294   TVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLY 353
                 + T  V       + +AEW        E ++                L  + +  +
Sbjct: 15524 NGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKRY------------GIWKLIPNGQYEF 15571

Query: 354   TLRIVSRGGVSDHSAFLFVRDADPL-VTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTES 412
              +R V++ G+SD      V   DP  + G PG P  L      +  ++V+W PP     S
Sbjct: 15572 RVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLA---RTKGSMLVSWTPPLDNGGS 15628

Query: 413   PVMGYFVDRCEVGTNNWVQCNDAPV-----KICKYPVTGLFEGRSYIFRVRAVNSAGISR 467
             P+ GY++++ E G+  W + + AP+     K  ++ V  L EG  Y FR  A+N+AGI  
Sbjct: 15629 PITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGP 15688

Query: 468   PSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYV 527
             PS  SD   A DP+                             PGPP+     + +++ +
Sbjct: 15689 PSEPSDPEVAGDPIF---------------------------PPGPPSCPEVKDKTKSSI 15721

Query: 528   VLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNA-QTAVRSPRYAVFDLMEGKSYVFRV 585
              L W+PP   G  P+  Y +E    G+  W+RVN     + +    V +L E + Y FRV
Sbjct: 15722 SLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCECVVPNLKELRKYRFRV 15781

Query: 586   LSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLA---------SRNTKTSVVVQWDRPK 636
              + N  G SEPS+ T  I A D+   P     + A         S+    +V+     PK
Sbjct: 15782 KAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPK 15841

Query: 637   HEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVV-----HGLTTGEQYIFRVKAVNAVG 691
                +  G        G +            N  V+         TG+   + + A N  G
Sbjct: 15842 SSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHTGK---YSITAKNKAG 15898

Query: 692   MSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKRE 751
                  Q++   +V+  + VP  P  + + +    S  L WK+P   GG  I GY ++KR 
Sbjct: 15899 -----QKTANCRVKV-MDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRT 15952

Query: 752   VHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMP 811
             +  K W +VN      T +  D L+E   Y F++ A N  GIG P +  +         P
Sbjct: 15953 IDGKAWTKVNPDCGSTTFVVPDLLSE-QQYFFRVRAENRFGIGPPVETIQRTTARDPIYP 16011

Query: 812   EPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREED-----AGEWITVNQTT 866
              P P   L    +   ++ + WK P   G SPV+ Y V+    D        W   N+  
Sbjct: 16012 -PDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRD 16070

Query: 867   TANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEIS----AGVDE 922
                    V DL +G  Y FRV+AVNA GV KPS T  P   +       I       V+E
Sbjct: 16071 VEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQRPDMPPSIDLKEFMEVEE 16130

Query: 923   QGNIYLGFDCQEMTDASQFTWCK-------SYEEISDDERFKIETVGDHSKLYLKNPDKE 975
               N+ +    + +   +  TW K       + E +  D       V D   L +    + 
Sbjct: 16131 GTNVNIVAKIKGVPFPT-LTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRS 16189

Query: 976   DLGTYSVSVSDTDGVSS 992
             D G Y+++  +  G +S
Sbjct: 16190 DTGLYTITAVNNLGTAS 16206



 Score =  188 bits (478), Expect = 3e-47
 Identities = 179/740 (24%), Positives = 304/740 (41%), Gaps = 121/740 (16%)

Query: 185   VQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAV 244
             VQW ++  ++ Q     K+++ S   +H L+I      D   Y  +A +   +     A 
Sbjct: 12942 VQWLRNNMVVVQG---DKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAA 12998

Query: 245   VVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVT 304
               +    D++    + + +G PL+ ++PY  +                            
Sbjct: 12999 APKIKTADQD----LVVDVGKPLTMVVPYDAYP--------------------------- 13027

Query: 305   PDLKRVQPRAEWYRDDVLLKESKWTKMFFGEG-QASLSFSHLHKDDEGLYTLRIVSRGGV 363
                   +  AEW++++  L     TK       Q S       K D+G Y + + ++ G 
Sbjct: 13028 ------KAEAEWFKENEPLS----TKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGK 13077

Query: 364   SDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCE 423
             ++    L V D        PG   +L+  +     V + W+ P T   S ++GY V+R +
Sbjct: 13078 AEGFINLKVIDV-------PGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRD 13130

Query: 424   VGTNNWVQCNDAPVKICKYPVTGLFEGR-SYIFRVRAVNSAGISRPSRVSDAVAALDPLD 482
             +    WV   D   + C++ VTGL +G   Y+FRV A N  G   P    + V A    D
Sbjct: 13131 IKRKTWVLATDR-AESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYD 13189

Query: 483   LRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPT-PRGKDP 541
                                        VPGPP  V  ++++R  V L+WEPP    G + 
Sbjct: 13190 ---------------------------VPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEI 13222

Query: 542   LMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITS 601
               Y IE     S  W       A       V D++EG+ Y FRV + NR G+ +PS  T 
Sbjct: 13223 TNYVIELRDKTSIRWDTAMTVRA-EDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATP 13281

Query: 602   PIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPC 659
              ++  D    PS P  + +S  T++SV ++W+ P  +    +LGY ++ C  G + W  C
Sbjct: 13282 FVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRC 13341

Query: 660   NHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQ-----ESDVIKVQAALTVPSHP 714
             N K +    + V GL  G +Y++RV A N  G+S+ S+      +D   V+  + + +  
Sbjct: 13342 NMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFK 13401

Query: 715   YGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNS-SPSKPTILTVD 773
              G+ ++  +  ++     VP      P   +    + +   +  ++ + S     +++  
Sbjct: 13402 DGLEVIVPNPITIL----VPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPS 13457

Query: 774   GLTEGSLYEFKI--------AAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVR 825
               ++  +Y  K+          +++  I  PS P E                 L F ++ 
Sbjct: 13458 ERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKE-----------------LKFGDIT 13500

Query: 826   DTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVF 885
               S+ + W+ P   G SP++GY V+ RE     W  V    T   +  V DL QGK Y+F
Sbjct: 13501 KDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEF-TVPDLVQGKEYLF 13559

Query: 886   RVRAVNANGVGKPSDTSEPV 905
             +V A N  G G+P+   EPV
Sbjct: 13560 KVCARNKCGPGEPAYVDEPV 13579



 Score =  188 bits (477), Expect = 4e-47
 Identities = 145/509 (28%), Positives = 233/509 (45%), Gaps = 82/509 (16%)

Query: 371   FVRDADPLVTG----APGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGT 426
             FV  ++ LV       P  P DL+  +  ++ V +TW PP     S ++ Y ++   +GT
Sbjct: 16701 FVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGT 16760

Query: 427   NNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAG------ISRPSRVSDAVAA--- 477
               + +  +  +   KY V GL EG +Y +RV AVN  G       ++P    D +A    
Sbjct: 16761 EKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTL 16820

Query: 478   ----LDPLDLRRLQAVHLEG-------------EKEIAIYQDDL---------------- 504
                  D L +R  +A  L G             + E  + +DD                 
Sbjct: 16821 HLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIK 16880

Query: 505   --------------------EGDAQV-----PGPPTG-VHASEISRNYVVLSWEPPTPRG 538
                                 +G  QV     PGPP G V   E++++Y+V+SW+PP   G
Sbjct: 16881 AKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLDDG 16940

Query: 539   KDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPS 597
                +  Y IEK  VG   W  V + +A  + +  V  L+EGK Y+FR+ + N +G+S+P 
Sbjct: 16941 GSKITNYIIEKKEVGKDVWMPVTSASAKTTCK--VSKLLEGKDYIFRIHAENLYGISDPL 16998

Query: 598   EITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNL 655
              ++  ++A+D   VP AP + + +  TK S +V W++P H+  + +  Y ++     +  
Sbjct: 16999 -VSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKP-HDGGKPITNYILEKRETMSKR 17056

Query: 656   WEPCNHKPIG-YNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHP 714
             W      PI  Y +F V  L  G QY FRV A N +G+ + S  S  +  +  +  PS P
Sbjct: 17057 WARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPP 17116

Query: 715   YGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSK--PTILTV 772
                  ++   +S+ L W+ P+  GGS ILGY ++ ++V  + W   N +P     T   V
Sbjct: 17117 VNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKV 17176

Query: 773   DGLTEGSLYEFKIAAVNLAGIGEPSDPSE 801
              GL +G  Y+F++ AVN AG  +P+   E
Sbjct: 17177 TGLRDGQTYKFRVLAVNAAGESDPAHVPE 17205



 Score =  187 bits (476), Expect = 5e-47
 Identities = 190/783 (24%), Positives = 312/783 (39%), Gaps = 105/783 (13%)

Query: 154   PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
             P + +   +  V  R  +K+    +G P   V W KDG  +    E  +  + S+  V +
Sbjct: 25395 PSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTL---KETTRVNVSSSKTVTS 25451

Query: 214   LEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPY 273
             L I  A  +D  TY    +N+ G ++    ++V    G   P R   +       S  P 
Sbjct: 25452 LSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPPGPIRIDEVSCDSITISWNPP 25511

Query: 274   THFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFF 333
              +     +  + +  ++E  + T                               W  +  
Sbjct: 25512 EYDGGCQISNY-IVEKKETTSTT-------------------------------WHIVSQ 25539

Query: 334   GEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHD 393
                + S+    L    E  + +   +R G S +S    V    P     PG P   +   
Sbjct: 25540 AVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPF--SPPGPPGTPKVVH 25597

Query: 394   ANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSY 453
             A +  ++VTW+ P     S V+GY ++  E  +  W + N   +   +  V+GL EG  Y
Sbjct: 25598 ATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLMY 25657

Query: 454   IFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGP 513
              +RV A N AGI + S+  + V A DP D                              P
Sbjct: 25658 EYRVYAENIAGIGKCSKSCEPVPARDPCD------------------------------P 25687

Query: 514   PTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAV 572
             P     + I+R  V L W  P   G   +  Y +E+  +  G W + N  T ++   + V
Sbjct: 25688 PGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCN-YTNIQETYFEV 25746

Query: 573   FDLMEGKSYVFRVLSAN-RHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQ 631
              +L E + Y FRV + N    +SEPSE T PI  +D       P RV+     +  +VV+
Sbjct: 25747 TELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKD----DVEPPRVMMDVKFRDVIVVK 25802

Query: 632   -WDRPKHEEDLLGY---YVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGE--------Q 679
               +  K   D+ G     +     G  + E    + I  +    H L T +        Q
Sbjct: 25803 AGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDN---HTLLTVKDCIRRDTGQ 25859

Query: 680   YIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGG 739
             Y+  +K  N  G    +    V+        P    G+T   C     +L W  P+  GG
Sbjct: 25860 YVLTLK--NVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKC-----SLSWGRPQEDGG 25912

Query: 740   SPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDP 799
             + I  Y ++KRE  H  W  +     + T   V  L +G+ Y F++  VN  G+GEP + 
Sbjct: 25913 ADIDYYIVEKRETSHLAW-TICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLES 25971

Query: 800   SEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEW 859
                   + +T+P P  + ++T   V   S+ + W  P   G S +SGY ++ RE+++  W
Sbjct: 25972 VAIKALDPFTVPSPPTSLEIT--SVTKESMTLCWSRPESDGGSEISGYIIERREKNSLRW 26029

Query: 860   ITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTS------EPVLVEARPGT 913
             + VN+    +  +K + L++G  Y +RV A NA G+  PS+TS      +PV + + P  
Sbjct: 26030 VRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSK 26089

Query: 914   KEI 916
              +I
Sbjct: 26090 PKI 26092



 Score =  187 bits (475), Expect = 6e-47
 Identities = 180/671 (26%), Positives = 294/671 (43%), Gaps = 73/671 (10%)

Query: 349   DEGL-YTLR-----IVSRGGVSDHSAFLFVRD-ADPLVTGAPGAPMDLQCHDANRDYVIV 401
             DEGL Y  +     IV  G  S  S     RD  DP     PG P  +      R+ V +
Sbjct: 24570 DEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDP-----PGRPEAIVI---TRNNVTL 24621

Query: 402   TWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVN 461
              WK P     S + GY V++ ++    W++ +   V   ++ V+GL E + Y FRV A N
Sbjct: 24622 KWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARN 24681

Query: 462   SAG-ISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDD---LEGDAQVPGPPTGV 517
             +AG  S PS  S A+ A D +D     ++  + +  I ++  +   LE D +    P  V
Sbjct: 24682 AAGNFSEPSDSSGAITARDEIDAPNA-SLDPKYKDVIVVHAGETFVLEADIRGKPIPDVV 24740

Query: 518   HASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLM- 576
              + +                GK+     +E++        R+  ++ ++     V D + 
Sbjct: 24741 WSKD----------------GKE-----LEETAA------RMEIKSTIQKTTLVVKDCIR 24773

Query: 577   -EGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRP 635
              +G  Y+ ++ +    G ++   IT  ++  D    P  P +V     T     + W+ P
Sbjct: 24774 TDGGQYILKLSNV---GGTKSIPIT--VKVLDRPGPPEGPLKVTGV--TAEKCYLAWNPP 24826

Query: 636   KHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMS 693
               +   ++  Y ++        W   + +    N + V  L  G +YIFRV AVN  G+ 
Sbjct: 24827 LQDGGANISHYIIEKRETSRLSWTQVSTEVQALN-YKVTKLLPGNEYIFRVMAVNKYGIG 24885

Query: 694   ENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVH 753
             E   ES  +        P  P    +      SM + W  P   GG+ I GY L+KR+  
Sbjct: 24886 E-PLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKE 24944

Query: 754   HKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFK-CEAWTMPE 812
                W + N        L V GLTEG  YEF++AA N AG+GEPS+PS  ++ C+A  +  
Sbjct: 24945 GVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDA--LYP 25002

Query: 813   PGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTT-TANRY 871
             PGP  +    +   +S+ + W  P+Y G +PV GY V+ +E  A EW T    T    + 
Sbjct: 25003 PGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQ 25062

Query: 872   LKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLG-- 929
               V+ L++   Y FR+ A+N+ GVG+P+     V+ + R    EI    D +  + L   
Sbjct: 25063 FTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRAS 25122

Query: 930   -----FDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSV 984
                  F   +     +  W K+   ++D  R +IE     + L + N  + D G Y++++
Sbjct: 25123 ATLRLFVTIKGRPEPEVKWEKAEGILTD--RAQIEVTSSFTMLVIDNVTRFDSGRYNLTL 25180

Query: 985   SDTDGVSSSFV 995
              +  G  ++FV
Sbjct: 25181 ENNSGSKTAFV 25191



 Score =  187 bits (474), Expect = 8e-47
 Identities = 169/652 (25%), Positives = 277/652 (42%), Gaps = 58/652 (8%)

Query: 357   IVSRGGVSDHSAFLFVRD-ADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVM 415
             IV  G  S  S     RD  DP     PG P   +     R+ V + WK P     S + 
Sbjct: 22420 IVGIGKPSKVSECYVARDPCDP-----PGRP---EAIIVTRNSVTLQWKKPTYDGGSKIT 22471

Query: 416   GYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGI-SRPSRVSDA 474
             GY V++ E+    W++ +   +    + VTGL E   Y FRV A N+AG+ S PS  + A
Sbjct: 22472 GYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGA 22531

Query: 475   VAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPP 534
             + A D +D  R+       +  +    +  + DA + G P              + W   
Sbjct: 22532 ITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPT-----------IQWI-- 22578

Query: 535   TPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLS 594
               +G   L       +  +     ++ + AVR         ++  +Y+ +  +     ++
Sbjct: 22579 --KGDQELSNTARLEIKSTDFATSLSVKDAVR---------VDSGNYILKAKN-----VA 22622

Query: 595   EPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAG 652
                 +T  ++  D    P  P  V+ S  T     + W  P  +   D++ Y V+     
Sbjct: 22623 GERSVTVNVKVLDRPGPPEGP--VVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETS 22680

Query: 653   TNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPS 712
               +W   +   +      V  L  G +Y FR+ AVN  G+ E   ES+ +  +    VP 
Sbjct: 22681 RLVWTVVDAN-VQTLSCKVTKLLEGNEYTFRIMAVNKYGVGE-PLESEPVVAKNPFVVPD 22738

Query: 713   HPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTV 772
              P    +      SM + W+ P   GGS ILGY L+KR+     W   +        L V
Sbjct: 22739 APKAPEVTTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRV 22798

Query: 773   DGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFK-CEAWTMPEPGPAYDLTFCEVRDTSLVM 831
              GL E   YEF+++A N AG+ EPS PS + K C+   + +PGP  +    ++  +S+ +
Sbjct: 22799 TGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACD--PIYKPGPPNNPKVIDITRSSVFL 22856

Query: 832   LWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANR-YLKVSDLQQGKTYVFRVRAV 890
              W  P+Y G   + GY V+  +   GEW      T  N+  ++V  L +   Y FR+ A+
Sbjct: 22857 SWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAI 22916

Query: 891   NANGVGKPSDTSEPVLVEARPGTKEISAGVDEQG--NIYLG-----FDCQEMTDASQFTW 943
             N  GVG+ +D   P++VE +    +I   ++ +   NI  G     F   +     +  W
Sbjct: 22917 NKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKW 22976

Query: 944   CKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
              K   EI D     I+     + L L N ++ D G Y++++ ++ G  S+FV
Sbjct: 22977 GKVDGEIRD--AAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFV 23026



 Score =  186 bits (473), Expect = 1e-46
 Identities = 191/764 (25%), Positives = 296/764 (38%), Gaps = 106/764 (13%)

Query: 154   PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
             P++     S++V     +K+   + G P P + W KDG  + Q     +  +  +  + T
Sbjct: 23230 PDVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTT---RINVTDSLDLTT 23286

Query: 214   LEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPY 273
             L I     DD   Y     N  GQ + +  +V                 +  P     P 
Sbjct: 23287 LSIKETHKDDGGQYGITVANVVGQKTASIEIVT----------------LDKPDPPKGPV 23330

Query: 274   THFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFF 333
                DV              E++TL     +     ++       RD      + W  +  
Sbjct: 23331 KFDDV------------SAESITLSWNPPLYTGGCQITNYIVQKRDTT---TTVWDVVSA 23375

Query: 334   GEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVT-------GAPGAP 386
                + +L  + L    E  + +   +R G S      F  ++DP+V        G PG P
Sbjct: 23376 TVARTTLKVTKLKTGTEYQFRIFAENRYGQS------FALESDPIVAQYPYKEPGPPGTP 23429

Query: 387   MDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTG 446
                     ++D +++ W  P     SPV+GY ++R E  +  W + N   +   ++    
Sbjct: 23430 F---ATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQN 23486

Query: 447   LFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEG 506
             L EG  Y FRV A N  G+ + S+ S+   A DP D                        
Sbjct: 23487 LEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCD------------------------ 23522

Query: 507   DAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAV 565
                 PG P  +    + RN + L W  P   G   +  Y +EK  +  G W + +  T V
Sbjct: 23523 ---PPGTPEPI---MVKRNEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASF-TNV 23575

Query: 566   RSPRYAVFDLMEGKSYVFRVLSANRHG-LSEPSEITSPIQAQDVTVVPSAPGRVLASRNT 624
                ++ V  L E + Y FRV++ N  G +S+PS+ T PI A+D   +P    R+      
Sbjct: 23576 IETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELP----RISMDPKF 23631

Query: 625   KTSVVVQ-WDRPKHEEDLLGYYVDCC--VAGTNLWEP---CNHKPIGYNRFVVHG---LT 675
             + ++VV   +  + E D+ G  +     + G    E    C  K   +   ++       
Sbjct: 23632 RDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRI 23691

Query: 676   TGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPK 735
              G QYI R  A N  G         V+        P    G+T   C     +L W  P 
Sbjct: 23692 DGGQYILR--ASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKC-----SLTWSPPL 23744

Query: 736   FSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGE 795
               GGS I  Y ++KRE     W  V +S      L V  L EG+ Y F+I AVN  G+GE
Sbjct: 23745 QDGGSDISHYVVEKRETSRLAW-TVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVGE 23803

Query: 796   PSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREED 855
             P + +       + +  PGP   L    +   S+ + W  P   G S + GY V+ R+  
Sbjct: 23804 PLESAPVLMKNPFVL--PGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRS 23861

Query: 856   AGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPS 899
                WI  N+    +  L+V+ L +   Y FRV A NA GVG+PS
Sbjct: 23862 GIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPS 23905



 Score =  186 bits (471), Expect = 2e-46
 Identities = 169/660 (25%), Positives = 282/660 (42%), Gaps = 64/660 (9%)

Query: 352   LYTLRIVSRGGVSDHSAFLFVRD-ADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTT 410
             +Y   IV  G  S +S     RD  DP     PG P  +      R+ + + W  P    
Sbjct: 23497 VYAENIVGVGKASKNSECYVARDPCDP-----PGTPEPIM---VKRNEITLQWTKPVYDG 23548

Query: 411   ESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAG-ISRPS 469
              S + GY V++ ++    W++ +   V   ++ V+GL E + Y FRV A N+AG IS+PS
Sbjct: 23549 GSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPS 23608

Query: 470   RVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVL 529
               +  + A D ++L R+       +  +    +    +A V G P              +
Sbjct: 23609 DSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPT-----------I 23657

Query: 530   SWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSAN 589
              W     RG   +       +  +     +  + A+R         ++G  Y+ R  +  
Sbjct: 23658 EWL----RGDKEIEESARCEIKNTDFKALLIVKDAIR---------IDGGQYILRASN-- 23702

Query: 590   RHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVD 647
                ++        ++  D    P  P +V    + K S+   W  P  +   D+  Y V+
Sbjct: 23703 ---VAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLT--WSPPLQDGGSDISHYVVE 23757

Query: 648   CCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAA 707
                     W     + +  N   V  L  G +Y+FR+ AVN  G+ E  + + V+ ++  
Sbjct: 23758 KRETSRLAWTVVASEVVT-NSLKVTKLLEGNEYVFRIMAVNKYGVGEPLESAPVL-MKNP 23815

Query: 708   LTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKP 767
               +P  P  + + N    SMT+ W  P   GGS I+GY ++KR+     W + N      
Sbjct: 23816 FVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITD 23875

Query: 768   TILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFK-CEAWTMPEPGPAYDLTFCEVRD 826
               L V GLTE   YEF+++A N AG+GEPS  + ++K C+   + +PGP  +    +   
Sbjct: 23876 LRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACD--PVFKPGPPTNAHIVDTTK 23933

Query: 827   TSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEW-ITVNQTTTANRYLKVSDLQQGKTYVF 885
              S+ + W  P+Y G S + GY V+  + D  EW I   QT       ++S L + + Y  
Sbjct: 23934 NSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKI 23993

Query: 886   RVRAVNANGVG---------KPSDTSE-PVLVEARPGTKEISAGVDEQGNIYLGFDCQEM 935
             RV A+N  G+G         KP D  E P L       K I         I++ F   + 
Sbjct: 23994 RVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPF---KG 24050

Query: 936   TDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
                 + TW +   E +D  + +IE   ++++L + N D+ D G Y + + ++ G  S+FV
Sbjct: 24051 RPTPEITWSREEGEFTD--KVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFV 24108



 Score =  186 bits (471), Expect = 2e-46
 Identities = 189/804 (23%), Positives = 332/804 (41%), Gaps = 87/804 (10%)

Query: 227   YSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLP-IGLPLSSMIPYTHFDVQFLEKFG 285
             +   A NA G +S  + VV     G      S G P I LPL     YT           
Sbjct: 26840 FRVFARNAVGSISNPSEVV-----GPITCIDSYGGPVIDLPLE----YTE---------- 26880

Query: 286   VTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHL 345
             V   R G +V L+  +   P      P  EWY+DD  L+ +    +      AS+     
Sbjct: 26881 VVKYRAGTSVKLRAGISGKP-----APTIEWYKDDKELQTNALVCVENTTDLASILIKDA 26935

Query: 346   HKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKP 405
              + + G Y L++  R  +   SA + V+  D    G PG P++ +   A +  + + W+P
Sbjct: 26936 DRLNSGCYELKL--RNAMGSASATIRVQILDK--PGPPGGPIEFKTVTAEK--ITLLWRP 26989

Query: 406   PNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGI 465
             P     + +  Y V++ E     W   ++  ++ C    T + +G  YIFRVRAVN  GI
Sbjct: 26990 PADDGGAKITHYIVEKRETSRVVWSMVSEH-LEECIITTTKIIKGNEYIFRVRAVNKYGI 27048

Query: 466   SRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRN 525
               P   SD+V A +                               PGPP     ++I++N
Sbjct: 27049 GEPLE-SDSVVAKNAF---------------------------VTPGPPGIPEVTKITKN 27080

Query: 526   YVVLSWEPP-TPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFR 584
              + + W  P    G D   YF+EK    S  W +V  +T +R  R  V  L E   Y +R
Sbjct: 27081 SMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKET-IRDTRQKVTGLTENSDYQYR 27139

Query: 585   VLSANRHG---LSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--E 639
             V + N  G    SEPSE     +A D    P  P ++  + +TK+S+ + W +P ++   
Sbjct: 27140 VCAVNAAGQGPFSEPSEF---YKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGS 27196

Query: 640   DLLGYYVDCCVAGTNLWEPCNHK-PIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQE 698
              + GY V+        W   + K  +    +VV  L  G  Y FRV AVN  G  E  + 
Sbjct: 27197 AVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEM 27256

Query: 699   SDVIKVQAALTVPSHPYGITL----LNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHH 754
             ++ ++ +  L  P     + L    +   G  + +   +P      P + +  D++ +  
Sbjct: 27257 NEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQV--LIPFKGRPPPTVTWRKDEKNLGS 27314

Query: 755   KNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPG 814
                + + ++ S  ++LT+  +T     ++ +   N  G+GEP   +   K     +  P 
Sbjct: 27315 DARYSIENTDSS-SLLTIPQVTRNDTGKYILTIEN--GVGEPKSSTVSVK----VLDTPA 27367

Query: 815   PAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKV 874
                 L    V   ++ +LW  P+  G SP+  Y ++ R+     W  V+   ++  + K+
Sbjct: 27368 ACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSSTSF-KL 27426

Query: 875   SDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPG-TKEISAGVDEQGNIYLGFDCQ 933
              DL +   + FRV A N  G+G+P +T+EPV     P   +++S     + ++ L +   
Sbjct: 27427 IDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKP 27486

Query: 934   EMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSS 993
             +    S  T      +   ++ +    +    ++ +    ++ +  + V   +  G+S  
Sbjct: 27487 DFDGGSVITEYVVERKGKGEQTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDP 27546

Query: 994   FVLDPEELERLMALSNEIKNPTIP 1017
               + P  ++ L+ ++ E+    IP
Sbjct: 27547 VTIGPITVKELI-ITPEVDLSDIP 27569



 Score =  185 bits (470), Expect = 2e-46
 Identities = 164/638 (25%), Positives = 263/638 (41%), Gaps = 91/638 (14%)

Query: 381   GAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKIC 440
             G PG P   +  +  ++   V+WK P     S + GY V+R E  +  WV+    PV   
Sbjct: 20570 GPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDL 20629

Query: 441   KYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIY 500
             +  VTGL EG +Y FRV A N AGI  PS  SD+V   D                     
Sbjct: 20630 RCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDA-------------------- 20669

Query: 501   QDDLEGDAQVPGPPTGVHASEISRNYVVLSW-EPPTPRGKDPLMYFIEKSVVGSGSWQRV 559
                    A  PGPP+  H ++ ++    L+W +P    G +   Y +E   VG  +W + 
Sbjct: 20670 -------AYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKD 20722

Query: 560   NAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPS--APGR 617
                TA+R  ++ V DL   + Y FR+ + N  G+ EP+ I       DV +V    AP  
Sbjct: 20723 TTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIP------DVEIVEREMAPDF 20776

Query: 618   VLASRNTKTSVVVQW----------DRPKHE----EDLLGYYVDCCVAGTNLWE-----P 658
              L +   +T VV              RP  E    +D +       +  T  +       
Sbjct: 20777 ELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESFTLLIIPE 20836

Query: 659   CNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGIT 718
             CN    G     +      +     V+ ++  G   N + +D+ K               
Sbjct: 20837 CNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITK--------------- 20881

Query: 719   LLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEG 778
                    S+TL W +P   GGS I  Y ++KRE   K++    +   K T   V GL+EG
Sbjct: 20882 ------DSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTKCHKCTY-KVTGLSEG 20934

Query: 779   SLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVY 838
               Y F++ A N  GIGEP++ +E  K        P P   L   ++  +++ + W  P +
Sbjct: 20935 CEYFFRVMAENEYGIGEPTETTEPVKASE----APSPPDSLNIMDITKSTVSLAWPKPKH 20990

Query: 839   SGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKP 898
              G S ++GY ++ + + + +W  +  TT       V +L +G+ Y F+V AVN+ G   P
Sbjct: 20991 DGGSKITGYVIEAQRKGSDQWTHI--TTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAP 21048

Query: 899   SDTSEPVLVEARPGTKEISA-GVDEQGNIYLGFDCQEMT------DASQFTWCKSYEEIS 951
              + S PV+V+ +    E+   G+ ++  I    D  ++            TW K  + + 
Sbjct: 21049 RE-SRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILK 21107

Query: 952   DDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
               +R   ET    + L +    + D G Y ++  +  G
Sbjct: 21108 QTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVG 21145



 Score =  185 bits (470), Expect = 2e-46
 Identities = 164/623 (26%), Positives = 257/623 (41%), Gaps = 58/623 (9%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
             P  P  +   D  R+ V ++W+ P     S ++GY V+    G++ W  C  A VK+ + 
Sbjct: 22049 PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATC--ATVKVTEA 22106

Query: 443   PVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQD 502
              +TGL +G  Y FRV A N  GIS P ++S  V A D   L    A  L       +  +
Sbjct: 22107 TITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKD---LVIPPAFKLLFNTFTVLAGE 22163

Query: 503   DLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQ 562
             DL+ D    G PT             ++W                K  V      RVNA+
Sbjct: 22164 DLKVDVPFIGRPTPA-----------VTWH---------------KDNVPLKQTTRVNAE 22197

Query: 563   TAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVV--PSAP-GRVL 619
             +   +    + D        + V   N  G          I+  +V V+  P  P G V 
Sbjct: 22198 STENNSLLTIKDACREDVGHYVVKLTNSAG--------EAIETLNVIVLDKPGPPTGPVK 22249

Query: 620   ASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTG 677
                 T  S+ + W  PK++    +  Y V+     T  W+  +   +         L TG
Sbjct: 22250 MDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVS-ATVARTTIKACRLKTG 22308

Query: 678   EQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFS 737
              +Y FR+ A N  G S        +  Q    VP  P    +      SM + W  P   
Sbjct: 22309 CEYQFRIAAENRYGKSTYLNSEPTV-AQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPISD 22367

Query: 738   GGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPS 797
             GGS ++GY+L+++E +   W ++N +P   T     GL EG  YEF+++A N+ GIG+PS
Sbjct: 22368 GGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPS 22427

Query: 798   DPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAG 857
               SE +       P   P   +    V   S+ + WK P Y G S ++GY V+ +E   G
Sbjct: 22428 KVSECYVARDPCDPPGRPEAII----VTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEG 22483

Query: 858   EWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGV-GKPSDTSEPVLVEARPGTKEI 916
              W+  + T   + + +V+ L +   Y FRV A NA GV  +PS+++  +          I
Sbjct: 22484 RWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRI 22543

Query: 917   SAGVDEQGNIYLGFDCQEMTDASQF-------TWCKSYEEISDDERFKIETVGDHSKLYL 969
             S     +  I +        DA  +        W K  +E+S+  R +I++    + L +
Sbjct: 22544 SMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSV 22603

Query: 970   KNPDKEDLGTYSVSVSDTDGVSS 992
             K+  + D G Y +   +  G  S
Sbjct: 22604 KDAVRVDSGNYILKAKNVAGERS 22626



 Score =  185 bits (469), Expect = 3e-46
 Identities = 198/834 (23%), Positives = 347/834 (41%), Gaps = 94/834 (11%)

Query: 170   SVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSA 229
             +++L   ++G P P V W K+         P K RI+       LEI  A  +D   YS 
Sbjct: 17235 TLRLSAIIKGVPFPKVTWKKE-----DRDAPTKARIDVTPVGSKLEIRNAAHEDGGIYSL 17289

Query: 230   VATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFR 289
                N  G  + +  V+V      ++P    G P  L +S +                  R
Sbjct: 17290 TVENPAGSKTVSVKVLVL-----DKP----GPPRDLEVSEI------------------R 17322

Query: 290   REGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDD 349
             ++   +T K  +    D   V       R DV    ++W+ +     + S    HL++ +
Sbjct: 17323 KDSCYLTWKEPL---DDGGSVITNYVVERRDVA--SAQWSPLSATSKKKSHFAKHLNEGN 17377

Query: 350   EGLYTLRIVSRGGVSDHSAFLF----VRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKP 405
             + L+ +   ++ G      F+     ++  DPL    PG P DL   D ++  V + W  
Sbjct: 17378 QYLFRVAAENQYG---RGPFVETPKPIKALDPL--HPPGPPKDLHHVDVDKTEVSLVWNK 17432

Query: 406   PNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGI 465
             P+    SP+ GY V+  E GT +W++        C   VTGL +G++Y FRV+A N  G+
Sbjct: 17433 PDRDGGSPITGYLVEYQEEGTQDWIKFKTVTNLECV--VTGLQQGKTYRFRVKAENIVGL 17490

Query: 466   SRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRN 525
               P           P++ +  + V    E ++ +    +EG     G  T V    I R 
Sbjct: 17491 GLPDTTI-------PIECQE-KLVPPSVELDVKL----IEGLVVKAG--TTVRFPAIIRG 17536

Query: 526   YVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRV 585
                     P P  K    +  + S + +   +    +T   S    + + +   +  +++
Sbjct: 17537 V-------PVPTAK----WTTDGSEIKTD--EHYTVETDNFSSVLTIKNCLRRDTGEYQI 17583

Query: 586   LSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLG 643
               +N  G      +   +   DV   P+ P  +L    T   + + W  PK +    ++ 
Sbjct: 17584 TVSNAAG---SKTVAVHLTVLDVPGPPTGPINILDV--TPEHMTISWQPPKDDGGSPVIN 17638

Query: 644   YYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIK 703
             Y V+      + W   +         + H L  G +Y+FRV+A N +G+      +  + 
Sbjct: 17639 YIVEKQDTRKDTWGVVSSGSSKTKLKIPH-LQKGCEYVFRVRAENKIGVGPPLDSTPTV- 17696

Query: 704   VQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSS 763
              +   + PS P    + +   ++ T+ W +PK  GGSPI GYY+++REV  K W  VN +
Sbjct: 17697 AKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREVTGK-WVRVNKT 17755

Query: 764   PSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCE 823
             P       V GL EG+ YEF++ A NLAG+ +PS  S+  K      P PGP  +    +
Sbjct: 17756 PIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKP-PGPPINPKLKD 17814

Query: 824   VRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANR-YLKVSDLQQGKT 882
                 +  ++W  P+  G SP+ GY V+ ++    +W  +N+     +   +V  L +G  
Sbjct: 17815 KSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNE 17874

Query: 883   YVFRVRAVNANGVGKPSDTSEPVLVE--ARPGTKEISAGVDEQGNIYLGFDCQEMTDAS- 939
             Y FR++A N  G G+P + +E V+ +    P   E+     +   + +G   + +     
Sbjct: 17875 YRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKG 17934

Query: 940   ----QFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
                   TW K  + +  ++R  +       +L +K   + D G Y +S  ++ G
Sbjct: 17935 RPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSG 17988



 Score =  185 bits (469), Expect = 3e-46
 Identities = 204/870 (23%), Positives = 337/870 (38%), Gaps = 134/870 (15%)

Query: 161   RSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRAD 220
             ++H V    S++L    QG PTP   W K  S +   A+     I +     TL +   +
Sbjct: 28365 QTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRAD-----IHTTDSFSTLTVENCN 28419

Query: 221   FDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFR-------SVGLPIGLPLSSMIPY 273
              +D   Y+    N  G  S    V V    G   P         S  L    PL      
Sbjct: 28420 RNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGAR 28479

Query: 274   THFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFF 333
              H  V  +EK   + RR  + ++ KCT  +                              
Sbjct: 28480 IHHYV--VEKREAS-RRSWQVISEKCTRQI------------------------------ 28506

Query: 334   GEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLV-TGAPGAPMDLQCH 392
                      + L +     + +  V+  GV +          +P+V T  P  P  L   
Sbjct: 28507 ------FKVNDLAEGVPYYFRVSAVNEYGVGEPYEM-----PEPIVATEQPAPPRRLDVV 28555

Query: 393   DANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRS 452
             D ++   ++ W  P+    S + GY ++  + G++ WV+      K   + V  L E   
Sbjct: 28556 DTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHT--KQLTFTVERLVEKTE 28613

Query: 453   YIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPG 512
             Y FRV+A N AG S P     +V   +P          +E   ++    + L       G
Sbjct: 28614 YEFRVKAKNDAGYSEPREAFSSVIIKEP---------QIEPTADLTGITNQLI--TCKAG 28662

Query: 513   PPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAV 572
              P  +      R    ++W+    R K+                 RV+  T        V
Sbjct: 28663 SPFTIDVPISGRPAPKVTWKLEEMRLKET---------------DRVSITTTKDRTTLTV 28707

Query: 573   FDLMEGKSYVFRVLSANRHG----------LSEPSEITSPIQAQDVTVVPSAPGRVLASR 622
              D M G S  + +   N  G          +  P  +T PI+   V+             
Sbjct: 28708 KDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSA------------ 28755

Query: 623   NTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQY 680
                 S V+ W  PK     ++  Y V+   +GT  W+  N   +   +  V  LT   +Y
Sbjct: 28756 ---ESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSS-VKRTQIKVTHLTKYMEY 28811

Query: 681   IFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGS 740
              FRV + N  G+S+  + + +I  +     PS P    + +   ++M++ W+ P   GGS
Sbjct: 28812 SFRVSSENRFGVSKPLESAPII-AEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGS 28870

Query: 741   PILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPS 800
              I+GY+++K+E +   W + N  P       V GL EG  Y+F+  A+N AG+ + S+ S
Sbjct: 28871 KIIGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEAS 28930

Query: 801   EHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFR---EEDAG 857
                  +   +  PG        +V  +++ ++W AP Y G S V GY ++ +   E   G
Sbjct: 28931 RPIMAQN-PVDAPGRP---EVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDG 28986

Query: 858   EWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGV-GKPSDTSEPVLV--EARPGTK 914
              W+  N T  ++ +  V+ L +G TY FRV A NA GV  K S+++ PV    E  P   
Sbjct: 28987 RWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKA 29046

Query: 915   EISAGV-DEQGNIYLGFDCQEMTDAS-------QFTWCKSYEEISDDERFKIETVGDHSK 966
             E+ A +  +   I  G D   + DA+       +  W K  +E+   E+  ++  G  + 
Sbjct: 29047 ELDARLHGDLVTIRAGSDL--VLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRAT 29104

Query: 967   LYLKNPDKEDLGTYSVSVSDTDGVSSSFVL 996
               +K  D+ D G Y+++V +  G  +  V+
Sbjct: 29105 AVIKFCDRSDSGKYTLTVKNASGTKAVSVM 29134



 Score =  184 bits (466), Expect = 7e-46
 Identities = 162/629 (25%), Positives = 274/629 (43%), Gaps = 63/629 (10%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
             PG  +DL+    ++    + WK P++   S ++GY VD      N W +   +     +Y
Sbjct: 19884 PGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFL-TEENKWQRVMKS--LSLQY 19940

Query: 443   PVTGLFEGRSYIFRVRAVNSAGISRPSRVS----DAVAALDPLDLRRLQAVHLEGEKEIA 498
                 L EG+ Y FRV A N  G   PS ++    D V A D LDL+ L  +         
Sbjct: 19941 SAKDLTEGKEYTFRVSAENENGEGTPSEITVVARDDVVAPD-LDLKGLPDL--------- 19990

Query: 499   IYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQR 558
              Y      + ++  P  G  A  +S       W+    +G+DPL            +  R
Sbjct: 19991 CYLAKENSNFRLKIPIKGKPAPSVS-------WK----KGEDPL-----------ATDTR 20028

Query: 559   VNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRV 618
             V+ +++  +    V+D  +  +  + +   N  G  E    T  I+      +P+ P  +
Sbjct: 20029 VSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEG---TISIKVVGKPGIPTGP--I 20083

Query: 619   LASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTT 676
                  T  ++ ++W  PK +   ++  Y ++   +  N W  C    +    F V  L  
Sbjct: 20084 KFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCA-SAVQKTTFRVTRLHE 20142

Query: 677   GEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKF 736
             G +Y FRV A N  G+ E  + S+ I  +    VP  P    +++    S++L W  PK 
Sbjct: 20143 GMEYTFRVSAENKYGVGEGLK-SEPIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKK 20201

Query: 737   SGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEP 796
             +GGSPI GY+L+ +E +   W   N +P +     V GLTEG  YEF++ A+NLAG+G+P
Sbjct: 20202 TGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKP 20261

Query: 797   SDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDA 856
             S PSE        +    P        +   S+ ++W  P Y G   ++GY V+ R+  +
Sbjct: 20262 SLPSE----PVVALDPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPS 20317

Query: 857   GEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVN-ANGVGKPSDTSEPVLV--EARPGT 913
               W+  N          V+DL +G  Y FR+RA N A  +  PS+++E ++   E    T
Sbjct: 20318 KSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPT 20377

Query: 914   KEISAGVDEQGNIYLGFDCQEMTDAS-------QFTWCKSYEEISDDERFKIETVGDHSK 966
               +   + +   I  G D   +   S       + +W K+ ++I   +  +I +    S 
Sbjct: 20378 IVLDPTIKDGLTIKAG-DTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSM 20436

Query: 967   LYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
             L +K   ++D G Y+++ ++  G     V
Sbjct: 20437 LTIKYATRKDAGEYTITATNPFGTKVEHV 20465



 Score =  184 bits (466), Expect = 7e-46
 Identities = 157/633 (24%), Positives = 259/633 (40%), Gaps = 56/633 (8%)

Query: 283   KFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSF 342
             K G+T +  G+T+ L    ++   L    P++ W +    ++ S  T++      + L+ 
Sbjct: 20385 KDGLTIKA-GDTIVLNAISILGKPL----PKSSWSKAGKDIRPSDITQITSTPTSSMLTI 20439

Query: 343   SHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVT 402
              +  + D G YT+   +  G         V      V   PG P  ++  + + +   +T
Sbjct: 20440 KYATRKDAGEYTITATNPFGTK-------VEHVKVTVLDVPGPPGPVEISNVSAEKATLT 20492

Query: 403   WKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNS 462
             W PP     SP+  Y +++ E     W   ++  ++ C++  T L +G  YIFRV AVN 
Sbjct: 20493 WTPPLEDGGSPIKSYILEKRETSRLLWTVVSE-DIQSCRHVATKLIQGNEYIFRVSAVNH 20551

Query: 463   AGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEI 522
              G   P + S+ V  +D                               PGPP     S +
Sbjct: 20552 YGKGEPVQ-SEPVKMVDRFG---------------------------PPGPPEKPEVSNV 20583

Query: 523   SRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSY 581
             ++N   +SW+ P   G   +  Y +E+    S  W R   +T V   R  V  L EG +Y
Sbjct: 20584 TKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRA-IKTPVSDLRCKVTGLQEGSTY 20642

Query: 582   VFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEE-- 639
              FRV + NR G+  PSE +  +  +D    P  P     +  TK S  + W +P ++   
Sbjct: 20643 EFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGL 20702

Query: 640   DLLGYYVDCCVAGTNLW-EPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQE 698
             ++ GY V+    G   W +      +   +FVV  L T E+Y FR+ A+N  G+ E +  
Sbjct: 20703 EITGYVVEHQKVGDEAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVI 20762

Query: 699   SDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWH 758
              DV  V+  +  P       L         L  ++     G P       K  ++ KN  
Sbjct: 20763 PDVEIVEREM-APDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRA 20821

Query: 759   EVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYD 818
              + ++ S  T+L +         +F +   N AG        +        +  PGP  +
Sbjct: 20822 NIENTESF-TLLIIPECNRYDTGKFVMTIENPAG-------KKSGFVNVRVLDTPGPVLN 20873

Query: 819   LTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQ 878
             L   ++   S+ + W  P+  G S ++ Y V+ RE     + T         Y KV+ L 
Sbjct: 20874 LRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTKCHKCTY-KVTGLS 20932

Query: 879   QGKTYVFRVRAVNANGVGKPSDTSEPVLVEARP 911
             +G  Y FRV A N  G+G+P++T+EPV     P
Sbjct: 20933 EGCEYFFRVMAENEYGIGEPTETTEPVKASEAP 20965



 Score =  184 bits (466), Expect = 7e-46
 Identities = 233/952 (24%), Positives = 374/952 (39%), Gaps = 107/952 (11%)

Query: 382   APGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDR---CEVGTNNWVQCNDAPVK 438
             APG P   +  D  R  V + W  P     S V+GY ++R    EVG   W++CN   V 
Sbjct: 28941 APGRP---EVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVS 28997

Query: 439   ICKYPVTGLFEGRSYIFRVRAVNSAG-ISRPSRVSDAVAALDPLDLRRLQA-VHLEGEKE 496
                + VT L EG +Y FRV A N+AG IS+ S  +  V   D     + +    L G+  
Sbjct: 28998 DNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLV 29057

Query: 497   IAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGK-DPLMYFIEKSVVGSGS 555
                   DL  DA V G P                 EP     K D  +   EK       
Sbjct: 29058 TIRAGSDLVLDAAVGGKP-----------------EPKIIWTKGDKELDLCEK------- 29093

Query: 556   WQRVNAQ-TAVRSPRYAVF-DLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPS 613
                V+ Q T  R+     F D  +   Y   V +A+  G    S +   + +      P 
Sbjct: 29094 ---VSLQYTGKRATAVIKFCDRSDSGKYTLTVKNAS--GTKAVSVMVKVLDS------PG 29142

Query: 614   APGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVV 671
               G++  SR T+    + W  P+ +   ++  Y V+        W     +    + +VV
Sbjct: 29143 PCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLS-YVV 29201

Query: 672   HGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGW 731
               L    +YIFRV+AVN  G      ES+ I  + + T+PS P     +      + + W
Sbjct: 29202 TRLIKNNEYIFRVRAVNKYGPGV-PVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQW 29260

Query: 732   KVPKFSGGSPILGYYLDKREVHHKNWHEVNSS-PSKPTILTVDGLTEGSLYEFKIAAVNL 790
               P+  GG+ I  Y +DKRE     W  VN       T L V  L EG  Y+F++ AVN 
Sbjct: 29261 TKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNA 29320

Query: 791   AGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVD 850
             AG  EPS+ S    C   +   PGP       +    S+ + W  P+Y G + + GY ++
Sbjct: 29321 AGNSEPSEASNFISCREPSYT-PGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLE 29379

Query: 851   FREEDAGEWITVN-QTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDT---SEPVL 906
              +E+D  +W  V+   T  N    V DL+ G+ Y FRV AVN  G+ + S++    EPV 
Sbjct: 29380 MQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVE 29439

Query: 907   VEARPGTKEISAGVDEQGNIYLGFDCQEMTDAS-----QFTWCKSYEEISDDERFKIETV 961
                 P   E++  + +   I  G   + M   S       TW K   +++   R  I+T 
Sbjct: 29440 RIEIPDL-ELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLA--SRAIIDTT 29496

Query: 962   GDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKSE 1021
               +S L +   ++ D G Y++   +  G  S+ VL             ++ +   P  S 
Sbjct: 29497 ESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVL------------VKVYDTPGPCPSV 29544

Query: 1022  LAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRI--KCDKA----TGIIEM 1075
                E+        W             +I+  RE +      +  KC K     +G++E 
Sbjct: 29545 KVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEG 29604

Query: 1076  VMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEY 1135
              M  F +  E  Y +    G+    S  VL+ +     L  A+ +  +  +         
Sbjct: 29605 TMYYFRVLPENIYGI----GEPCETSDAVLVSE---VPLVPAKLEVVDVTKS-----TVT 29652

Query: 1136  LHWD-VTEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNLERGICELLIPKLSKKD 1194
             L W+    +   RL   V    K    +W+K         +  L+  + E  +  L++ +
Sbjct: 29653 LAWEKPLYDGGSRLTGYVLEACKAGTERWMK---------VVTLKPTVLEHTVTSLNEGE 29703

Query: 1195  HGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLKVLCTPEGIRLQCFMK 1254
                ++   ++++G       +      D  L +      S  P K +  P G  ++  + 
Sbjct: 29704 QYLFRIRAQNEKGVSEPRETVTAVTVQD--LRVLPTIDLSTMPQKTIHVPAGRPVELVIP 29761

Query: 1255  YF-TDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEI 1305
                      +W    +K+  SE + +    ++A L I E T +D G+YT E+
Sbjct: 29762 IAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLEL 29813



 Score =  182 bits (462), Expect = 2e-45
 Identities = 157/621 (25%), Positives = 254/621 (40%), Gaps = 75/621 (12%)

Query: 302   LVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRG 361
             LV P   R  P A W+     L+ES+   +      A L+       D G YTL + +  
Sbjct: 29758 LVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVT 29817

Query: 362   GVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDR 421
             G +  +  + + D      G P  P+ +   DA    + ++W+PP     +P+ GY V++
Sbjct: 29818 GTTSETIKVIILDKP----GPPTGPIKIDEIDATS--ITISWEPPELDGGAPLSGYVVEQ 29871

Query: 422   CEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPL 481
              +     W+  +++  +   +  T L EG  Y+FRV A N  GI                
Sbjct: 29872 RDAHRPGWLPVSESVTR-STFKFTRLTEGNEYVFRVAATNRFGIGS-------------- 29916

Query: 482   DLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDP 541
                 LQ+  +E    I           ++PGPP  +   ++SR+ + L+W PP   G   
Sbjct: 29917 ---YLQSEVIECRSSI-----------RIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQ 29962

Query: 542   LM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEIT 600
             +  Y +E+  V +  W RVN +  V   RY    L EG  Y  RV + N  G  +PS  +
Sbjct: 29963 VTGYIVERKEVRADRWVRVN-KVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPS 30021

Query: 601   SPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEP 658
              PI A D    P  P     +  T+TSV + W  P+ E    + GY ++      + W  
Sbjct: 30022 KPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTK 30081

Query: 659   CNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPY--- 715
             CN  P     + +  L  G +Y FRV A NA G  E ++    +KV   L  P +     
Sbjct: 30082 CNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDER 30141

Query: 716   ---GITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTV 772
                GI +       +T+  K   F    PI  +  + +++  +     + + ++  I   
Sbjct: 30142 YQEGIFVRQGGVIRLTIPIKGKPF----PICKWTKEGQDISKRAMIATSETHTELVIKEA 30197

Query: 773   DGLTEGSLYEF--------KIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEV 824
             D    G+ Y+         K   + +  IG P+ P              GP   L + ++
Sbjct: 30198 DRGDSGT-YDLVLENKCGKKAVYIKVRVIGSPNSPE-------------GP---LEYDDI 30240

Query: 825   RDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYV 884
             +  S+ + W+ P   G + + GY ++ RE     W T++        L V  L++   Y 
Sbjct: 30241 QVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRVRGTS-LVVKGLKENVEYH 30299

Query: 885   FRVRAVNANGVGKPSDTSEPV 905
             FRV A N  G+ KP  + EPV
Sbjct: 30300 FRVSAENQFGISKPLKSEEPV 30320



 Score =  182 bits (461), Expect = 3e-45
 Identities = 173/685 (25%), Positives = 271/685 (39%), Gaps = 56/685 (8%)

Query: 238   VSTNAAVVVRRFRGDEEPFRSVGLPIGLPLS----SMIPYTHFDVQFLEKFGVTFRREGE 293
             VS N   V     GD   FR +       +S    S  P T  D     K  +  R  G+
Sbjct: 28996 VSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGD 29055

Query: 294   TVTLKCTMLVTPDLK---RVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDE 350
              VT++    +  D     + +P+  W + D  L   +   + +   +A+       + D 
Sbjct: 29056 LVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDS 29115

Query: 351   GLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTT 410
             G YTL + +  G    S  + V D+       PG    L      ++   + W  P    
Sbjct: 29116 GKYTLTVKNASGTKAVSVMVKVLDS-------PGPCGKLTVSRVTQEKCTLAWSLPQEDG 29168

Query: 411   ESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSR 470
              + +  Y V+R E    NWV   +       Y VT L +   YIFRVRAVN  G      
Sbjct: 29169 GAEITHYIVERRETSRLNWVIV-EGECPTLSYVVTRLIKNNEYIFRVRAVNKYG------ 29221

Query: 471   VSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLS 530
                               V +E E  +A           +P PP         + ++++ 
Sbjct: 29222 ----------------PGVPVESEPIVA------RNSFTIPSPPGIPEEVGTGKEHIIIQ 29259

Query: 531   W-EPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSAN 589
             W +P +  G +   Y ++K    S  W RVN    V   R  V  LMEG  Y FRV + N
Sbjct: 29260 WTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVN 29319

Query: 590   RHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVD 647
               G SEPSE ++ I  ++ +  P  P        TK S+ + W +P ++   D++GY ++
Sbjct: 29320 AAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLE 29379

Query: 648   CCVAGTNLWEPCN-HKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQA 706
                  T+ W   + +  I    F V  L  G++Y FRV AVN  GMSE S+    I+   
Sbjct: 29380 MQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVE 29439

Query: 707   ALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSK 766
              + +P       L            ++     G P       K+ +   +   ++++ S 
Sbjct: 29440 RIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESY 29499

Query: 767   PTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRD 826
              ++L VD +      ++ I A N +G        +           PGP   +   EV  
Sbjct: 29500 -SLLIVDKVNRYDAGKYTIEAENQSG-------KKSATVLVKVYDTPGPCPSVKVKEVSR 29551

Query: 827   TSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFR 886
              S+ + W+ P   G +PV+ Y V+ RE     + TV    +   Y ++S L +G  Y FR
Sbjct: 29552 DSVTITWEIPTIDGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLY-RISGLVEGTMYYFR 29610

Query: 887   VRAVNANGVGKPSDTSEPVLVEARP 911
             V   N  G+G+P +TS+ VLV   P
Sbjct: 29611 VLPENIYGIGEPCETSDAVLVSEVP 29635



 Score =  181 bits (460), Expect = 4e-45
 Identities = 159/669 (23%), Positives = 274/669 (40%), Gaps = 82/669 (12%)

Query: 376   DPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDA 435
             DP+    PG P + +  D  R  V + W  P     S V GY ++  +V  + W +CN  
Sbjct: 30028 DPIAP--PGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTT 30085

Query: 436   PVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLR--RLQAVHLEG 493
             P KI +Y +T L +G  Y FRV A N+ G   P+ V   V   + L+     L   + EG
Sbjct: 30086 PTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEG 30145

Query: 494   EKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGS 553
                I + Q    G  ++  P  G       + + +  W   T  G+D     I K     
Sbjct: 30146 ---IFVRQG---GVIRLTIPIKG-------KPFPICKW---TKEGQD-----ISK----- 30179

Query: 554   GSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHG----------LSEPSEITSPI 603
                 R    T+       + +   G S  + ++  N+ G          +  P+    P+
Sbjct: 30180 ----RAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIGSPNSPEGPL 30235

Query: 604   QAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNH 661
             +  D+ V                SV V W  P  +   D+LGY ++        W   + 
Sbjct: 30236 EYDDIQV---------------RSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDS 30280

Query: 662   KPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGIT-LL 720
             +  G +  VV GL    +Y FRV A N  G+S+  +  + +  +  L  P  P     +L
Sbjct: 30281 RVRGTS-LVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVL 30339

Query: 721   NCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSL 780
             +    S++L W  PK  GGS + GYY++++E     W   N +    T+ TV GL   + 
Sbjct: 30340 DVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAE 30399

Query: 781   YEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSG 840
             Y+F+I A N  G+ E S  SE   C+     +P    +L    +   S+ + W+ P   G
Sbjct: 30400 YQFRIIAQNDVGLSETSPASEPVVCKD-PFDKPSQPGELEILSISKDSVTLQWEKPECDG 30458

Query: 841   SSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSD 900
                + GY+V++R+     W   N+    ++   +  L +   Y FRV A N  G+ +P  
Sbjct: 30459 GKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRR 30518

Query: 901   TSEPVLVEARPG--------TKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISD 952
             T+  +  +   G         K+++  + E   +      + + D     W +  +E+  
Sbjct: 30519 TAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPD---IKWYRFGKELIQ 30575

Query: 953   DERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIK 1012
               ++K+ + G    L +   ++ED G Y+        ++++ V + E   +L+  +    
Sbjct: 30576 SRKYKMSSDGRTHTLTVMTEEQEDEGVYTC-------IATNEVGEVETSSKLLLQATPQF 30628

Query: 1013  NPTIPLKSE 1021
             +P  PLK +
Sbjct: 30629 HPGYPLKEK 30637



 Score =  179 bits (453), Expect = 2e-44
 Identities = 155/603 (25%), Positives = 260/603 (43%), Gaps = 78/603 (12%)

Query: 327   KWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGA---- 382
             +W ++  G          L +  E  + +R V++ G S+ S       +DP++       
Sbjct: 14029 EWVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPS-----EPSDPVLCREKLYP 14083

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
             P  P  L+  +  ++   + W  P     SP+  Y V++ +V    W Q  D  VK  K 
Sbjct: 14084 PSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGW-QTVDTTVKDTKC 14142

Query: 443   PVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQD 502
              VT L EG  Y+FRV A N+ G S  + + D+V A D                       
Sbjct: 14143 TVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFT-------------------- 14182

Query: 503   DLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNA 561
                     PGPP  +   ++++ +V L WEPP   G  P+  Y IEK       W +   
Sbjct: 14183 -------TPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAG- 14234

Query: 562   QTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLAS 621
             +TA     + V D++EG    F+V + N  G+  PSE T  +  +D T  PS P  +  +
Sbjct: 14235 KTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVT 14294

Query: 622   RNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVH-GLTTGE 678
                +  + + W  P+      ++GY+V+ C  GT  W   N +PI   +F V  G+   +
Sbjct: 14295 DAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDK 14354

Query: 679   QYIFRVKAVNAVGMSENSQESDVIKVQ---AALTVPSHPYGITLLNCDGHSMTLGWKVPK 735
             +Y+ RV+AVNA+G+SE S+ S+ +  +      T+    + I ++  +G  +++   VP 
Sbjct: 14355 EYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHDIIVI--EGEKLSI--PVPF 14410

Query: 736   FSGGSPILGYYLDKREVHH------KNWHEVNSSPSKPTILTVDGLTEGSLYEFKI---- 785
              +   P + ++ D +EV        KN H +++    P  +  D        E K+    
Sbjct: 14411 RAVPVPTVSWHKDGKEVKASDRLTMKNDH-ISAHLEVPKSVRADAGIYTITLENKLGSAT 14469

Query: 786   AAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVS 845
             A++N+  IG P                 GP  D+   ++  +S  + W+ P + G +P+ 
Sbjct: 14470 ASINVKVIGLP-----------------GPCKDIKASDITKSSCKLTWEPPEFDGGTPIL 14512

Query: 846   GYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPV 905
              Y ++ RE     +I V        +  V DL     Y FRV+AVN  G G+  +   PV
Sbjct: 14513 HYVLERREAGRRTYIPVMSGENKLSW-TVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPV 14571

Query: 906   LVE 908
             + +
Sbjct: 14572 IAQ 14574



 Score =  177 bits (450), Expect = 5e-44
 Identities = 166/627 (26%), Positives = 257/627 (40%), Gaps = 66/627 (10%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICK- 441
             PG P   +  D  +  V + W  P     S ++GYFV+ C++  + WV+CN AP +I + 
Sbjct: 19193 PGKP---EVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQE 19249

Query: 442   -YPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIY 500
              Y  TGL E   Y FR  A  +  IS PS  SD V  L         A ++    ++++ 
Sbjct: 19250 EYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTIL---------AENVPPRIDLSVA 19300

Query: 501   QDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVN 560
                L       G    + A+   +    +SW+      KD  +    K   G     + N
Sbjct: 19301 MKSLL--TVKAGTNVCLDATVFGKPMPTVSWK------KDGTLL---KPAEGIKMAMQRN 19349

Query: 561   AQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLA 620
               T        +F +    S  + + + N  G       T  ++  D    P  P  V  
Sbjct: 19350 LCTL------ELFSVNRKDSGDYTITAENSSG---SKSATIKLKVLDK---PGPPASVKI 19397

Query: 621   SRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGE 678
             ++      ++ W+ P  +   ++  Y VD        W   +   +      V  L  G 
Sbjct: 19398 NKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVS-ATVPITSCSVEKLIEGH 19456

Query: 679   QYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGI----TLLNCDGHSMTLGWKVP 734
             +Y FR+ A N  G+ +      V    A    P  P G      + N     MT+ WK P
Sbjct: 19457 EYQFRICAENKYGVGD-----PVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPP 19511

Query: 735   KFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIG 794
                GGSPI GY L+KRE    NW +VN  P     L   GL EG+ YEF++ A+N AG G
Sbjct: 19512 ADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPG 19571

Query: 795   EPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREE 854
             +PSD S+         P   PA+   +   R +S+ + W  P Y G SP+ GY V+ +  
Sbjct: 19572 KPSDASKAAYARDPQYPPGPPAFPKVYDTTR-SSVSLSWGKPAYDGGSPIIGYLVEVKRA 19630

Query: 855   DAGEWITVN--QTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSE-----PVLV 907
             D+  W+  N  Q     R+ +V+ L +   Y FRV AVN  G   PSD  +      +L+
Sbjct: 19631 DSDNWVRCNLPQNLQKTRF-EVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILI 19689

Query: 908   EARPGTKEISAGVDEQGNIYLGFDCQEMTDAS-----QFTWCKSYEEISDDERFKIETVG 962
                P   E+ A + +   +  G   +           + TW K    + D     I++  
Sbjct: 19690 ---PPEGELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTD 19746

Query: 963   DHSKLYLKNPDKEDLGTYSVSVSDTDG 989
               + L  +N +K D G Y +++ ++ G
Sbjct: 19747 FDTFLRCENVNKYDAGKYILTLENSCG 19773



 Score =  176 bits (445), Expect = 2e-43
 Identities = 164/628 (26%), Positives = 264/628 (42%), Gaps = 59/628 (9%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
             PG P   +  +  R+ V + W  P       + GY V++ ++ + +W++ N   V  C +
Sbjct: 20277 PGKP---EVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAF 20333

Query: 443   PVTGLFEGRSYIFRVRAVNSAG-ISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQ 501
              VT L EG  Y FR+RA N+AG IS PS  ++ +   D            E E    +  
Sbjct: 20334 TVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKD------------EYEAPTIVLD 20381

Query: 502   DDLEGDAQVPGPPTGV--HASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRV 559
               ++    +    T V    S + +     SW   +  GKD     I + +  + +   +
Sbjct: 20382 PTIKDGLTIKAGDTIVLNAISILGKPLPKSSW---SKAGKDIRPSDITQ-ITSTPTSSML 20437

Query: 560   NAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTV--VPSAPGR 617
               + A R                     A  + ++  +   + ++   VTV  VP  PG 
Sbjct: 20438 TIKYATRK-------------------DAGEYTITATNPFGTKVEHVKVTVLDVPGPPGP 20478

Query: 618   VLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLT 675
             V  S  +     + W  P  +    +  Y ++       LW   + + I   R V   L 
Sbjct: 20479 VEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVS-EDIQSCRHVATKLI 20537

Query: 676   TGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPK 735
              G +YIFRV AVN  G  E  Q S+ +K+      P  P    + N   ++ T+ WK P 
Sbjct: 20538 QGNEYIFRVSAVNHYGKGEPVQ-SEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPV 20596

Query: 736   FSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGE 795
               GGS I GY++++RE     W     +P       V GL EGS YEF+++A N AGIG 
Sbjct: 20597 DDGGSEITGYHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGP 20656

Query: 796   PSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREED 855
             PS+ S+    +    P PGP  +    +    S  + W  P Y G   ++GY V+ ++  
Sbjct: 20657 PSEASDSVLMKDAAYP-PGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVG 20715

Query: 856   AGEWITVNQTTTANRYLK--VSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGT 913
                WI  + T TA R  +  V DLQ  + Y FR+ A+N  GVG+P+   +  +VE     
Sbjct: 20716 DEAWIK-DTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAP 20774

Query: 914   K-EISAGVDEQGNIYLGFDCQ-----EMTDASQFTWCKSYEEISDDERFKIETVGDHSKL 967
               E+ A +     +  G   +     +   A + TW K  + I+   R  IE     + L
Sbjct: 20775 DFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTK--DNINLKNRANIENTESFTLL 20832

Query: 968   YLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
              +   ++ D G + +++ +  G  S FV
Sbjct: 20833 IIPECNRYDTGKFVMTIENPAGKKSGFV 20860



 Score =  174 bits (442), Expect = 4e-43
 Identities = 154/640 (24%), Positives = 249/640 (38%), Gaps = 84/640 (13%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
             PG P   +    +++ + V W PP       + GYF+++ E  +  WV  N + +   + 
Sbjct: 18396 PGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRM 18455

Query: 443   PVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQD 502
              V  L     Y FRV+A N  GI  PS  S  V A DP++                    
Sbjct: 18456 KVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIE-------------------- 18495

Query: 503   DLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIE-KSVVGSGS----W 556
                     PGPPT     + +++ + L W  P   G  P++ Y +E +  +   S    W
Sbjct: 18496 -------PPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGW 18548

Query: 557   QRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPS--- 613
             +R NA   +    + V  L E + Y FRV + N+ G+  P+E+   I+ +++   P    
Sbjct: 18549 KRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDL 18608

Query: 614   -------------APGRVLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCN 660
                           P R+ A    + +  V W +   +  +    VD       L  P +
Sbjct: 18609 DASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNS 18668

Query: 661   HKPIGYNRFVVHGLTTGEQYIF-RVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITL 719
              +       +      GE+ +F  V+ ++  G   + + SDV K                
Sbjct: 18669 TRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKT--------------- 18713

Query: 720   LNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGS 779
                   S  + W  P+  GGS +  Y ++KRE   K W  V     K T   V  L  G+
Sbjct: 18714 ------SCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVKK-TSFHVTNLVPGN 18766

Query: 780   LYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYS 839
              Y F++ AVN  G G P+D  +        + EP P   L   E+   S  + W  P+  
Sbjct: 18767 EYYFRVTAVNEYGPGVPTDVPKPVLASD-PLSEPDPPRKLEVTEMTKNSATLAWLPPLRD 18825

Query: 840   GSSPVSGYFVDFREED--AGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGK 897
             G + + GY   +REE+  A  W     +   +  L V+ L++GK Y FRV A NA GV  
Sbjct: 18826 GGAKIDGYITSYREEEQPADRW--TEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSL 18883

Query: 898   PSDTSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDA-----SQFTWCKSYEEISD 952
             P +     + EA+         + EQ  I  G   +              W K  +E+  
Sbjct: 18884 PREAEG--VYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVT 18941

Query: 953   DERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSS 992
                  +      S L +K+  ++D G YS++  ++ G  +
Sbjct: 18942 SSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDT 18981



 Score =  173 bits (439), Expect = 1e-42
 Identities = 157/607 (25%), Positives = 254/607 (41%), Gaps = 62/607 (10%)

Query: 312   PRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLF 371
             P  +W + +  +  S    +   +  + L    + + D G Y+L   +  G       + 
Sbjct: 18928 PTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVV 18987

Query: 372   VRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQ 431
             V DA     G P  P D+   D + D   ++W  P     S +  Y V++C+V   +WV 
Sbjct: 18988 VMDAP----GPPQPPFDIS--DIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVT 19041

Query: 432   CNDAPVKI-CKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVH 490
                +  K  C+  V  L  G+ YIFRVRA N  GIS P                      
Sbjct: 19042 ALASVTKTSCR--VGKLIPGQEYIFRVRAENRFGISEP---------------------- 19077

Query: 491   LEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKS 549
             L   K +A +         VP  P     ++++++ + ++W+ P   G  P++ Y IE+ 
Sbjct: 19078 LTSPKMVAQFPFG------VPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERK 19131

Query: 550   VVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVT 609
                S  W + N  T VRS  Y    L+EG  Y FR+ + N+ G S PS+ T  + A+ + 
Sbjct: 19132 ERNSLLWVKAN-DTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTAR-MP 19189

Query: 610   VVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKP--IG 665
             V P  PG+      TK++V + W RPKH+    ++GY+V+ C    + W  CN  P  I 
Sbjct: 19190 VDP--PGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIP 19247

Query: 666   YNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNC--- 722
                +   GL    QY FR  A  AV +S  S+ SD + + A    P     + + +    
Sbjct: 19248 QEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTV 19307

Query: 723   -DGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLY 781
               G ++ L   V  F    P + +  D   +      ++    +  T L +  +      
Sbjct: 19308 KAGTNVCLDATV--FGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCT-LELFSVNRKDSG 19364

Query: 782   EFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGS 841
             ++ I A N +G       S+    +   + +PGP   +   ++     ++ W+ P+  G 
Sbjct: 19365 DYTITAENSSG-------SKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGG 19417

Query: 842   SPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDT 901
             S ++ Y VD RE     W  V+ T        V  L +G  Y FR+ A N  GVG P  T
Sbjct: 19418 SEITNYIVDKRETSRPNWAQVSATVPITS-CSVEKLIEGHEYQFRICAENKYGVGDPVFT 19476

Query: 902   SEPVLVE 908
              EP + +
Sbjct: 19477 -EPAIAK 19482



 Score =  172 bits (437), Expect = 2e-42
 Identities = 163/628 (25%), Positives = 259/628 (41%), Gaps = 61/628 (9%)

Query: 292   GETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQ-ASLSFSHLHKDDE 350
             GET  L+  +   P      P   W +D   L+E+          Q  +L      + D 
Sbjct: 24722 GETFVLEADIRGKPI-----PDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDG 24776

Query: 351   GLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTT 410
             G Y L++ + GG       + V D      G P  P+ +    A + Y+   W PP    
Sbjct: 24777 GQYILKLSNVGGTKSIPITVKVLDRP----GPPEGPLKVTGVTAEKCYL--AWNPPLQDG 24830

Query: 411   ESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSR 470
              + +  Y +++ E    +W Q +   V+   Y VT L  G  YIFRV AVN  GI  P  
Sbjct: 24831 GANISHYIIEKRETSRLSWTQVS-TEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLE 24889

Query: 471   VSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLS 530
              S  V A +P                            + PGPP+    S I+++ +V++
Sbjct: 24890 -SGPVTACNPY---------------------------KPPGPPSTPEVSAITKDSMVVT 24921

Query: 531   WEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSAN 589
             W  P   G   +  Y +EK       W + N +T +   R  V  L EG SY FRV + N
Sbjct: 24922 WARPVDDGGTEIEGYILEKRDKEGVRWTKCNKKT-LTDLRLRVTGLTEGHSYEFRVAAEN 24980

Query: 590   RHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVD 647
               G+ EPSE +   +A D    P  P     +  +++SV + W +P ++    + GY V+
Sbjct: 24981 AAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVE 25040

Query: 648   CCVAGTNLWEPCNHKPIGY--NRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQ 705
                A  + W  C   P G    +F V  L    +Y FR+ A+N+ G+ E +     +  Q
Sbjct: 25041 VKEAAADEWTTCT-PPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQ 25099

Query: 706   AALTVPSHPYGITLLNCD--GHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSS 763
               +  P       L        S TL   V       P + +   +  +  +   EV SS
Sbjct: 25100 ERIEPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSS 25159

Query: 764   PSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCE 823
                 T+L +D +T      + +   N +G       S+        +  P    +LT  E
Sbjct: 25160 ---FTMLVIDNVTRFDSGRYNLTLENNSG-------SKTAFVNVRVLDSPSAPVNLTIRE 25209

Query: 824   VRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTY 883
             V+  S+ + W+ P+  G + ++ Y V+ RE     + T+    T   + ++ +LQ+G +Y
Sbjct: 25210 VKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKTTF-RIENLQEGCSY 25268

Query: 884   VFRVRAVNANGVGKPSDTSEPVLVEARP 911
              FRV A N  G+G P++T+EPV V   P
Sbjct: 25269 YFRVLASNEYGIGLPAETTEPVKVSEPP 25296



 Score =  172 bits (436), Expect = 2e-42
 Identities = 149/603 (24%), Positives = 243/603 (40%), Gaps = 66/603 (10%)

Query: 309   RVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSA 368
             R  P   W R++    +    ++  G     LS  +  ++D G Y L++ +  G    SA
Sbjct: 24051 RPTPEITWSREEGEFTDK--VQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSG--SKSA 24106

Query: 369   FLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNN 428
             F+ V+  D      PG P +L   +  +D   + W+PP     + V  Y +D+ E     
Sbjct: 24107 FVTVKVLD-----TPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKA 24161

Query: 429   WVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQA 488
             +   +    K   + V  L EG  Y FRV A N  G+  P    DAV A +P        
Sbjct: 24162 YANVSSKCSKT-SFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEP-------- 24212

Query: 489   VHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIE 547
                                   P PP  V  +++S+    L WE P   G   ++ Y +E
Sbjct: 24213 ----------------------PSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVE 24250

Query: 548   KSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQD 607
                 G+  W  V       +    V  L  G+ Y FRV + N  G S+P  +  P+ A+D
Sbjct: 24251 MQPKGTEKWSIVAESKVCNA---VVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKD 24307

Query: 608   VTVVPSA-----PGRVLASRNTKTSV-VVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNH 661
             +T+ PS         + A  + K  + V+   RP          +     G  L +    
Sbjct: 24308 LTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPN---------ISWVKDGEPLKQTTRV 24358

Query: 662   KPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYG-ITLL 720
                      V  +  G +  F    V A   +  + E+  + V   L  P  P G +   
Sbjct: 24359 NVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIV---LEKPGPPVGPVRFD 24415

Query: 721   NCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSL 780
                   + + W+ P ++GG  I  Y ++KR+     WH V+++ ++ TI  +  L  G+ 
Sbjct: 24416 EVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTI-KITKLKTGTE 24474

Query: 781   YEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSG 840
             Y+F+I A N  G   P D         +   EPGP        +    +++ W  PV  G
Sbjct: 24475 YQFRIFAENRYGKSAPLDSKA--VIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDG 24532

Query: 841   SSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSD 900
              + + GY ++ +E+++  W+ +N+T   +   K + L +G  Y F+V A N  G+GKPS 
Sbjct: 24533 GTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSK 24592

Query: 901   TSE 903
              SE
Sbjct: 24593 VSE 24595



 Score =  172 bits (435), Expect = 3e-42
 Identities = 170/703 (24%), Positives = 284/703 (40%), Gaps = 123/703 (17%)

Query: 353   YTLRIVSRG--GVSDHSA-FLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTT 409
             Y  R+ +    GV + S   +F R  D L    PG P + +  D +R  V + W  P   
Sbjct: 24972 YEFRVAAENAAGVGEPSEPSVFYRACDALYP--PGPPSNPKVTDTSRSSVSLAWSKPIYD 25029

Query: 410   TESPVMGYFVDRCEVGTNNWVQCNDAP-VKICKYPVTGLFEGRSYIFRVRAVNSAGISRP 468
               +PV GY V+  E   + W  C     ++  ++ VT L E   Y FR+ A+NS G+  P
Sbjct: 25030 GGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEP 25089

Query: 469   SRVSDAVAALDPL---------DLRRLQA----------VHLEGEKEIAIYQDDLEG--- 506
             + +  +V A + +         DLR++            V ++G  E  +  +  EG   
Sbjct: 25090 ATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT 25149

Query: 507   -DAQV--------------------------------------------PGPPTGVHASE 521
               AQ+                                            P  P  +   E
Sbjct: 25150 DRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIRE 25209

Query: 522   ISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKS 580
             + ++ V LSWEPP   G   +  Y +EK      ++  +       +  + + +L EG S
Sbjct: 25210 VKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKTT--FRIENLQEGCS 25267

Query: 581   YVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE-- 638
             Y FRVL++N +G+  P+E T P++   V+  P  PGRV     T+ +  ++W++P+ +  
Sbjct: 25268 YYFRVLASNEYGIGLPAETTEPVK---VSEPPLPPGRVTLVDVTRNTATIKWEKPESDGG 25324

Query: 639   EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQ- 697
               + GY V+    G+  W  C    +      + GLT GE+Y+FRV AVN  G S+  Q 
Sbjct: 25325 SKITGYVVEMQTKGSEKWSTCTQ--VKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQL 25382

Query: 698   ----ESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVH 753
                  +  I+++ ++ +P H + +           L   VP        + +  D + + 
Sbjct: 25383 GVPVIARDIEIKPSVELPFHTFNVKARE------QLKIDVPFKGRPQATVNWRKDGQTL- 25435

Query: 754   HKNWHEVNSSPSKP-TILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPE 812
              K    VN S SK  T L++   ++  +  +++   N AG       S         +  
Sbjct: 25436 -KETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAG-------SITVPITIIVLDR 25487

Query: 813   PGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYL 872
             PGP   +   EV   S+ + W  P Y G   +S Y V+ +E  +  W  V+Q   A   +
Sbjct: 25488 PGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQ-AVARTSI 25546

Query: 873   KVSDLQQGKTYVFRVRAVNANGVGKPSDTSE-----PVLVEARPGTKEI----------- 916
             K+  L  G  Y FRV A N  G    S++S      P      PGT ++           
Sbjct: 25547 KIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVT 25606

Query: 917   -SAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKI 958
                 V++ G+  +G+   E  + S   W K+ + +  D + K+
Sbjct: 25607 WQVPVNDGGSRVIGYHL-EYKERSSILWSKANKILIADTQMKV 25648



 Score =  171 bits (434), Expect = 4e-42
 Identities = 161/542 (29%), Positives = 240/542 (44%), Gaps = 50/542 (9%)

Query: 376   DPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDA 435
             DPL  G P +P  L   +  +  + + WK P +   SP+ GY +++      ++ + N  
Sbjct: 15290 DPL--GPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKR 15347

Query: 436   PVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEK 495
                   + V  L E + Y FRV+AVN  G S PS   + V   D +       + + G+ 
Sbjct: 15348 LCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDT 15407

Query: 496   EIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGS 555
                   + +   A V G P  +   E S+N  V+  E PT    D L   I K  V    
Sbjct: 15408 IKVKAGEPVHIPADVTGLP--MPKIEWSKNETVI--EKPT----DALQ--ITKEEV---- 15453

Query: 556   WQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVV--PS 613
               R  A+T +  P+     + E K   + V ++NR G        S  +   V V   PS
Sbjct: 15454 -SRSEAKTELSIPK----AVREDKG-TYTVTASNRLG--------SVFRNVHVEVYDRPS 15499

Query: 614   APGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNL--WEPCNHKPIGYNRF 669
              P  +  +     S  + WD P      ++  Y +D   A      WE   +  +   R+
Sbjct: 15500 PPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAV-EKRY 15558

Query: 670   VVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTL 729
              +  L    QY FRV+AVN  G+S+   +SD + +Q    +P  P    +L     SM +
Sbjct: 15559 GIWKLIPNGQYEFRVRAVNKYGISDEC-KSDKVVIQDPYRLPGPPGKPKVLARTKGSMLV 15617

Query: 730   GWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSP-----SKPTILTVDGLTEGSLYEFK 784
              W  P  +GGSPI GY+L+KRE     W  V+ +P      K     V  L EG  Y+F+
Sbjct: 15618 SWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFR 15677

Query: 785   IAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPV 844
               A+N AGIG PS+PS+         P PGP       +   +S+ + WK P   G SP+
Sbjct: 15678 AMAINAAGIGPPSEPSDPEVAGDPIFP-PGPPSCPEVKDKTKSSISLGWKPPAKDGGSPI 15736

Query: 845   SGYFVDFREEDAGEWITVNQ----TTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSD 900
              GY V+ +EE   +W  VN+     TT      V +L++ + Y FRV+AVN  G  +PSD
Sbjct: 15737 KGYIVEMQEEGTTDWKRVNEPDKLITTCE--CVVPNLKELRKYRFRVKAVNEAGESEPSD 15794

Query: 901   TS 902
             T+
Sbjct: 15795 TT 15796



 Score =  171 bits (433), Expect = 5e-42
 Identities = 165/648 (25%), Positives = 245/648 (37%), Gaps = 83/648 (12%)

Query: 281   LEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVL--LKESKWTKMFFGEGQA 338
             L+  GV   + G+T+ L+  +   P      P   W +D     L  S   K+      +
Sbjct: 18205 LKLSGVLTVKAGDTIRLEAGVRGKPF-----PEVAWTKDKDATDLTRSPRVKIDTRADSS 18259

Query: 339   SLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDY 398
               S +   + D G Y +   +  G        FV  A   V   PG   +L+  D + D 
Sbjct: 18260 KFSLTKAKRSDGGKYVVTATNTAGS-------FVAYATVNVLDKPGPVRNLKIVDVSSDR 18312

Query: 399   VIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVR 458
               V W PP       +  Y +++CE     W     A V      VT L EG  YIFRVR
Sbjct: 18313 CTVCWDPPEDDGGCEIQNYILEKCETKRMVW-STYSATVLTPGTTVTRLIEGNEYIFRVR 18371

Query: 459   AVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVH 518
             A N  G   P+     +A                            +     PG P    
Sbjct: 18372 AENKIGTGPPTESKPVIA----------------------------KTKYDKPGRPDPPE 18403

Query: 519   ASEISRNYVVLSWEPPT-PRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLME 577
              +++S+  + + W PP    GK    YF+EK    S  W  VN ++A+   R  V +L+ 
Sbjct: 18404 VTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVN-KSAIPERRMKVQNLLP 18462

Query: 578   GKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKH 637
                Y FRV + N  G+ EPS  + P+ A+D    P  P        TK S+ + W +P +
Sbjct: 18463 DHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTKHSITLGWGKPVY 18522

Query: 638   E--EDLLGYYVD-----CCVAGTNLWEPCN-HKPIGYNRFVVHGLTTGEQYIFRVKAVNA 689
             +    ++GY V+        +    W+ CN    +    F V  L   ++Y FRV A N 
Sbjct: 18523 DGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQ 18582

Query: 690   VGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDK 749
             VG+   ++  + IK +  L  P      ++            K+     G PI  + + +
Sbjct: 18583 VGIGRPAELKEAIKPKEILEPPEIDLDASMR-----------KLVIVRAGCPIRLFAIVR 18631

Query: 750   -REVHHKNWHEVN----------SSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSD 798
              R      W +V                   L +   T     ++ +  VN AG      
Sbjct: 18632 GRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAG------ 18685

Query: 799   PSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGE 858
               +        +  PGP  DL   +V  TS  + W  P   G S V+ Y V+ RE D   
Sbjct: 18686 -EKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKT 18744

Query: 859   WITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVL 906
             W TV        +  V++L  G  Y FRV AVN  G G P+D  +PVL
Sbjct: 18745 WSTVTPEVKKTSF-HVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVL 18791



 Score =  171 bits (433), Expect = 5e-42
 Identities = 160/655 (24%), Positives = 271/655 (41%), Gaps = 62/655 (9%)

Query: 364   SDHSAFLFVRDADPL-VTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRC 422
             +++   L  + ADP+ V   P  P  +   D  R+ V ++W  P     S ++ Y V+  
Sbjct: 23111 NEYGIGLPAQTADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQ 23170

Query: 423   EVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLD 482
                +  W +C  A VK  +  +T L +G  Y+FRV AVN  G S P  ++  + A D + 
Sbjct: 23171 AKHSEKWSEC--ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLV- 23227

Query: 483   LRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPL 542
                   +  + +   + Y   +  D ++  P +G       R    ++W           
Sbjct: 23228 ------IEPDVKPAFSSYSVQVGQDLKIEVPISG-------RPKPTITWT---------- 23264

Query: 543   MYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSP 602
                  K  +      R+N   ++     ++ +  +     + +  AN  G     + T+ 
Sbjct: 23265 -----KDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVG-----QKTAS 23314

Query: 603   IQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEE--DLLGYYVDCCVAGTNLWEPCN 660
             I+   +       G V     +  S+ + W+ P +     +  Y V      T +W+  +
Sbjct: 23315 IEIVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVS 23374

Query: 661   HKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLL 720
                +      V  L TG +Y FR+ A N  G S  + ESD I  Q     P  P      
Sbjct: 23375 -ATVARTTLKVTKLKTGTEYQFRIFAENRYGQSF-ALESDPIVAQYPYKEPGPPGTPFAT 23432

Query: 721   NCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSL 780
                  SM + W  P  +GGSP++GY+L+++E +   W +VN +    T      L EG  
Sbjct: 23433 AISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIE 23492

Query: 781   YEFKIAAVNLAGIGEPSDPSEHF----KCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAP 836
             YEF++ A N+ G+G+ S  SE +     C+    PEP          V+   + + W  P
Sbjct: 23493 YEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEP--------IMVKRNEITLQWTKP 23544

Query: 837   VYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANG-V 895
             VY G S ++GY V+ R+   G W+  + T        VS L + + Y FRV A NA G +
Sbjct: 23545 VYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAI 23604

Query: 896   GKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDAS-------QFTWCKSYE 948
              KPSD++ P+  +       IS     +  I +        +A           W +  +
Sbjct: 23605 SKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDK 23664

Query: 949   EISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELER 1003
             EI +  R +I+     + L +K+  + D G Y +  S+  G S SF ++ + L+R
Sbjct: 23665 EIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAG-SKSFPVNVKVLDR 23718



 Score =  170 bits (431), Expect = 8e-42
 Identities = 168/685 (24%), Positives = 281/685 (41%), Gaps = 86/685 (12%)

Query: 305   PDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVS 364
             P + R +P   W +D   LK++    +        L     +KDD G YT+   +  G +
Sbjct: 24334 PVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTA 24393

Query: 365   DHSAFLFVRDADPLVTGAPGAPMD-LQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCE 423
               +  + V +        PG P+  ++  + + D+V+++W+PP  T    +  Y V++ +
Sbjct: 24394 TENLSVIVLEK-------PGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRD 24446

Query: 424   VGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDL 483
               T  W   + A V      +T L  G  Y FR+ A N  G S P               
Sbjct: 24447 TTTTTWHMVS-ATVARTTIKITKLKTGTEYQFRIFAENRYGKSAP--------------- 24490

Query: 484   RRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM 543
                    L+ +  I  Y        + PGPP     + IS++ +++ W  P   G   ++
Sbjct: 24491 -------LDSKAVIVQYP------FKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKII 24537

Query: 544   -YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSP 602
              Y +E+    S  W ++N +T ++  ++    L EG  Y F+V + N  G+ +PS+++  
Sbjct: 24538 GYHLEQKEKNSILWVKLN-KTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSEC 24596

Query: 603   IQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCN 660
               A+D    P  P  ++ +RN   +V ++W +P ++    + GY V+        W   +
Sbjct: 24597 FVARDPCDPPGRPEAIVITRN---NVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKAS 24653

Query: 661   HKPIGYNRFVVHGLTTGEQYIFRVKAVNAVG-MSENSQESDVIKVQAALTVPS----HPY 715
                +    F V GL   ++Y FRV A NA G  SE S  S  I  +  +  P+      Y
Sbjct: 24654 FTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKY 24713

Query: 716   GITLLNCDGHSMTLGWKVPKFSGGSPI--LGYYLDKREVHHKNWH-EVNSSPSKPTILTV 772
                ++   G +  L   +     G PI  + +  D +E+       E+ S+  K T++  
Sbjct: 24714 KDVIVVHAGETFVLEADI----RGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVK 24769

Query: 773   DGL-TEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAY-DLTFCEVRDTSLV 830
             D + T+G  Y  K++ V     G  S P          +  PGP    L    V      
Sbjct: 24770 DCIRTDGGQYILKLSNVG----GTKSIP-----ITVKVLDRPGPPEGPLKVTGVTAEKCY 24820

Query: 831   MLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAV 890
             + W  P+  G + +S Y ++ RE     W  V+    A  Y KV+ L  G  Y+FRV AV
Sbjct: 24821 LAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNY-KVTKLLPGNEYIFRVMAV 24879

Query: 891   NANGVGKPSDTS-----EPVLVEARPGTKEISA------------GVDEQGNIYLGFDCQ 933
             N  G+G+P ++       P      P T E+SA             VD+ G    G+   
Sbjct: 24880 NKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGY-IL 24938

Query: 934   EMTDASQFTWCKSYEEISDDERFKI 958
             E  D     W K  ++   D R ++
Sbjct: 24939 EKRDKEGVRWTKCNKKTLTDLRLRV 24963



 Score =  169 bits (429), Expect = 1e-41
 Identities = 139/511 (27%), Positives = 223/511 (43%), Gaps = 34/511 (6%)

Query: 677   GEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKF 736
             G +YIFRV+AVN  G+ E   ESD +  + A   P  P    +     +SMT+ W  P  
Sbjct: 27033 GNEYIFRVRAVNKYGIGE-PLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIA 27091

Query: 737   SGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEP 796
              GGS I GY+L+KR+     W +V     + T   V GLTE S Y++++ AVN AG G  
Sbjct: 27092 DGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPF 27151

Query: 797   SDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDA 856
             S+PSE +K  A  +  PGP   +   +   +S+ + W  PVY G S V+GY V+ R+ + 
Sbjct: 27152 SEPSEFYKA-ADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEE 27210

Query: 857   GEWITVNQ--TTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTK 914
              EW TV+         Y+ VS+L+ G  Y FRV AVN  G G+P + +EPV  +      
Sbjct: 27211 EEWTTVSTKGEVRTTEYV-VSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAP 27269

Query: 915   EISAGVDEQGNIY--LGFDCQEM-----TDASQFTWCKSYEEISDDERFKIETVGDHSKL 967
             EI   V  + ++    G D Q +           TW K  + +  D R+ IE     S L
Sbjct: 27270 EIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLL 27329

Query: 968   YLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSN-EIKN------------P 1014
              +    + D G Y +++ +  G   S  +  + L+   A    ++K+            P
Sbjct: 27330 TIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPP 27389

Query: 1015  TIPLKSELAYEIFDK--GRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGI 1072
              I   S +   + +K     R W    H     S++ I  D         R+  +   GI
Sbjct: 27390 LIDGGSPIINYVIEKRDATKRTWSVVSHKCSSTSFKLI--DLSEKTPFFFRVLAENEIGI 27447

Query: 1073  IEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHF 1132
              E       ++        I D   K  +   +I    K   +      +  + ++G   
Sbjct: 27448 GEPCETTEPVK-AAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGE 27506

Query: 1133  AEYLHWDVTEECEVRLVCKVANTKKETVFKW 1163
               + H  +++ CE+    +V+  K+++V ++
Sbjct: 27507 QTWSHAGISKTCEI----EVSQLKEQSVLEF 27533



 Score =  169 bits (429), Expect = 1e-41
 Identities = 160/636 (25%), Positives = 264/636 (41%), Gaps = 66/636 (10%)

Query: 302   LVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRG 361
             L  P   + +P   W +D + LKES++ +    E + +LS  +  K+  G YT+      
Sbjct: 27583 LELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTV------ 27636

Query: 362   GVSDHSAFLFVRDADPLVTGAPGAPMD-LQCHDANRDYVIVTWKPPNTTTESPVMGYFVD 420
              + D++          +  G P  P   ++  +   D VI++W  P       +  Y ++
Sbjct: 27637 -ILDNAVCRIAVPITVITLGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIE 27695

Query: 421   RCEVGTNNW-VQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALD 479
             + E    NW + C+       K P   L +   Y FRVRA N  G+S+P   S  VA   
Sbjct: 27696 KRETSQTNWKMVCSSVARTTFKVP--NLVKDAEYQFRVRAENRYGVSQPLVSSIIVA--- 27750

Query: 480   PLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGK 539
                                      +   ++PGPP       ++ + + L+W+ P   G 
Sbjct: 27751 -------------------------KHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGG 27785

Query: 540   DPLMYF-IEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSE 598
               +  F +EK    S  WQ+VN  + +    Y    L+EG  Y FRV + N  GLS PS+
Sbjct: 27786 SEVTGFHVEKKERNSILWQKVNT-SPISGREYRATGLVEGLDYQFRVYAENSAGLSSPSD 27844

Query: 599   ITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLW 656
              +    A      P  P  +  +R T   + ++W+ P  +    ++GY ++    G   W
Sbjct: 27845 PSKFTLAVSPVDPPGTPDYIDVTRET---ITLKWNPPLRDGGSKIVGYSIE-KRQGNERW 27900

Query: 657   EPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVG-MSENSQESDVIKVQAALTVPSHPY 715
               CN   +   ++ V GL+ G++Y FR+ A NAVG +S  SQ S +I  +     P   +
Sbjct: 27901 VRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEF 27960

Query: 716   GITLLNCDGHSMTLG--WKVPKFSGGSPI--LGYYLDKREVHHKNWHEVNSSPSKPTILT 771
             G      DG  +  G   ++     G P+  + ++ D  E+  +   E+       T L 
Sbjct: 27961 GPEYF--DGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGS-TSLF 28017

Query: 772   VDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAY-DLTFCEVRDTSLV 830
             V   T      + + A N +G       S   + +      PG     + F  +    + 
Sbjct: 28018 VRDATRDHRGVYTVEAKNASG-------SAKAEIKVKVQDTPGKVVGPIRFTNITGEKMT 28070

Query: 831   MLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAV 890
             + W AP+  G +P++ Y ++ RE     W  +     A  Y  +  L  G  Y FRV AV
Sbjct: 28071 LWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIK-LINGNEYQFRVSAV 28129

Query: 891   NANGVGKPSDTSEPVLVEARPGTKEISAGVDEQGNI 926
             N  GVG+P D S+PV+ + +  T   + G+ E  NI
Sbjct: 28130 NKFGVGRPLD-SDPVVAQIQ-YTVPDAPGIPEPSNI 28163



 Score =  169 bits (427), Expect = 2e-41
 Identities = 159/618 (25%), Positives = 253/618 (40%), Gaps = 50/618 (8%)

Query: 382   APGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICK 441
             AP  P  L   D  +  V + W  P     S + GY ++    G++ W       VK  +
Sbjct: 20964 APSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITT--VKGLE 21021

Query: 442   YPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQ 501
               V  L EG  Y F+V AVNSAG S P R S  V   +   L  L    +  +  IA   
Sbjct: 21022 CVVRNLTEGEEYTFQVMAVNSAGRSAP-RESRPVIVKEQTMLPELDLRGIYQKLVIAKAG 21080

Query: 502   DDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNA 561
             D+++ +  V G P              ++W+    +G   L              QRVN 
Sbjct: 21081 DNIKVEIPVLGRPKPT-----------VTWK----KGDQILK-----------QTQRVNF 21114

Query: 562   QTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLAS 621
             +T   S    + + +   S  + + + N  G  E  ++ + IQ  D+   P+ P  +   
Sbjct: 21115 ETTATSTILNINECVRSDSGPYPLTARNIVG--EVGDVIT-IQVHDIPGPPTGP--IKFD 21169

Query: 622   RNTKTSVVVQWDRPKHEED--LLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQ 679
               +   V   WD P+++    +  Y V+     +  W       I    +    LTTG +
Sbjct: 21170 EVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTVIR-TTYKATRLTTGLE 21228

Query: 680   YIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGG 739
             Y FRVKA N  G+      + ++       VP  P    +      SMT+ W  P   GG
Sbjct: 21229 YQFRVKAQNRYGVGPGITSACIV-ANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGG 21287

Query: 740   SPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDP 799
             SPILGY+++++E +   W  V+ +     I    GLT+G  YEF++ A N+AG  +PS P
Sbjct: 21288 SPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKP 21347

Query: 800   SEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEW 859
             SE         P PG    L    +   ++ + W  P Y+G   ++ Y V+ R+   G W
Sbjct: 21348 SEPMLALDPIDP-PGKPVPL---NITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRW 21403

Query: 860   ITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANG-VGKPSDTSEPVLVEARPGTKEISA 918
             +  N +        VS L +   Y FRV A NA G +  PS+ S+ +         +I  
Sbjct: 21404 LKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKV 21463

Query: 919   GVDEQGNIYL--GFDCQEMTDAS-----QFTWCKSYEEISDDERFKIETVGDHSKLYLKN 971
              V  +  + L  G   +   D S        W K  +E+    + +I+     + L  K+
Sbjct: 21464 DVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKD 21523

Query: 972   PDKEDLGTYSVSVSDTDG 989
               + D G Y+++ ++  G
Sbjct: 21524 STRRDSGAYTLTATNPGG 21541



 Score =  168 bits (426), Expect = 3e-41
 Identities = 145/581 (24%), Positives = 244/581 (41%), Gaps = 63/581 (10%)

Query: 335   EGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDA 394
             +G++ L      + D GLY +++ +  G++     + V D        PG P++    D 
Sbjct: 14761 KGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDT-------PGPPINFVFEDI 14813

Query: 395   NRDYVIVTWKPPNTTTESPVMGYFVDRCE--VGTNNWVQCNDAPVKICKYPVTGLFEGRS 452
              +  V+  W+PP     S ++ Y +++ +     + W+    + ++ CKY VT L EG+ 
Sbjct: 14814 RKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVT-STLRHCKYSVTKLIEGKE 14872

Query: 453   YIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPG 512
             Y+FRVRA N  G   P  VS  + A DP                         G    P 
Sbjct: 14873 YLFRVRAENRFGPGPPC-VSKPLVAKDPF------------------------GPPDAPD 14907

Query: 513   PPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAV 572
              P      +++ N +++ W  P   G   L Y++EK  V S  W RVN ++ + + +  V
Sbjct: 14908 KPI---VEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVN-KSLLNALKANV 14963

Query: 573   FDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQW 632
               L+EG +YVFRV + N  G  + S  + P  A D  + P  P     +  + T++ ++W
Sbjct: 14964 DGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTAHD-PISPPGPPIPRVTDTSSTTIELEW 15022

Query: 633   DRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAV 690
             + P      +++GY+VD  + GTN W  C  K I   ++ V  +  G  Y  RV AVNA 
Sbjct: 15023 EPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAA 15082

Query: 691   GMSENSQESDVIKVQAALTVPSHPYGITL-LNCDGHSMTLGWK---VPKFSGGSPILGYY 746
             G     +   V      +  P  P  + L ++  G    +  K   +P    G P+    
Sbjct: 15083 GEGPPGETQPV-----TVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKV 15137

Query: 747   LDKREVH-HKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
               K E    K+   +++  +K  ++  D L +     + I A N  G       S+    
Sbjct: 15138 WTKEEGELDKDRVVIDNVGTKSELIIKDALRKDH-GRYVITATNSCG-------SKFAAA 15189

Query: 806   EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQT 865
                    PGP  DL          ++ W  P   G S ++G+ ++ ++     W    +T
Sbjct: 15190 RVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIET 15249

Query: 866   TTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVL 906
               +     ++ L +G+ Y FRV A N  G G P +   P+L
Sbjct: 15250 ERSK--CDITGLLEGQEYKFRVIAKNKFGCGPPVEIG-PIL 15287



 Score =  167 bits (424), Expect = 5e-41
 Identities = 156/610 (25%), Positives = 250/610 (40%), Gaps = 58/610 (9%)

Query: 305   PDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVS 364
             P L R +P   W + D +LK+++            L+ +   + D G Y L   +R  V 
Sbjct: 21088 PVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPL--TARNIVG 21145

Query: 365   DHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEV 424
             +    + ++  D  + G P  P+     + + D+V  +W PP      P+  Y V+  + 
Sbjct: 21146 EVGDVITIQVHD--IPGPPTGPIKFD--EVSSDFVTFSWDPPENDGGVPISNYVVEMRQT 21201

Query: 425   GTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLR 484
              +  WV+     ++   Y  T L  G  Y FRV+A N  G+  P   S  + A  P    
Sbjct: 21202 DSTTWVELATTVIR-TTYKATRLTTGLEYQFRVKAQNRYGVG-PGITSACIVANYPF--- 21256

Query: 485   RLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM- 543
                                     +VPGPP     + ++++ + +SW  P   G  P++ 
Sbjct: 21257 ------------------------KVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILG 21292

Query: 544   YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPI 603
             Y +E+       WQ V ++  V    +    L +G +Y FRV++ N  G S+PS+ + P+
Sbjct: 21293 YHVERKERNGILWQTV-SKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPM 21351

Query: 604   QAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEE--DLLGYYVDCCVAGTNLWEPCNH 661
              A D       PG+ +    T+ +V ++W +P++     +  Y V+        W   N 
Sbjct: 21352 LALDPI---DPPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANF 21408

Query: 662   KPIGYNRFVVHGLTTGEQYIFRVKAVNAVG-MSENSQESDVIKVQAALTVPSHPYGI--- 717
               I  N F V GLT    Y FRV A NA G +S  S+ SD I  +  +  P     +   
Sbjct: 21409 SNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFK 21468

Query: 718   -TLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLT 776
              T++   G +  L   V       P + +  D +E+      E+  +     ++  D  T
Sbjct: 21469 DTVILKAGEAFRLEADVS--GRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDS-T 21525

Query: 777   EGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAP 836
                   + + A N  G  +       F  +    P P P   L   EV     V+ W  P
Sbjct: 21526 RRDSGAYTLTATNPGGFAK-----HIFNVKVLDRPGP-PEGPLAVTEVTSEKCVLSWFPP 21579

Query: 837   VYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVG 896
             +  G + +  Y V  RE     W  V       + LKV+ L +G  Y+FRV AVN  GVG
Sbjct: 21580 LDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTK-LKVTKLLKGNEYIFRVMAVNKYGVG 21638

Query: 897   KPSDTSEPVL 906
             +P + SEPVL
Sbjct: 21639 EPLE-SEPVL 21647



 Score =  167 bits (424), Expect = 5e-41
 Identities = 158/611 (25%), Positives = 256/611 (41%), Gaps = 64/611 (10%)

Query: 309   RVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSA 368
             R +P   W +D + LK++    +       +LS    HKDD G Y + + +  G    S 
Sbjct: 23256 RPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASI 23315

Query: 369   FLFVRDA-DPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTN 427
              +   D  DP     P  P+     D + + + ++W PP  T    +  Y V + +  T 
Sbjct: 23316 EIVTLDKPDP-----PKGPVKFD--DVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTT 23368

Query: 428   NWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQ 487
              W     A V      VT L  G  Y FR+ A N  G                      Q
Sbjct: 23369 VW-DVVSATVARTTLKVTKLKTGTEYQFRIFAENRYG----------------------Q 23405

Query: 488   AVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFI 546
             +  LE +  +A Y        + PGPP    A+ IS++ +V+ W  P   G  P++ Y +
Sbjct: 23406 SFALESDPIVAQYP------YKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHL 23459

Query: 547   EKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQ 606
             E+    S  W +VN +T +   ++   +L EG  Y FRV + N  G+ + S+ +    A+
Sbjct: 23460 ERKERNSILWTKVN-KTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVAR 23518

Query: 607   DVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEED--LLGYYVDCCVAGTNLWEPCNHKPI 664
             D    P  P  ++  RN    + +QW +P ++    + GY V+        W   +   +
Sbjct: 23519 DPCDPPGTPEPIMVKRN---EITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNV 23575

Query: 665   GYNRFVVHGLTTGEQYIFRVKAVNAVG-MSENSQESDVIKVQAALTVP----SHPYGITL 719
                +F V GLT  ++Y FRV A NA G +S+ S  +  I  +  + +P       +  T+
Sbjct: 23576 IETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTI 23635

Query: 720   LNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGL-TEG 778
             +   G +  L  +        P + +    +E+      E+ ++  K  ++  D +  +G
Sbjct: 23636 VVNAGETFRL--EADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDG 23693

Query: 779   SLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAY-DLTFCEVRDTSLVMLWKAPV 837
               Y  +  A N+AG       S+ F      +  PGP    +    V      + W  P+
Sbjct: 23694 GQYILR--ASNVAG-------SKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPPL 23744

Query: 838   YSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGK 897
               G S +S Y V+ RE     W  V      N  LKV+ L +G  YVFR+ AVN  GVG+
Sbjct: 23745 QDGGSDISHYVVEKRETSRLAWTVVASEVVTNS-LKVTKLLEGNEYVFRIMAVNKYGVGE 23803

Query: 898   PSDTSEPVLVE 908
             P + S PVL++
Sbjct: 23804 PLE-SAPVLMK 23813



 Score =  167 bits (423), Expect = 7e-41
 Identities = 161/636 (25%), Positives = 268/636 (42%), Gaps = 74/636 (11%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
             PG P+ L   +  R  V + W  P  T    +  Y V++ ++    W++ N + +   ++
Sbjct: 21360 PGKPVPL---NITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEF 21416

Query: 443   PVTGLFEGRSYIFRVRAVNSAG-ISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQ 501
              V+GL E  +Y FRV A N+AG IS PS  SDA+   D ++  +++ V ++ +  + +  
Sbjct: 21417 TVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIK-VDVKFKDTVILKA 21475

Query: 502   DD---LEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQR 558
              +   LE D     PPT             + W       +      I+   +   S   
Sbjct: 21476 GEAFRLEADVSGRPPPT-------------MEWSKDGKELEGTAKLEIK---IADFSTNL 21519

Query: 559   VNAQTAVR-SPRYAVFDLMEG--KSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAP 615
             VN  +  R S  Y +     G    ++F V   +R G  E                    
Sbjct: 21520 VNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPE-------------------- 21559

Query: 616   GRVLASRNTKTSVVVQWDRPKHEEDL-LGYYV-----DCCVAGTNLWEPCNHKPIGYNRF 669
             G +  +  T    V+ W  P  +    + +Y+        +A TN+        +   + 
Sbjct: 21560 GPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNV-----ASEVQVTKL 21614

Query: 670   VVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTL 729
              V  L  G +YIFRV AVN  G+ E  +   V+ V      P  P    +      SM +
Sbjct: 21615 KVTKLLKGNEYIFRVMAVNKYGVGEPLESEPVLAVNP-YGPPDPPKNPEVTTITKDSMVV 21673

Query: 730   GWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVN 789
              W  P   GGS I+ Y +++R+   + W + N          V GLTEG  YEF+I A N
Sbjct: 21674 CWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAEN 21733

Query: 790   LAGIGEPSDPSEHFK-CEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYF 848
              AGI  PS  S  +K C+  T+ +PGP  +    +   +S+ + W  P+Y G S ++GY 
Sbjct: 21734 AAGISAPSPTSPFYKACD--TVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYM 21791

Query: 849   VDFR--EEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVL 906
             V+    EED  + +T      A  Y  ++ L + + Y  R+ A+N+ G+G+P+       
Sbjct: 21792 VEIALPEEDEWQIVTPPAGLKATSY-TITGLTENQEYKIRIYAMNSEGLGEPALVPGTPK 21850

Query: 907   VEARPGTKEISAGVDEQGNIYLGFDCQ-------EMTDASQFTWCKSYEEISDDERFKIE 959
              E R    EI    D +  + +   C        +   A +  W + + E  D  +  IE
Sbjct: 21851 AEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLD--KASIE 21908

Query: 960   TVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
             +   ++ L + N ++ D G Y ++V ++ G  S+FV
Sbjct: 21909 STSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFV 21944



 Score =  167 bits (422), Expect = 9e-41
 Identities = 157/616 (25%), Positives = 246/616 (39%), Gaps = 58/616 (9%)

Query: 309   RVQPRAEWYR---DDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSD 365
             R  P+  W +   D+V+ K     ++   +  A L   +  +DD G Y+L +V+  G  +
Sbjct: 18633 RPAPKVTWRKVGIDNVVRKG----QVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAG--E 18686

Query: 366   HSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVG 425
              + F+ VR  D      PG   DL+  D  +    V+W PP     S V  Y V++ E  
Sbjct: 18687 KAVFVNVRVLD-----TPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREAD 18741

Query: 426   TNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRR 485
                W       VK   + VT L  G  Y FRV AVN  G   P+ V   V A DPL    
Sbjct: 18742 RKTWSTVTPE-VKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPL---- 18796

Query: 486   LQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYF 545
                                      P PP  +  +E+++N   L+W PP   G   +  +
Sbjct: 18797 -----------------------SEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGY 18833

Query: 546   IEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQA 605
             I           R    + V+     V  L EGK Y FRV + N  G+S P E     +A
Sbjct: 18834 ITSYREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEA 18893

Query: 606   QDVTVVPS--APGRVLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNHKP 663
             ++  + P    P ++      K  +        H         D  V  ++L     HK 
Sbjct: 18894 KEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHL---AVHKA 18950

Query: 664   IGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCD 723
                +  ++  +T  +   + + A N+ G   ++Q+  V+ V  A   P  P+ I+  + D
Sbjct: 18951 DSSSILIIKDVTRKDSGYYSLTAENSSG--TDTQKIKVV-VMDAPGPPQPPFDIS--DID 19005

Query: 724   GHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEF 783
               + +L W +P   GGS I  Y ++K +V   +W    +S +K T   V  L  G  Y F
Sbjct: 19006 ADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTK-TSCRVGKLIPGQEYIF 19064

Query: 784   KIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSP 843
             ++ A N  GI EP    +      +    P    +    +V    + + W  P   G SP
Sbjct: 19065 RVRAENRFGISEPLTSPK--MVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSP 19122

Query: 844   VSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSE 903
             + GY ++ +E ++  W+  N T   +     + L +G  Y FR+ A+N  G   PS  +E
Sbjct: 19123 IIGYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTE 19182

Query: 904   PVLVEA---RPGTKEI 916
              V        PG  E+
Sbjct: 19183 YVTARMPVDPPGKPEV 19198



 Score =  166 bits (420), Expect = 2e-40
 Identities = 155/611 (25%), Positives = 243/611 (39%), Gaps = 63/611 (10%)

Query: 312   PRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLF 371
             P  +W + D  L  +   ++   +   SLS     + D G Y L+  +  G    +  + 
Sbjct: 22573 PTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVK 22632

Query: 372   VRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQ 431
             V D      G P  P+ +    A +    + WKPP     S ++ Y V+R E     W  
Sbjct: 22633 VLDRP----GPPEGPVVISGVTAEK--CTLAWKPPLQDGGSDIINYIVERRETSRLVWTV 22686

Query: 432   CNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHL 491
               DA V+     VT L EG  Y FR+ AVN  G+  P   S+ V A +P           
Sbjct: 22687 V-DANVQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLE-SEPVVAKNPF---------- 22734

Query: 492   EGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWE-PPTPRGKDPLMYFIEKSV 550
                               VP  P     + ++++ +++ WE P +  G + L Y +EK  
Sbjct: 22735 -----------------VVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVLEKRD 22777

Query: 551   VGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTV 610
                  W R + +  +   R  V  L+E   Y FRV + N  GLSEPS  ++  +A D   
Sbjct: 22778 KEGIRWTRCHKRL-IGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACDPIY 22836

Query: 611   VPSAPGRVLASRNTKTSVVVQWDRPKHEE--DLLGYYVDCCVAGTNLWEPCNHKPIGYNR 668
              P  P        T++SV + W +P ++   ++ GY V+ C      W  C   P G N+
Sbjct: 22837 KPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCT-PPTGINK 22895

Query: 669   --FVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHS 726
                 V  L    +Y FR+ A+N  G+ E++     I V+  L  P     + L       
Sbjct: 22896 TNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKI---- 22951

Query: 727   MTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIA 786
                   +   +GGS  L   +  R      W +V+       I+ V      S     + 
Sbjct: 22952 ------INIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDV----TSSFTSLVLD 23001

Query: 787   AVNLAGIG------EPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSG 840
              VN    G      E S  ++        +  P P  +L   E+   S+ + W+ P+  G
Sbjct: 23002 NVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDG 23061

Query: 841   SSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSD 900
              S +  Y V+ RE     +  V      N + K+  LQ+G +Y FRV A N  G+G P+ 
Sbjct: 23062 GSKIKNYIVEKREATRKSYAAVVTNCHKNSW-KIDQLQEGCSYYFRVTAENEYGIGLPAQ 23120

Query: 901   TSEPVLVEARP 911
             T++P+ V   P
Sbjct: 23121 TADPIKVAEVP 23131



 Score =  165 bits (418), Expect = 3e-40
 Identities = 154/563 (27%), Positives = 231/563 (41%), Gaps = 60/563 (10%)

Query: 376   DPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDA 435
             DP+   AP  P   +  D  +    + W PP     S V GY V+  E G   W +  D 
Sbjct: 16417 DPI---APPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDK 16473

Query: 436   PVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEK 495
              V+  K  VTGL EG  Y FRVRAVN AGI  P  V+D +   D L              
Sbjct: 16474 EVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRL-------------- 16519

Query: 496   EIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGS 555
                    DL+ DA V      VHA  + R    +S +PP       + + + +  +    
Sbjct: 16520 ----VSPDLQLDASVRDRIV-VHAGGVIRIIAYVSGKPPPT-----VTWNMNERTLP--- 16566

Query: 556   WQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAP 615
              Q    +T   S    + +       V+ +L+ N  G  + + I       DV  VP   
Sbjct: 16567 -QEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIV------DVLDVPGPV 16619

Query: 616   GRVLASRN-TKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVH 672
             G    + N T  S  + W  P+ +    +  Y ++   +    W P  +     N   V 
Sbjct: 16620 GTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNA-TVQ 16678

Query: 673   GLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWK 732
             GL  G+ Y FR+ A N++GM    + S+ + ++  +TVP  P  + +     +++TL W 
Sbjct: 16679 GLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWN 16738

Query: 733   VPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAG 792
              PK+ GGS I+ Y L+ R +  + +H+V +        TV GL EG  YE++++AVN+ G
Sbjct: 16739 PPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVG 16798

Query: 793   IGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPV----YSGS-SPVSGY 847
              G+PS  ++   C+    P   P   L F   RD   + + +A      YSG   P   +
Sbjct: 16799 QGKPSFCTKPITCKDELAP---PTLHLDF---RDKLTIRVGEAFALTGRYSGKPKPKVSW 16852

Query: 848   FVDFRE--EDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPV 905
             F D  +  ED    I     T A   +K      GK  V     V  N  G      +  
Sbjct: 16853 FKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCV-----VVENSTGSRKGFCQVN 16907

Query: 906   LVEARPGTKEISAGVDEQGNIYL 928
             +V+ RPG        DE    Y+
Sbjct: 16908 VVD-RPGPPVGPVSFDEVTKDYM 16929



 Score =  162 bits (410), Expect = 2e-39
 Identities = 182/806 (22%), Positives = 327/806 (40%), Gaps = 96/806 (11%)

Query: 153   APEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVH 212
             AP I   ++  T     + +L   + G P P ++WY+ G  + Q+    KY++ S+   H
Sbjct: 30532 APGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSR---KYKMSSDGRTH 30588

Query: 213   TLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIP 272
             TL +   + +D   Y+ +ATN  G+V T++ ++++                        P
Sbjct: 30589 TLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQA----------------------TP 30626

Query: 273   YTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMF 332
               H      EK+   +   G T+ L    +  P      P   W+    LL+ S+   + 
Sbjct: 30627 QFHPGYPLKEKY---YGAVGSTLRLHVMYIGRP-----VPAMTWFHGQKLLQNSENITIE 30678

Query: 333   FGEGQASLSFSHLH-KDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQC 391
               E    L   ++  K   G Y +++ +  G  D    + ++D     TG    P+ ++ 
Sbjct: 30679 NTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTG----PIVIEA 30734

Query: 392   HDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGR 451
                N    +++WKPP     S +  Y V++CE       Q   + + +    +  L E  
Sbjct: 30735 LLKNS--AVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENA 30792

Query: 452   SYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVP 511
              Y FRV A N+ GIS P  VS  V    P +                            P
Sbjct: 30793 GYYFRVSAQNTFGISDPLEVSSVVIIKSPFEK---------------------------P 30825

Query: 512   GPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRY 570
             G P     + ++++  V++W+PP   G   +  Y++EK       W  V  +  +R   +
Sbjct: 30826 GAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEE-IRETVF 30884

Query: 571   AVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQ-DVTVVPSAPGRVLASRNTK--TS 627
             +V +L+EG  Y FRV   N  G SE SEI+ PI  + DV +        L + N +  ++
Sbjct: 30885 SVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSN 30944

Query: 628   VVVQWDRPKHEEDLLGYYVDCC-VAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKA 686
               +      H + ++ +Y     +    L         GY++ ++  +T  +  +++V+A
Sbjct: 30945 ATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRA 31004

Query: 687   VNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNC-DGHSMTLGWKVPKFSGGSPILGY 745
              N  G S +   S  ++V A + +P    G+  ++   G  +++  K+P      P++ +
Sbjct: 31005 TNQGG-SVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSI--KIPFSGKPDPVITW 31061

Query: 746   YLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
                +  + +   ++V  + S  +++  +G+       + + A N  GI + +        
Sbjct: 31062 QKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKT-------V 31114

Query: 806   EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQT 865
             E      P P   +   +V   S+ + W  P   G S ++ Y V+     A  W+ V Q 
Sbjct: 31115 ELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQ- 31173

Query: 866   TTANRYLKVSDLQQGKT-YVFRVRAVNANGVGKPSDTSEPVLV-EARPGTKEISAGVDEQ 923
                 RY  ++    GKT Y FRV A N  G+ KPS+ SEP +  E +         VDE 
Sbjct: 31174 ARETRYTVINLF--GKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDET 31231

Query: 924   GNIYLGFDCQEMTDASQFTWCKSYEE 949
               +        MT AS  +  + YE+
Sbjct: 31232 REV-------SMTKASHSSTKELYEK 31250



 Score =  161 bits (408), Expect = 4e-39
 Identities = 155/638 (24%), Positives = 255/638 (39%), Gaps = 72/638 (11%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
             PG P +L   D  + +V + W+ P+    SP + Y V+R   G+++W + +   +K   Y
Sbjct: 18101 PGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHY 18160

Query: 443   PVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALD----PLDLRRLQAVHLEGEKEIA 498
              V    E + Y FRV+  N  G S   +  + V   D     LDL+    + ++    I 
Sbjct: 18161 MVDRCVENQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIR 18220

Query: 499   IYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQR 558
             +       +A V G P           +  ++W               +K         R
Sbjct: 18221 L-------EAGVRGKP-----------FPEVAWTK-------------DKDATDLTRSPR 18249

Query: 559   VNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRV 618
             V   T   S ++++          + V + N  G            A     V   PG V
Sbjct: 18250 VKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAG---------SFVAYATVNVLDKPGPV 18300

Query: 619   LASRNTKTSVV------VQWDRPKHEE--DLLGYYVDCCVAGTNLWEPCNHKPIGYNRFV 670
                RN K   V      V WD P+ +   ++  Y ++ C     +W   +   +     V
Sbjct: 18301 ---RNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTV 18357

Query: 671   VHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLG 730
                L  G +YIFRV+A N +G    ++   VI  +     P  P    +       MT+ 
Sbjct: 18358 TR-LIEGNEYIFRVRAENKIGTGPPTESKPVI-AKTKYDKPGRPDPPEVTKVSKEEMTVV 18415

Query: 731   WKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNL 790
             W  P++ GG  I GY+L+K+E H   W  VN S      + V  L     Y+F++ A N 
Sbjct: 18416 WNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENE 18475

Query: 791   AGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVD 850
              GIGEPS PS     +    P PGP  +    +    S+ + W  PVY G +P+ GY V+
Sbjct: 18476 IGIGEPSLPSRPVVAKDPIEP-PGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVE 18534

Query: 851   FREEDAGE-----WITVNQTT-TANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEP 904
              R + A       W   N       +   V+ L + + Y FRV A N  G+G+P++  E 
Sbjct: 18535 MRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEA 18594

Query: 905   VLVE--ARPGTKEISAGVDEQGNIYLG-----FDCQEMTDASQFTWCKSYEEISDDERFK 957
             +  +    P   ++ A + +   +  G     F       A + TW K   + +   + +
Sbjct: 18595 IKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGID-NVVRKGQ 18653

Query: 958   IETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
             ++ V   + L + N  ++D G YS+++ +  G  + FV
Sbjct: 18654 VDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFV 18691



 Score =  161 bits (407), Expect = 5e-39
 Identities = 157/614 (25%), Positives = 257/614 (41%), Gaps = 62/614 (10%)

Query: 305   PDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVS 364
             P + R  P   W++D+V LK++        E  + L+     ++D G Y +++ +  G +
Sbjct: 22170 PFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEA 22229

Query: 365   DHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEV 424
               +  + V D      G P  P+ +   +   D + ++W PP     S +  Y V++ + 
Sbjct: 22230 IETLNVIVLDKP----GPPTGPVKMD--EVTADSITLSWGPPKYDGGSSINNYIVEKRDT 22283

Query: 425   GTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLR 484
              T  W Q   A V         L  G  Y FR+ A N  G                    
Sbjct: 22284 STTTW-QIVSATVARTTIKACRLKTGCEYQFRIAAENRYG-------------------- 22322

Query: 485   RLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSW-EPPTPRGKDPLM 543
               ++ +L  E  +A Y        +VPGPP     +  SR+ + + W EP +  G   + 
Sbjct: 22323 --KSTYLNSEPTVAQYP------FKVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIG 22374

Query: 544   YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPI 603
             Y +E+    S  W ++N +T +   ++    L EG  Y FRV + N  G+ +PS+++   
Sbjct: 22375 YHLERKERNSILWVKLN-KTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECY 22433

Query: 604   QAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNH 661
              A+D    P  P  ++ +RN   SV +QW +P ++    + GY V+        W   + 
Sbjct: 22434 VARDPCDPPGRPEAIIVTRN---SVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASF 22490

Query: 662   KPIGYNRFVVHGLTTGEQYIFRVKAVNAVGM-SENSQESDVIKVQAALTVP----SHPYG 716
               I    F V GL    +Y FRV A NA G+ SE S+ +  I  +  +  P       Y 
Sbjct: 22491 TNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYK 22550

Query: 717   ITLLNCDGHSMTLGWKVPKFSGGSPI--LGYYLDKREVHHKNWHEVNSSPSKPTILTVDG 774
              T++   G S    +KV     G PI  + +    +E+ +    E+ S+    ++   D 
Sbjct: 22551 DTIVVHAGES----FKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDA 22606

Query: 775   LTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWK 834
             +   S   + + A N+AG     + S     +    P P P   +    V      + WK
Sbjct: 22607 VRVDS-GNYILKAKNVAG-----ERSVTVNVKVLDRPGP-PEGPVVISGVTAEKCTLAWK 22659

Query: 835   APVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANG 894
              P+  G S +  Y V+ RE     W TV          KV+ L +G  Y FR+ AVN  G
Sbjct: 22660 PPLQDGGSDIINYIVERRETSRLVW-TVVDANVQTLSCKVTKLLEGNEYTFRIMAVNKYG 22718

Query: 895   VGKPSDTSEPVLVE 908
             VG+P + SEPV+ +
Sbjct: 22719 VGEPLE-SEPVVAK 22731



 Score =  160 bits (406), Expect = 6e-39
 Identities = 164/646 (25%), Positives = 251/646 (38%), Gaps = 84/646 (13%)

Query: 291   EGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDE 350
             EGE +++       P      P   W++D   +K S    M      A L      + D 
Sbjct: 14400 EGEKLSIPVPFRAVP-----VPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADA 14454

Query: 351   GLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTT 410
             G+YT+ + ++ G +  S        +  V G PG   D++  D  +    +TW+PP    
Sbjct: 14455 GIYTITLENKLGSATASI-------NVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDG 14507

Query: 411   ESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSR 470
              +P++ Y ++R E G   ++       K+  + V  L     Y FRV+AVN  G      
Sbjct: 14508 GTPILHYVLERREAGRRTYIPVMSGENKL-SWTVKDLIPNGEYFFRVKAVNKVGGGEYIE 14566

Query: 471   VSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLS 530
             + + V A DP                            Q P PP  V     +   + ++
Sbjct: 14567 LKNPVIAQDP---------------------------KQPPDPPVDVEVHNPTAEAMTIT 14599

Query: 531   WEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSAN 589
             W+PP   G   +M Y IEK   G   W+R N +  V    Y    L EGK Y FRV + N
Sbjct: 14600 WKPPLYDGGSKIMGYIIEKIAKGEERWKRCN-EHLVPILTYTAKGLEEGKEYQFRVRAEN 14658

Query: 590   RHGLSEPSEITSPIQAQDVTVVPSAPGRVL------------ASRNTKTSVVVQWDR--- 634
               G+SEPS  T P +A D    P    R              AS +      + W +   
Sbjct: 14659 AAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYPTITWIKDEN 14718

Query: 635   ---PKHEEDLLGYYVDCCVAGTNLWEP----------CNHKPIGYNRFVVHGLTTGEQYI 681
                P+  +      V          EP           ++   G ++  V      +  +
Sbjct: 14719 VIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGL 14778

Query: 682   FRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSP 741
             + +K  N  G+++      V      L  P  P      +    S+   W+ P   GGS 
Sbjct: 14779 YMIKVENDHGIAKAPCTVSV------LDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGSE 14832

Query: 742   ILGYYLDKRE--VHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDP 799
             I+ Y L+K++       W  V S+  +    +V  L EG  Y F++ A N  G G P   
Sbjct: 14833 IINYTLEKKDKTKPDSEWIVVTST-LRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVS 14891

Query: 800   SEHFKCEAWTMPEPGPAYDLTFCE-VRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGE 858
                   + +  P+   A D    E V   S+++ W  P  +G SP+ GY+++ RE ++  
Sbjct: 14892 KPLVAKDPFGPPD---APDKPIVEDVTSNSMLVKWNEPKDNG-SPILGYWLEKREVNSTH 14947

Query: 859   WITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEP 904
             W  VN++        V  L +G TYVFRV A NA G GK S  S+P
Sbjct: 14948 WSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDP 14993



 Score =  158 bits (399), Expect = 4e-38
 Identities = 128/444 (28%), Positives = 198/444 (44%), Gaps = 35/444 (7%)

Query: 511   PGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPR 569
             P  P  +   +I+++ V L+WEPP   G  PL  Y +EK  V   +W +V     V    
Sbjct: 13488 PSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV--MDFVTDLE 13545

Query: 570   YAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV 629
             + V DL++GK Y+F+V + N+ G  EP+ +  P+       VP  P  V     T  S+ 
Sbjct: 13546 FTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWRDRTANSIF 13605

Query: 630   VQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAV 687
             + WD PK++    + GY V+ C  G++ W  C  +P+   +  V GL  G+ Y +RVKA+
Sbjct: 13606 LTWDPPKNDGGSRIKGYIVERCPRGSDKWVACG-EPVAETKMEVTGLEEGKWYAYRVKAL 13664

Query: 688   NAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKV--PKFSGGSPILGY 745
             N  G S+ S+ ++ I+       P     + LL   G ++  G K+  P    G P    
Sbjct: 13665 NRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLL--AGLTVKAGTKIELPATVTGKPEPKI 13722

Query: 746   YLDKREVHHKNWHE--VNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHF 803
                K ++  K      + + P K T+  VD         + I AVN+ G           
Sbjct: 13723 TWTKADMILKQDKRITIENVPKKSTVTIVDS-KRSDTGTYIIEAVNVCGRATA------- 13774

Query: 804   KCEAWTMPEPGP--AYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWIT 861
               E   + +PGP  A+D+T  +V + S ++ W  P   G S ++ Y V+ R  D+  W  
Sbjct: 13775 VVEVNVLDKPGPPAAFDIT--DVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHK 13832

Query: 862   VNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISAGVD 921
             ++ T     + K + L   K Y+FRV A N  GVG+P        V+A P T +     D
Sbjct: 13833 LSSTVKDTNF-KATKLIPNKEYIFRVAAENMYGVGEP--------VQASPITAKYQ--FD 13881

Query: 922   EQGNIYLGFDCQEMTDASQFTWCK 945
               G            DA   TWC+
Sbjct: 13882 PPGPPTRLEPSDITKDAVTLTWCE 13905



 Score =  157 bits (397), Expect = 7e-38
 Identities = 168/638 (26%), Positives = 259/638 (40%), Gaps = 70/638 (10%)

Query: 372   VRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQ 431
             V+ A+P     P  P  +   D ++    + W+ P     S V+GY V+    GT  W  
Sbjct: 24207 VKAAEP-----PSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSI 24261

Query: 432   CNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHL 491
               ++  K+C   VTGL  G+ Y FRV+A N  G S P  +   V A D   L    ++ L
Sbjct: 24262 VAES--KVCNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKD---LTIQPSLKL 24316

Query: 492   EGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVV 551
                       +DL+ +  V G P              +SW     +  +PL         
Sbjct: 24317 PFNTYSIQAGEDLKIEIPVIGRPRPN-----------ISWV----KDGEPLK-------- 24353

Query: 552   GSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVF---RVLSANRHGLSEPSEITSPIQAQDV 608
                   RVN +    S    V  + EG    F    V + N  G +  +E  S I    V
Sbjct: 24354 ---QTTRVNVEETATS---TVLHIKEGNKDDFGKYTVTATNSAGTA--TENLSVI----V 24401

Query: 609   TVVPSAP-GRVLASRNTKTSVVVQWDRPKHEE--DLLGYYVDCCVAGTNLWEPCNHKPIG 665
                P  P G V     +   VV+ W+ P +     +  Y V+     T  W   +   + 
Sbjct: 24402 LEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVS-ATVA 24460

Query: 666   YNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGH 725
                  +  L TG +Y FR+ A N  G S       VI VQ     P  P    + +    
Sbjct: 24461 RTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVI-VQYPFKEPGPPGTPFVTSISKD 24519

Query: 726   SMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKI 785
              M + W  P   GG+ I+GY+L+++E +   W ++N +P + T     GL EG  YEFK+
Sbjct: 24520 QMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKV 24579

Query: 786   AAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVS 845
             +A N+ GIG+PS  SE F       P   P   +    +   ++ + WK P Y G S ++
Sbjct: 24580 SAENIVGIGKPSKVSECFVARDPCDPPGRPEAIV----ITRNNVTLKWKKPAYDGGSKIT 24635

Query: 846   GYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANG-VGKPSDTSEP 904
             GY V+ ++   G W+  + T        VS L + + Y FRV A NA G   +PSD+S  
Sbjct: 24636 GYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSG- 24694

Query: 905   VLVEARPGTKEISAGVDEQGNIYLGFDCQEM---------TDASQFTWCKSYEEISDD-E 954
               + AR      +A +D +    +     E                 W K  +E+ +   
Sbjct: 24695 -AITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAA 24753

Query: 955   RFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSS 992
             R +I++    + L +K+  + D G Y + +S+  G  S
Sbjct: 24754 RMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKS 24791



 Score =  151 bits (382), Expect = 4e-36
 Identities = 175/732 (23%), Positives = 295/732 (40%), Gaps = 58/732 (7%)

Query: 511   PGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPR 569
             PGPP      +I +  V+  WEPP   G   ++ Y +EK        + +   + +R  +
Sbjct: 14802 PGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCK 14861

Query: 570   YAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV 629
             Y+V  L+EGK Y+FRV + NR G   P  ++ P+ A+D    P AP + +    T  S++
Sbjct: 14862 YSVTKLIEGKEYLFRVRAENRFGPGPPC-VSKPLVAKDPFGPPDAPDKPIVEDVTSNSML 14920

Query: 630   VQWDRPK-HEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVN 688
             V+W+ PK +   +LGY+++     +  W   N   +   +  V GL  G  Y+FRV A N
Sbjct: 14921 VKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAEN 14980

Query: 689   AVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLD 748
             A G  + S  SD       ++ P  P    + +    ++ L W+ P F+GG  I+GY++D
Sbjct: 14981 AAGPGKFSPPSDPKTAHDPISPPGPPIP-RVTDTSSTTIELEWEPPAFNGGGEIVGYFVD 15039

Query: 749   KREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAW 808
             K+ V    W        K    TV  + EG+ Y+ +++AVN AG G P +       E  
Sbjct: 15040 KQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGETQPVTVAE-- 15097

Query: 809   TMPEPGPAYDLTFCEVRDTSLVMLWK-----APVYSGSSPVSGYFVDFREEDAGEWITVN 863
               P+  PA +L    V+    +M  K     A V     P   +  +  E D    +  N
Sbjct: 15098 --PQEPPAVELD-VSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDN 15154

Query: 864   QTTTANRYLKVSDLQQGKTYV----------FRVRAVNANGVGKPSDTSEPVLVEARPGT 913
               T +   +K +  +    YV          F    V    V  P    +PV+   +   
Sbjct: 15155 VGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCL 15214

Query: 914   KEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPD 973
                S   D+ G+   GF   E  DA   TW +  E     ER K +  G      L+  +
Sbjct: 15215 LNWSDPEDDGGSEITGF-IIERKDAKMHTWRQPIE----TERSKCDITG-----LLEGQE 15264

Query: 974   KEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVR 1033
              +    + V   +  G        P E+  ++A+ + +  PT P    L Y    K  + 
Sbjct: 15265 YK----FRVIAKNKFGCG-----PPVEIGPILAV-DPLGPPTSP--ERLTYTERTKSTIT 15312

Query: 1034  F-WLQAEHLSPDASYRFIINDREVSDSEIHRIK---CDKATGIIEMVMDRFSIENEGTYT 1089
               W +           +II  R     +  R+    C   + ++E + +    E      
Sbjct: 15313 LDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAV 15372

Query: 1090  VQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLV 1149
              +I + +     ++V+  D     ++     R + ++ +     E +H  +  +     +
Sbjct: 15373 NEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKA---GEPVH--IPADVTGLPM 15427

Query: 1150  CKVANTKKETVFKWLKDDVLYETETLPNLERGICELLIPKLSKKDHGEYKATLKDDRGQD 1209
              K+  +K ETV +    D L  T+   +      EL IPK  ++D G Y  T  +  G  
Sbjct: 15428 PKIEWSKNETVIE-KPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSV 15486

Query: 1210  VSILEIAGKVYD 1221
                + +  +VYD
Sbjct: 15487 FRNVHV--EVYD 15496



 Score =  151 bits (382), Expect = 4e-36
 Identities = 151/584 (25%), Positives = 239/584 (40%), Gaps = 82/584 (14%)

Query: 347   KDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPP 406
             + D G Y +   +  G    +A + V D        PG  +DL+    NR   ++ W  P
Sbjct: 15168 RKDHGRYVITATNSCGSKFAAARVEVFDV-------PGPVLDLKPVVTNRKMCLLNWSDP 15220

Query: 407   NTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGIS 466
                  S + G+ ++R +   + W Q  +     C   +TGL EG+ Y FRV A N  G  
Sbjct: 15221 EDDGGSEITGFIIERKDAKMHTWRQPIETERSKC--DITGLLEGQEYKFRVIAKNKFGCG 15278

Query: 467   RPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTG---VHASEIS 523
              P  +   + A+DPL                              GPPT    +  +E +
Sbjct: 15279 PPVEIG-PILAVDPL------------------------------GPPTSPERLTYTERT 15307

Query: 524   RNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYV 582
             ++ + L W+ P   G  P+  Y IEK       ++RVN +    +  + V +L E + Y 
Sbjct: 15308 KSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLC-PTTSFLVENLDEHQMYE 15366

Query: 583   FRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKH-EEDL 641
             FRV + N  G SEPS +   +  QD  V P+   R+    +T   + V+   P H   D+
Sbjct: 15367 FRVKAVNEIGESEPS-LPLNVVIQDDEVPPTIKLRLSVRGDT---IKVKAGEPVHIPADV 15422

Query: 642   LGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGE--------------QYIFRVKAV 687
              G  +       N  E    KP    +     ++  E              +  + V A 
Sbjct: 15423 TGLPMPKIEWSKN--ETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTAS 15480

Query: 688   NAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYL 747
             N +G    +   +V         PS P  + + +    S  L W  P  +GGS I  Y +
Sbjct: 15481 NRLGSVFRNVHVEV------YDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVI 15534

Query: 748   DKREVHHK--NWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
             DKR+   K   W EV ++  +     +  L     YEF++ AVN  GI +     +    
Sbjct: 15535 DKRDASRKKAEWEEVTNTAVEKR-YGIWKLIPNGQYEFRVRAVNKYGISDECKSDKVVIQ 15593

Query: 806   EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQT 865
             + + +P P P         + + LV  W  P+ +G SP++GY+++ REE +  W  V++ 
Sbjct: 15594 DPYRLPGP-PGKPKVLARTKGSMLVS-WTPPLDNGGSPITGYWLEKREEGSPYWSRVSRA 15651

Query: 866   TTANRYLK-----VSDLQQGKTYVFRVRAVNANGVGKPSDTSEP 904
                   LK     V  L +G  Y FR  A+NA G+G PS+ S+P
Sbjct: 15652 PITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDP 15695



 Score =  150 bits (379), Expect = 9e-36
 Identities = 109/444 (24%), Positives = 202/444 (45%), Gaps = 39/444 (8%)

Query: 563   TAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASR 622
             T      + + +  +G    ++++  N+HG +E       I  + + V    PG V    
Sbjct: 13047 TTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGF-----INLKVIDV----PGPVRNLE 13097

Query: 623   NTKT---SVVVQWDRPKHE--EDLLGYYVD-------CCVAGTNLWEPCNHKPIGYNRFV 670
              T+T    V + W+ P  +    ++GY V+         V  T+  E C         F 
Sbjct: 13098 VTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDRAESCE--------FT 13149

Query: 671   VHGLTTGE-QYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTL 729
             V GL  G  +Y+FRV A N VG  E  +  + ++ ++   VP  P  +T+ + +   ++L
Sbjct: 13150 VTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSL 13209

Query: 730   GWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVN 789
              W+ P++ GG+ I  Y ++ R+     W    +  ++    TV  + EG  Y F++ A N
Sbjct: 13210 TWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQN 13269

Query: 790   LAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFV 849
               G+G+PS  +   K  A  +  P P  +LT  +   +S+ + W+ P+  G SP+ GY +
Sbjct: 13270 RIGVGKPSAATPFVKV-ADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYII 13328

Query: 850   DFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEA 909
             +  EE    WI  N         KV+ L++G  Y++RV A N  GV  PS+   P+  + 
Sbjct: 13329 ERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADD 13388

Query: 910   R--PGTKEISAGVDEQGNIYLGFDCQEMTDASQF-----TWCKSYEEISDDERFKIETVG 962
                  T ++SA  D    + +      +  ++ +     TWC   + +   +R K++T+ 
Sbjct: 13389 AFVEPTMDLSAFKDGL-EVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLS 13447

Query: 963   DHSKLYLKNPDKEDLGTYSVSVSD 986
              +++L +   ++ D G Y++ + +
Sbjct: 13448 AYAELVISPSERSDKGIYTLKLEN 13471



 Score =  150 bits (378), Expect = 1e-35
 Identities = 138/520 (26%), Positives = 208/520 (40%), Gaps = 88/520 (16%)

Query: 375   ADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVD--RCEVGTNNWVQC 432
             +DPL    P  P  L+  +  ++   + W PP     + + GY       E   + W + 
Sbjct: 18793 SDPL--SEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEY 18850

Query: 433   NDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAA----LDPLDLRRLQ- 487
             +   VK     VTGL EG+ Y FRV A N+ G+S P        A    L P  L   Q 
Sbjct: 18851 S--VVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQI 18908

Query: 488   -------------------------------------AVHLEGEKEIAIYQDDLEGDA-- 508
                                                  AVH      I I +D    D+  
Sbjct: 18909 TIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGY 18968

Query: 509   ---------------------QVPGPPTG-VHASEISRNYVVLSWEPPTPRGKDPLM-YF 545
                                    PGPP      S+I  +   LSW  P   G   +  Y 
Sbjct: 18969 YSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHIPLEDGGSNITNYI 19028

Query: 546   IEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSP-IQ 604
             +EK  V  G W  V A  +V      V  L+ G+ Y+FRV + NR G+SEP  +TSP + 
Sbjct: 19029 VEKCDVSRGDW--VTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEP--LTSPKMV 19084

Query: 605   AQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHK 662
             AQ    VPS P     ++  K  + V WDRP  +    ++GY ++     + LW   N  
Sbjct: 19085 AQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVKANDT 19144

Query: 663   PIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNC 722
              +    +   GL  G +Y FR+ A+N  G S  S+ ++ +  +  +  P  P    +++ 
Sbjct: 19145 LVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKP---EVIDV 19201

Query: 723   DGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSK--PTILTVDGLTEGSL 780
                +++L W  PK  GGS I+GY+++  ++    W   N++P +      T  GL E + 
Sbjct: 19202 TKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQ 19261

Query: 781   YEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLT 820
             Y+F+  A     I  PS+PS+     A  +P   P  DL+
Sbjct: 19262 YQFRAIARTAVNISPPSEPSDPVTILAENVP---PRIDLS 19298



 Score =  149 bits (376), Expect = 2e-35
 Identities = 199/866 (22%), Positives = 327/866 (37%), Gaps = 118/866 (13%)

Query: 150   ISRAPEIL--VRLRSHTVWER-MSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIE 206
             I  APEI   V LR+  + +    V++    +G P P V W KD   +   A   +Y IE
Sbjct: 27265 ILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDA---RYSIE 27321

Query: 207   SNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLP 266
             +      L I +   +DT  Y     N                             +G P
Sbjct: 27322 NTDSSSLLTIPQVTRNDTGKYILTIENG----------------------------VGEP 27353

Query: 267   LSSMIPYTHFDVQFL-EKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKE 325
              SS +     D     +K  V     G TVTL   +   P +    P   +  +     +
Sbjct: 27354 KSSTVSVKVLDTPAACQKLQVKHVSRG-TVTL---LWDPPLIDGGSPIINYVIEKRDATK 27409

Query: 326   SKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGA 385
               W+ +      +S SF  +   ++  +  R+++   +            +P+      A
Sbjct: 27410 RTWSVV--SHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEP---CETTEPVKAAEVPA 27464

Query: 386   PM-DLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPV 444
             P+ DL   D+ +  VI++W  P+    S +  Y V+R   G   W     +  K C+  V
Sbjct: 27465 PIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGIS--KTCEIEV 27522

Query: 445   TGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDL 504
             + L E     FRV A N  G+S P         + P+ ++ L          I   + DL
Sbjct: 27523 SQLKEQSVLEFRVFAKNEKGLSDP-------VTIGPITVKEL----------IITPEVDL 27565

Query: 505   EGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTA 564
                + +PG    V    I  N   +  E P      P + +++  +              
Sbjct: 27566 ---SDIPGAQVTVR---IGHN---VHLELPYKGKPKPSISWLKDGL-------------P 27603

Query: 565   VRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQ--AQDVTVV----PSAP-GR 617
             ++   +  F   E K  +    +   HG      + + +   A  +TV+    PS P G 
Sbjct: 27604 LKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKGP 27663

Query: 618   VLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNHK----PIGYNRFVVHG 673
             +        SV++ WD P   ED  G  + C           N K     +    F V  
Sbjct: 27664 IRFDEIKADSVILSWDVP---EDNGGGEITCYSIEKRETSQTNWKMVCSSVARTTFKVPN 27720

Query: 674   LTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKV 733
             L    +Y FRV+A N  G+S+    S +I  +    +P  P    + N     M+L W  
Sbjct: 27721 LVKDAEYQFRVRAENRYGVSQ-PLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDA 27779

Query: 734   PKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGI 793
             P + GGS + G++++K+E +   W +VN+SP         GL EG  Y+F++ A N AG+
Sbjct: 27780 PVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGL 27839

Query: 794   GEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFRE 853
               PSDPS+     +   P   P Y     +V   ++ + W  P+  G S + GY ++ R+
Sbjct: 27840 SSPSDPSKFTLAVSPVDPPGTPDY----IDVTRETITLKWNPPLRDGGSKIVGYSIEKRQ 27895

Query: 854   EDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKP----------SDTSE 903
              +   W+  N T  +     V+ L  G  Y FR+ A NA G   P           D + 
Sbjct: 27896 GNE-RWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENV 27954

Query: 904   PVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGD 963
             P +VE   G +     + + G         +     + TW K   EI      +I  V  
Sbjct: 27955 PPIVEF--GPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLG 28012

Query: 964   HSKLYLKNPDKEDLGTYSVSVSDTDG 989
              + L++++  ++  G Y+V   +  G
Sbjct: 28013 STSLFVRDATRDHRGVYTVEAKNASG 28038



 Score =  149 bits (376), Expect = 2e-35
 Identities = 139/518 (26%), Positives = 220/518 (42%), Gaps = 56/518 (10%)

Query: 511   PGPPTG-VHASEISRNYVVLSWEPPTPRG-KDPLMYFIEKSVVGSGSWQRVNAQTAVRSP 568
             P  P G +   +I    V +SW PP   G  D L Y +E+  V   +W  ++++  VR  
Sbjct: 30228 PNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSR--VRGT 30285

Query: 569   RYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQ---DVTVVPSAPGRVLASRNTK 625
                V  L E   Y FRV + N+ G+S+P +   P+  +   +    PS P  VL    TK
Sbjct: 30286 SLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVLDV--TK 30343

Query: 626   TSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFR 683
             +SV + W RPK +    + GYY++     T+ W   N   I    + V GL    +Y FR
Sbjct: 30344 SSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFR 30403

Query: 684   VKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPIL 743
             + A N VG+SE S  S+ +  +     PS P  + +L+    S+TL W+ P+  GG  IL
Sbjct: 30404 IIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEIL 30463

Query: 744   GYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHF 803
             GY+++ R+     W + N    K    T+ GL E + YEF++ A N  G+  P   +   
Sbjct: 30464 GYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSI 30523

Query: 804   KCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVN 863
             K +  +   PG        E++D +  +        G +      +  R     +W    
Sbjct: 30524 KTKLTSGEAPGIRK-----EMKDVTTKL--------GEAAQLSCQIVGRPLPDIKWYRFG 30570

Query: 864   QTTTANRYLKVSDLQQGKTYVFRV-----------RAVNANGVGKPSDTSEPVLVEARP- 911
             +    +R  K+S    G+T+   V             +  N VG+  +TS  +L++A P 
Sbjct: 30571 KELIQSRKYKMS--SDGRTHTLTVMTEEQEDEGVYTCIATNEVGE-VETSSKLLLQATPQ 30627

Query: 912   -----GTKEISAGVD----EQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVG 962
                    KE   G          +Y+G     M      TW    + + + E   IE   
Sbjct: 30628 FHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAM------TWFHGQKLLQNSENITIENTE 30681

Query: 963   DHSKLYLKNPD-KEDLGTYSVSVSDTDGVSSSFVLDPE 999
              ++ L +KN   K   G Y V +S+  G   + +LD E
Sbjct: 30682 HYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDA-ILDVE 30718



 Score =  147 bits (371), Expect = 7e-35
 Identities = 164/689 (23%), Positives = 272/689 (39%), Gaps = 81/689 (11%)

Query: 250   RGDEEPFRSVGLP-----IGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVT 304
             +G  +P R +G+P     I +  S  +P+  F+V+  E+  +    +G            
Sbjct: 25374 KGRSDP-RQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKIDVPFKG------------ 25420

Query: 305   PDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVS 364
                 R Q    W +D   LKE+    +   +   SLS     K+D G Y L + +  G  
Sbjct: 25421 ----RPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSI 25476

Query: 365   DHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEV 424
                  + V D        PG P  ++  + + D + ++W PP       +  Y V++ E 
Sbjct: 25477 TVPITIIVLDR-------PGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKET 25529

Query: 425   GTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLR 484
              +  W   + A V      +  L  G  Y FRV A N  G S  S  S  VA        
Sbjct: 25530 TSTTWHIVSQA-VARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVA-------- 25580

Query: 485   RLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM- 543
                                 E     PGPP        +++ ++++W+ P   G   ++ 
Sbjct: 25581 --------------------EYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIG 25620

Query: 544   YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPI 603
             Y +E     S  W + N +  +   +  V  L EG  Y +RV + N  G+ + S+   P+
Sbjct: 25621 YHLEYKERSSILWSKAN-KILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPV 25679

Query: 604   QAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNH 661
              A+D       PG+   +  T+ SV ++W +P ++    + GY V+        W  CN+
Sbjct: 25680 PARDPC---DPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNY 25736

Query: 662   KPIGYNRFVVHGLTTGEQYIFRVKAVNAV-GMSENSQESDVIKVQAALTVPSHPYGITLL 720
               I    F V  LT  ++Y FRV A NA   +SE S+ +  I V+  +  P     +   
Sbjct: 25737 TNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFR 25796

Query: 721   NCDGHSMTLGWKVPKFSGGS--PILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEG 778
             +          K+     G   P++ +  D  E+  +   E+ S+ +  T+LTV      
Sbjct: 25797 DVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNH-TLLTVKDCIRR 25855

Query: 779   SLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVY 838
                ++ +   N+AG       S    C+    P P PA  L    +      + W  P  
Sbjct: 25856 DTGQYVLTLKNVAG-----TRSVAVNCKVLDKPGP-PAGPLEINGLTAEKCSLSWGRPQE 25909

Query: 839   SGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKP 898
              G + +  Y V+ RE     W T+ +        KV+ L +G  Y+FRV  VN  GVG+P
Sbjct: 25910 DGGADIDYYIVEKRETSHLAW-TICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEP 25968

Query: 899   SDT-----SEPVLVEARPGTKEISAGVDE 922
              ++      +P  V + P + EI++   E
Sbjct: 25969 LESVAIKALDPFTVPSPPTSLEITSVTKE 25997



 Score =  144 bits (364), Expect = 5e-34
 Identities = 163/681 (23%), Positives = 264/681 (38%), Gaps = 79/681 (11%)

Query: 312   PRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLF 371
             P+    RD V LK +            +++       D G Y +   +  G +     + 
Sbjct: 26506 PKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIV 26565

Query: 372   VRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQ 431
             V D      G P  P+ +   D   + V + W+PP     S V  Y + + E  T  W +
Sbjct: 26566 VLDRP----GPPTGPVVIS--DITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTE 26619

Query: 432   CNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHL 491
              + A V      V  L  G  Y FR++A N  GIS            D +D   +     
Sbjct: 26620 VS-ATVARTMMKVMKLTTGEEYQFRIKAENRFGIS------------DHIDSACVT---- 26662

Query: 492   EGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSV 550
                         ++     PGPP+    + ++R  + + W  P   G   ++ Y +E   
Sbjct: 26663 ------------VKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKD 26710

Query: 551   VGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTV 610
               S  WQ+ N +  +R+  + V  +  G  Y FRV + N  G+ +PS  + P+ A D   
Sbjct: 26711 RNSILWQKAN-KLVIRTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDAC- 26768

Query: 611   VPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNR 668
                 P  V  +  +K SV + W +P  +    + GY V+        W   +   +   +
Sbjct: 26769 --EPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQ 26826

Query: 669   FVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPY-GITLLNCDGHSM 727
             F++ GLT   QY FRV A NAVG   N   S+V+     +     P   + L   +    
Sbjct: 26827 FIISGLTQNSQYEFRVFARNAVGSISNP--SEVVGPITCIDSYGGPVIDLPLEYTEVVKY 26884

Query: 728   TLGWKVPKFSGGS----PILGYYLDKREVHHKNWHEVNSSPSKPTILTVDG--LTEGSLY 781
               G  V   +G S    P + +Y D +E+       V ++    +IL  D   L  G  Y
Sbjct: 26885 RAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGC-Y 26943

Query: 782   EFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGS 841
             E K+   N  G       S   + +    P P P   + F  V    + +LW+ P   G 
Sbjct: 26944 ELKLR--NAMG-----SASATIRVQILDKPGP-PGGPIEFKTVTAEKITLLWRPPADDGG 26995

Query: 842   SPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDT 901
             + ++ Y V+ RE     W  V++       +  + + +G  Y+FRVRAVN  G+G+P ++
Sbjct: 26996 AKITHYIVEKRETSRVVWSMVSEHLE-ECIITTTKIIKGNEYIFRVRAVNKYGIGEPLES 27054

Query: 902   SEPVLVEA-----RPGTKEI------------SAGVDEQGNIYLGFDCQEMTDASQFTWC 944
                V   A      PG  E+            S  + + G+   G+   E  D     W 
Sbjct: 27055 DSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGY-FLEKRDKKSLGWF 27113

Query: 945   KSYEEISDDERFKIETVGDHS 965
             K  +E   D R K+  + ++S
Sbjct: 27114 KVLKETIRDTRQKVTGLTENS 27134



 Score =  141 bits (355), Expect = 5e-33
 Identities = 122/473 (25%), Positives = 210/473 (44%), Gaps = 49/473 (10%)

Query: 511   PGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPR 569
             PGPP  +   E+ ++   L WEPP   G   +  Y I+K      ++  V+++ +  S  
Sbjct: 24116 PGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKTS-- 24173

Query: 570   YAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV 629
             + V +L EG  Y FRV++ N  G+  P E    ++A +    PS PG+V  +  ++TS  
Sbjct: 24174 FKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEP---PSPPGKVTLTDVSQTSAS 24230

Query: 630   VQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAV 687
             + W++P+H+    +LGY V+    GT  W       +     VV GL++G++Y FRVKA 
Sbjct: 24231 LMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVC--NAVVTGLSSGQEYQFRVKAY 24288

Query: 688   NAVGMSEN-----SQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPI 742
             N  G S+         +  + +Q +L +P + Y I      G  + +  ++P      P 
Sbjct: 24289 NEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQA----GEDLKI--EIPVIGRPRPN 24342

Query: 743   LGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEH 802
             + +  D   +       V  + +  T+L +    +    ++ + A N AG       +E+
Sbjct: 24343 ISWVKDGEPLKQTTRVNVEETATS-TVLHIKEGNKDDFGKYTVTATNSAGTA-----TEN 24396

Query: 803   FKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITV 862
                     P P P   + F EV    +V+ W+ P Y+G   +S Y V+ R+     W  V
Sbjct: 24397 LSVIVLEKPGP-PVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMV 24455

Query: 863   NQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVE------ARPGTKEI 916
             +  T A   +K++ L+ G  Y FR+ A N  G   P D S+ V+V+        PGT  +
Sbjct: 24456 S-ATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLD-SKAVIVQYPFKEPGPPGTPFV 24513

Query: 917   SA------------GVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFK 957
             ++             V++ G   +G+   E  + +   W K  +    D +FK
Sbjct: 24514 TSISKDQMLVQWHEPVNDGGTKIIGYHL-EQKEKNSILWVKLNKTPIQDTKFK 24565



 Score =  140 bits (353), Expect = 9e-33
 Identities = 116/421 (27%), Positives = 187/421 (44%), Gaps = 32/421 (7%)

Query: 511   PGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPR 569
             PGP   +  ++I+++ V L W+ P   G   +  Y +EK      S+    A T      
Sbjct: 20868 PGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYS--TATTKCHKCT 20925

Query: 570   YAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV 629
             Y V  L EG  Y FRV++ N +G+ EP+E T P++A +    PS P  +     TK++V 
Sbjct: 20926 YKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASE---APSPPDSLNIMDITKSTVS 20982

Query: 630   VQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAV 687
             + W +PKH+    + GY ++    G++ W   +   +     VV  LT GE+Y F+V AV
Sbjct: 20983 LAWPKPKHDGGSKITGYVIEAQRKGSDQW--THITTVKGLECVVRNLTEGEEYTFQVMAV 21040

Query: 688   NAVGMSENSQESDVIKVQAALTVPSHPYGI---TLLNCDGHSMTLGWKVPKFSGGSPILG 744
             N+ G S   +   VI  +  +       GI    ++   G ++ +  ++P      P + 
Sbjct: 21041 NSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKV--EIPVLGRPKPTVT 21098

Query: 745   YYLDKREVHHKNWHEVN-SSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHF 803
             +   K +   K    VN  + +  TIL ++         + + A N+ G     +  +  
Sbjct: 21099 W--KKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVG-----EVGDVI 21151

Query: 804   KCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVN 863
               +   +P P P   + F EV    +   W  P   G  P+S Y V+ R+ D+  W+ + 
Sbjct: 21152 TIQVHDIPGP-PTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELA 21210

Query: 864   QTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSE------PVLVEARPGTKEIS 917
              T     Y K + L  G  Y FRV+A N  GVG P  TS       P  V   PGT +++
Sbjct: 21211 TTVIRTTY-KATRLTTGLEYQFRVKAQNRYGVG-PGITSACIVANYPFKVPGPPGTPQVT 21268

Query: 918   A 918
             A
Sbjct: 21269 A 21269



 Score =  136 bits (343), Expect = 1e-31
 Identities = 112/417 (26%), Positives = 180/417 (43%), Gaps = 28/417 (6%)

Query: 511   PGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPR 569
             PGPP  +   E+++  V L+W+PP   G   +  Y +EK      ++  V   T      
Sbjct: 21952 PGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTV--ATNCHKTS 22009

Query: 570   YAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV 629
             + V  L EG SY FRVL+ N +G+  P+E    ++A +    P  PG++     T+ SV 
Sbjct: 22010 WKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASE---RPLPPGKITLMDVTRNSVS 22066

Query: 630   VQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAV 687
             + W++P+H+    +LGY V+    G++ W  C    +      + GL  GE+Y FRV A 
Sbjct: 22067 LSWEKPEHDGGSRILGYIVEMQTKGSDKWATC--ATVKVTEATITGLIQGEEYSFRVSAQ 22124

Query: 688   NAVGMSENSQESDVIKVQAALTVPSHPYGI-TLLNCDGHSMTLGWKVPKFSGGSPILGYY 746
             N  G+S+  Q S  +  +  +  P+      T     G  + +   VP     +P + ++
Sbjct: 22125 NEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKV--DVPFIGRPTPAVTWH 22182

Query: 747   LDKREVHHKNWHEVNS-SPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
              D   V  K    VN+ S    ++LT+       +  + +   N AG     +  E    
Sbjct: 22183 KD--NVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAG-----EAIETLNV 22235

Query: 806   EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQT 865
                  P P P   +   EV   S+ + W  P Y G S ++ Y V+ R+     W  V+  
Sbjct: 22236 IVLDKPGP-PTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVS-A 22293

Query: 866   TTANRYLKVSDLQQGKTYVFRVRAVNANGV-----GKPSDTSEPVLVEARPGTKEIS 917
             T A   +K   L+ G  Y FR+ A N  G       +P+    P  V   PGT  ++
Sbjct: 22294 TVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVT 22350



 Score =  134 bits (337), Expect = 6e-31
 Identities = 174/771 (22%), Positives = 294/771 (38%), Gaps = 127/771 (16%)

Query: 171   VKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT-LEINRADFDDTATYSA 229
             ++L   ++G P P+ +W K+G  I + A      + +    HT L I  AD  D+ TY  
Sbjct: 30154 IRLTIPIKGKPFPICKWTKEGQDISKRA------MIATSETHTELVIKEADRGDSGTYDL 30207

Query: 230   VATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFR 289
             V  N  G+ +    V V                IG P S   P  + D+Q +    V++R
Sbjct: 30208 VLENKCGKKAVYIKVRV----------------IGSPNSPEGPLEYDDIQ-VRSVRVSWR 30250

Query: 290   REGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDD 349
                +         +    +R  P+A WY  D  ++ +            SL    L ++ 
Sbjct: 30251 PPADDGGADILGYILE--RREVPKAAWYTIDSRVRGT------------SLVVKGLKENV 30296

Query: 350   EGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCH-----DANRDYVIVTWK 404
             E  + +   ++ G+S       ++  +P+    P  P +   +     D  +  V ++W 
Sbjct: 30297 EYHFRVSAENQFGISKP-----LKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWS 30351

Query: 405   PPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAG 464
              P     S V GY+++R E  T+ WV+ N   +    Y VTGL     Y FR+ A N  G
Sbjct: 30352 RPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVG 30411

Query: 465   ISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISR 524
             +S  S  S+ V   DP D                            P  P  +    IS+
Sbjct: 30412 LSETSPASEPVVCKDPFD---------------------------KPSQPGELEILSISK 30444

Query: 525   NYVVLSWE-PPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVF 583
             + V L WE P    GK+ L Y++E    G  +W++ N +  ++  ++ +  L+E   Y F
Sbjct: 30445 DSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKE-RIKDKQFTIGGLLEATEYEF 30503

Query: 584   RVLSANRHGLSEPSEITSPIQAQDVTVVPSAPG--RVLASRNTKTSVVVQWD-----RPK 636
             RV + N  GLS P      I+ +       APG  + +    TK     Q       RP 
Sbjct: 30504 RVFAENETGLSRPRRTAMSIKTK--LTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPL 30561

Query: 637   HEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQY---IFRVKAVNAVGMS 693
                D+  Y       G  L +   +K     R     + T EQ    ++   A N VG  
Sbjct: 30562 --PDIKWYRF-----GKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEV 30614

Query: 694   ENSQESDVIKVQAALTVPSHP--------YGITLLNCDGHSMTLGWKVPKFSGGSPILGY 745
             E S      K+    T   HP        YG        H M +G  VP  +       +
Sbjct: 30615 ETSS-----KLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMT-------W 30662

Query: 746   YLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
             +  ++ + +     + ++     ++  +   +    ++K+   N+ G  +          
Sbjct: 30663 FHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAI-----LDV 30717

Query: 806   EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFRE-EDAGEWITVNQ 864
             E    P+  P   +    +   S V+ WK P   G S ++ Y V+  E ++  EW  V+ 
Sbjct: 30718 EIQDKPDK-PTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSS 30776

Query: 865   TTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEA---RPG 912
               +     ++ +L +   Y FRV A N  G+  P + S  V++++   +PG
Sbjct: 30777 AISVTT-CRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPG 30826



 Score =  121 bits (304), Expect = 4e-27
 Identities = 113/424 (26%), Positives = 188/424 (44%), Gaps = 38/424 (8%)

Query: 493   GEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVV 551
             G+KE  I    L+     PGPP  V   EIS++   ++WEPP   G  P++ Y ++K   
Sbjct: 19773 GKKEYTIVVKVLD----TPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDA 19828

Query: 552   GSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVV 611
                SW  V  + +  S  + V +L EGKSY FRV + N +G+ +P E    ++A      
Sbjct: 19829 ERKSWSTVTTECSKTS--FRVANLEEGKSYFFRVFAENEYGIGDPGETRDAVKAS----- 19881

Query: 612   PSAPGRVL---ASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGY 666
                PG V+       +K+S  + W +P  +    ++GY VD  +   N W+    K +  
Sbjct: 19882 -QTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVD-FLTEENKWQRV-MKSLSL 19938

Query: 667   NRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIK---VQAALTVPSHPYGITLLNCD 723
              ++    LT G++Y FRV A N  G    S+ + V +   V   L +   P  +  L  +
Sbjct: 19939 -QYSAKDLTEGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLP-DLCYLAKE 19996

Query: 724   GHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEF 783
               +  L  K+P     +P + +   +  +       V SS    T++  D   +    ++
Sbjct: 19997 NSNFRL--KIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYD-CQKSDAGKY 20053

Query: 784   KIAAVNLAGIGEPSDPSEHFKCEAWTMPEPG-PAYDLTFCEVRDTSLVMLWKAPVYSGSS 842
              I   N+AG  E +            + +PG P   + F EV   ++ + W  P   G S
Sbjct: 20054 TITLKNVAGTKEGT-------ISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGS 20106

Query: 843   PVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTS 902
              ++ Y ++ R+    +W+T         + +V+ L +G  Y FRV A N  GVG+    S
Sbjct: 20107 EITNYILEKRDSVNNKWVTCASAVQKTTF-RVTRLHEGMEYTFRVSAENKYGVGE-GLKS 20164

Query: 903   EPVL 906
             EP++
Sbjct: 20165 EPIV 20168



 Score =  111 bits (278), Expect = 4e-24
 Identities = 93/324 (28%), Positives = 134/324 (41%), Gaps = 41/324 (12%)

Query: 152   RAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRI-ESNYG 210
             +AP     LR+  V  + +  L   V G P P+V+WY+ G  I   A+  KYRI E   G
Sbjct: 30926 QAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEII--ADGLKYRIQEFKGG 30983

Query: 211   VHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSM 270
              H L I     DD   Y   ATN  G VS  A+                 L + +P    
Sbjct: 30984 YHQLIIASVTDDDATVYQVRATNQGGSVSGTAS-----------------LEVEVPAKIH 31026

Query: 271   IPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTK 330
             +P T      LE  G      GE V++K      PD     P   W +   L+  +   +
Sbjct: 31027 LPKT------LEGMGAVHALRGEVVSIKIPFSGKPD-----PVITWQKGQDLIDNNGHYQ 31075

Query: 331   MFFGEGQASLSFSH-LHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDL 389
             +       SL F + + + D G Y +   +R G+   +  L V D        P  P  +
Sbjct: 31076 VIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADV-------PDPPRGV 31128

Query: 390   QCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFE 449
             +  D +RD V +TW  P +   S +  Y V++C      W++   A  +  +Y V  LF 
Sbjct: 31129 KVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQA--RETRYTVINLFG 31186

Query: 450   GRSYIFRVRAVNSAGISRPSRVSD 473
               SY FRV A N  G+S+PS  S+
Sbjct: 31187 KTSYQFRVIAENKFGLSKPSEPSE 31210



 Score =  102 bits (255), Expect = 2e-21
 Identities = 131/585 (22%), Positives = 229/585 (39%), Gaps = 85/585 (14%)

Query: 864  QTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVE--------ARPGTKE 915
            QT+  +    +  LQ  ++++ +     +N +G  S +++ +L E         +P + +
Sbjct: 7163 QTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVD 7222

Query: 916  ISAGVDEQGNIYLGFDCQEMTDAS-QFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDK 974
            ++ G  E G     F C     A  + TW K   EI     +K+  V + + L +    K
Sbjct: 7223 LALG--ESGT----FKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGK 7276

Query: 975  EDLGTYSVSVSDTDGVSS-SFVLDPEELERLMALSNEIKNPTIPLKSELA-YEIFDKGRV 1032
             D G Y+   S+  G  S S  L  +E  R +    +++   I  + E   YE    G  
Sbjct: 7277 GDAGQYTCYASNIAGKDSCSAQLGVQEPPRFI---KKLEPSRIVKQDEFTRYECKIGG-- 7331

Query: 1033 RFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQI 1092
                     SP+    +  ++ E+ +S   R+    +  ++EM     S+E+ G YT + 
Sbjct: 7332 ---------SPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEM--HNLSVEDSGDYTCEA 7380

Query: 1093 HDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKV 1152
            H+    + SS  L       V E   F++K       PH  E L     +  +V L C++
Sbjct: 7381 HNAAGSASSSTSL------KVKEPPIFRKK-------PHPIETL-----KGADVHLECEL 7422

Query: 1153 ANTKKETVFKWLKDDVLYETETLPNL--ERGICELLIPKLSKKDHGEYKATLKDDRGQDV 1210
              T    V  W KD     +     +  E  +  + I  +   D GEY+    +D G D 
Sbjct: 7423 QGTPPFHV-SWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDT 7481

Query: 1211 SILEIAGKVYDDMILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAK 1270
             +  IA K     +  +S +       +++  T EG      + +F D+ ++        
Sbjct: 7482 CVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAE-PISVVWFKDKGEI-------- 7532

Query: 1271 ISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEF 1330
            +  S+++ I  SE +A LQ       + GKYT +I             +     E FA  
Sbjct: 7533 VRESDNIWISYSENIATLQFSRVEPANAGKYTCQI------------KNDAGMQECFATL 7580

Query: 1331 QQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEH 1390
               + A   EK         P+ + +  G T  L CTV G P+    WFK+ +++     
Sbjct: 7581 SVLEPATIVEK---------PESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNK 7631

Query: 1391 FSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
            + +     K   + I  V   DSG YS  ++N  G +    ++ V
Sbjct: 7632 YKISFFN-KVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQV 7675



 Score = 95.5 bits (236), Expect = 3e-19
 Identities = 99/408 (24%), Positives = 161/408 (39%), Gaps = 25/408 (6%)

Query: 603   IQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEED--LLGYYVDCCVAGTNLWEPCN 660
             ++ QD    P+ P  ++     K S V+ W  P  +    +  Y V+ C A         
Sbjct: 30717 VEIQDKPDKPTGP--IVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLV 30774

Query: 661   HKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLL 720
                I      +  LT    Y FRV A N  G+S+  + S V+ +++    P  P   T+ 
Sbjct: 30775 SSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTIT 30834

Query: 721   NCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSL 780
                  S  + WK P   GG+ I  YYL+KRE     W  V +   + T+ +V  L EG  
Sbjct: 30835 AVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLE 30894

Query: 781   YEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAY--DLTFCEVRDTSLVMLWKAPVY 838
             YEF++   NL G  E S+ SE    ++  +P   P +  +L    VR  S   L    V 
Sbjct: 30895 YEFRVKCENLGGESEWSEISEPITPKS-DVPIQAPHFKEELRNLNVRYQSNATL-VCKVT 30952

Query: 839   SGSSPVSGYFVDFREEDA-GEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANG--- 894
                 P+  ++   +E  A G    + +       L ++ +      V++VRA N  G   
Sbjct: 30953 GHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVS 31012

Query: 895   ------VGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYE 948
                   V  P+    P  +E   G   + A   E  +I + F  +        TW K  +
Sbjct: 31013 GTASLEVEVPAKIHLPKTLE---GMGAVHALRGEVVSIKIPFSGK---PDPVITWQKGQD 31066

Query: 949   EISDDERFKIETVGDHSKLYLKN-PDKEDLGTYSVSVSDTDGVSSSFV 995
              I ++  +++      + L   N  +++D G Y V   +  G+    V
Sbjct: 31067 LIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTV 31114



 Score = 77.8 bits (190), Expect = 7e-14
 Identities = 113/534 (21%), Positives = 206/534 (38%), Gaps = 93/534 (17%)

Query: 930  FDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
            F+C+         W K+  EI   E+FKI   G   +L + N   ED   Y+  V   D 
Sbjct: 2901 FECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTF-VCGNDQ 2959

Query: 990  VSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRF 1049
            VS++  + P  +  ++   N  +  TI  +  + YE                    SY++
Sbjct: 2960 VSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYE------------------GISYKW 3001

Query: 1050 IINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDA 1109
            + N  E+  ++  +++  K T  + +    F    + T+      GKA S ++L +    
Sbjct: 3002 LKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVA----GKATSTATLYV---- 3053

Query: 1110 FKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDV- 1168
                    E +  EF +    H  +     V E+      C+V+  + +   +W+KDD  
Sbjct: 3054 --------EARHIEFRK----HIKDI---KVLEKKRAMFECEVS--EPDITVQWMKDDQE 3096

Query: 1169 LYETETLP-NLERGICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAM 1227
            L  T+ +    E+ +  LLIP     D G+Y        G +VS  ++  +  D  I ++
Sbjct: 3097 LQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVA----GGNVSTAKLFVEGRDVRIRSI 3152

Query: 1228 SRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSS--EHMRIGGSEEM 1285
             +        ++V+   E  R     +   D++  +W     +I+    E  +      +
Sbjct: 3153 KK-------EVQVI---EKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRI 3202

Query: 1286 AWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGR 1345
              + I E  + D G+YTF    G++    +L ++     +   E Q              
Sbjct: 3203 HRMFISETRQSDAGEYTFVA--GRNRSSVTLYVNAPEPPQVLQELQP------------- 3247

Query: 1346 LIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVK-VEQAKYVSMT 1404
                    VT+  GK       + G P P++ W+K +Q   LS  F  K +   +  ++ 
Sbjct: 3248 --------VTVQSGKPARFCAVISGRPQPKISWYKEEQ--LLSTGFKCKFLHDGQEYTLL 3297

Query: 1405 IKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAKPKLIPA 1458
            +     ED+  Y+   KN YG      ++SV     ++P++  P Q  P   PA
Sbjct: 3298 LIEAFPEDAAVYTCEAKNDYGVATTSASLSV-----EVPEVVSPDQEMPVYPPA 3346



 Score = 76.6 bits (187), Expect = 2e-13
 Identities = 115/523 (21%), Positives = 192/523 (36%), Gaps = 81/523 (15%)

Query: 930  FDCQEMTDAS--QFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDT 987
            F+C  +T A   + TW K  +EI     + I  VG+   L +    K D G Y+   ++ 
Sbjct: 6290 FECH-VTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATND 6348

Query: 988  DGVSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHL---SPD 1044
             G            + + +    +K P   +K   A ++  +G     +Q E     SP+
Sbjct: 6349 VG------------KDMCSAQLSVKEPPKFVKKLEASKVAKQGES---IQLECKISGSPE 6393

Query: 1045 ASYRFIINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLV 1104
                +  ND E+ +S  + +    +  ++   ++  S E+ G Y  + H+G   +  S  
Sbjct: 6394 IKVSWFRNDSELHESWKYNMSFINSVALL--TINEASAEDSGDYICEAHNGVGDASCSTA 6451

Query: 1105 LIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWL 1164
            L   A              F +K  P  A        +  +V L C+++ T    V  W+
Sbjct: 6452 LTVKAPPV-----------FTQKPSPVGA-------LKGSDVILQCEISGTPPFEVV-WV 6492

Query: 1165 KD--DVLYETETLPNLERGICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDD 1222
            KD   V    +     +     L I  L   D GEY     ++ G D     +  K    
Sbjct: 6493 KDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPR 6552

Query: 1223 MILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAK-ISSSEHMRIGG 1281
             +  +S         +++    EG +           + V W     + I  SE+ RI  
Sbjct: 6553 FVKKLSDTSTLIGDAVELRAIVEGFQ----------PISVVWLKDRGEVIRESENTRISF 6602

Query: 1282 SEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEK 1341
             + +A LQ+  P   + GKY  +I             +     E  A     + A   EK
Sbjct: 6603 IDNIATLQLGSPEASNSGKYICQI------------KNDAGMRECSAVLTVLEPARIIEK 6650

Query: 1342 NRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQL-SEHFSVKVEQAKY 1400
                     P+ +T+  G    L C V G P+    WFK+ +++   S+H    +   K 
Sbjct: 6651 ---------PEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFIN--KV 6699

Query: 1401 VSMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIP 1443
             S+ I      D G YS  +KN  G  K + TVSV+     +P
Sbjct: 6700 ASLKIPCAEMSDKGLYSFEVKNSVG--KSNCTVSVHVSDRIVP 6740



 Score = 72.4 bits (176), Expect = 3e-12
 Identities = 107/522 (20%), Positives = 194/522 (37%), Gaps = 69/522 (13%)

Query: 930  FDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
            F+C+         W K  +E+   +R KI+      +L + +    D G Y+V       
Sbjct: 3077 FECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVS 3136

Query: 990  VSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASY-- 1047
             +  FV   +   R+ ++  E+             ++ +K R     +      DA +  
Sbjct: 3137 TAKLFVEGRDV--RIRSIKKEV-------------QVIEKQRAVVEFEVNEDDVDAHWYK 3181

Query: 1048 -----RFIINDRE--VSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQ 1100
                  F + +R   V +  IHR           M +      + G YT        +++
Sbjct: 3182 DGIEINFQVQERHKYVVERRIHR-----------MFISETRQSDAGEYTFVA----GRNR 3226

Query: 1101 SSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETV 1160
            SS+ L  +A                  + P   + L     +  +    C V + + +  
Sbjct: 3227 SSVTLYVNA-----------------PEPPQVLQELQPVTVQSGKPARFCAVISGRPQPK 3269

Query: 1161 FKWLKDDVLYETETLPNLERGICE--LLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGK 1218
              W K++ L  T           E  LL+ +   +D   Y    K+D G   +   ++ +
Sbjct: 3270 ISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVE 3329

Query: 1219 VYDDMILAMSRVCGKSA--SPLKVLCTPEG--IRLQCFMKYFTDEMKVNWCHKDAKISSS 1274
            V + +           A  +PL+   T EG   R QC  +    ++KV+W  KD KI  S
Sbjct: 3330 VPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQC--RVSGTDLKVSWYSKDKKIKPS 3387

Query: 1275 EHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFK 1334
               R+   E+   L+I E   +D+G YTF   +       + +LS +A +    E  + +
Sbjct: 3388 RFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHE--RIE 3445

Query: 1335 AAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVK 1394
                 E     +I    + + +  G     TC +   P+    WFK  ++I  S+  S++
Sbjct: 3446 QEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIR 3505

Query: 1395 VEQAKYV-SMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
               +KY+ S+ I      D G+Y+    N+YG      T++V
Sbjct: 3506 --SSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTV 3545



 Score = 71.6 bits (174), Expect = 5e-12
 Identities = 119/575 (20%), Positives = 220/575 (38%), Gaps = 90/575 (15%)

Query: 864  QTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPS---DTSEPVLVEARPGTKEISAGV 920
            +   A+ YL   +++    YV   +A N  G+ + S      EP  +     + +++ G 
Sbjct: 4537 ENNVASLYLSGIEVKHDGKYV--CQAKNDAGIQRCSALLSVKEPATITEEAVSIDVTQG- 4593

Query: 921  DEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTY 980
             +   + + F   +   A    W K  +E++   ++KI      S L + + +K+D G Y
Sbjct: 4594 -DPATLQVKFSGTKEITAK---WFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEY 4649

Query: 981  SVSVSDTDGVSSSF----VLD---PEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVR 1033
            +  V +  G SS      VLD   P    + +   + IK   I L+  +A          
Sbjct: 4650 TFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAG--------- 4700

Query: 1034 FWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIH 1093
                    S   S ++  +D+E+S SE ++      T  +E+   +    + GTYT    
Sbjct: 4701 --------SHPISIQWFKDDQEISASEKYKFSFHDNTAFLEI--SQLEGTDSGTYTCSAT 4750

Query: 1094 DGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLH-WDVTEECEVRLVCKV 1152
            +    +Q S  L      TV             K+ P+F E     DV     V+L   V
Sbjct: 4751 NKAGHNQCSGHL------TV-------------KEPPYFVEKPQSQDVNPNTRVQLKALV 4791

Query: 1153 ANTKKETVFKWLKDDVLYETETLPNLERGICELLIPKLSKK--DHGEYKATLKDDRGQDV 1210
              T   T+ KW KD+    +    ++ +      +   + K  D G Y   L +D G   
Sbjct: 4792 GGTAPMTI-KWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTAT 4850

Query: 1211 SILEIAGKVYDDMILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAK 1270
            S   +  K     I        K  SP+ VL   +    +C +   T +++V+W     +
Sbjct: 4851 SKATLFVKEPPQFI--------KKPSPVLVLRNGQSTTFECQITG-TPKIRVSWYLDGNE 4901

Query: 1271 ISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEF 1330
            I++ +   I   + +A  QI     ++ G Y  E  +       S++L  +       E 
Sbjct: 4902 ITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIREL 4961

Query: 1331 QQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEH 1390
            +  +   +++                     + L C V G P  EV W KN+++I+ S+ 
Sbjct: 4962 KPVEVVKYSD---------------------VELECEVTGTPPFEVTWLKNNREIRSSKK 5000

Query: 1391 FSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYG 1425
            +++  ++    ++ I      D+G+Y   + N+ G
Sbjct: 5001 YTL-TDRVSVFNLHITKCDPSDTGEYQCIVSNEGG 5034



 Score = 71.2 bits (173), Expect = 7e-12
 Identities = 143/693 (20%), Positives = 256/693 (36%), Gaps = 104/693 (15%)

Query: 770  LTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSL 829
            LTV+ L E    ++   A N+AG  E S P    +  ++   +P P   LT   V  TS+
Sbjct: 7739 LTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQ-KPDPMDVLTGTNVTFTSI 7797

Query: 830  VMLWKAPVYSGSSPVS-GYFVDFREEDAGEWITVN-QTTTANRYLKVSDLQQGKTYVFRV 887
            V         G+ P S  +F    E   G+   V+ + + A   L   D  Q   Y    
Sbjct: 7798 V--------KGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYT--- 7846

Query: 888  RAVNANGVGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSY 947
              + +N  GK S T+   +       K ++    E+G   +       T     TW K+ 
Sbjct: 7847 -CIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNG 7905

Query: 948  EEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSS----FVLDPEELER 1003
              ++  +R  I T    + L + +   ED G Y+  + +  G  S      +L+P    +
Sbjct: 7906 INVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVK 7965

Query: 1004 LMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHR 1063
             +         +  L+ +LA                  +P+    +   D ++  +  ++
Sbjct: 7966 QLEPVKVSVGDSASLQCQLAG-----------------TPEIGVSWYKGDTKLRPTTTYK 8008

Query: 1064 IKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKE 1123
            +       +  +V ++  I + G Y  +  +   +  +S       F TV E+       
Sbjct: 8009 MHF--RNNVATLVFNQVDINDSGEYICKAENSVGEVSAS------TFLTVQEQ------- 8053

Query: 1124 FLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETV-FKWLKDDVLYETETLPNLERGI 1182
               K  P F+  L  DV E   + +V   A +  E +   W KD    +    PN++   
Sbjct: 8054 ---KLPPSFSRQLR-DVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDS--PNVQTSF 8107

Query: 1183 CE----LLIPKLSKKDHGEYKATLKDDRGQDVS---ILEIAGK---VYDDMILAMSRVCG 1232
             +    L I K  +   G+Y  T  +  G   S   ++   GK    +D  +  +  V G
Sbjct: 8108 LDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVG 8167

Query: 1233 KSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICE 1292
            +SA              +C +   T  +KV+W     +I S    +I   E  A L + +
Sbjct: 8168 ESAD------------FECHVTG-TQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLK 8214

Query: 1293 PTEKDKGKYTFEIFD--GKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGL 1350
              + D G+YT    +  GKD+    L++  +    +F +                    L
Sbjct: 8215 VDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTK-------------------RL 8255

Query: 1351 PDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTS 1410
             + V   EG +  L   V G+    V W+KN+ +IQ + +  +  +    V + ++    
Sbjct: 8256 SETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLV-LQVRKAGM 8314

Query: 1411 EDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIP 1443
             D+G Y+  + N   G  +  +  V K  +K P
Sbjct: 8315 NDAGLYTCKVSND-AGSALCTSSIVIKEPKKPP 8346



 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 118/566 (20%), Positives = 206/566 (36%), Gaps = 92/566 (16%)

Query: 885  FRVRAVNANGVGKPSDT---SEPVLVEARPGTKEISAGVDEQGNIYLGFDCQ-EMTDASQ 940
            +   A NA G    S +    EP +   +P   E   G D      +  +C+ + T    
Sbjct: 7376 YTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGAD------VHLECELQGTPPFH 7429

Query: 941  FTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSV-----SDTDGVSSSFV 995
             +W K   E+   +++KI +    + +++ N D  D+G Y         SDT   S +  
Sbjct: 7430 VSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALK 7489

Query: 996  LDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDRE 1055
              P  +++L  +S  +                    V+     E   P +   F      
Sbjct: 7490 APPRFVKKLSDISTVVGK-----------------EVQLQTTIEGAEPISVVWFKDKGEI 7532

Query: 1056 VSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLE 1115
            V +S+   I    +  I  +   R    N G YT QI +     +    L      +VLE
Sbjct: 7533 VRESD--NIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATL------SVLE 7584

Query: 1116 EAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKD--DVLYETE 1173
             A    K    K            VT      L C VA T  E   KW KD  ++  + +
Sbjct: 7585 PATIVEKPESIK------------VTTGDTCTLECTVAGTP-ELSTKWFKDGKELTSDNK 7631

Query: 1174 TLPNLERGICELLIPKLSKKDHGEYKATLKDDRGQD--VSILEIAGK-VYDDMILAMSRV 1230
               +    +  L I  ++  D G Y   +++  G+D   + L+++ + V       +   
Sbjct: 7632 YKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKET 7691

Query: 1231 CGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQI 1290
             G S S + + C   G          +  + V+W H+  +ISS    +   ++    L +
Sbjct: 7692 NGLSGSSVVMECKVYG----------SPPISVSWFHEGNEISSGRKYQTTLTDNTCALTV 7741

Query: 1291 CEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGL 1350
                E D G YT            + +++G   DE  A     +  +F +K         
Sbjct: 7742 NMLEESDSGDYTCI----------ATNMAGS--DECSAPLTVREPPSFVQK--------- 7780

Query: 1351 PDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTS 1410
            PD + ++ G  +  T  V G P   V WFK   ++   +  +V +E +    + +  V +
Sbjct: 7781 PDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDS-VAELELFDVDT 7839

Query: 1411 EDSGKYSINIKNKYGGEKIDVTVSVY 1436
              SG+Y+  + N+ G  K   T  +Y
Sbjct: 7840 SQSGEYTCIVSNEAG--KASCTTHLY 7863



 Score = 70.1 bits (170), Expect = 1e-11
 Identities = 108/561 (19%), Positives = 201/561 (35%), Gaps = 85/561 (15%)

Query: 885  FRVRAVNANGVGKPSDT---SEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQF 941
            F  RA N+ G    S      EP     +PG+K++  G      + L    Q  T  +  
Sbjct: 4183 FTCRATNSVGSKDSSGALIVQEPPSFVTKPGSKDVLPG----SAVCLKSTFQGSTPLT-I 4237

Query: 942  TWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG----VSSSFVLD 997
             W K  +E+       I      S L L      D GTY+  VS+  G     ++ FV +
Sbjct: 4238 RWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKE 4297

Query: 998  PEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVS 1057
            P      +  S  +K       ++LA ++               +P     +  NDRE+ 
Sbjct: 4298 PATFVEKLEPSQLLKKGDA---TQLACKVTG-------------TPPIKITWFANDREIK 4341

Query: 1058 DSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEA 1117
            +S  HR+   ++T ++ +      IE+ G Y  +  +       S ++I           
Sbjct: 4342 ESSKHRMSFVESTAVLRLT--DVGIEDSGEYMCEAQNEAGSDHCSSIVIV---------- 4389

Query: 1118 EFQRKEFLRKQGPHFA-EYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDVLYET--ET 1174
                     K+ P+F  E+   +V +E +V L+ +VA T    +  W KD+ +  +  + 
Sbjct: 4390 ---------KESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEI-TWFKDNTILRSGRKY 4439

Query: 1175 LPNLERGICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKS 1234
               ++  +  L I K    D GEY+  + ++ G  +    +  +     I  +       
Sbjct: 4440 KTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLR 4499

Query: 1235 ASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPT 1294
                    T +G          +  + V W     +I+  +++R+     +A L +    
Sbjct: 4500 GGTAAFQATLKG----------SLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGIE 4549

Query: 1295 EKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVV 1354
             K  GKY                   QA ++A  +    + +A         I      +
Sbjct: 4550 VKHDGKYVC-----------------QAKNDAGIQ----RCSALLSVKEPATITEEAVSI 4588

Query: 1355 TIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSG 1414
             + +G    L     G  +    WFK+ Q++ L   + + V     + + I     +DSG
Sbjct: 4589 DVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSI-LKIISTEKKDSG 4647

Query: 1415 KYSINIKNKYGGEKIDVTVSV 1435
            +Y+  ++N  G       ++V
Sbjct: 4648 EYTFEVQNDVGRSSCKARINV 4668



 Score = 70.1 bits (170), Expect = 1e-11
 Identities = 151/729 (20%), Positives = 265/729 (36%), Gaps = 124/729 (17%)

Query: 735  KFSGGSPI-LGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGI 793
            K +G SPI + ++ +K ++     ++   S +  T L ++ L    +  +   A N+AG 
Sbjct: 5822 KVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCT-LQLNSLDSSDMGNYTCVAANVAGS 5880

Query: 794  GE------PSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVS-G 846
             E        +P    K       EP P   L    V  TS++         G+ P    
Sbjct: 5881 DECRAVLTVQEPPSFVK-------EPEPLEVLPGKNVTFTSVIR--------GTPPFKVN 5925

Query: 847  YFVDFREEDAGEWITVN-QTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPV 905
            +F   RE   G+   +  + T A   L   D+ Q   Y      V +N  G+ S T+   
Sbjct: 5926 WFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYT----CVVSNNAGQASCTTRLF 5981

Query: 906  LVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHS 965
            + E     K +S    E G   +       T     TW K    I+  E+  I T     
Sbjct: 5982 VKEPAAFLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTC 6041

Query: 966  KLYLKNPDKEDLGTYSVSVSDTDG--VSSSFV--LDPE----ELERLMALSNEIKNPTIP 1017
             L + N  K D G YS  + +  G  V  + V  L+P     ELE L A   +    ++ 
Sbjct: 6042 ILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGD----SVS 6097

Query: 1018 LKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGIIEMVM 1077
            L+ ++A     +  V ++     L P   YR    +                  +  +V 
Sbjct: 6098 LQCQVAGT--PEITVSWYKGDTKLRPTPEYRTYFTNN-----------------VATLVF 6138

Query: 1078 DRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLH 1137
            ++ +I + G YT +  +    + S         KTV    E       R+  P FA  L 
Sbjct: 6139 NKVNINDSGEYTCKAENSIGTASS---------KTVFRIQE-------RQLPPSFARQLK 6182

Query: 1138 -WDVTEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNLERG----ICELLIPKLSK 1192
              + T    V L C++  +    V  W +D VL   +   NL+      +  L I +   
Sbjct: 6183 DIEQTVGLPVTLTCRLNGSAPIQVC-WYRDGVLLRDDE--NLQTSFVDNVATLKILQTDL 6239

Query: 1193 KDHGEYKATLKDDRGQDVSILEIAGK------VYDDMILAMSRVCGKSASPLKVLCTPEG 1246
               G+Y  +  +  G   S   +  +       +D   +++  + G+SA           
Sbjct: 6240 SHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESAD---------- 6289

Query: 1247 IRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIF 1306
               +C +      M++ W   + +I    +  I        L+I +  + D G+YT +  
Sbjct: 6290 --FECHVTG-AQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQAT 6346

Query: 1307 DGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTC 1366
            +       S  LS +   +   + +  K A                     +G+++ L C
Sbjct: 6347 NDVGKDMCSAQLSVKEPPKFVKKLEASKVAK--------------------QGESIQLEC 6386

Query: 1367 TVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYGG 1426
             + G+P+ +V WF+ND ++  S  +++    +    +TI   ++EDSG Y     N  G 
Sbjct: 6387 KISGSPEIKVSWFRNDSELHESWKYNMSFINS-VALLTINEASAEDSGDYICEAHNGVGD 6445

Query: 1427 EKIDVTVSV 1435
                  ++V
Sbjct: 6446 ASCSTALTV 6454



 Score = 69.3 bits (168), Expect = 3e-11
 Identities = 117/629 (18%), Positives = 243/629 (38%), Gaps = 91/629 (14%)

Query: 823  EVRDTSLVMLWKAPVYS---GSSPVSGYFV---DFREEDAGEWITVNQTTTANRYLKVSD 876
            ++ +T+ V+   A   S   GS P+S  ++      +ED   +I+   +      L++  
Sbjct: 5053 KIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVAT---LQIRS 5109

Query: 877  LQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEM- 935
            +  G +  +  +A N +GV +       +LV+      E +  VD      +  +C    
Sbjct: 5110 VDNGHSGRYTCQAKNESGVER---CYAFLLVQEPAQIVEKAKSVDVTEKDPMTLECVVAG 5166

Query: 936  TDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSF- 994
            T   +  W K  ++I     F +    + +   +++  K+D G Y+  V +  G SS   
Sbjct: 5167 TPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDA 5226

Query: 995  ---VLD---PEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYR 1048
               VLD   P    + +   +++   +I ++ +++  +      +++   + +S  A YR
Sbjct: 5227 YLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSL--PISAQWFKDGKEISTSAKYR 5284

Query: 1049 FIINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGD 1108
             + ++R VS                 + ++   +E+   YT ++ +       S +L   
Sbjct: 5285 LVCHERSVS-----------------LEVNNLELEDTANYTCKVSNVAGDDACSGIL--- 5324

Query: 1109 AFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDV 1168
               TV E   F  K   ++  P              E + + K     K    KW KDDV
Sbjct: 5325 ---TVKEPPSFLVKPGRQQAIPD----------STVEFKAILKGTPPFK---IKWFKDDV 5368

Query: 1169 --LYETETLPNLERGICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILA 1226
              +   +    LE     L +  +     G+Y   + +D G D     +        +  
Sbjct: 5369 ELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFV-- 5426

Query: 1227 MSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMA 1286
                  K     K++   +  RL+C +   + E++V W   + ++ +S+  R+   + +A
Sbjct: 5427 ------KKLEASKIVKAGDSSRLECKIAG-SPEIRVVWFRNEHELPASDKYRMTFIDSVA 5479

Query: 1287 WLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRL 1346
             +Q+   + +D G +  E      N   S   S +   +    F  F             
Sbjct: 5480 VIQMNNLSTEDSGDFICEA----QNPAGSTSCSTKVIVKEPPVFSSF------------- 5522

Query: 1347 IGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIK 1406
                P +V  ++   ++L C + G P  EV+W+K+ + ++ S+ + +   +  + S+ I 
Sbjct: 5523 ----PPIVETLKNAEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKI-ASKNFHTSIHIL 5577

Query: 1407 GVTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
             V + D G+Y    +N+ G +    TV +
Sbjct: 5578 NVDTSDIGEYHCKAQNEVGSDTCVCTVKL 5606



 Score = 68.6 bits (166), Expect = 4e-11
 Identities = 127/607 (20%), Positives = 225/607 (37%), Gaps = 84/607 (13%)

Query: 839  SGSSPVSG-YFVDFRE-EDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVG 896
            SGS P+S  +F D +E   + ++  V    + +  L+V++L+   T  +  +  N  G  
Sbjct: 5261 SGSLPISAQWFKDGKEISTSAKYRLVCHERSVS--LEVNNLELEDTANYTCKVSNVAGDD 5318

Query: 897  KPSD---TSEPVLVEARPGTKE-ISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISD 952
              S      EP     +PG ++ I     E   I  G      T   +  W K   E+  
Sbjct: 5319 ACSGILTVKEPPSFLVKPGRQQAIPDSTVEFKAILKG------TPPFKIKWFKDDVELVS 5372

Query: 953  DERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIK 1012
              +  I   G  S L L + D    G Y+  V++  G  S            M L  E  
Sbjct: 5373 GPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTT---------MLLVTEPP 5423

Query: 1013 NPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGI 1072
                 L++    +  D  R+   +     SP+    +  N+ E+  S+ +R+    +  +
Sbjct: 5424 KFVKKLEASKIVKAGDSSRLECKIAG---SPEIRVVWFRNEHELPASDKYRMTFIDSVAV 5480

Query: 1073 IEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHF 1132
            I+M  +  S E+ G +  +  +    +  S  +I                    K+ P F
Sbjct: 5481 IQM--NNLSTEDSGDFICEAQNPAGSTSCSTKVIV-------------------KEPPVF 5519

Query: 1133 AEYLHW-DVTEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNL--ERGICELLIPK 1189
            + +    +  +  EV L C+++ T    V  W KD     +     +  +     + I  
Sbjct: 5520 SSFPPIVETLKNAEVSLECELSGTPPFEVV-WYKDKRQLRSSKKYKIASKNFHTSIHILN 5578

Query: 1190 LSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLKVLCTPEGIRL 1249
            +   D GEY    +++ G D  +  +  K     +  ++ +   +  P ++  + EG + 
Sbjct: 5579 VDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQ- 5637

Query: 1250 QCFMKYFTDEMKVNWC-HKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDG 1308
                      + V W   K+  I  SE++RI   E +A LQ  +    + GKY  +I + 
Sbjct: 5638 ---------PIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKN- 5687

Query: 1309 KDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTV 1368
             D   R          E  A     + A   EK            +T+  G+T  L C V
Sbjct: 5688 -DGGMR----------ENMATLMVLEPAVIVEK---------AGPMTVTVGETCTLECKV 5727

Query: 1369 FGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYGGEK 1428
             G P+  V W+K+ + +  S+         K  S+ I  V  +D+G Y+  ++N  G   
Sbjct: 5728 AGTPELSVEWYKDGKLLTSSQKHKFSFYN-KISSLRILSVERQDAGTYTFQVQNNVGKSS 5786

Query: 1429 IDVTVSV 1435
                V V
Sbjct: 5787 CTAVVDV 5793



 Score = 65.9 bits (159), Expect = 3e-10
 Identities = 67/248 (27%), Positives = 102/248 (41%), Gaps = 30/248 (12%)

Query: 30    DEYASKKRASTQASSQKSLSQRSSSQRASSQTSLGGTICRVCAKRVSTQEDEEQENRSRY 89
             +EY   K A  ++SS  S   R     + +   L   +  +   R    E+ E +   R 
Sbjct: 32249 EEYEISKHAQRESSSSASRLLRRRRSLSPTYIELMRPVSELIRSRPQPAEEYEDDTERRS 32308

Query: 90    QSLVAAYGEAKRQRFLSELAHLEEDVHLARSQARDKLDKYAIQQMMEDKLAWERHTFEER 149
              +      E  R R  S ++    +  L+R +   + D ++  + M+  L  ++ T E +
Sbjct: 32309 PT-----PERTRPRSPSPVS---SERSLSRFERSARFDIFSRYESMKAALKTQK-TSERK 32359

Query: 150   ----------ISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAE 199
                       +  AP I +R+RSH V    + +    VQ  PT  V+WY +G    +  E
Sbjct: 32360 YEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNG---VELQE 32416

Query: 200   PGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVV--------RRFRG 251
               K    +  GV TLEI     DD+ TY AV TN  G+ S  A + V           R 
Sbjct: 32417 SSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRR 32476

Query: 252   DEEPFRSV 259
             DEE  RSV
Sbjct: 32477 DEEVPRSV 32484



 Score = 65.9 bits (159), Expect = 3e-10
 Identities = 50/166 (30%), Positives = 76/166 (45%), Gaps = 22/166 (13%)

Query: 1262  VNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTF--EIFDGKDNHQRSLDLS 1319
             V W     ++++SE  R G S     L I + + +D+G  T   +  +G    Q  L LS
Sbjct: 33068 VKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLS 33127

Query: 1320  GQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWF 1379
              +  D          A AF  + R +          I EG+ +  TC + G P PE+ WF
Sbjct: 33128 KELSD----------APAFISQPRSQ---------NINEGQNVLFTCEISGEPSPEIEWF 33168

Query: 1380  KNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYG 1425
             KN+  I +S + S+   +  Y S+ I+  +  DSGKY+I  KN  G
Sbjct: 33169 KNNLPISISSNVSISRSRNVY-SLEIRNASVSDSGKYTIKAKNFRG 33213



 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 61/247 (24%), Positives = 97/247 (39%), Gaps = 22/247 (8%)

Query: 154  PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
            P  + +L++  + E   +++     G P P + W K+  +I     P K RIE   G   
Sbjct: 1556 PMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYP-KIRIEGTKGEAA 1614

Query: 214  LEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPY 273
            L+I+     D+A Y+A A N  G+ +T   V V     + EP R + +P G   +  I  
Sbjct: 1615 LKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAA 1674

Query: 274  THFDVQFLE------KFGVTFRREGETVTLKCTMLVTPDLKRVQPR-------------- 313
               +   L       + G  + +E +        L +  LKR  P               
Sbjct: 1675 PELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTM 1734

Query: 314  -AEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFV 372
              EW  D   L+ +   +M    G  SL +   +  D G+ T R  ++ G    SA L V
Sbjct: 1735 VVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIV 1794

Query: 373  RDADPLV 379
            +D   LV
Sbjct: 1795 KDEKSLV 1801



 Score = 62.8 bits (151), Expect = 2e-09
 Identities = 67/264 (25%), Positives = 101/264 (38%), Gaps = 44/264 (16%)

Query: 149  RISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESN 208
            ++   P  + +L S TV      +L  +++G     VQW K+   + + +E    RI   
Sbjct: 5605 KLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESE--NIRITFV 5662

Query: 209  YGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLS 268
              V TL+  +A+  +   Y     N  G     A ++V       EP             
Sbjct: 5663 ENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVL------EP------------- 5703

Query: 269  SMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKW 328
                        +EK G      GET TL+C +  TP+L       EWY+D  LL  S+ 
Sbjct: 5704 ---------AVIVEKAGPMTVTVGETCTLECKVAGTPELS-----VEWYKDGKLLTSSQK 5749

Query: 329  TKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRD--ADPLVT------ 380
             K  F    +SL    + + D G YT ++ +  G S  +A + V D    P  T      
Sbjct: 5750 HKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNT 5809

Query: 381  -GAPGAPMDLQCHDANRDYVIVTW 403
             G  GA   L+C  A    + V W
Sbjct: 5810 GGVLGASCILECKVAGSSPISVAW 5833



 Score = 62.0 bits (149), Expect = 4e-09
 Identities = 42/125 (33%), Positives = 59/125 (47%), Gaps = 5/125 (4%)

Query: 123   RDKLDKYAIQQMMEDKLAWERHTFEERI-SRAPEILVRLRSHTVWERMSVKLCFTVQGFP 181
             R+  D Y  + M + K    R T   R+  R PE  + L + T +   +V+   T+   P
Sbjct: 31662 REVYDYYCRRTMKKIK----RRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHP 31717

Query: 182   TPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTN 241
              P V WYK G  I       KY  ES+ G++ L IN    DD A Y+ VA N +G+ S  
Sbjct: 31718 EPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCK 31777

Query: 242   AAVVV 246
             A + V
Sbjct: 31778 AKLTV 31782



 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 105/502 (20%), Positives = 190/502 (37%), Gaps = 81/502 (16%)

Query: 936  TDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
            T   + TW K+  EI   +++ +        L++   D  D G Y   VS+  G  S   
Sbjct: 4981 TPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCST 5040

Query: 996  LDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDRE 1055
                 L+   +   +I+N T  LKS   ++    G           SP  S  ++ +D+ 
Sbjct: 5041 --RVALKEPPSFIKKIENTTTVLKSSATFQSTVAG-----------SPPISITWLKDDQI 5087

Query: 1056 VSDSEIHRIKCDKATGIIEMVMDRFSIEN--EGTYTVQIHDGKAKSQSSLVLIGDAFKTV 1113
            + + +   I    +   +++     S++N   G YT Q     AK++S +     AF  V
Sbjct: 5088 LDEDDNVYISFVDSVATLQI----RSVDNGHSGRYTCQ-----AKNESGVERC-YAFLLV 5137

Query: 1114 LEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKD--DVLYE 1171
             E A+   K                DVTE+  + L C VA T  E   KWLKD   ++  
Sbjct: 5138 QEPAQIVEKA------------KSVDVTEKDPMTLECVVAGT-PELKVKWLKDGKQIVPS 5184

Query: 1172 TETLPNLERGICELLIPKLSKKDHGEYKATLKDDRGQ---DVSILEIAGKV---YDDMIL 1225
                 + E  +    I  + K+D G+Y   +++D G    D  +  +   +   +   + 
Sbjct: 5185 RYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLT 5244

Query: 1226 AMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEM 1285
             M +V G S            I ++C +   +  +   W     +IS+S   R+   E  
Sbjct: 5245 KMDKVLGSS------------IHMECKVS-GSLPISAQWFKDGKEISTSAKYRLVCHERS 5291

Query: 1286 AWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGR 1345
              L++     +D   YT ++             S  A D+A +     K         GR
Sbjct: 5292 VSLEVNNLELEDTANYTCKV-------------SNVAGDDACSGILTVKEPPSFLVKPGR 5338

Query: 1346 LIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTI 1405
                +PD        T+     + G P  ++ WFK+D ++       + +E +    + +
Sbjct: 5339 Q-QAIPD-------STVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSF-LNL 5389

Query: 1406 KGVTSEDSGKYSINIKNKYGGE 1427
              V +  +G+Y+ ++ N  G +
Sbjct: 5390 YSVDASKTGQYTCHVTNDVGSD 5411



 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 73/333 (21%), Positives = 124/333 (37%), Gaps = 48/333 (14%)

Query: 76    STQEDEEQENRSRYQSLVA--AYGEAKRQRFLS-ELAHLEEDVHLARSQARDKLDKYAIQ 132
             ++Q  +E+  RS +  L    AY  +  ++    E +    +V    ++ R+ L  Y   
Sbjct: 32472 ASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHS 32531

Query: 133   QMMEDK-LAWERHTFEERISR-------APEILVRLRSHTVWERMSVKLCFTVQGFPTPV 184
                E K  A E  + EE+ +        A  IL + RS TV+E  S +      G P P 
Sbjct: 32532 ASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPT 32591

Query: 185   VQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAV 244
             V W + G ++  +A   ++++ +     T EI+     D   YS V  N+ G+      +
Sbjct: 32592 VTWLRKGQVLSTSA---RHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTL 32648

Query: 245   VVRRFRGDEEPFRS----------------------VGLPIGLPLSSMIP---------- 272
              +++ R  E+   S                      V  P      ++ P          
Sbjct: 32649 TIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEK 32708

Query: 273   YTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMF 332
               H  V    K     + E      K T +V   + R +    WY+D   LKE+   +  
Sbjct: 32709 VQHLPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAK-EVTWYKDGKKLKENGHFQFH 32767

Query: 333   FG-EGQASLSFSHLHKDDEGLYTLRIVSRGGVS 364
             +  +G   L  ++L + D+G Y   I   GG S
Sbjct: 32768 YSADGTYELKINNLTESDQGEYVCEISGEGGTS 32800



 Score = 61.2 bits (147), Expect = 7e-09
 Identities = 32/84 (38%), Positives = 47/84 (55%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             D+VTI  G  L L   V G P+P++IW K D+++ L E  S++    K  +  IK     
Sbjct: 29055 DLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQY-TGKRATAVIKFCDRS 29113

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             DSGKY++ +KN  G + + V V V
Sbjct: 29114 DSGKYTLTVKNASGTKAVSVMVKV 29137



 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 24/201 (11%)

Query: 154  PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
            P++L  L+  TV      + C  + G P P + WYK+  L+       K +   +   +T
Sbjct: 3239 PQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGF---KCKFLHDGQEYT 3295

Query: 214  LEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPY 273
            L +  A  +D A Y+  A N +G  +T+A++             SV +P  +     +P 
Sbjct: 3296 LLLIEAFPEDAAVYTCEAKNDYGVATTSASL-------------SVEVPEVVSPDQEMPV 3342

Query: 274  THFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFF 333
              +    +     T   EG+    +C +  T DLK       WY  D  +K S++ +M  
Sbjct: 3343 --YPPAIITPLQDTVTSEGQPARFQCRVSGT-DLK-----VSWYSKDKKIKPSRFFRMTQ 3394

Query: 334  GEGQASLSFSHLHKDDEGLYT 354
             E    L  +  + +DEG YT
Sbjct: 3395 FEDTYQLEIAEAYPEDEGTYT 3415



 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 128/584 (21%), Positives = 200/584 (34%), Gaps = 125/584 (21%)

Query: 930  FDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
            F C+      + +W    ++I     F++    D  +L +     ED GTY+   S+  G
Sbjct: 3364 FQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVG 3423

Query: 990  -VSSSFVLDPE------------ELERLMALSNEIKNPTIPLKSELAY------EIFDKG 1030
             VSS+  L  E            E+E  M  +  IK    PL+  L +      EI    
Sbjct: 3424 QVSSTANLSLEAPESILHERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAP 3483

Query: 1031 RVRF-WLQAEHLSPDASYRFIINDREVSDSEIHR-------------------IKCDKAT 1070
             VRF W +A     ++    I + + +S  EI R                   + C    
Sbjct: 3484 NVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATL 3543

Query: 1071 GIIEMVMDRFSIENE-----------------GTYTVQI---HDGKAKSQSSLVLIGDAF 1110
             + E     F    +                 GT  ++     DG A S S    I DA 
Sbjct: 3544 TVTEAYPPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAE 3603

Query: 1111 -KTVLE--------------------EAEFQRKEFLRKQGPHFAEYLH-WDVTEECEVRL 1148
             K +LE                     A+  + E +    PHF + L         +V L
Sbjct: 3604 NKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKELEPVQSAINKKVHL 3663

Query: 1149 VCKVANTKKETVFKWLKDDVLYETETLPN-------LERGICELLIPKLSKKDHGEYKAT 1201
             C+V   +K TV  W KD      + LP         E  I  L IP    KD G Y  T
Sbjct: 3664 ECQVDEDRKVTV-TWSKDG-----QKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCT 3717

Query: 1202 LKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMK 1261
              ++ G       +  +     +        K   P  ++   E  RL C +K  +  ++
Sbjct: 3718 ASNEAGSSSCSATVTVREPPSFV--------KKVDPSYLMLPGESARLHCKLKG-SPVIQ 3768

Query: 1262 VNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQ 1321
            V W   + ++S S  +R+      A L I +   +D G Y+ E  +   +   S ++   
Sbjct: 3769 VTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEI--- 3825

Query: 1322 AFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKN 1381
                               K     I  L +   I+ G    L C V G    E+ WFK+
Sbjct: 3826 -----------------VIKEPPSFIKTL-EPADIVRGTNALLQCEVSGTGPFEISWFKD 3867

Query: 1382 DQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYG 1425
             + I+ S+ + +   Q   V + I    S D G+Y   + N+ G
Sbjct: 3868 KKQIRSSKKYRL-FSQKSLVCLEIFSFNSADVGEYECVVANEVG 3910



 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 137/640 (21%), Positives = 223/640 (34%), Gaps = 120/640 (18%)

Query: 902  SEPVLVEARPGTKEISAGVDEQGNIYLGFDCQ-EMTDASQFTWCKSYEEISDDERFKIET 960
            S  V+V+  P        V+   N  +  +C+   T   +  W K   ++   +++KI +
Sbjct: 5508 STKVIVKEPPVFSSFPPIVETLKNAEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKIAS 5567

Query: 961  VGDHSKLYLKNPDKEDLGTYSVSV-----SDTDGVSSSFVLDPEELERLMALSNEIKNPT 1015
               H+ +++ N D  D+G Y         SDT   +      P  + +L +L+     P 
Sbjct: 5568 KNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLNSLTVVAGEPA 5627

Query: 1016 -IPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGIIE 1074
             +    E A  IF +     WL+               ++E    E   I+      +  
Sbjct: 5628 ELQASIEGAQPIFVQ-----WLK---------------EKEEVIRESENIRITFVENVAT 5667

Query: 1075 MVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAE 1134
            +   +    N G Y  QI +     ++   L+      VLE A       + K GP    
Sbjct: 5668 LQFAKAEPANAGKYICQIKNDGGMRENMATLM------VLEPAVI-----VEKAGP---- 5712

Query: 1135 YLHWDVTEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNLE--RGICELLIPKLSK 1192
             +   V E C   L CKVA T + +V +W KD  L  +           I  L I  + +
Sbjct: 5713 -MTVTVGETCT--LECKVAGTPELSV-EWYKDGKLLTSSQKHKFSFYNKISSLRILSVER 5768

Query: 1193 KDHGEYKATLKDDRGQ-------DVSI----------LEIAGKVYDDMILAMSRVCGKSA 1235
            +D G Y   ++++ G+       DVS           L+  G V     +   +V G  +
Sbjct: 5769 QDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAG--S 5826

Query: 1236 SPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHM--------RIGGSEEM-A 1286
            SP+ V    E  ++    KY T     N C        S  M         + GS+E  A
Sbjct: 5827 SPISVAWFHEKTKIVSGAKYQTT-FSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRA 5885

Query: 1287 WLQICEPTEKDKGKYTFEIFDGKDNHQRSL---------------------DLSGQAFDE 1325
             L + EP    K     E+  GK+    S+                     D     F++
Sbjct: 5886 VLTVQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFED 5945

Query: 1326 AFAEFQQFKA--------AAFAEKNRG------RLIGGLPDVV-------TIMEGKTLNL 1364
              AE + F                N G      RL    P          ++  GK++ L
Sbjct: 5946 TVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDHSVEPGKSIIL 6005

Query: 1365 TCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKY 1424
              T  G     V W K+  +I  SE  ++ V   K   + I   T  D+G+YS  I+N+ 
Sbjct: 6006 ESTYTGTLPISVTWKKDGFNITTSEKCNI-VTTEKTCILEILNSTKRDAGQYSCEIENEA 6064

Query: 1425 GGEKIDVTVSVYKHGEKIPDMAPPQQAKPKLIPASASAAG 1464
            G +     VS  +    + ++ P + A    +      AG
Sbjct: 6065 GRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAG 6104



 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 73/337 (21%), Positives = 124/337 (36%), Gaps = 49/337 (14%)

Query: 1129  GPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKW------LKDDVLYETETLPNLERGI 1182
             GP   + +H    E   V+ VCK+ N  + T   W      L++   YE       E G+
Sbjct: 31568 GPVSGQIMHAVGEEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEI----TYEDGV 31623

Query: 1183  CELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGK----VYDDMILAMSRVCGKSASPL 1238
               L +  ++K D G Y+  + +D G+D S  E+  K    VYD       +   +    +
Sbjct: 31624 AILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTM 31683

Query: 1239  KVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWL---QICEPTE 1295
             ++L  P    L  + K           +    +     + +     + W    Q  +P +
Sbjct: 31684 RLLERPPEFTLPLYNK---------TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGD 31734

Query: 1296  KDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKN-RGRLIGGLPDVV 1354
              DK KYTFE     D     L ++    D+  AE+       + E + + +L   L    
Sbjct: 31735 NDK-KYTFE----SDKGLYQLTINSVTTDDD-AEYTVVARNKYGEDSCKAKLTVTLHPPP 31788

Query: 1355  T----------------IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQA 1398
             T                  EG+++     V G P P + W K+ Q + L  +  +  E  
Sbjct: 31789 TDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGL 31848

Query: 1399  KYVSMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
              Y ++ I+    ED+G Y +   N  G       + V
Sbjct: 31849 DYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 31885



 Score = 58.9 bits (141), Expect = 3e-08
 Identities = 104/506 (20%), Positives = 199/506 (39%), Gaps = 98/506 (19%)

Query: 930   FDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
             F+C+  T+ ++  W ++ E I D  ++ I        L +++   +D   Y+VS+++  G
Sbjct: 12659 FNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRG 12718

Query: 990   VS----SSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDA 1045
              +    ++ +++ E+L  +            PLK     E  +K  V FW +   L+   
Sbjct: 12719 ENVKSAANLIVEEEDLRIVE-----------PLKD---IETMEKKSVTFWCKVNRLN--V 12762

Query: 1046  SYRFIINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVL 1105
             + ++  N  EV        + DK   ++ +    F   +EG Y V    G+ KS + L++
Sbjct: 12763 TLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFP--DEGEYIVTA--GQDKSVAELLI 12818

Query: 1106  IGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKW-- 1163
             I         EA  +  E L  Q           VTE  +    C+++  K     KW  
Sbjct: 12819 I---------EAPTEFVEHLEDQ----------TVTEFDDAVFSCQLSREKANV--KWYR 12857

Query: 1164  ----LKDDVLYETETLPNLERGICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKV 1219
                 +K+   Y+ E   ++ R    L+I      D  EY   ++D + +       A   
Sbjct: 12858 NGREIKEGKKYKFEKDGSIHR----LIIKDCRLDDECEYACGVEDRKSR-------ARLF 12906

Query: 1220  YDDMILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRI 1279
              +++ + + R       P  +L  P G  +    +   D+++V W   +  +   +  ++
Sbjct: 12907 VEEIPVEIIR------PPQDILEAP-GADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQM 12959

Query: 1280  GGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFA 1339
                 ++  LQIC+   +D+G+Y F   D                 EA A+ +   A    
Sbjct: 12960 MSEGKIHRLQICDIKPRDQGEYRFIAKD----------------KEARAKLELAAAPKIK 13003

Query: 1340  EKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAK 1399
               ++  ++    DV     GK L +       P  E  WFK ++ +  ++      EQ  
Sbjct: 13004 TADQDLVV----DV-----GKPLTMVVPYDAYPKAEAEWFKENEPLS-TKTIDTTAEQTS 13053

Query: 1400  YVSMTIKGVTSEDSGKYSINIKNKYG 1425
             +  +  K     D G+Y I ++NK+G
Sbjct: 13054 FRILEAK---KGDKGRYKIVLQNKHG 13076



 Score = 58.5 bits (140), Expect = 4e-08
 Identities = 36/101 (35%), Positives = 61/101 (60%), Gaps = 6/101 (5%)

Query: 154 PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
           P  + RL+S TV +   V+L   V G PTPVV++Y+DG+ I  + +   ++I     +++
Sbjct: 104 PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLD---FQISQEGDLYS 160

Query: 214 LEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEE 254
           L I  A  +D+ TYS  ATN+ G+ ++ A ++V   +G+EE
Sbjct: 161 LLIAEAYPEDSGTYSVNATNSVGRATSTAELLV---QGEEE 198



 Score = 58.2 bits (139), Expect = 6e-08
 Identities = 33/106 (31%), Positives = 49/106 (46%), Gaps = 3/106 (2%)

Query: 148   ERISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIES 207
             E IS  P I+  L+  TV      K      G P P   W KDG  I Q    GKY++  
Sbjct: 32846 EPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQG---GKYKLSE 32902

Query: 208   NYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDE 253
             + G   LEI++ D  D+  Y+    N+ G VS++  + ++  +  E
Sbjct: 32903 DKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTE 32948



 Score = 57.8 bits (138), Expect = 8e-08
 Identities = 60/265 (22%), Positives = 96/265 (36%), Gaps = 42/265 (15%)

Query: 145  TFEERISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYR 204
            + E ++   P  +  L+   V +   V+L   V G P   V W K+   I  +    KY 
Sbjct: 4946 SIELKVKEPPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSK---KYT 5002

Query: 205  IESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIG 264
            +     V  L I + D  DT  Y  + +N  G  S +  V ++     E P         
Sbjct: 5003 LTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALK-----EPP--------- 5048

Query: 265  LPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLK 324
                           F++K   T      + T + T+  +P +        W +DD +L 
Sbjct: 5049 --------------SFIKKIENTTTVLKSSATFQSTVAGSPPIS-----ITWLKDDQILD 5089

Query: 325  ESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPG 384
            E     + F +  A+L    +     G YT +  +  GV    AFL V++   +V  A  
Sbjct: 5090 EDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIVEKAKS 5149

Query: 385  A------PMDLQCHDANRDYVIVTW 403
                   PM L+C  A    + V W
Sbjct: 5150 VDVTEKDPMTLECVVAGTPELKVKW 5174



 Score = 57.8 bits (138), Expect = 8e-08
 Identities = 118/544 (21%), Positives = 191/544 (35%), Gaps = 82/544 (15%)

Query: 893  NGVGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQ-EMTDASQFTWCKSYEEIS 951
            NGVG  S  S  + V+A P   +  + V       +   C+   T   +  W K  +++ 
Sbjct: 6441 NGVGDAS-CSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVR 6499

Query: 952  DDERFKIETVGDHSKLYLKNPDKEDLGTYSVSV-----SDTDGVSSSFVLDPEELERLMA 1006
            + ++FKI +    + L++ N +  D+G Y         SDT   S  F   P  +++L  
Sbjct: 6500 NSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSD 6559

Query: 1007 LSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKC 1066
             S  I +    ++     E F    V  WL+               DR     E    + 
Sbjct: 6560 TSTLIGDA---VELRAIVEGFQPISV-VWLK---------------DRGEVIRESENTRI 6600

Query: 1067 DKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLR 1126
                 I  + +      N G Y  QI +     + S VL      TVLE A       + 
Sbjct: 6601 SFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVL------TVLEPARI-----IE 6649

Query: 1127 KQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNLE--RGICE 1184
            K  P         VT      L C V  T  E   KW KD      ++  ++     +  
Sbjct: 6650 KPEP-------MTVTTGNPFALECVVTGTP-ELSAKWFKDGRELSADSKHHITFINKVAS 6701

Query: 1185 LLIPKLSKKDHGEYKATLKDDRGQD---VSILEIAGKVYDDMILAMSRVCGKSASPLKVL 1241
            L IP     D G Y   +K+  G+    VS+      V    I  +  V     + + + 
Sbjct: 6702 LKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLE 6761

Query: 1242 CTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKY 1301
            C   G          +  + V W     +I S    +   SE +  L +      D G Y
Sbjct: 6762 CRVSG----------SAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIY 6811

Query: 1302 TFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKT 1361
            T            + +++G   DE  A     +  +F +          PD V ++ G +
Sbjct: 6812 TCV----------AANVAGS--DECSAVLTVQEPPSFEQT---------PDSVEVLPGMS 6850

Query: 1362 LNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIK 1421
            L  T  + G P  +V WFK  +++   E  ++ +E      + +  V   +SG YS  + 
Sbjct: 6851 LTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDF-VTELELFEVQPLESGDYSCLVT 6909

Query: 1422 NKYG 1425
            N  G
Sbjct: 6910 NDAG 6913



 Score = 57.0 bits (136), Expect = 1e-07
 Identities = 109/586 (18%), Positives = 215/586 (36%), Gaps = 97/586 (16%)

Query: 873   KVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEAR--------PGTKEISAGVDEQG 924
             KV    +GK +   +R V     G+   T++     A           TK +     E+G
Sbjct: 12240 KVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEG 12299

Query: 925   NIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSV 984
                +  +C+   + ++  W K+  EI   ++++I   G   KL + +   ED+ TY+   
Sbjct: 12300 ATAV-LECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDA 12358

Query: 985   SDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPD 1044
              D    S +  + P  +E L  L++               ++ +K   RF  + E    +
Sbjct: 12359 KDFK-TSCNLNVVPPHVEFLRPLTD--------------LQVREKEMARF--ECELSREN 12401

Query: 1045  ASYRFIINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLV 1104
             A  ++  +  E+   + + I    A  I  +V+++  +++E  Y+ ++   +        
Sbjct: 12402 AKVKWFKDGAEIKKGKKYDIISKGAVRI--LVINKCLLDDEAEYSCEVRTART------- 12452

Query: 1105  LIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWL 1164
                    TVLEE     K              + +V+E   ++LVC+V+    E +  W 
Sbjct: 12453 ---SGMLTVLEEEAVFTKNL-----------ANIEVSETDTIKLVCEVSKPGAEVI--WY 12496

Query: 1165  K-DDVLYETETLPNLERGICELL-IPKLSKKDHGEYKATLKDDRGQ-DVSILEIAGKVYD 1221
             K D+ + ET     L  G   +L I     +D G Y   L   R    V + E+A +   
Sbjct: 12497 KGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFI- 12555

Query: 1222  DMILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGG 1281
                             L++L   EG + +       +   V W   D  + S +   +  
Sbjct: 12556 -----------SKPQNLEIL---EGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIA 12601

Query: 1282  SEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEK 1341
               +   L + + T +D G Y   +   +                         AA     
Sbjct: 12602 DGKKRVLVVKDATLQDMGTYVVMVGAAR------------------------AAAHLTVI 12637

Query: 1342  NRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYV 1401
              + R++  L D   + E + +   C V      +  WF+N++ I  S  + +  +   Y 
Sbjct: 12638 EKLRIVVPLKD-TRVKEQQEVVFNCEV-NTEGAKAKWFRNEEAIFDSSKYIILQKDLVY- 12694

Query: 1402  SMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAP 1447
             ++ I+    +D   Y++++ N + GE +    ++    E +  + P
Sbjct: 12695 TLRIRDAHLDDQANYNVSLTN-HRGENVKSAANLIVEEEDLRIVEP 12739



 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 54/225 (24%), Positives = 85/225 (37%), Gaps = 36/225 (16%)

Query: 150  ISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNY 209
            +   P  + ++ + T   + S     TV G P   + W KD  ++    E     I    
Sbjct: 5044 LKEPPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQIL---DEDDNVYISFVD 5100

Query: 210  GVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSS 269
             V TL+I   D   +  Y+  A N  G     A ++V      +EP              
Sbjct: 5101 SVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLV------QEP-------------- 5140

Query: 270  MIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWT 329
                     Q +EK       E + +TL+C +  TP+LK      +W +D   +  S++ 
Sbjct: 5141 --------AQIVEKAKSVDVTEKDPMTLECVVAGTPELK-----VKWLKDGKQIVPSRYF 5187

Query: 330  KMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRD 374
             M F    AS     + K D G YT ++ +  G S   A+L V D
Sbjct: 5188 SMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLD 5232



 Score = 56.2 bits (134), Expect = 2e-07
 Identities = 98/501 (19%), Positives = 188/501 (37%), Gaps = 63/501 (12%)

Query: 948   EEISD----DERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELER 1003
             EEIS      E  K+       KL LK    + L +  V  S    +  S V   EE+ +
Sbjct: 32970 EEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIV--HEEITK 33027

Query: 1004  LMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHR 1063
                 S E++     +K+       ++G+ R  L+A +++     ++++N  E+++SE +R
Sbjct: 33028 TSQASEEVRTHA-EIKAFSTQMSINEGQ-RLVLKA-NIAGATDVKWVLNGVELTNSEEYR 33084

Query: 1064  IKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKE 1123
                  +   + +       E   T   +  +G  K Q  L L                KE
Sbjct: 33085 YGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTL---------------SKE 33129

Query: 1124  FLRKQGPHF-AEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNLERG- 1181
                   P F ++    ++ E   V   C+++      + +W K+++     +  ++ R  
Sbjct: 33130 L--SDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEI-EWFKNNLPISISSNVSISRSR 33186

Query: 1182  -ICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLKV 1240
              +  L I   S  D G+Y    K+ RGQ  +   +       M+L +     +      V
Sbjct: 33187 NVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASL-------MVLPLVEEPSREV----V 33235

Query: 1241  LCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGK 1300
             L T     LQ    + +  ++++   ++A  SS          EM +  +   +      
Sbjct: 33236 LRTSGDTSLQG--SFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSM-- 33291

Query: 1301  YTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRG-----RLIGGLPDVVT 1355
                         +  +++S  +F    +   Q +++       G       I  LP  ++
Sbjct: 33292 -----------QESFVEMSSSSF-MGISNMTQLESSTSKMLKAGIRGIPPKIEALPSDIS 33339

Query: 1356  IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQA-KYVSMTIKGVTSEDSG 1414
             I EGK L + C   G P PEV W    + I   E     +E      ++ I  V  +D G
Sbjct: 33340 IDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGG 33399

Query: 1415  KYSINIKNKYGGEKIDVTVSV 1435
              Y++++ N++G +   V + +
Sbjct: 33400 LYTLSLGNEFGSDSATVNIHI 33420



 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 40/202 (19%), Positives = 91/202 (45%), Gaps = 11/202 (5%)

Query: 1247  IRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIF 1306
             ++  C ++ +    +V W     ++ +SE   I   + +A L + + T+ D G Y  ++ 
Sbjct: 31585 VKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVV 31644

Query: 1307  DGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEK-NRGRLIGGLPDVV------TIMEG 1359
             +         +L  +   E +  + +        + +  RL+   P+        T   G
Sbjct: 31645 NDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVG 31704

Query: 1360  KTLNLTCTVFGNPDPEVIWFKNDQDIQLSEH---FSVKVEQAKYVSMTIKGVTSEDSGKY 1416
             + +    T+  +P+P V W+K+ Q I+  ++   ++ + ++  Y  +TI  VT++D  +Y
Sbjct: 31705 ENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLY-QLTINSVTTDDDAEY 31763

Query: 1417  SINIKNKYGGEKIDVTVSVYKH 1438
             ++  +NKYG +     ++V  H
Sbjct: 31764 TVVARNKYGEDSCKAKLTVTLH 31785



 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 69/264 (26%), Positives = 108/264 (40%), Gaps = 19/264 (7%)

Query: 12    RHRHFDQSYRNIQTRYLLDEYASKKRASTQASSQKSLS-QRSSSQRASSQTSLGGTICRV 70
             R      S    Q +  L E ASK   S +     + S ++S      ++TS      R 
Sbjct: 32978 RSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRT 33037

Query: 71    CA--KRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHLEE--------DVHLARS 120
              A  K  STQ    +  R   ++ +A   + K      EL + EE        D  L   
Sbjct: 33038 HAEIKAFSTQMSINEGQRLVLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIK 33097

Query: 121   QA--RDKLDKYAIQQMMEDKLAWERH-TFEERISRAPEILVRLRSHTVWERMSVKLCFTV 177
             QA  RD+     I +  E  +  +   T  + +S AP  + + RS  + E  +V     +
Sbjct: 33098 QASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEI 33157

Query: 178   QGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQ 237
              G P+P ++W+K+   I  ++      I  +  V++LEI  A   D+  Y+  A N  GQ
Sbjct: 33158 SGEPSPEIEWFKNNLPISISS---NVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQ 33214

Query: 238   VSTNAAVVVRRFRGDEEPFRSVGL 261
              S  A+++V      EEP R V L
Sbjct: 33215 CSATASLMVLPL--VEEPSREVVL 33236



 Score = 55.1 bits (131), Expect = 5e-07
 Identities = 30/86 (34%), Positives = 46/86 (53%), Gaps = 3/86 (3%)

Query: 1350  LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVT 1409
             +P+ +TI  GK L +   V+G P P   W K + ++  S H +V    +  + + IK VT
Sbjct: 18904 MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSI-LIIKDVT 18962

Query: 1410  SEDSGKYSINIKNKYG--GEKIDVTV 1433
              +DSG YS+  +N  G   +KI V V
Sbjct: 18963 RKDSGYYSLTAENSSGTDTQKIKVVV 18988



 Score = 54.7 bits (130), Expect = 6e-07
 Identities = 61/243 (25%), Positives = 101/243 (41%), Gaps = 29/243 (11%)

Query: 154  PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
            P ++  L++ TV E  SV L   + G+P+P V WY++   I  + +   ++I    G+  
Sbjct: 943  PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSID---FQITFQSGIAR 999

Query: 214  LEINRADFDDTATYSAVATNAHGQVSTNAAVVVR--------------RFRGDEEPFRS- 258
            L I  A  +D+  ++  A N  G VST+  + V+              +F  +E+ F   
Sbjct: 1000 LMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVES 1059

Query: 259  ---VGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAE 315
               V     L      P       F+ K  V    EG +V   C +   P     +P   
Sbjct: 1060 RDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNP-----KPHVY 1114

Query: 316  WYRDDVLLKESKWTKMFFGE--GQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVR 373
            W +  V L      K+ + +  G+  L  S    DD G YT+ + ++ G +  SA L + 
Sbjct: 1115 WKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL-LE 1173

Query: 374  DAD 376
            +AD
Sbjct: 1174 EAD 1176



 Score = 54.7 bits (130), Expect = 6e-07
 Identities = 50/192 (26%), Positives = 80/192 (41%), Gaps = 39/192 (20%)

Query: 185  VQWYKDGSLICQAAEPGK-YRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAA 243
            V W KDG    Q   PGK Y+I     + TLEI  A   D+ TY   A+N  G  S +A 
Sbjct: 3675 VTWSKDG----QKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSAT 3730

Query: 244  VVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTF-RREGETVTLKCTML 302
            V VR     E P                        F++K   ++    GE+  L C + 
Sbjct: 3731 VTVR-----EPP-----------------------SFVKKVDPSYLMLPGESARLHCKLK 3762

Query: 303  VTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGG 362
             +P +     +  W++++  L ES   +M+F   +A L  + +  +D G Y+   V+  G
Sbjct: 3763 GSPVI-----QVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVG 3817

Query: 363  VSDHSAFLFVRD 374
                S  + +++
Sbjct: 3818 SDSCSTEIVIKE 3829



 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 65/276 (23%), Positives = 95/276 (34%), Gaps = 45/276 (16%)

Query: 154  PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
            P  L R +S T +   + K   TV G P     W KDG+ +  +     +RI      H 
Sbjct: 3551 PTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPN---WRISDAENKHI 3607

Query: 214  LEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPY 273
            LE++     D   YS  A+N  G     A +++     D+  F     P+   ++  +  
Sbjct: 3608 LELSNLTIQDRGVYSCKASNKFGADICQAELIII----DKPHFIKELEPVQSAINKKV-- 3661

Query: 274  THFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFF 333
             H + Q  E   VT                            W +D   L   K  K+ F
Sbjct: 3662 -HLECQVDEDRKVT--------------------------VTWSKDGQKLPPGKDYKICF 3694

Query: 334  GEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFL-------FVRDADPLVTGAPGAP 386
             +  A+L        D G Y     +  G S  SA +       FV+  DP     PG  
Sbjct: 3695 EDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGES 3754

Query: 387  MDLQCHDANRDYVIVTWKPPN--TTTESPVMGYFVD 420
              L C       + VTW   N   +  + V  YFV+
Sbjct: 3755 ARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVN 3790



 Score = 52.8 bits (125), Expect = 2e-06
 Identities = 62/264 (23%), Positives = 99/264 (37%), Gaps = 42/264 (15%)

Query: 147  EERISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIE 206
            E  +  AP I  ++    V      K    +Q  P    QW+K G  I    E  K  I 
Sbjct: 3449 EMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIY---ESDKCSIR 3505

Query: 207  SNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLP 266
            S+  + +LEI R    D   Y+  A+N +G VS  A + V       E +    L     
Sbjct: 3506 SSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVT------EAYPPTFLSRPKS 3559

Query: 267  LSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKES 326
            L++ +                    G+     CT+  TP ++ +     W +D   L  S
Sbjct: 3560 LTTFV--------------------GKAAKFICTVTGTPVIETI-----WQKDGAALSPS 3594

Query: 327  KWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFL-------FVRDADPLV 379
               ++   E +  L  S+L   D G+Y+ +  ++ G     A L       F+++ +P V
Sbjct: 3595 PNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKELEP-V 3653

Query: 380  TGAPGAPMDLQCHDANRDYVIVTW 403
              A    + L+C       V VTW
Sbjct: 3654 QSAINKKVHLECQVDEDRKVTVTW 3677



 Score = 52.8 bits (125), Expect = 2e-06
 Identities = 56/250 (22%), Positives = 88/250 (35%), Gaps = 48/250 (19%)

Query: 170  SVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSA 229
            SV L   V G P   V WYK  + +    E   YR      V TL  N+ + +D+  Y+ 
Sbjct: 6095 SVSLQCQVAGTPEITVSWYKGDTKLRPTPE---YRTYFTNNVATLVFNKVNINDSGEYTC 6151

Query: 230  VATNAHGQVSTNAAVVVRRFR---GDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGV 286
             A N+ G  S+     ++  +         + +   +GLP++                 +
Sbjct: 6152 KAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVT-----------------L 6194

Query: 287  TFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLH 346
            T R  G      C                WYRD VLL++ +  +  F +  A+L      
Sbjct: 6195 TCRLNGSAPIQVC----------------WYRDGVLLRDDENLQTSFVDNVATLKILQTD 6238

Query: 347  KDDEGLYTLRIVSRGGVSDHSAFLFVR--------DADPL-VTGAPGAPMDLQCHDANRD 397
                G Y+    +  G +  SA L  R        D  P+ +    G   D +CH     
Sbjct: 6239 LSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQ 6298

Query: 398  YVIVTWKPPN 407
             + +TW   N
Sbjct: 6299 PMRITWSKDN 6308



 Score = 52.4 bits (124), Expect = 3e-06
 Identities = 26/80 (32%), Positives = 47/80 (58%), Gaps = 2/80 (2%)

Query: 1346 LIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTI 1405
            L+ GL +V T++EG+++ L C + G P P V W++ D  I+ S  F +   Q+    + I
Sbjct: 945  LVSGLKNV-TVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITF-QSGIARLMI 1002

Query: 1406 KGVTSEDSGKYSINIKNKYG 1425
            +   +EDSG+++ +  N+ G
Sbjct: 1003 REAFAEDSGRFTCSAVNEAG 1022



 Score = 52.0 bits (123), Expect = 4e-06
 Identities = 51/223 (22%), Positives = 91/223 (40%), Gaps = 31/223 (13%)

Query: 151 SRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYG 210
           ++AP     L+S  V E  +      + GFP P V W++DG +I  +  PG  +I  + G
Sbjct: 3   TQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPG-VQISFSDG 61

Query: 211 VHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSM 270
              L I      ++  YS  ATN  GQ ++ A ++V   + +  P               
Sbjct: 62  RAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLV---KAETAP--------------- 103

Query: 271 IPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTK 330
                    F+++      R+G  V L+  +   P      P  ++YRD   ++ S   +
Sbjct: 104 -------PNFVQRLQSMTVRQGSQVRLQVRVTGIP-----TPVVKFYRDGAEIQSSLDFQ 151

Query: 331 MFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVR 373
           +       SL  +  + +D G Y++   +  G +  +A L V+
Sbjct: 152 ISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 52.0 bits (123), Expect = 4e-06
 Identities = 48/207 (23%), Positives = 83/207 (40%), Gaps = 27/207 (13%)

Query: 1245 EGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFE 1304
            E + L+C +  +     V W  +D +I SS   +I     +A L I E   +D G++T  
Sbjct: 958  ESVTLECHISGYPSPT-VTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCS 1016

Query: 1305 IFDGKDNHQRSLDLSGQAFDE-----------------AFAEFQQ--FKAAAFAEKNRGR 1345
              +       S  L+ Q  +E                  F E +       +  E+  G 
Sbjct: 1017 AVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGP 1076

Query: 1346 LIGGLPDVVT------IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKV-EQA 1398
                 P  +T      ++EG ++   C V GNP P V W K+   +     + V   +Q 
Sbjct: 1077 GEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQT 1136

Query: 1399 KYVSMTIKGVTSEDSGKYSINIKNKYG 1425
                + I    ++D+G+Y+I ++NK+G
Sbjct: 1137 GECKLVISMTFADDAGEYTIVVRNKHG 1163



 Score = 52.0 bits (123), Expect = 4e-06
 Identities = 57/240 (23%), Positives = 91/240 (37%), Gaps = 42/240 (17%)

Query: 177  VQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHG 236
            V G P   + WYK+ + +  A     Y+++    V +L IN+ D  D   YS  A N+ G
Sbjct: 7043 VDGTPEIRISWYKEHTKLRSAPA---YKMQFKNNVASLVINKVDHSDVGEYSCKADNSVG 7099

Query: 237  QVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVT 296
             V+++A +V++  +          LP         P+      F  K        G  V 
Sbjct: 7100 AVASSAVLVIKARK----------LP---------PF------FARKLKDVHETLGFPVA 7134

Query: 297  LKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLR 356
             +C +  +  L     +  WY+D VLLK+    +  F    A+L      +   G Y   
Sbjct: 7135 FECRINGSEPL-----QVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCS 7189

Query: 357  IVSRGGVSDHSAFLFVR--------DADPL-VTGAPGAPMDLQCHDANRDYVIVTWKPPN 407
              +  G +  SA L +         D  P+ V  A G     +CH      + +TW   N
Sbjct: 7190 ASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDN 7249



 Score = 50.8 bits (120), Expect = 9e-06
 Identities = 113/619 (18%), Positives = 230/619 (37%), Gaps = 109/619 (17%)

Query: 872  LKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARP---GTKEISAGVDEQGNIYL 928
            L + D+    +    V+A+N  G    + +   +LV+A+     T+E+   V ++ +   
Sbjct: 2136 LVIRDVTAEDSASIMVKAINIAG---ETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMA 2192

Query: 929  GFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTD 988
             F+C+      +  W K   E+ + +++++ +      L +   D  D   YS  + + +
Sbjct: 2193 TFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDE 2252

Query: 989  GVSSS-----------FVLDPEELERLMALSNEIK-------------NPTIPLKSELAY 1024
             V ++           FV + +++E   + S E++             +  + LKS   Y
Sbjct: 2253 NVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKY 2312

Query: 1025 EIFDK-GRVRFWLQAEHLSPDASYRFIIN----------------------DREVSDSEI 1061
             I  + GR    ++         Y F+I+                      D++V + +I
Sbjct: 2313 TITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDI 2372

Query: 1062 HRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQR 1121
             +++   +   +E V  +   E + +  V I   K   QS ++LI D  K       F  
Sbjct: 2373 VQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDK---QSHMLLIEDMTKEDAGNYSFTI 2429

Query: 1122 KEFLRKQGPHFAEYL--------HWDVTEECEVRLVCKVANTKKETVFKWLKDDVLYETE 1173
                       + Y           +V E  +  L CKV+     +V  +L D+ +   +
Sbjct: 2430 PALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDD 2489

Query: 1174 TLPNLERGICE-LLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCG 1232
             +  + +G  + L+I +    D G YK               I G+V  +  L++ ++  
Sbjct: 2490 RVQAIVKGTKQRLVINRTHASDEGPYKL--------------IVGRVETNCNLSVEKI-- 2533

Query: 1233 KSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICE 1292
            K    L+ L   E   +   ++     + V W  KD +I  S   +I    ++  L +  
Sbjct: 2534 KIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLN 2593

Query: 1293 PTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPD 1352
              + D+GKYTF  + G++     L ++G A  +   +                       
Sbjct: 2594 MMKDDEGKYTF--YAGENMTSGKLTVAGGAISKPLTD----------------------- 2628

Query: 1353 VVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSED 1412
              T+ E +     C V  NPD +  W ++ + + L+ +   + +  K   + I     +D
Sbjct: 2629 -QTVAESQEAVFECEV-ANPDSKGEWLRDGKHLPLTNNIRSESDGHKR-RLIIAATKLDD 2685

Query: 1413 SGKYSINIKNKYGGEKIDV 1431
             G+Y+  +       K+ V
Sbjct: 2686 IGEYTYKVATSKTSAKLKV 2704



 Score = 50.8 bits (120), Expect = 9e-06
 Identities = 59/283 (20%), Positives = 107/283 (37%), Gaps = 31/283 (10%)

Query: 1184 ELLIPKLSKKDHGEYKATLKDDRGQDVSI----LEIAGKVYDDMILAMSRVCGKSASPLK 1239
            +L I +   +D G Y     +  GQ  S     LE    +  + I     +  K+A  +K
Sbjct: 3400 QLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKAAPVIK 3459

Query: 1240 VLCTPEGIRLQCFMKYFTD-----EMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPT 1294
                P  + L    K+  +      ++  W     +I  S+   I  S+ ++ L+I    
Sbjct: 3460 RKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQ 3519

Query: 1295 EKDKGKYTFEIFDGKDNHQRSLDLS-GQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDV 1353
              D G+YT +  +   +   +  L+  +A+   F                       P  
Sbjct: 3520 VVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLS--------------------RPKS 3559

Query: 1354 VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
            +T   GK     CTV G P  E IW K+   +  S ++ +   + K++ + +  +T +D 
Sbjct: 3560 LTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHI-LELSNLTIQDR 3618

Query: 1414 GKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAKPKLI 1456
            G YS    NK+G +     + +      I ++ P Q A  K +
Sbjct: 3619 GVYSCKASNKFGADICQAELIIIDKPHFIKELEPVQSAINKKV 3661



 Score = 50.8 bits (120), Expect = 9e-06
 Identities = 67/281 (23%), Positives = 113/281 (40%), Gaps = 48/281 (17%)

Query: 152  RAPEILV-RLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYG 210
            +AP   V RL  +++ +   + L  T  G P   V W K+G  +  +    +  I +   
Sbjct: 7865 KAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQ---RCNITTTEK 7921

Query: 211  VHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSM 270
               LEI  +  +D   Y+    NA G+ S +A +++       EP               
Sbjct: 7922 SAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILIL------EP--------------- 7960

Query: 271  IPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTK 330
             PY    V+ LE   V+    G++ +L+C +  TP++        WY+ D  L+ +   K
Sbjct: 7961 -PYF---VKQLEPVKVSV---GDSASLQCQLAGTPEIG-----VSWYKGDTKLRPTTTYK 8008

Query: 331  MFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDAD---------PLVTG 381
            M F    A+L F+ +  +D G Y  +  +  G    S FL V++             V  
Sbjct: 8009 MHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQE 8068

Query: 382  APGAPMDLQCHDANRDYVIVTW-KPPNTTTESP-VMGYFVD 420
              G P+   C  +  + + V+W K      +SP V   F+D
Sbjct: 8069 TVGLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLD 8109



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 58/228 (25%), Positives = 86/228 (37%), Gaps = 49/228 (21%)

Query: 186  QWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVV 245
            QW+KDG  I  +A   KYR+  +    +LE+N  + +DTA Y+   +N  G  + +  + 
Sbjct: 5269 QWFKDGKEISTSA---KYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILT 5325

Query: 246  VRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTP 305
            V+     E P                        FL K G        TV  K  +  TP
Sbjct: 5326 VK-----EPP-----------------------SFLVKPGRQQAIPDSTVEFKAILKGTP 5357

Query: 306  DLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDD---EGLYTLRIVSRGG 362
              K      +W++DDV L      K F G  + S SF +L+  D    G YT  + +  G
Sbjct: 5358 PFK-----IKWFKDDVELVSG--PKCFIGL-EGSTSFLNLYSVDASKTGQYTCHVTNDVG 5409

Query: 363  VSDHSAFL-------FVRDADPLVTGAPGAPMDLQCHDANRDYVIVTW 403
                +  L       FV+  +       G    L+C  A    + V W
Sbjct: 5410 SDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVW 5457



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 66/254 (25%), Positives = 93/254 (36%), Gaps = 45/254 (17%)

Query: 159  RLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINR 218
            RL   +V     + L  T  G P   V W KD  LI Q+        E +     LEI  
Sbjct: 6932 RLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKST---ILEILE 6988

Query: 219  ADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDV 278
            +  +D A YS +  N  GQ    A V V       EP                PY     
Sbjct: 6989 STIEDYAQYSCLIENEAGQDICEALVSVL------EP----------------PY----- 7021

Query: 279  QFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQA 338
             F+E         GE  TL+C +  TP++     R  WY++   L+ +   KM F    A
Sbjct: 7022 -FIEPLEHVEAVIGEPATLQCKVDGTPEI-----RISWYKEHTKLRSAPAYKMQFKNNVA 7075

Query: 339  SLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFV--RDADPL-------VTGAPGAPMDL 389
            SL  + +   D G Y+ +  +  G    SA L +  R   P        V    G P+  
Sbjct: 7076 SLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLPPFFARKLKDVHETLGFPVAF 7135

Query: 390  QCHDANRDYVIVTW 403
            +C     + + V+W
Sbjct: 7136 ECRINGSEPLQVSW 7149



 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 28/107 (26%), Positives = 52/107 (48%), Gaps = 6/107 (5%)

Query: 1351  PDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTS 1410
             P  +T+ EG++   +C   G P P V W +  Q +  S    V   + K  +  I  V +
Sbjct: 32567 PRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYK-STFEISSVQA 32625

Query: 1411  EDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMA---PPQQAKPK 1454
              D G YS+ ++N  G ++ + T+++ K   ++ + A   PP+   P+
Sbjct: 32626 SDEGNYSVVVENSEGKQEAEFTLTIQK--ARVTEKAVTSPPRVKSPE 32670



 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 54/214 (25%), Positives = 77/214 (35%), Gaps = 40/214 (18%)

Query: 175  FTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNA 234
            +TV G P    +WYKDG  +  +    KYRI     V  L+   A+  D+  Y+   +N 
Sbjct: 4038 YTVAGTPELKPKWYKDGRPLVASK---KYRISFKNNVAQLKFYSAELHDSGQYTFEISNE 4094

Query: 235  HGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGET 294
             G  S      V     D  PF                           F    R     
Sbjct: 4095 VGSSSCETTFTV--LDRDIAPF---------------------------FTKPLRNVDSV 4125

Query: 295  VTLKCTMLVTPDLK---RVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEG 351
            V   C +    D K    +  R  W++D   +  S   ++ F EG ASL    +  +D G
Sbjct: 4126 VNGTCRL----DCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAG 4181

Query: 352  LYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGA 385
             +T R  +  G  D S  L V++    VT  PG+
Sbjct: 4182 NFTCRATNSVGSKDSSGALIVQEPPSFVT-KPGS 4214



 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 123/610 (20%), Positives = 219/610 (35%), Gaps = 104/610 (17%)

Query: 837  VYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKT-------YVFRVRA 889
            +  G  P+S  ++    +D GE I  ++ T  +    ++ LQ G         Y+ +++ 
Sbjct: 6573 IVEGFQPISVVWL----KDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIK- 6627

Query: 890  VNANGVGKPS---DTSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEM-TDASQFTWCK 945
             N  G+ + S      EP  +  +P    ++ G           +C    T      W K
Sbjct: 6628 -NDAGMRECSAVLTVLEPARIIEKPEPMTVTTGNP------FALECVVTGTPELSAKWFK 6680

Query: 946  SYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLM 1005
               E+S D +  I  +   + L +   +  D G YS  V ++ G S+  V      +R++
Sbjct: 6681 DGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTV-SVHVSDRIV 6739

Query: 1006 ALS--NEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHR 1063
              S   ++K+    L + +  E    G           S   S  +  +  E+       
Sbjct: 6740 PPSFIRKLKDVNAILGASVVLECRVSG-----------SAPISVGWFQDGNEIVSGP--- 6785

Query: 1064 IKCDKA--TGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQR 1121
             KC  +    +  + +      + G YT    +     + S VL      TV E   F+ 
Sbjct: 6786 -KCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVL------TVQEPPSFE- 6837

Query: 1122 KEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDVLYETETLP----- 1176
                  Q P   E L         +     +  T    V KW K       E +P     
Sbjct: 6838 ------QTPDSVEVL-----PGMSLTFTSVIRGTPPFKV-KWFKGS----RELVPGESCN 6881

Query: 1177 -NLERGICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSA 1235
             +LE  + EL + ++   + G+Y   + +D G       +  K     +  ++    ++ 
Sbjct: 6882 ISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSVETG 6941

Query: 1236 SPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTE 1295
            SP+ +  T  G          T  + V+W   +  IS SE   I  +E+   L+I E T 
Sbjct: 6942 SPIVLEATYTG----------TPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTI 6991

Query: 1296 KDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVT 1355
            +D  +Y+  I    +N       +GQ   EA       +   F E         L  V  
Sbjct: 6992 EDYAQYSCLI----ENE------AGQDICEALVSV--LEPPYFIEP--------LEHVEA 7031

Query: 1356 IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGK 1415
            ++ G+   L C V G P+  + W+K    ++ +  + ++ +     S+ I  V   D G+
Sbjct: 7032 VI-GEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKN-NVASLVINKVDHSDVGE 7089

Query: 1416 YSINIKNKYG 1425
            YS    N  G
Sbjct: 7090 YSCKADNSVG 7099



 Score = 48.9 bits (115), Expect = 4e-05
 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 2/75 (2%)

Query: 1351 PDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTS 1410
            P+ V ++EG+T    C V G P P+V W+ N Q I+ S+ F V+ +   Y  + I    S
Sbjct: 1847 PEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHY--LDIVDCKS 1904

Query: 1411 EDSGKYSINIKNKYG 1425
             D+G+  +  +N  G
Sbjct: 1905 YDTGEVKVTAENPEG 1919



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 55/207 (26%), Positives = 88/207 (42%), Gaps = 26/207 (12%)

Query: 1261 KVNWCHKDAKISSSE--HMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDL 1318
            +V+W      IS+S    ++I  S+  A L I   T+ + G+Y+ +  +G          
Sbjct: 36   EVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNG---------- 85

Query: 1319 SGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIW 1378
            SGQA   A       +    AE      +  L  + T+ +G  + L   V G P P V +
Sbjct: 86   SGQATSTA-------ELLVKAETAPPNFVQRLQSM-TVRQGSQVRLQVRVTGIPTPVVKF 137

Query: 1379 FKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKH 1438
            +++  +IQ S  F +  E   Y S+ I     EDSG YS+N  N  G  +   T  +   
Sbjct: 138  YRDGAEIQSSLDFQISQEGDLY-SLLIAEAYPEDSGTYSVNATNSVG--RATSTAELLVQ 194

Query: 1439 GEKIPDMAPPQQAKPKLIPASASAAGQ 1465
            GE   +  P ++ K  +  A  S + Q
Sbjct: 195  GE---EEVPAKKTKTIVSTAQISESRQ 218



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 113/584 (19%), Positives = 203/584 (34%), Gaps = 78/584 (13%)

Query: 890  VNANGVGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEE 949
            V AN VGK    +  +L E     K++   +   G           ++    TW K  E 
Sbjct: 3904 VVANEVGKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEV 3963

Query: 950  ISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSS----FVLDPEEL-ERL 1004
            I +D + K+      + L + +      G Y+    +  G  +S     V +P ++ ER 
Sbjct: 3964 IREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERA 4023

Query: 1005 MALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRI 1064
              +     +P     + L Y +               +P+   ++  + R +  S+ +RI
Sbjct: 4024 ELIQVTAGDP-----ATLEYTVAG-------------TPELKPKWYKDGRPLVASKKYRI 4065

Query: 1065 KCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEF 1124
                   + ++      + + G YT +I +    S            TVL+         
Sbjct: 4066 SFKN--NVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTF------TVLD--------- 4108

Query: 1125 LRKQGPHFAEYL-HWDVTEECEVRLVCKVANTKKETVFKWLKD--DVLYETETLPNLERG 1181
             R   P F + L + D       RL CK+A +    V  W KD  ++            G
Sbjct: 4109 -RDIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRV-SWFKDGKEIAASDRYRIAFVEG 4166

Query: 1182 ICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLKVL 1241
               L I ++   D G +     +  G   S       +  +    +++   K   P   +
Sbjct: 4167 TASLEIIRVDMNDAGNFTCRATNSVGSKDSS---GALIVQEPPSFVTKPGSKDVLPGSAV 4223

Query: 1242 CTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKY 1301
            C     +        +  + + W   + ++ S     I      + L++      D G Y
Sbjct: 4224 CLKSTFQ-------GSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTY 4276

Query: 1302 TFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKT 1361
            T ++     N    ++ S   F +        + A F EK        L     + +G  
Sbjct: 4277 TCKV----SNVAGGVECSANLFVK--------EPATFVEK--------LEPSQLLKKGDA 4316

Query: 1362 LNLTCTVFGNPDPEVIWFKNDQDI-QLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINI 1420
              L C V G P  ++ WF ND++I + S+H    VE    + +T  G+  EDSG+Y    
Sbjct: 4317 TQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGI--EDSGEYMCEA 4374

Query: 1421 KNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAKPKLIPASASAAG 1464
            +N+ G +     V V +      +  P +  K   +   A  AG
Sbjct: 4375 QNEAGSDHCSSIVIVKESPYFTKEFKPIEVLKEYDVMLLAEVAG 4418



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 124/606 (20%), Positives = 230/606 (37%), Gaps = 106/606 (17%)

Query: 832   LWKAPVYSGSSPVSGYFVDFREEDA-GEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAV 890
             L+   V+ G +  + + ++  E D  G+W    Q  TA+   ++  ++ GK ++  +   
Sbjct: 11757 LYGVEVFVGET--AHFEIELSEPDVHGQWKLKGQPLTASPDCEI--IEDGKKHILILHNC 11812

Query: 891   NANGVGKPSDTSEPVLVEARPGTKEIS-------AGVDEQGNIYLGFDCQEMTDASQFTW 943
                  G+ S  +      A    KE+        + V         F+C+   +   F W
Sbjct: 11813 QLGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRW 11872

Query: 944   CKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELER 1003
              K  +EI+ D+RF++   G    + +K+   ED   Y     D    S   +++   L+ 
Sbjct: 11873 LKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKH-TSGKLIIEGIRLKF 11931

Query: 1004  LMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHR 1063
             L            PLK   A E   K    F ++  H   +   ++  ND+ +  +    
Sbjct: 11932 L-----------TPLKDVTAKE---KESAVFTVELSH--DNIRVKWFKNDQRLHTTRSVS 11975

Query: 1064  IKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKE 1123
             ++ +  T  I       SI++     V+          ++ +  +A  TVLE        
Sbjct: 11976 MQDEGKTHSI--TFKDLSIDDTSQIRVE----------AMGMSSEAKLTVLE-------- 12015

Query: 1124  FLRKQGPHFAEYLH-WDVTEECEVRLVCKVANTKKETVFKWLKD--DVLYETETLPNLER 1180
                   P+F   L  +   E+ EV L C++  +K +   KW KD  ++      +   + 
Sbjct: 12016 ----GDPYFTGKLQDYTGVEKDEVILQCEI--SKADAPVKWFKDGKEIKPSKNAVIKADG 12069

Query: 1181  GICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKV-YDDMILAMSRVCGKSASPLK 1239
                 L++ K  K D G+Y      D G D    + +GK+  +D  + + R       PL 
Sbjct: 12070 KKRMLILKKALKSDIGQYTC----DCGTD----KTSGKLDIEDREIKLVR-------PLH 12114

Query: 1240  VLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKG 1299
              +   E    +   +   D++  NW  K                  A LQ  +   K++G
Sbjct: 12115 SVEVMETETARFETEISEDDIHANWKLKGE----------------ALLQTPDCEIKEEG 12158

Query: 1300  KYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAE-KNRGRLIGGLPDV--VTI 1356
             K    +      H   LD +G        +FQ     + A  + + R+IG L  +  VT+
Sbjct: 12159 KIHSLVL-----HNCRLDQTGG------VDFQAANVKSSAHLRVKPRVIGLLRPLKDVTV 12207

Query: 1357  MEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKY 1416
               G+T    C +    D  V W+   + ++ S+   V   + K  ++T++ V  ED+G+ 
Sbjct: 12208 TAGETATFDCEL-SYEDIPVEWYLKGKKLEPSDKV-VPRSEGKVHTLTLRDVKLEDAGEV 12265

Query: 1417  SINIKN 1422
              +  K+
Sbjct: 12266 QLTAKD 12271



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             D +TI  G+   LT    G P P+V WFK++ D+   +   +K   A      IK   S 
Sbjct: 16826 DKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRS- 16884

Query: 1412  DSGKYSINIKNKYGGEK 1428
             DSGKY + ++N  G  K
Sbjct: 16885 DSGKYCVVVENSTGSRK 16901



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             D + +  G++  +   ++G P P + W K DQ++  +    +K       S+++K     
Sbjct: 22551 DTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFA-TSLSVKDAVRV 22609

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             DSG Y +  KN  G   + V V V
Sbjct: 22610 DSGNYILKAKNVAGERSVTVNVKV 22633



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 39/145 (26%), Positives = 65/145 (44%), Gaps = 15/145 (10%)

Query: 1293  PTEKDKGKYTFEIFDGKDNHQRSLDLSGQA-FDEAFAEFQQFKAAAFAEKNRGRLIGGLP 1351
             P  K   KY+F +         ++++ G + + E+ AE +  +     +     L   L 
Sbjct: 29405 PDLKMGQKYSFRV--------AAVNVKGMSEYSESIAEIEPVERIEIPDLE---LADDLK 29453

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
               VTI  G +L L  +V G P P + W K  Q I L+    +   ++ Y  + +  V   
Sbjct: 29454 KTVTIRAGASLRLMVSVSGRPPPVITWSK--QGIDLASRAIIDTTES-YSLLIVDKVNRY 29510

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSVY 1436
             D+GKY+I  +N+ G +   V V VY
Sbjct: 29511 DAGKYTIEAENQSGKKSATVLVKVY 29535



 Score = 48.1 bits (113), Expect = 6e-05
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 7/105 (6%)

Query: 1354 VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAK-YVSMTIKGVTSED 1412
            V I EG  L +     GNP+P+++W KN   I   ++  +++E  K   ++ I    S+D
Sbjct: 1565 VNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQD 1624

Query: 1413 SGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAKPKLIP 1457
            S  Y+    NK G +     V+V        + A P+  +  +IP
Sbjct: 1625 SAWYTATAINKAGRDTTRCKVNVE------VEFAEPEPERKLIIP 1663



 Score = 48.1 bits (113), Expect = 6e-05
 Identities = 52/232 (22%), Positives = 86/232 (37%), Gaps = 38/232 (16%)

Query: 150  ISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNY 209
            +   P  + +  S  V    +V L  T QG     ++W+K      +    G   I    
Sbjct: 4202 VQEPPSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNK---ELVSGGSCYITKEA 4258

Query: 210  GVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSS 269
               +LE+      D+ TY+   +N  G V  +A + V+      EP              
Sbjct: 4259 LESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVK------EP-------------- 4298

Query: 270  MIPYTHFDVQFLEKFGVT-FRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKW 328
                      F+EK   +   ++G+   L C +  TP +K       W+ +D  +KES  
Sbjct: 4299 --------ATFVEKLEPSQLLKKGDATQLACKVTGTPPIK-----ITWFANDREIKESSK 4345

Query: 329  TKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVT 380
             +M F E  A L  + +  +D G Y     +  G SDH + + +    P  T
Sbjct: 4346 HRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAG-SDHCSSIVIVKESPYFT 4396



 Score = 48.1 bits (113), Expect = 6e-05
 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 3/86 (3%)

Query: 1350  LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVT 1409
             L  ++ I  G +L L   + G P PEV W K D +I+ +    V    + + S+ +  V 
Sbjct: 22948 LRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVT---SSFTSLVLDNVN 23004

Query: 1410  SEDSGKYSINIKNKYGGEKIDVTVSV 1435
               DSGKY++ ++N  G +   VTV V
Sbjct: 23005 RYDSGKYTLTLENSSGTKSAFVTVRV 23030



 Score = 47.8 bits (112), Expect = 8e-05
 Identities = 56/222 (25%), Positives = 87/222 (39%), Gaps = 37/222 (16%)

Query: 185  VQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAV 244
            V W+KDG  I   A   +YRI    G  +LEI R D +D   ++  ATN+ G   ++ A+
Sbjct: 4144 VSWFKDGKEI---AASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGAL 4200

Query: 245  VVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVT 304
            +V      +EP                        F+ K G      G  V LK T   +
Sbjct: 4201 IV------QEP----------------------PSFVTKPGSKDVLPGSAVCLKSTFQGS 4232

Query: 305  PDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVS 364
              L        W++ +  L       +     ++SL    +   D G YT ++ +  G  
Sbjct: 4233 TPL-----TIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGV 4287

Query: 365  DHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPP 406
            + SA LFV++    V     + + L+  DA +    VT  PP
Sbjct: 4288 ECSANLFVKEPATFVEKLEPSQL-LKKGDATQLACKVTGTPP 4328



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 91/436 (20%), Positives = 177/436 (40%), Gaps = 67/436 (15%)

Query: 999  EELERLMALSNEIKNPTI-PLKSEL-----AYEIFDKGRVRFWLQAEHLSPDASYRFIIN 1052
            EE ++ +A   +I  PT  P K EL     A +IF+    R   Q      DA +R  + 
Sbjct: 2047 EEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFE----RIQSQTVGQGSDAHFRVRVV 2102

Query: 1053 DREVSDSEIHR--IKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAF 1110
             +   + E ++  +K +++  I       +    +    + I D  A+  +S+++     
Sbjct: 2103 GKPDPECEWYKNGVKIERSDRIY------WYWPEDNVCELVIRDVTAEDSASIMV----- 2151

Query: 1111 KTVLEEAEFQRKEFLRKQGPH---FAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDD 1167
            K +    E     FL  Q      F + L   V +E +     +   ++     KW KD 
Sbjct: 2152 KAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDG 2211

Query: 1168 V-LYETETLP-NLERGICELLIPKLSKKDHGEYKATLKDDRG-QDVSILEIAGKVYDDMI 1224
            + ++E +    + +R +  L I  +   D  +Y   L +D   +  + L + G V + + 
Sbjct: 2212 MEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFV- 2270

Query: 1225 LAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEE 1284
                    K    ++V  +  G  L+C +    + ++  W H D ++ S+    I     
Sbjct: 2271 --------KELQDIEVPESYSG-ELECIVS--PENIEGKWYHNDVELKSNGKYTITSRRG 2319

Query: 1285 MAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRG 1344
               L + + T++D+G+Y+F + DGK    +                 + K    A     
Sbjct: 2320 RQNLTVKDVTKEDQGEYSF-VIDGKKTTCK----------------LKMKPRPIA----- 2357

Query: 1345 RLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMT 1404
             ++ GL D   + EG  + L   V      E +W K+ Q++Q S+   + +++  ++ + 
Sbjct: 2358 -ILQGLSD-QKVCEGDIVQLEVKV-SLESVEGVWMKDGQEVQPSDRVHIVIDKQSHM-LL 2413

Query: 1405 IKGVTSEDSGKYSINI 1420
            I+ +T ED+G YS  I
Sbjct: 2414 IEDMTKEDAGNYSFTI 2429



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 116/553 (20%), Positives = 198/553 (35%), Gaps = 103/553 (18%)

Query: 930   FDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYS--VSVSDT 987
             F+C      +  TW K    I +  + +    G   KL++ +    D G Y+  + + + 
Sbjct: 11138 FECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNK 11197

Query: 988   DGVSSSFVLDPEELERLMALSNE----IKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSP 1043
             +  S++ ++  E   R +    E    +K   + L  EL     +K R   W +   +  
Sbjct: 11198 EKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSCEL-----NKERDVVWRKDGKIVV 11252

Query: 1044  DASYRFI-----------INDREVSDS--------EIHRIKCDKATGIIEMVMDRFSIEN 1084
             +   R +           IND + +D+          + ++C     ++E++ D      
Sbjct: 11253 EKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWL---- 11308

Query: 1085  EGTYTVQIHDGKAKSQSSLVLIGDAFKTVLE----------EAEFQRKEFLRKQGPHF-- 1132
                    I D   K + + +   D  K               AE   K  + + G H   
Sbjct: 11309 ----VKPIRDQHVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYL 11364

Query: 1133  --AEYLHWDVTE---ECE-VRLVCKVANTKKET-VFKWLKDDVLYETET----------- 1174
                  +  D+ E   E E  R   K+   ++E  + K ++D  +YE E+           
Sbjct: 11365 KIKNAMPEDIAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEAD 11424

Query: 1175  LPNLERGICELLIPKLS---KKDHGEYKATL-KDDRGQDVSILEIAGKVYDDMILAMSRV 1230
             +P   +   ELL P  +   K + G+   TL K    Q   +L  A       IL +  +
Sbjct: 11425 IPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEI 11484

Query: 1231  CGKSASPLKVLCTPEG--IRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWL 1288
                 A PLK +  PE    R +C +   T E  V W      I SS+   I    +   L
Sbjct: 11485 ELDFAVPLKDVTVPERRQARFECVL---TREANVIWSKGPDIIKSSDKFDIIADGKKHIL 11541

Query: 1289  QICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIG 1348
              I +    D+G YT E+                       E ++  A  F    R + + 
Sbjct: 11542 VINDSQFDDEGVYTAEV-----------------------EGKKTSARLFVTGIRLKFMS 11578

Query: 1349  GLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGV 1408
              L D  T+ EG+T    C +  +    V+WFKND  +  S    +  E  K   + +K V
Sbjct: 11579 PLEDQ-TVKEGETATFVCEL-SHEKMHVVWFKNDAKLHTSRTVLISSE-GKTHKLEMKEV 11635

Query: 1409  TSEDSGKYSINIK 1421
             T +D  +    +K
Sbjct: 11636 TLDDISQIKAQVK 11648



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             DV+T+  G+T+ +   V G P+P++ W K  + +   +   + ++    V + IK     
Sbjct: 17916 DVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDL-IQDLPRVELQIKEAVRA 17974

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             D GKY I+ KN  G  +    V+V
Sbjct: 17975 DHGKYIISAKNSSGHAQGSAIVNV 17998



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 48/209 (22%), Positives = 81/209 (38%), Gaps = 22/209 (10%)

Query: 1238  LKVLCTPEGIRLQCFMKYFTDEMK-VNWCHKDAKISSSEHMRIGGSEEMAW-LQICEPTE 1295
             LK   + E  +L C ++      K V W     K+  + H +   S +  + L+I   TE
Sbjct: 32724 LKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTE 32783

Query: 1296  KDKGKYTFEIFDGKDNHQRSLDLSGQAF----------DEAFAEFQQFKAAAFAEKNRGR 1345
              D+G+Y  EI       + +L   GQAF           E     Q+   +    K   +
Sbjct: 32784 SDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPK 32843

Query: 1346  L---IGGLPDVVTIMEGKTLN------LTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVE 1396
                 I   P +VT ++  T++            G P P  IW K+ + I     + +  +
Sbjct: 32844 APEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSED 32903

Query: 1397  QAKYVSMTIKGVTSEDSGKYSINIKNKYG 1425
             +  +  + I    + DSG Y+  +KN  G
Sbjct: 32904 KGGFF-LEIHKTDTSDSGLYTCTVKNSAG 32931



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 100/499 (20%), Positives = 179/499 (35%), Gaps = 72/499 (14%)

Query: 943  WCKSYEE-ISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSS-SFVLDPEE 1000
            W K   E I + E  +I  + + + L L +P+  + G Y   + +  G+   S VL   E
Sbjct: 6584 WLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLE 6643

Query: 1001 LERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSE 1060
              R++     +   T+   +  A E    G           +P+ S ++  + RE+S   
Sbjct: 6644 PARIIEKPEPM---TVTTGNPFALECVVTG-----------TPELSAKWFKDGRELSADS 6689

Query: 1061 IHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQ 1120
             H I        +++     S  ++G Y+ ++ +   KS  ++        +V       
Sbjct: 6690 KHHITFINKVASLKIPCAEMS--DKGLYSFEVKNSVGKSNCTV--------SVHVSDRIV 6739

Query: 1121 RKEFLRKQGPHFAEYLHWDVTE--ECEVRLVCKVANTKKETVFKWLKD--DVLYETETLP 1176
               F+RK           DV       V L C+V+ +   +V  W +D  +++   +   
Sbjct: 6740 PPSFIRKLK---------DVNAILGASVVLECRVSGSAPISV-GWFQDGNEIVSGPKCQS 6789

Query: 1177 NLERGICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSAS 1236
            +    +C L +  L   D G Y     +  G D              +L +        +
Sbjct: 6790 SFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDEC----------SAVLTVQEPPSFEQT 6839

Query: 1237 PLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEK 1296
            P  V   P        +   T   KV W     ++   E   I   + +  L++ E    
Sbjct: 6840 PDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPL 6899

Query: 1297 DKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTI 1356
            + G Y+  +     N   S   +   F +  A F + + A F+                +
Sbjct: 6900 ESGDYSCLV----TNDAGSASCTTHLFVKEPATFVK-RLADFS----------------V 6938

Query: 1357 MEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKY 1416
              G  + L  T  G P   V W K++  I  SE  S+ + + K   + I   T ED  +Y
Sbjct: 6939 ETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTE-KSTILEILESTIEDYAQY 6997

Query: 1417 SINIKNKYGGEKIDVTVSV 1435
            S  I+N+ G +  +  VSV
Sbjct: 6998 SCLIENEAGQDICEALVSV 7016



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 51/207 (24%), Positives = 77/207 (37%), Gaps = 36/207 (17%)

Query: 170  SVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSA 229
            +V L   V+G     V W K   +I    E GK ++  + GV  L I          Y+ 
Sbjct: 3940 TVTLQAAVRGSEPISVTWMKGQEVI---REDGKIKMSFSNGVAVLIIPDVQISFGGKYTC 3996

Query: 230  VATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFR 289
            +A N  G  ++   ++V+      EP                       + +E+  +   
Sbjct: 3997 LAENEAGSQTSVGELIVK------EP----------------------AKIIERAELIQV 4028

Query: 290  REGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDD 349
              G+  TL+ T+  TP+LK      +WY+D   L  SK  ++ F    A L F      D
Sbjct: 4029 TAGDPATLEYTVAGTPELK-----PKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHD 4083

Query: 350  EGLYTLRIVSRGGVSDHSAFLFVRDAD 376
             G YT  I +  G S       V D D
Sbjct: 4084 SGQYTFEISNEVGSSSCETTFTVLDRD 4110



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 5/91 (5%)

Query: 1345  RLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMT 1404
             +LI GL     +  G T+     + G P P   W  +  +I+  EH++V+ +    V +T
Sbjct: 17515 KLIEGL----VVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSV-LT 17569

Query: 1405  IKGVTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
             IK     D+G+Y I + N  G + + V ++V
Sbjct: 17570 IKNCLRRDTGEYQITVSNAAGSKTVAVHLTV 17600



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 24/79 (30%), Positives = 39/79 (49%)

Query: 1357 MEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKY 1416
            +EG+T      V G P PE  WF + Q I       V +++    S+ I   T  DSG++
Sbjct: 1469 LEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEW 1528

Query: 1417 SINIKNKYGGEKIDVTVSV 1435
            ++  +N+ G   I V ++V
Sbjct: 1529 TVVAQNRAGRSSISVILTV 1547



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 47/177 (26%), Positives = 74/177 (41%), Gaps = 37/177 (20%)

Query: 181  PTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVST 240
            P   V+WYKDG    +  E  KYR+ S+  VH L I   D  D   YS V       V T
Sbjct: 2201 PFVKVKWYKDGM---EVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDE-NVKT 2256

Query: 241  NAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCT 300
             A ++V                      +++ +    V+ L+   V     GE   L+C 
Sbjct: 2257 TAKLIVE--------------------GAVVEF----VKELQDIEVPESYSGE---LEC- 2288

Query: 301  MLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRI 357
             +V+P+        +WY +DV LK +    +    G+ +L+   + K+D+G Y+  I
Sbjct: 2289 -IVSPE----NIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVI 2340



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 1350  LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVT 1409
             L  VV +    TL L  T+ G P+PEV W K +    L++   ++V  + +  + I  VT
Sbjct: 25113 LRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEG--ILTDRAQIEV-TSSFTMLVIDNVT 25169

Query: 1410  SEDSGKYSINIKNKYGGEKIDVTVSV 1435
               DSG+Y++ ++N  G +   V V V
Sbjct: 25170 RFDSGRYNLTLENNSGSKTAFVNVRV 25195



 Score = 45.4 bits (106), Expect = 4e-04
 Identities = 55/259 (21%), Positives = 97/259 (37%), Gaps = 44/259 (16%)

Query: 154  PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
            P  + +L   +      V+L  T++G     V W+KD   I +  E     I  +  + T
Sbjct: 7492 PRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVR--ESDNIWISYSENIAT 7549

Query: 214  LEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPY 273
            L+ +R +  +   Y+    N  G     A + V       EP   V  P  + +++    
Sbjct: 7550 LQFSRVEPANAGKYTCQIKNDAGMQECFATLSVL------EPATIVEKPESIKVTT---- 7599

Query: 274  THFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFF 333
                              G+T TL+CT+  TP+L       +W++D   L      K+ F
Sbjct: 7600 ------------------GDTCTLECTVAGTPELS-----TKWFKDGKELTSDNKYKISF 7636

Query: 334  GEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRD--ADPLVT-------GAPG 384
                + L   ++   D G+Y+  + +  G    +A L V D    P  T       G  G
Sbjct: 7637 FNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSG 7696

Query: 385  APMDLQCHDANRDYVIVTW 403
            + + ++C       + V+W
Sbjct: 7697 SSVVMECKVYGSPPISVSW 7715



 Score = 45.4 bits (106), Expect = 4e-04
 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 3/80 (3%)

Query: 1356  IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGK 1415
             I  G TL L+  + G P P+V W K D+D        V    +K   + I+    ED G 
Sbjct: 17230 IKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGSK---LEIRNAAHEDGGI 17286

Query: 1416  YSINIKNKYGGEKIDVTVSV 1435
             YS+ ++N  G + + V V V
Sbjct: 17287 YSLTVENPAGSKTVSVKVLV 17306



 Score = 45.1 bits (105), Expect = 5e-04
 Identities = 91/479 (18%), Positives = 176/479 (36%), Gaps = 75/479 (15%)

Query: 943  WCKSYEEISDDERFKIETVGDH-SKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEEL 1001
            W K+  +I   +R       D+  +L +++   ED  +  V   +  G +SS      + 
Sbjct: 2111 WYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQA 2170

Query: 1002 ERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEI 1061
            ++L+  + E+++     K  +A             + E   P    ++  +  EV + + 
Sbjct: 2171 KQLITFTQELQDVVAKEKDTMAT-----------FECETSEPFVKVKWYKDGMEVHEGDK 2219

Query: 1062 HRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQR 1121
            +R+  D+    + ++    S + E    V + D   K+ + L++ G   + V E  + + 
Sbjct: 2220 YRMHSDRKVHFLSILTIDTS-DAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIE- 2277

Query: 1122 KEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNL--E 1179
                              V E     L C V+    E   KW  +DV  ++     +   
Sbjct: 2278 ------------------VPESYSGELECIVSPENIEG--KWYHNDVELKSNGKYTITSR 2317

Query: 1180 RGICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLK 1239
            RG   L +  ++K+D GEY   + D +     +      +     L+  +VC        
Sbjct: 2318 RGRQNLTVKDVTKEDQGEYSFVI-DGKKTTCKLKMKPRPIAILQGLSDQKVC-------- 2368

Query: 1240 VLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKG 1299
                 EG  +Q  +K   + ++  W     ++  S+ + I   ++   L I + T++D G
Sbjct: 2369 -----EGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAG 2423

Query: 1300 KYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEG 1359
             Y+F I         +L LS       ++                 +I  L D V ++EG
Sbjct: 2424 NYSFTI--------PALGLSTSGRVSVYSV---------------DVITPLKD-VNVIEG 2459

Query: 1360 KTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSI 1418
                L C V       V W+ ND+ I+  +     V+  K   + I    + D G Y +
Sbjct: 2460 TKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQ-RLVINRTHASDEGPYKL 2517



 Score = 45.1 bits (105), Expect = 5e-04
 Identities = 21/84 (25%), Positives = 42/84 (50%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             DV+ +  G+T  L   + G P P+V+W K+ ++++ +          +  ++ +K     
Sbjct: 24715 DVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRT 24774

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             D G+Y + + N  G + I +TV V
Sbjct: 24775 DGGQYILKLSNVGGTKSIPITVKV 24798



 Score = 44.7 bits (104), Expect = 7e-04
 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 1354 VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAK-YVSMTIKGVTSED 1412
            V ++EG T      + G P PEV WF++ Q I  S    V++  +     +TI  VT  +
Sbjct: 15   VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKAN 74

Query: 1413 SGKYSINIKNKYG 1425
            SG+YS+   N  G
Sbjct: 75   SGRYSLKATNGSG 87



 Score = 44.7 bits (104), Expect = 7e-04
 Identities = 52/229 (22%), Positives = 87/229 (37%), Gaps = 49/229 (21%)

Query: 185  VQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAV 244
            + W KD   I      G Y++       TL + +    D   Y+  A+N  G+ S +A +
Sbjct: 7243 ITWAKDNREIRPG---GNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQL 7299

Query: 245  VVR---RFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTM 301
             V+   RF    EP R V                              ++ E    +C +
Sbjct: 7300 GVQEPPRFIKKLEPSRIV------------------------------KQDEFTRYECKI 7329

Query: 302  LVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRG 361
              +P++K +     WY+D+  ++ES   +M F +  A L   +L  +D G YT    +  
Sbjct: 7330 GGSPEIKVL-----WYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAA 7384

Query: 362  GVSDHSAFLFVRDADPLVTGAP-------GAPMDLQCHDANRDYVIVTW 403
            G +  S  L V++  P+    P       GA + L+C         V+W
Sbjct: 7385 GSASSSTSLKVKE-PPIFRKKPHPIETLKGADVHLECELQGTPPFHVSW 7432



 Score = 44.7 bits (104), Expect = 7e-04
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             D + I  G++L +   V G P P V WFK+  +I+   +  +  +     S+ ++  T +
Sbjct: 27966 DGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEI-TDVLGSTSLFVRDATRD 28024

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
               G Y++  KN  G  K ++ V V
Sbjct: 28025 HRGVYTVEAKNASGSAKAEIKVKV 28048



 Score = 44.3 bits (103), Expect = 9e-04
 Identities = 74/326 (22%), Positives = 128/326 (39%), Gaps = 34/326 (10%)

Query: 1130 PHFAEYLHWDV--TEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNLE----RGIC 1183
            P F + L   V  TE    +L  +VA ++  TV  W K+++  E +   N E        
Sbjct: 8249 PSFTKRLSETVEETEGNSFKLEGRVAGSQPITV-AWYKNNI--EIQPTSNCEITFKNNTL 8305

Query: 1184 ELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLKVLCT 1243
             L + K    D G Y   + +D G  +    I  K           V  +  +P+ V   
Sbjct: 8306 VLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKK-----PPVFDQHLTPVTV-SE 8359

Query: 1244 PEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTF 1303
             E ++L C ++  ++ +++ W     +I  S+      +   A L++ +  + D G Y  
Sbjct: 8360 GEYVQLSCHVQG-SEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVC 8418

Query: 1304 EIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNR---GRLIG-GLPDVVTIMEG 1359
                      ++ +++G    ++    +   A A A K     GRL     P  + ++E 
Sbjct: 8419 ----------KASNVAGSDTTKSKVTIKDKPAVAPATKKAAVDGRLFFVSEPQSIRVVEK 8468

Query: 1360 KTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQ-AKYVSMTIKGVTSEDSGKYSI 1418
             T      V G+P P V W K     QL++   V + Q      + I+  T  DSG Y  
Sbjct: 8469 TTATFIAKVGGDPIPNVKWTKGKWR-QLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRC 8527

Query: 1419 NIKNKYG--GEKIDVTVSVYKHGEKI 1442
               N++G     +++ V   K  EKI
Sbjct: 8528 VAFNEHGEIESNVNLQVDERKKQEKI 8553



 Score = 44.3 bits (103), Expect = 9e-04
 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             D + +  G+T  L   V G P P + W + D++I+ S    +K    K + + +K     
Sbjct: 23633 DTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKAL-LIVKDAIRI 23691

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             D G+Y +   N  G +   V V V
Sbjct: 23692 DGGQYILRASNVAGSKSFPVNVKV 23715



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 43/189 (22%), Positives = 74/189 (39%), Gaps = 33/189 (17%)

Query: 186  QWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVV 245
            +W+KDG  +   +   KY+I     V  L+I   +  D+  Y+    N  G+ S  A + 
Sbjct: 4611 KWFKDGQELTLGS---KYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARIN 4667

Query: 246  VRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTP 305
            V                    L  +IP +     F +K       +G  + L+C +  + 
Sbjct: 4668 V--------------------LDLIIPPS-----FTKKLKKMDSIKGSFIDLECIVAGSH 4702

Query: 306  DLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSD 365
             +       +W++DD  +  S+  K  F +  A L  S L   D G YT    ++ G + 
Sbjct: 4703 PIS-----IQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQ 4757

Query: 366  HSAFLFVRD 374
             S  L V++
Sbjct: 4758 CSGHLTVKE 4766



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 52/218 (23%), Positives = 84/218 (38%), Gaps = 36/218 (16%)

Query: 157  LVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEI 216
            L RL  H+V    S+ L  T  G     V W KDG  I  +    K  I +      LEI
Sbjct: 5989 LKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSE---KCNIVTTEKTCILEI 6045

Query: 217  NRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHF 276
              +   D   YS    N  G+    A V         EP                PY   
Sbjct: 6046 LNSTKRDAGQYSCEIENEAGRDVCGALVSTL------EP----------------PYFVT 6083

Query: 277  DVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEG 336
            +++ LE         G++V+L+C +  TP++        WY+ D  L+ +   + +F   
Sbjct: 6084 ELEPLEA------AVGDSVSLQCQVAGTPEIT-----VSWYKGDTKLRPTPEYRTYFTNN 6132

Query: 337  QASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRD 374
             A+L F+ ++ +D G YT +  +  G +       +++
Sbjct: 6133 VATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQE 6170



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 52/265 (19%), Positives = 99/265 (37%), Gaps = 32/265 (12%)

Query: 1183 CELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLKVLC 1242
            C L +  L + D G+Y     +  G D     +  +     +        +   P+ VL 
Sbjct: 7737 CALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFV--------QKPDPMDVL- 7787

Query: 1243 TPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYT 1302
            T   +     +K  T    V+W    +++   +   +   + +A L++ +      G+YT
Sbjct: 7788 TGTNVTFTSIVKG-TPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYT 7846

Query: 1303 FEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTL 1362
              +             S +A   +       KA A       + +  L D  +I +GK L
Sbjct: 7847 CIV-------------SNEAGKASCTTHLYIKAPA-------KFVKRLNDY-SIEKGKPL 7885

Query: 1363 NLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKN 1422
             L  T  G P   V W KN  ++  S+  ++   + K   + I   T ED+G+Y+  I+N
Sbjct: 7886 ILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTE-KSAILEIPSSTVEDAGQYNCYIEN 7944

Query: 1423 KYGGEKIDVTVSVYKHGEKIPDMAP 1447
              G +     + + +    +  + P
Sbjct: 7945 ASGKDSCSAQILILEPPYFVKQLEP 7969



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 29/92 (31%), Positives = 39/92 (42%), Gaps = 2/92 (2%)

Query: 167   ERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTAT 226
             E  SV     V G P P ++W KDG  +  +  P    I      + L I     +DT  
Sbjct: 31808 EGQSVCFEIRVSGIPPPTLKWEKDGQPL--SLGPNIEIIHEGLDYYALHIRDTLPEDTGY 31865

Query: 227   YSAVATNAHGQVSTNAAVVVRRFRGDEEPFRS 258
             Y   ATN  G  S  A + V R R  ++ F+S
Sbjct: 31866 YRVTATNTAGSTSCQAHLQVERLRYKKQEFKS 31897



 Score = 43.5 bits (101), Expect = 0.001
 Identities = 60/266 (22%), Positives = 105/266 (39%), Gaps = 54/266 (20%)

Query: 179  GFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQV 238
            G PT VV+W  DG  +  A    + R+ + +G  +L+   A   D+   +  ATN +G  
Sbjct: 1730 GDPTMVVEWLHDGKPLEAA---NRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTD 1786

Query: 239  STNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKF----------GVTF 288
             T+A ++V+    DE+          L   S +P     +Q +E+           GVT 
Sbjct: 1787 HTSATLIVK----DEK---------SLVEESQLPEGRKGLQRIEELERMAHEGALTGVTT 1833

Query: 289  RR------------------EGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTK 330
             +                  EGET   +C +   P     QP+  WY +  L+++SK  +
Sbjct: 1834 DQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYP-----QPKVNWYLNGQLIRKSKRFR 1888

Query: 331  MFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVR---DADPLVTGAPGAPM 387
            + + +G   L        D G   +   +  GV +H   L ++   D   ++  AP    
Sbjct: 1889 VRY-DGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRP 1947

Query: 388  DLQCHDANR-DYVIVTWKPPNTTTES 412
            +   H+  +  + +     P  TTE+
Sbjct: 1948 EFHVHEPGKLQFEVQKVDRPVDTTET 1973



 Score = 43.5 bits (101), Expect = 0.001
 Identities = 38/141 (26%), Positives = 61/141 (43%), Gaps = 8/141 (5%)

Query: 107  ELAHLEEDVHLARSQARDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVW 166
            EL H  +++     +A  +  K  I     DK+             AP+I  R++S TV 
Sbjct: 2037 ELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSM------EAPKIFERIQSQTVG 2090

Query: 167  ERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTAT 226
            +         V G P P  +WYK+G  I ++     Y  E N  V  L I     +D+A+
Sbjct: 2091 QGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDN--VCELVIRDVTAEDSAS 2148

Query: 227  YSAVATNAHGQVSTNAAVVVR 247
                A N  G+ S++A ++V+
Sbjct: 2149 IMVKAINIAGETSSHAFLLVQ 2169



 Score = 43.5 bits (101), Expect = 0.001
 Identities = 61/311 (19%), Positives = 116/311 (37%), Gaps = 47/311 (15%)

Query: 102  QRFLSELAHLEEDVHLARSQARDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLR 161
            ++F     H +  +H+   +A D + +Y  +   E  +  +  +   +    P  + +L 
Sbjct: 6502 KKFKITSKHFDTSLHILNLEASD-VGEYHCKATNE--VGSDTCSCSVKFKEPPRFVKKLS 6558

Query: 162  SHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADF 221
              +     +V+L   V+GF    V W KD   + + +E  +     N  + TL++   + 
Sbjct: 6559 DTSTLIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDN--IATLQLGSPEA 6616

Query: 222  DDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFL 281
             ++  Y     N  G    +A + V       EP R +  P  + +++  P+        
Sbjct: 6617 SNSGKYICQIKNDAGMRECSAVLTVL------EPARIIEKPEPMTVTTGNPFA------- 6663

Query: 282  EKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLS 341
                           L+C +  TP+L      A+W++D   L       + F    ASL 
Sbjct: 6664 ---------------LECVVTGTPELS-----AKWFKDGRELSADSKHHITFINKVASLK 6703

Query: 342  FSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRD--ADPL-------VTGAPGAPMDLQCH 392
                   D+GLY+  + +  G S+ +  + V D    P        V    GA + L+C 
Sbjct: 6704 IPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECR 6763

Query: 393  DANRDYVIVTW 403
             +    + V W
Sbjct: 6764 VSGSAPISVGW 6774



 Score = 43.5 bits (101), Expect = 0.001
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 1356  IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGK 1415
             +  G +  +T    G P P V+W K D D++   +      +    S+TI+     DSGK
Sbjct: 26198 VKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRT---SLTIENANRNDSGK 26254

Query: 1416  YSINIKNKYGGEKIDVTVSV 1435
             Y++ I+N      + + V V
Sbjct: 26255 YTLTIQNVLSAASLTLVVKV 26274



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 33/94 (35%), Positives = 46/94 (48%), Gaps = 8/94 (8%)

Query: 291  EGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKM-FFGEGQASLSFSHLHKDD 349
            EG  VT  C M   P      P+  WY+D   +K  +  +M F  +G+ASL    +  +D
Sbjct: 1304 EGMGVTFHCKMSGYP-----LPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPED 1358

Query: 350  EGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAP 383
            EG+YT    +  G +  S  L+V  A PL  GAP
Sbjct: 1359 EGIYTAFASNIKGNAICSGKLYVEPAAPL--GAP 1390



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 8/115 (6%)

Query: 145  TFEERISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYR 204
            T +++  + P+I++      V E  + +    V G+P P V WY +G LI ++    ++R
Sbjct: 1832 TTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSK---RFR 1888

Query: 205  IESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSV 259
            +  + G+H L+I      DT      A N  G +     + +++     E FRSV
Sbjct: 1889 VRYD-GIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQ----REDFRSV 1938



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 80/376 (21%), Positives = 138/376 (36%), Gaps = 82/376 (21%)

Query: 905   VLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDH 964
             VL E    TK + A ++      +   C+     ++  W K  EEI +  R++I T G  
Sbjct: 12458 VLEEEAVFTKNL-ANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRK 12516

Query: 965   SKLYLKNPDKEDLGTYSVSV--SDTDG------VSSSFVLDPEELERLMALSNE----IK 1012
               L ++N   ED G Y+  +  S TDG      +++ F+  P+ LE L     E    I 
Sbjct: 12517 RILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAEFVCSIS 12576

Query: 1013  NPTIP---------LKSELAYEIFDKGRVRFWL--------------------QAEHLSP 1043
               + P         L+S   Y++   G+ R  +                     A HL+ 
Sbjct: 12577 KESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTV 12636

Query: 1044  DASYRFII--NDREVSDSEIHRIKCDKATGII--------EMVMDR---FSIENEGTYTV 1090
                 R ++   D  V + +     C+  T           E + D      ++ +  YT+
Sbjct: 12637 IEKLRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTL 12696

Query: 1091  QIHDGKAKSQSSLVL---------IGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVT 1141
             +I D     Q++  +         +  A   ++EE + +  E L+            +  
Sbjct: 12697 RIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLK----------DIETM 12746

Query: 1142  EECEVRLVCKVANTKKETVFKWLK--DDVLYETETLPNLERGICELLIPKLSKKDHGEYK 1199
             E+  V   CKV   +     KW K  ++V ++      +++    L I      D GEY 
Sbjct: 12747 EKKSVTFWCKV--NRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYI 12804

Query: 1200  ATLKDDRGQDVSILEI 1215
              T     GQD S+ E+
Sbjct: 12805 VT----AGQDKSVAEL 12816



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 20/80 (25%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 1356  IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGK 1415
             +  G ++ L     G P P  +W K D ++ L            + ++T++     D+GK
Sbjct: 28369 VRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTT---DSFSTLTVENCNRNDAGK 28425

Query: 1416  YSINIKNKYGGEKIDVTVSV 1435
             Y++ ++N  G + I  TV V
Sbjct: 28426 YTLTVENNSGSKSITFTVKV 28445



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 42/190 (22%), Positives = 75/190 (39%), Gaps = 33/190 (17%)

Query: 185  VQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAV 244
            V WYKDG  +  +       +++     TL I + D      YS  ATN  G  S++A +
Sbjct: 8088 VSWYKDGKPLKDSPNVQTSFLDNTA---TLNIFKTDRSLAGQYSCTATNPIGSASSSARL 8144

Query: 245  VVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVT 304
            ++    G   PF  + L    P+ +++                    GE+   +C +  T
Sbjct: 8145 ILTE--GKNPPFFDIRLA---PVDAVV--------------------GESADFECHVTGT 8179

Query: 305  PDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVS 364
              +K       W +D   ++     ++ + E  A L+   + K D G YT   V+  G  
Sbjct: 8180 QPIK-----VSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKD 8234

Query: 365  DHSAFLFVRD 374
              +A L +++
Sbjct: 8235 SCTAQLNIKE 8244



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 27/87 (31%), Positives = 39/87 (44%), Gaps = 1/87 (1%)

Query: 1350  LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVE-QAKYVSMTIKGV 1408
             L  V+T+  G T+ L   V G P PEV W K+     L+    VK++ +A     ++   
Sbjct: 18207 LSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKA 18266

Query: 1409  TSEDSGKYSINIKNKYGGEKIDVTVSV 1435
                D GKY +   N  G      TV+V
Sbjct: 18267 KRSDGGKYVVTATNTAGSFVAYATVNV 18293



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 1350  LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVT 1409
             +  ++T+  G  + L  TVFG P P V W K+   ++ +E   + + Q    ++ +  V 
Sbjct: 19301 MKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAM-QRNLCTLELFSVN 19359

Query: 1410  SEDSGKYSINIKNKYGGEKIDVTVSV 1435
              +DSG Y+I  +N  G +   + + V
Sbjct: 19360 RKDSGDYTITAENSSGSKSATIKLKV 19385



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 6/99 (6%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
             V  + G+ +++     G PDP + W K    I  + H+ V V ++    +   GV  +D+
Sbjct: 31037 VHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDA 31096

Query: 1414  GKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAK 1452
             G Y +  KN++G ++  V + V      +PD  PP+  K
Sbjct: 31097 GFYVVCAKNRFGIDQKTVELDV----ADVPD--PPRGVK 31129



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 51/226 (22%), Positives = 83/226 (36%), Gaps = 42/226 (18%)

Query: 185  VQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAV 244
            V W+ + + I   A   KY+   +  V TL++N  D  D   Y+ VA N  G     A +
Sbjct: 5831 VAWFHEKTKIVSGA---KYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVL 5887

Query: 245  VVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVT 304
             V      +EP   V  P  L    ++P                   G+ VT    +  T
Sbjct: 5888 TV------QEPPSFVKEPEPL---EVLP-------------------GKNVTFTSVIRGT 5919

Query: 305  PDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVS 364
            P  K       W+R    L +     ++F +  A L   ++     G YT  + +  G +
Sbjct: 5920 PPFK-----VNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQA 5974

Query: 365  DHSAFLFVRDADPLV------TGAPGAPMDLQCHDANRDYVIVTWK 404
              +  LFV++    +      +  PG  + L+        + VTWK
Sbjct: 5975 SCTTRLFVKEPAAFLKRLSDHSVEPGKSIILESTYTGTLPISVTWK 6020



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 54/227 (23%), Positives = 87/227 (38%), Gaps = 45/227 (19%)

Query: 185  VQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAV 244
            + W KD   I      G Y I        L I +    D+  Y+  ATN  G+   +A +
Sbjct: 6302 ITWSKDNKEIRPG---GNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQL 6358

Query: 245  VVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVT-FRREGETVTLKCTMLV 303
             V+     E P                       +F++K   +   ++GE++ L+C +  
Sbjct: 6359 SVK-----EPP-----------------------KFVKKLEASKVAKQGESIQLECKISG 6390

Query: 304  TPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGV 363
            +P++K       W+R+D  L ES    M F    A L+ +    +D G Y     +  G 
Sbjct: 6391 SPEIK-----VSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGD 6445

Query: 364  SDHSAFLFVRDADPLVTGAP-------GAPMDLQCHDANRDYVIVTW 403
            +  S  L V+ A P+ T  P       G+ + LQC  +      V W
Sbjct: 6446 ASCSTALTVK-APPVFTQKPSPVGALKGSDVILQCEISGTPPFEVVW 6491



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 57/257 (22%), Positives = 91/257 (35%), Gaps = 37/257 (14%)

Query: 176  TVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAH 235
            TV G P    +W+KDG    +     KY+I     V  L+I      D+  YS    N  
Sbjct: 7608 TVAGTPELSTKWFKDGK---ELTSDNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPV 7664

Query: 236  GQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETV 295
            G+ S  A++ V                        +P +     F  K   T    G +V
Sbjct: 7665 GKDSCTASLQVS--------------------DRTVPPS-----FTRKLKETNGLSGSSV 7699

Query: 296  TLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTL 355
             ++C +  +P +        W+ +   +   +  +    +   +L+ + L + D G YT 
Sbjct: 7700 VMECKVYGSPPIS-----VSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTC 7754

Query: 356  RIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVM 415
               +  G  + SA L VR+    V      PMD+          IV   PP + +     
Sbjct: 7755 IATNMAGSDECSAPLTVREPPSFVQKPD--PMDVLTGTNVTFTSIVKGTPPFSVSWFKGS 7812

Query: 416  GYFV--DRCEVGTNNWV 430
               V  DRC V   + V
Sbjct: 7813 SELVPGDRCNVSLEDSV 7829



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             DV+ +  G+ L +   + G P P + W K+  +I+      + +    +  +T+K     
Sbjct: 25797 DVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEI-ISTDNHTLLTVKDCIRR 25855

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             D+G+Y + +KN  G   + V   V
Sbjct: 25856 DTGQYVLTLKNVAGTRSVAVNCKV 25879



 Score = 42.0 bits (97), Expect = 0.004
 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 10/98 (10%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKN----DQDIQLSEHFSVKVEQAKYVSMTIKGVT 1409
             + IM GKTL +   V G P P  +W K     D+D  + ++   K E      + IK   
Sbjct: 15114 IQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSE------LIIKDAL 15167

Query: 1410  SEDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAP 1447
              +D G+Y I   N  G +     V V+     + D+ P
Sbjct: 15168 RKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKP 15205



 Score = 42.0 bits (97), Expect = 0.004
 Identities = 27/87 (31%), Positives = 46/87 (52%), Gaps = 2/87 (2%)

Query: 1350  LPDVVTIMEGKTLNLTC-TVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGV 1408
             + D +TI  G T+ L   ++ G P P+  W K  +DI+ S+   +       + +TIK  
Sbjct: 20384 IKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSM-LTIKYA 20442

Query: 1409  TSEDSGKYSINIKNKYGGEKIDVTVSV 1435
             T +D+G+Y+I   N +G +   V V+V
Sbjct: 20443 TRKDAGEYTITATNPFGTKVEHVKVTV 20469



 Score = 42.0 bits (97), Expect = 0.004
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
             + +  G+ + L   + G P P   WF     ++ SE  +V+    K   +TI+  T  D+
Sbjct: 29748 IHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETH-TKVAKLTIRETTIRDT 29806

Query: 1414  GKYSINIKNKYG 1425
             G+Y++ +KN  G
Sbjct: 29807 GEYTLELKNVTG 29818



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 2/88 (2%)

Query: 1349  GLPDVVTIM-EGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKG 1407
             GLPD+  +  E     L   + G P P V W K +  +      SV+   A   ++ +  
Sbjct: 19986 GLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVE-SSAVNTTLIVYD 20044

Query: 1408  VTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
                 D+GKY+I +KN  G ++  +++ V
Sbjct: 20045 CQKSDAGKYTITLKNVAGTKEGTISIKV 20072



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 32/105 (30%), Positives = 47/105 (44%), Gaps = 9/105 (8%)

Query: 1350  LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVT 1409
             L  VVTI    TL L   + G P PEV W ++    +  +  S++   + Y  + +  V 
Sbjct: 21866 LRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHG--ESLDKASIE-STSSYTLLIVGNVN 21922

Query: 1410  SEDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAKPK 1454
               DSGKY + ++N  G +   V V V      +    PPQ  K K
Sbjct: 21923 RFDSGKYILTVENSSGSKSAFVNVRV------LDTPGPPQDLKVK 21961



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 21/84 (25%), Positives = 40/84 (47%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             +VV    G ++ L   + G P P + W+K+D+++Q +    V+       S+ IK     
Sbjct: 26880 EVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVE-NTTDLASILIKDADRL 26938

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             +SG Y + ++N  G     + V +
Sbjct: 26939 NSGCYELKLRNAMGSASATIRVQI 26962



 Score = 41.2 bits (95), Expect = 0.007
 Identities = 118/574 (20%), Positives = 203/574 (35%), Gaps = 100/574 (17%)

Query: 892  ANGVGKPSDTSEPVLVEARPGT-----KEISAGVDEQGNIYLGFDCQEM-TDASQFTWCK 945
            +N  G  S T+   + EA P T     K ++  V +       F C    T   +  W K
Sbjct: 3531 SNEYGSVSCTATLTVTEAYPPTFLSRPKSLTTFVGKAAK----FICTVTGTPVIETIWQK 3586

Query: 946  SYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGV----SSSFVLD-PEE 1000
                +S    ++I    +   L L N   +D G YS   S+  G     +   ++D P  
Sbjct: 3587 DGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHF 3646

Query: 1001 LERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSE 1060
            ++ L  + + I N  + L+ ++  +   K  V +    + L P   Y+    D+ ++  E
Sbjct: 3647 IKELEPVQSAI-NKKVHLECQVDED--RKVTVTWSKDGQKLPPGKDYKICFEDK-IATLE 3702

Query: 1061 IHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQ 1120
            I   K                +++ GTY     +    S  S  +      TV E   F 
Sbjct: 3703 IPLAK----------------LKDSGTYVCTASNEAGSSSCSATV------TVREPPSFV 3740

Query: 1121 RK---EFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPN 1177
            +K    +L   G                 RL CK+  +    V  +  +  L E+ T+  
Sbjct: 3741 KKVDPSYLMLPGE--------------SARLHCKLKGSPVIQVTWFKNNKELSESNTVRM 3786

Query: 1178 LERGICELL-IPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSAS 1236
                   +L I  +  +D G Y     +D G D    EI  K     I        K+  
Sbjct: 3787 YFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFI--------KTLE 3838

Query: 1237 PLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEK 1296
            P  ++     + LQC +   T   +++W     +I SS+  R+   + +  L+I      
Sbjct: 3839 PADIVRGTNAL-LQCEVSG-TGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSA 3896

Query: 1297 DKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAE---KNRGRLIGGLPDV 1353
            D G+Y                       E     +  K    A    K     +  + D+
Sbjct: 3897 DVGEY-----------------------ECVVANEVGKCGCMATHLLKEPPTFVKKVDDL 3933

Query: 1354 VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVS-MTIKGVTSED 1412
            +  + G+T+ L   V G+    V W K  + I+  E   +K+  +  V+ + I  V    
Sbjct: 3934 IA-LGGQTVTLQAAVRGSEPISVTWMKGQEVIR--EDGKIKMSFSNGVAVLIIPDVQISF 3990

Query: 1413 SGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMA 1446
             GKY+   +N+  G +  V   + K   KI + A
Sbjct: 3991 GGKYTCLAENE-AGSQTSVGELIVKEPAKIIERA 4023



 Score = 41.2 bits (95), Expect = 0.007
 Identities = 22/90 (24%), Positives = 43/90 (47%), Gaps = 1/90 (1%)

Query: 1346  LIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTI 1405
             L G    ++T   G    +   + G P P+V W   +  ++ ++  S+   + +  ++T+
Sbjct: 28649 LTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDR-TTLTV 28707

Query: 1406  KGVTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
             K     DSG+Y + ++N  G +   VTV V
Sbjct: 28708 KDSMRGDSGRYFLTLENTAGVKTFSVTVVV 28737



 Score = 40.8 bits (94), Expect = 0.010
 Identities = 99/513 (19%), Positives = 182/513 (35%), Gaps = 69/513 (13%)

Query: 940  QFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPE 999
            Q  W +    + DDE  +   V + + L +   D    G YS S S+  G +SS      
Sbjct: 6205 QVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSA---- 6260

Query: 1000 ELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDS 1059
               RL A   + K+P   +K  ++ ++       F        P     +  +++E+   
Sbjct: 6261 ---RLTAREPK-KSPFFDIKP-VSIDVIAGESADFECHVTGAQP-MRITWSKDNKEIRPG 6314

Query: 1060 EIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEF 1119
              + I C   T  + ++  +    + G YT Q  +   K   S  L      +V E  +F
Sbjct: 6315 GNYTITCVGNTPHLRIL--KVGKGDSGQYTCQATNDVGKDMCSAQL------SVKEPPKF 6366

Query: 1120 QRK---EFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDVLYET-ETL 1175
             +K     + KQG                ++L CK++ + +  V  +  D  L+E+ +  
Sbjct: 6367 VKKLEASKVAKQGE--------------SIQLECKISGSPEIKVSWFRNDSELHESWKYN 6412

Query: 1176 PNLERGICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSA 1235
             +    +  L I + S +D G+Y     +  G       +  K         S V     
Sbjct: 6413 MSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGALKG 6472

Query: 1236 SPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTE 1295
            S + + C   G          T   +V W     ++ +S+  +I        L I     
Sbjct: 6473 SDVILQCEISG----------TPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEA 6522

Query: 1296 KDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVT 1355
             D G+Y          H ++ +  G        +F          K   R +  L D  T
Sbjct: 6523 SDVGEY----------HCKATNEVGSDTCSCSVKF----------KEPPRFVKKLSDTST 6562

Query: 1356 IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVS-MTIKGVTSEDSG 1414
            ++ G  + L   V G     V+W K+  ++ + E  + ++     ++ + +    + +SG
Sbjct: 6563 LI-GDAVELRAIVEGFQPISVVWLKDRGEV-IRESENTRISFIDNIATLQLGSPEASNSG 6620

Query: 1415 KYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAP 1447
            KY   IKN  G  +    ++V +    I    P
Sbjct: 6621 KYICQIKNDAGMRECSAVLTVLEPARIIEKPEP 6653



 Score = 40.8 bits (94), Expect = 0.010
 Identities = 37/149 (24%), Positives = 63/149 (42%), Gaps = 2/149 (1%)

Query: 1287  WLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRL 1346
             W+   EP  + K + T  + +GK    R   L+ Q   +     ++ +A    E     L
Sbjct: 13634 WVACGEPVAETKMEVT-GLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFL 13692

Query: 1347  IGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIK 1406
                L   +T+  G  + L  TV G P+P++ W K D  ++  +  +++    K  ++TI 
Sbjct: 13693 DVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIE-NVPKKSTVTIV 13751

Query: 1407  GVTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
                  D+G Y I   N  G     V V+V
Sbjct: 13752 DSKRSDTGTYIIEAVNVCGRATAVVEVNV 13780



 Score = 40.4 bits (93), Expect = 0.013
 Identities = 68/297 (22%), Positives = 116/297 (39%), Gaps = 49/297 (16%)

Query: 1150 CKVANTKKETVFKWLKDDVL----YETETLPNLERGICELLIPKLSKKDHGEYKATLKDD 1205
            C+V    K  V+ W K  V     Y  +   N + G C+L+I      D GEY   +++ 
Sbjct: 1103 CQVGGNPKPHVY-WKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNK 1161

Query: 1206 RGQ---DVSILEIAG-----KVYDDMILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFT 1257
             G+     S+LE A      K   +M L  ++V      P KV  T  G     + K + 
Sbjct: 1162 HGETSASASLLEEADYELLMKSQQEM-LYQTQVTAFVQEP-KVGETAPGFVYSEYEKEYE 1219

Query: 1258 DEMKV--NWCHKDAKISSS----EHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDN 1311
             E  +      KD  +  +    +   I   EE    ++ +  E    K T E    +D 
Sbjct: 1220 KEQALIRKKMAKDTVVVRTYVEDQEFHISSFEE----RLIKEIEYRIIKTTLEELLEEDG 1275

Query: 1312 HQR-SLDLS-GQAFDEAF-AEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTV 1368
             ++ ++D+S  +A +  F +  + ++                     I+EG  +   C +
Sbjct: 1276 EEKMAVDISESEAVESGFDSRIKNYR---------------------ILEGMGVTFHCKM 1314

Query: 1369 FGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYG 1425
             G P P++ W+K+ + I+  E + +   Q    S+ I  V  ED G Y+    N  G
Sbjct: 1315 SGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKG 1371



 Score = 40.4 bits (93), Expect = 0.013
 Identities = 29/109 (26%), Positives = 49/109 (44%), Gaps = 11/109 (10%)

Query: 159  RLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIE-SNYGVHTLEIN 217
            R++++ + E M V     + G+P P + WYKDG  I       +Y+++    G  +L I 
Sbjct: 1296 RIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGE---RYQMDFLQDGRASLRIP 1352

Query: 218  RADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLP 266
                +D   Y+A A+N  G    +  + V       EP   +G P  +P
Sbjct: 1353 VVLPEDEGIYTAFASNIKGNAICSGKLYV-------EPAAPLGAPTYIP 1394



 Score = 40.4 bits (93), Expect = 0.013
 Identities = 21/71 (29%), Positives = 32/71 (45%)

Query: 1355 TIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSG 1414
            T+ +G   +    V G PDPE  W+KN   I+ S+       +     + I+ VT+EDS 
Sbjct: 2088 TVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSA 2147

Query: 1415 KYSINIKNKYG 1425
               +   N  G
Sbjct: 2148 SIMVKAINIAG 2158



 Score = 40.4 bits (93), Expect = 0.013
 Identities = 56/241 (23%), Positives = 90/241 (37%), Gaps = 45/241 (18%)

Query: 171  VKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAV 230
            V L   + G P   V WYKD     Q     KY+I S     ++ I   D  D   Y   
Sbjct: 5534 VSLECELSGTPPFEVVWYKDKR---QLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCK 5590

Query: 231  ATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRR 290
            A N  G  +    V ++      EP R                      F+ K       
Sbjct: 5591 AQNEVGSDTCVCTVKLK------EPPR----------------------FVSKLNSLTVV 5622

Query: 291  EGETVTLKCTMLVTPDLKRVQPR-AEWYRD-DVLLKESKWTKMFFGEGQASLSFSHLHKD 348
             GE   L+ +      ++  QP   +W ++ + +++ES+  ++ F E  A+L F+     
Sbjct: 5623 AGEPAELQAS------IEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPA 5676

Query: 349  DEGLYTLRIVSRGGVSDHSAFLFVRDADPLV------TGAPGAPMDLQCHDANRDYVIVT 402
            + G Y  +I + GG+ ++ A L V +   +V      T   G    L+C  A    + V 
Sbjct: 5677 NAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVE 5736

Query: 403  W 403
            W
Sbjct: 5737 W 5737



 Score = 40.4 bits (93), Expect = 0.013
 Identities = 31/121 (25%), Positives = 55/121 (45%), Gaps = 18/121 (14%)

Query: 1332  QFKAAAFAEKNRG--RLIG--------------GLP-DVVTIMEGKTLNLTCTVFGNPDP 1374
             QF+  A+ EK +   R++G               LP +  +I  G+ L +   V G P P
Sbjct: 24282 QFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRP 24341

Query: 1375  EVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVS 1434
              + W K+ + ++ +   +V+ E A    + IK    +D GKY++   N  G    +++V 
Sbjct: 24342 NISWVKDGEPLKQTTRVNVE-ETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVI 24400

Query: 1435  V 1435
             V
Sbjct: 24401 V 24401



 Score = 40.0 bits (92), Expect = 0.017
 Identities = 21/82 (25%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
             + ++EG+ L++       P P V W K+ ++++ S+  ++K +         K V + D+
Sbjct: 14396 IIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRA-DA 14454

Query: 1414  GKYSINIKNKYGGEKIDVTVSV 1435
             G Y+I ++NK G     + V V
Sbjct: 14455 GIYTITLENKLGSATASINVKV 14476



 Score = 40.0 bits (92), Expect = 0.017
 Identities = 22/93 (23%), Positives = 43/93 (46%), Gaps = 3/93 (3%)

Query: 1344  GRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKY-VS 1402
             G L   L   + +  G T+ L   V G P P++ W K   ++ L +   + ++   +   
Sbjct: 19693 GELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSK--PNVNLRDRIGLDIKSTDFDTF 19750

Query: 1403  MTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
             +  + V   D+GKY + ++N  G ++  + V V
Sbjct: 19751 LRCENVNKYDAGKYILTLENSCGKKEYTIVVKV 19783



 Score = 40.0 bits (92), Expect = 0.017
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 1359  GKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSI 1418
             G+ + +     G P P V W K+++++     +S++   +  + +TI  VT  D+GKY +
Sbjct: 27286 GEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSL-LTIPQVTRNDTGKYIL 27344

Query: 1419  NIKNKYGGEKIDVTVSV 1435
              I+N  G  K   TVSV
Sbjct: 27345 TIENGVGEPK-SSTVSV 27360



 Score = 39.7 bits (91), Expect = 0.022
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 1354 VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
            VT+ EG+T  +TC  F  P+ +  WF+N + ++       +VE  K   +TI  V +ED 
Sbjct: 8754 VTLKEGQTCTMTCQ-FSVPNVKSEWFRNGRILKPQGRHKTEVEH-KVHKLTIADVRAEDQ 8811

Query: 1414 GKYS 1417
            G+Y+
Sbjct: 8812 GQYT 8815



 Score = 39.7 bits (91), Expect = 0.022
 Identities = 47/191 (24%), Positives = 75/191 (39%), Gaps = 27/191 (14%)

Query: 1263  NWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQA 1322
             +W    A +  S  ++ GGS+   ++       K++GK  +E   GKD   R   L    
Sbjct: 16431 DWTKSSADLEWSPPLKDGGSKVTGYIV----EYKEEGKEEWE--KGKDKEVRGTKLVVTG 16484

Query: 1323  FDE-AFAEFQ--QFKAAAFAEKN--------RGRLIG-------GLPDVVTIMEGKTLNL 1364
               E AF +F+      A   E          + RL+         + D + +  G  + +
Sbjct: 16485 LKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRI 16544

Query: 1365  TCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKY 1424
                V G P P V W  N++   L +  +++   A   SM IK       G YS+  KN+ 
Sbjct: 16545 IAYVSGKPPPTVTWNMNER--TLPQEATIET-TAISSSMVIKNCQRSHQGVYSLLAKNEA 16601

Query: 1425  GGEKIDVTVSV 1435
             G  K  + V V
Sbjct: 16602 GERKKTIIVDV 16612



 Score = 39.3 bits (90), Expect = 0.028
 Identities = 28/110 (25%), Positives = 47/110 (42%), Gaps = 15/110 (13%)

Query: 1354 VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
            VT+ EG+ + L+C V G+    + W K  ++I+ S+  S        V + ++ V   DS
Sbjct: 8355 VTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAV-LELRDVAKADS 8413

Query: 1414 GKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAKPKLIPASASAA 1463
            G Y     N  G +     V++              + KP + PA+  AA
Sbjct: 8414 GDYVCKASNVAGSDTTKSKVTI--------------KDKPAVAPATKKAA 8449



 Score = 39.3 bits (90), Expect = 0.028
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 3/82 (3%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
             + + +G  + LT  + G P P   W K  QDI  S+   +   +  +  + IK     DS
Sbjct: 30146 IFVRQGGVIRLTIPIKGKPFPICKWTKEGQDI--SKRAMIATSET-HTELVIKEADRGDS 30202

Query: 1414  GKYSINIKNKYGGEKIDVTVSV 1435
             G Y + ++NK G + + + V V
Sbjct: 30203 GTYDLVLENKCGKKAVYIKVRV 30224



 Score = 39.3 bits (90), Expect = 0.028
 Identities = 60/321 (18%), Positives = 118/321 (36%), Gaps = 50/321 (15%)

Query: 68    CRVCAKRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHLEEDVHLARSQARDKL- 126
             C++  K +  ++ E Q+  ++  S +    +A  Q  +S+ A   E++ ++ +++++KL 
Sbjct: 32937 CKLTIKAI--KDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLA 32994

Query: 127   -----DKYAIQQMMEDKLAW--ERHTFEERISRAPEILVRLRSHTVWERMSV-------- 171
                   K  I + ++   A   E+    E I++  +    +R+H   +  S         
Sbjct: 32995 LKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQ 33054

Query: 172   KLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVA 231
             +L           V+W  +G  +  + E   YR   +    TL I +A   D    + ++
Sbjct: 33055 RLVLKANIAGATDVKWVLNGVELTNSEE---YRYGVSGSDQTLTIKQASHRDEGILTCIS 33111

Query: 232   TNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRRE 291
                 G V     + + +   D   F      I  P S  I                   E
Sbjct: 33112 KTKEGIVKCQYDLTLSKELSDAPAF------ISQPRSQNI------------------NE 33147

Query: 292   GETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEG 351
             G+ V   C +   P      P  EW+++++ +  S    +       SL   +    D G
Sbjct: 33148 GQNVLFTCEISGEPS-----PEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSG 33202

Query: 352   LYTLRIVSRGGVSDHSAFLFV 372
              YT++  +  G    +A L V
Sbjct: 33203 KYTIKAKNFRGQCSATASLMV 33223



 Score = 38.9 bits (89), Expect = 0.037
 Identities = 26/104 (25%), Positives = 44/104 (42%), Gaps = 15/104 (14%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAK---YVSMTIKGVTS 1410
             + +  G +  +     G P PE+ W + + +      F+ KV+  K   Y  ++I     
Sbjct: 24034 IVVRAGGSARIHIPFKGRPTPEITWSREEGE------FTDKVQIEKGVNYTQLSIDNCDR 24087

Query: 1411  EDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAKPK 1454
              D+GKY + ++N  G +   VTV V      +    PPQ    K
Sbjct: 24088 NDAGKYILKLENSSGSKSAFVTVKV------LDTPGPPQNLAVK 24125



 Score = 38.5 bits (88), Expect = 0.048
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
             VT+  G  ++L     G P P + W K+   ++ SE       + K ++++IK    E  
Sbjct: 27573 VTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENK-ITLSIKNAKKEHG 27631

Query: 1414  GKYSINIKNKYGGEKIDVTV 1433
             GKY++ + N      + +TV
Sbjct: 27632 GKYTVILDNAVCRIAVPITV 27651



 Score = 38.5 bits (88), Expect = 0.048
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 1359  GKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE-DSGKYS 1417
             G TL L     G P P + WF   + +Q SE+ +++     Y  + +K V  +  +GKY 
Sbjct: 30643 GSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIE-NTEHYTHLVMKNVQRKTHAGKYK 30701

Query: 1418  INIKNKYG 1425
             + + N +G
Sbjct: 30702 VQLSNVFG 30709



 Score = 38.1 bits (87), Expect = 0.063
 Identities = 22/90 (24%), Positives = 42/90 (46%), Gaps = 5/90 (5%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQL-SEHFSVKVEQAK----YVSMTIK 1406
             D + +  G+ +++   V G P P++ W KN+  I+  ++   +  E+         ++I 
Sbjct: 15406 DTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIP 15465

Query: 1407  GVTSEDSGKYSINIKNKYGGEKIDVTVSVY 1436
                 ED G Y++   N+ G    +V V VY
Sbjct: 15466 KAVREDKGTYTVTASNRLGSVFRNVHVEVY 15495



 Score = 38.1 bits (87), Expect = 0.063
 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             D V +  G+   L   V G P P + W K+ ++++ +    +K+      ++  K  T  
Sbjct: 21469 DTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFS-TNLVNKDSTRR 21527

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             DSG Y++   N  G  K    V V
Sbjct: 21528 DSGAYTLTATNPGGFAKHIFNVKV 21551



 Score = 38.1 bits (87), Expect = 0.063
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 3/72 (4%)

Query: 1355  TIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVS-MTIKGVTSEDS 1413
             T++ G+ L +     G P P V W K+  ++ L +   V  E  +  S +TIK    ED 
Sbjct: 22158 TVLAGEDLKVDVPFIGRPTPAVTWHKD--NVPLKQTTRVNAESTENNSLLTIKDACREDV 22215

Query: 1414  GKYSINIKNKYG 1425
             G Y + + N  G
Sbjct: 22216 GHYVVKLTNSAG 22227



 Score = 37.0 bits (84), Expect = 0.14
 Identities = 26/93 (27%), Positives = 42/93 (45%), Gaps = 2/93 (2%)

Query: 1353  VVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSED 1412
             +V +  G  + L   V G P P+V W K   D  + +     V+   +  + I   T +D
Sbjct: 18615 LVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAF--LVIPNSTRDD 18672

Query: 1413  SGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDM 1445
             SGKYS+ + N  G + + V V V      + D+
Sbjct: 18673 SGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDL 18705



 Score = 37.0 bits (84), Expect = 0.14
 Identities = 16/79 (20%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 1355  TIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSG 1414
             ++  G+ L +   + G P P + W K+   ++ +   +V  +     +++IK    +D G
Sbjct: 23240 SVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINV-TDSLDLTTLSIKETHKDDGG 23298

Query: 1415  KYSINIKNKYGGEKIDVTV 1433
             +Y I + N  G +   + +
Sbjct: 23299 QYGITVANVVGQKTASIEI 23317



 Score = 37.0 bits (84), Expect = 0.14
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 907   VEARPGTKEISAGVDEQGNIYLGFDC--QEMTDASQFTWCKSYEEISDDERFKIETVGDH 964
             +E  P + +I   V E+G  ++ + C  +    ++Q TW     ++ + E+++I      
Sbjct: 31565 IEIGPVSGQIMHAVGEEGG-HVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGV 31623

Query: 965   SKLYLKNPDKEDLGTYSVSVSDTDGVSSSF 994
             + LY+K+  K D GTY   V +  G  SS+
Sbjct: 31624 AILYVKDITKLDDGTYRCKVVNDYGEDSSY 31653



 Score = 36.6 bits (83), Expect = 0.18
 Identities = 110/564 (19%), Positives = 213/564 (37%), Gaps = 96/564 (17%)

Query: 879   QGKTYVFRVRAVNANGVGKP-------SDTSEPVLVEARP--GTKEISAGVDEQGNIYLG 929
             +GKT+   ++ V  + + +        S T++  ++EA P    K       E+  I L 
Sbjct: 11624 EGKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITL- 11682

Query: 930   FDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
               C+   D     W K  EEI    ++ I+  G    L +K  D +D G Y V    TD 
Sbjct: 11683 -KCEVSKDVP-VKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEY-VCDCGTDK 11739

Query: 990   VSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRF 1049
               ++  ++     RL+ +   +    + +     +EI            E   PD   ++
Sbjct: 11740 TKANVTVEA----RLIKVEKPLYGVEVFVGETAHFEI------------ELSEPDVHGQW 11783

Query: 1050  IINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDA 1109
              +  + ++ S    I  D    I+  ++    +   G  + Q  + K+ +   +  +   
Sbjct: 11784 KLKGQPLTASPDCEIIEDGKKHIL--ILHNCQLGMTGEVSFQAANAKSAANLKVKELPLI 11841

Query: 1110  FKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDVL 1169
             F T L + +                     V E+ E +  C+V+   K   F+WLK    
Sbjct: 11842 FITPLSDVK---------------------VFEKDEAKFECEVSREPK--TFRWLKG--- 11875

Query: 1170  YETETLPNLERGICELLIPKLSKKDHGEYKATLKDDRGQDVS--ILEIAGKVYDDMILAM 1227
               T+ +   +R   EL+      KD  ++   +K    +D +  + E   K +    L +
Sbjct: 11876 --TQEITGDDR--FELI------KDGTKHSMVIKSAAFEDEAKYMFEAEDK-HTSGKLII 11924

Query: 1228  SRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAW 1287
               +  K  +PLK +   E       ++   D ++V W   D ++ ++  + +        
Sbjct: 11925 EGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSM-------- 11976

Query: 1288  LQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLI 1347
                     +D+GK     F  KD    S+D + Q   EA     + K      +      
Sbjct: 11977 --------QDEGKTHSITF--KD---LSIDDTSQIRVEAMGMSSEAKLTVL--EGDPYFT 12021

Query: 1348  GGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKG 1407
             G L D   + + + + L C +    D  V WFK+ ++I+ S++  +K +  K + + +K 
Sbjct: 12022 GKLQDYTGVEKDEVI-LQCEI-SKADAPVKWFKDGKEIKPSKNAVIKADGKKRM-LILKK 12078

Query: 1408  VTSEDSGKYSINIKNKYGGEKIDV 1431
                 D G+Y+ +        K+D+
Sbjct: 12079 ALKSDIGQYTCDCGTDKTSGKLDI 12102



 Score = 36.6 bits (83), Expect = 0.18
 Identities = 42/144 (29%), Positives = 64/144 (44%), Gaps = 24/144 (16%)

Query: 186   QWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVV 245
             +W+++   I  ++   KY I     V+TL I  A  DD A Y+   TN  G+   +AA +
Sbjct: 12671 KWFRNEEAIFDSS---KYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANL 12727

Query: 246   VRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTF--RREGETVTLKCTM-- 301
             +     +EE  R V      PL         D++ +EK  VTF  +     VTLK T   
Sbjct: 12728 I----VEEEDLRIVE-----PLK--------DIETMEKKSVTFWCKVNRLNVTLKWTKNG 12770

Query: 302   LVTPDLKRVQPRAEWYRDDVLLKE 325
                P   RV  R + Y+  + +K+
Sbjct: 12771 EEVPFDNRVSYRVDKYKHMLTIKD 12794



 Score = 36.6 bits (83), Expect = 0.18
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 1370  GNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYV-SMTIKGVTSEDSGKYSINIKNKYGGEK 1428
             G P   V W K+ Q   L E   V V  +K V S++IK  + ED G Y + + N  G   
Sbjct: 25420 GRPQATVNWRKDGQT--LKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSIT 25477

Query: 1429  IDVTVSV 1435
             + +T+ V
Sbjct: 25478 VPITIIV 25484



 Score = 36.6 bits (83), Expect = 0.18
 Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 1364  LTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAK--YVSMTIKGVTSEDSGKYSINIK 1421
             L C V G+P P V W++  ++I +++    ++++ K  Y  + I  VT +D+  Y +   
Sbjct: 30947 LVCKVTGHPKPIVKWYRQGKEI-IADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRAT 31005

Query: 1422  NKYG 1425
             N+ G
Sbjct: 31006 NQGG 31009



 Score = 36.2 bits (82), Expect = 0.24
 Identities = 49/261 (18%), Positives = 95/261 (36%), Gaps = 43/261 (16%)

Query: 150  ISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNY 209
            +   P  LV+          +V+    ++G P   ++W+KD     +     K  I    
Sbjct: 5326 VKEPPSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDD---VELVSGPKCFIGLEG 5382

Query: 210  GVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSS 269
                L +   D   T  Y+   TN  G  S    ++V      E P              
Sbjct: 5383 STSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVT-----EPP-------------- 5423

Query: 270  MIPYTHFDVQFLEKFGVT-FRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKW 328
                     +F++K   +   + G++  L+C +  +P+++ V     W+R++  L  S  
Sbjct: 5424 ---------KFVKKLEASKIVKAGDSSRLECKIAGSPEIRVV-----WFRNEHELPASDK 5469

Query: 329  TKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDA------DPLVTGA 382
             +M F +  A +  ++L  +D G +     +  G +  S  + V++        P+V   
Sbjct: 5470 YRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETL 5529

Query: 383  PGAPMDLQCHDANRDYVIVTW 403
              A + L+C  +      V W
Sbjct: 5530 KNAEVSLECELSGTPPFEVVW 5550



 Score = 36.2 bits (82), Expect = 0.24
 Identities = 20/84 (23%), Positives = 36/84 (42%), Gaps = 1/84 (1%)

Query: 1353  VVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSED 1412
             +V    G  + +   V G P P V W K DQ ++ ++  + +      + + I      D
Sbjct: 21074 LVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTI-LNINECVRSD 21132

Query: 1413  SGKYSINIKNKYGGEKIDVTVSVY 1436
             SG Y +  +N  G     +T+ V+
Sbjct: 21133 SGPYPLTARNIVGEVGDVITIQVH 21156



 Score = 36.2 bits (82), Expect = 0.24
 Identities = 17/72 (23%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
             VT   G+   L+C + G P P++ W++  +++  S  + +  +   + ++T+     ED 
Sbjct: 30542 VTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTH-TLTVMTEEQEDE 30600

Query: 1414  GKYSINIKNKYG 1425
             G Y+    N+ G
Sbjct: 30601 GVYTCIATNEVG 30612



 Score = 35.4 bits (80), Expect = 0.41
 Identities = 28/97 (28%), Positives = 41/97 (42%), Gaps = 9/97 (9%)

Query: 153  APEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVH 212
            AP  + +     + E  SV     V G P P V W K G  +        YR + +Y   
Sbjct: 1081 APYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTG-----YRYKVSYNKQ 1135

Query: 213  T----LEINRADFDDTATYSAVATNAHGQVSTNAAVV 245
            T    L I+    DD   Y+ V  N HG+ S +A+++
Sbjct: 1136 TGECKLVISMTFADDAGEYTIVVRNKHGETSASASLL 1172



 Score = 35.4 bits (80), Expect = 0.41
 Identities = 46/222 (20%), Positives = 81/222 (36%), Gaps = 34/222 (15%)

Query: 145  TFEERISRA--PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGK 202
            T E ++ R   P  +++  S    E  + +    V G P P   W+ DG  I       K
Sbjct: 1446 TDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVN-DYTHK 1504

Query: 203  YRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLP 262
              I+ + G  +L I  A   D+  ++ VA N  G+ S +  + V       +P       
Sbjct: 1505 VVIKED-GTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKP------- 1556

Query: 263  IGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVL 322
                             F+EK      +EG  + +K      P+     P   W ++  +
Sbjct: 1557 ----------------MFVEKLKNVNIKEGSRLEMKVRATGNPN-----PDIVWLKNSDI 1595

Query: 323  LKESKWTKMFF--GEGQASLSFSHLHKDDEGLYTLRIVSRGG 362
            +   K+ K+     +G+A+L        D   YT   +++ G
Sbjct: 1596 IVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAG 1637



 Score = 35.0 bits (79), Expect = 0.53
 Identities = 55/234 (23%), Positives = 82/234 (35%), Gaps = 50/234 (21%)

Query: 185   VQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAV 244
             V+W+KDG+ I +     KY I S   V  L IN+   DD A YS     A          
Sbjct: 12404 VKWFKDGAEIKKGK---KYDIISKGAVRILVINKCLLDDEAEYSCEVRTAR--------- 12451

Query: 245   VVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVT 304
                                    S M+     +  F +        E +T+ L C +   
Sbjct: 12452 ----------------------TSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEV--- 12486

Query: 305   PDLKRVQPRAE--WYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSR-- 360
                   +P AE  WY+ D  + E+   ++     +  L   + H +D G Y  R+ S   
Sbjct: 12487 -----SKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRT 12541

Query: 361   -GGVSDHS-AFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTES 412
              G V  H  A  F+     L     G   +  C   +++   V WK  + T ES
Sbjct: 12542 DGKVKVHELAAEFISKPQNLEI-LEGEKAEFVC-SISKESFPVQWKRDDKTLES 12593



 Score = 34.7 bits (78), Expect = 0.69
 Identities = 51/233 (21%), Positives = 86/233 (36%), Gaps = 36/233 (15%)

Query: 154  PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKY-RIESNYGVH 212
            P I+  L+     E    +    V G    V  + KD  +     +P ++ R+      +
Sbjct: 3345 PAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKI-----KPSRFFRMTQFEDTY 3399

Query: 213  TLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIP 272
             LEI  A  +D  TY+ VA+NA GQVS+ A                  L +  P S +  
Sbjct: 3400 QLEIAEAYPEDEGTYTFVASNAVGQVSSTA-----------------NLSLEAPESILHE 3442

Query: 273  YTHFDVQFLEKFGVTFRRE--------GETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLK 324
                +++   K     +R+        G      C +   P++     R +W++    + 
Sbjct: 3443 RIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNV-----RFQWFKAGREIY 3497

Query: 325  ESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADP 377
            ES    +   +  +SL        D G YT +  +  G    +A L V +A P
Sbjct: 3498 ESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYP 3550



 Score = 34.7 bits (78), Expect = 0.69
 Identities = 24/94 (25%), Positives = 38/94 (40%), Gaps = 3/94 (3%)

Query: 154  PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
            P    +L+        SV +   V G P   V W+ +G+ I       KY+         
Sbjct: 7682 PSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGR---KYQTTLTDNTCA 7738

Query: 214  LEINRADFDDTATYSAVATNAHGQVSTNAAVVVR 247
            L +N  +  D+  Y+ +ATN  G    +A + VR
Sbjct: 7739 LTVNMLEESDSGDYTCIATNMAGSDECSAPLTVR 7772



 Score = 33.9 bits (76), Expect = 1.2
 Identities = 19/78 (24%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 1345  RLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMT 1404
             R +  L + VT+++G+ L L+C +  N + +V+W K+ + +       V        ++T
Sbjct: 11213 RFVKTLEEEVTVVKGQPLYLSCEL--NKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALT 11270

Query: 1405  IKGVTSEDSGKYSINIKN 1422
             I      D+G Y++ ++N
Sbjct: 11271 INDADDTDAGTYTVTVEN 11288



 Score = 33.5 bits (75), Expect = 1.5
 Identities = 26/94 (27%), Positives = 39/94 (41%), Gaps = 2/94 (2%)

Query: 161  RSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRAD 220
            +S  V E+ +      V G P P V+W K      Q  + G+  I        LEI    
Sbjct: 8461 QSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWR--QLNQGGRVFIHQKGDEAKLEIRDTT 8518

Query: 221  FDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEE 254
              D+  Y  VA N HG++ +N  + V   +  E+
Sbjct: 8519 KTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEK 8552



 Score = 33.1 bits (74), Expect = 2.0
 Identities = 23/85 (27%), Positives = 39/85 (45%), Gaps = 3/85 (3%)

Query: 900  DTSEPVLVEARP--GTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFK 957
            +TS  + +EA P   TK I   V  +      F+C+   D +  TW K   E+++ +++ 
Sbjct: 8822 ETSAELRIEAEPIQFTKRIQNIVVSEHQSAT-FECEVSFDDAIVTWYKGPTELTESQKYN 8880

Query: 958  IETVGDHSKLYLKNPDKEDLGTYSV 982
                G    + + N   +D G YSV
Sbjct: 8881 FRNDGRCHYMTIHNVTPDDEGVYSV 8905



 Score = 33.1 bits (74), Expect = 2.0
 Identities = 25/93 (26%), Positives = 36/93 (38%), Gaps = 3/93 (3%)

Query: 154   PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
             P   +   + TV     +K+     G PTP V W+KD   + Q         E+N     
Sbjct: 22148 PAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENN---SL 22204

Query: 214   LEINRADFDDTATYSAVATNAHGQVSTNAAVVV 246
             L I  A  +D   Y    TN+ G+      V+V
Sbjct: 22205 LTIKDACREDVGHYVVKLTNSAGEAIETLNVIV 22237



 Score = 32.0 bits (71), Expect = 4.5
 Identities = 28/123 (22%), Positives = 52/123 (42%), Gaps = 21/123 (17%)

Query: 1354 VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
            + + E ++    C V  + D  V W+K   ++  S+ ++ +    +   MTI  VT +D 
Sbjct: 8843 IVVSEHQSATFECEVSFD-DAIVTWYKGPTELTESQKYNFR-NDGRCHYMTIHNVTPDDE 8900

Query: 1414 GKYSINIKNKYGGE-----KIDVTVSVYKHGEKIPDM--------------APPQQAKPK 1454
            G YS+  + +  GE     ++ +T    K   K PD+               PP++  P 
Sbjct: 8901 GVYSVIARLEPRGEARSTAELYLTTKEIKLELKPPDIPDSRVPIPTMPIRAVPPEEIPPV 8960

Query: 1455 LIP 1457
            + P
Sbjct: 8961 VAP 8963



 Score = 32.0 bits (71), Expect = 4.5
 Identities = 24/108 (22%), Positives = 42/108 (38%), Gaps = 28/108 (25%)

Query: 1356  IMEGKTLNLTCTVFGNPDPEVIWFKNDQ--------------------DIQLSEHFSVKV 1395
             +  G  + L  ++ G+P P + W K++                     ++Q  E F + +
Sbjct: 14691 VKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPL 14750

Query: 1396  EQAKYVSMTIKGVTS--------EDSGKYSINIKNKYGGEKIDVTVSV 1435
              Q   +  + KG +          D G Y I ++N +G  K   TVSV
Sbjct: 14751 TQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSV 14798



 Score = 32.0 bits (71), Expect = 4.5
 Identities = 24/105 (22%), Positives = 44/105 (41%), Gaps = 10/105 (9%)

Query: 1350  LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFK-------NDQDIQLSEHFSVKVEQAKYVS 1402
             L + + + EG  +N+   + G P P + WFK       N + +    H + K+      +
Sbjct: 16122 LKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVN-KLVVDDTCT 16180

Query: 1403  MTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAP 1447
             + I      D+G Y+I   N  G    ++ ++V   G   P + P
Sbjct: 16181 LVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVL--GRPGPPVGP 16223



 Score = 32.0 bits (71), Expect = 4.5
 Identities = 22/99 (22%), Positives = 45/99 (45%), Gaps = 3/99 (3%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
             + +  G ++ +   + G P PEV W K+  +I L    +++  ++ +  + I      D+
Sbjct: 20786 LVVRAGLSIRIFVPIKGRPAPEVTWTKD--NINLKNRANIENTES-FTLLIIPECNRYDT 20842

Query: 1414  GKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAK 1452
             GK+ + I+N  G +   V V V      + ++ P    K
Sbjct: 20843 GKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITK 20881



 Score = 32.0 bits (71), Expect = 4.5
 Identities = 18/70 (25%), Positives = 31/70 (44%), Gaps = 2/70 (2%)

Query: 1364  LTCTVFGNP--DPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIK 1421
             LTC V  +     EV W+K+ + ++ + HF           + I  +T  D G+Y   I 
Sbjct: 32735 LTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEIS 32794

Query: 1422  NKYGGEKIDV 1431
              + G  K ++
Sbjct: 32795 GEGGTSKTNL 32804



 Score = 31.6 bits (70), Expect = 5.9
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 3/71 (4%)

Query: 177  VQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHG 236
            + G P   V WY DG+ I    + G   I+   G+ T +I+ A  +++ TY   A N  G
Sbjct: 4885 ITGTPKIRVSWYLDGNEITAIQKHGISFID---GLATFQISGARVENSGTYVCEARNDAG 4941

Query: 237  QVSTNAAVVVR 247
              S +  + V+
Sbjct: 4942 TASCSIELKVK 4952



 Score = 31.6 bits (70), Expect = 5.9
 Identities = 15/59 (25%), Positives = 28/59 (47%)

Query: 940  QFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDP 998
            + +W K  E++   ++F+I   GD   L +KN   +D G Y +        +   V++P
Sbjct: 8687 KLSWYKGTEKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLVCGPHIASAKLTVIEP 8745


>gi|110349717 titin isoform novex-2 [Homo sapiens]
          Length = 27118

 Score =  269 bits (688), Expect = 1e-71
 Identities = 229/865 (26%), Positives = 373/865 (43%), Gaps = 101/865 (11%)

Query: 153  APEILVRLR---SHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNY 209
            APEI + ++     TV     ++L  TV G P P + W K   ++ Q     +  IE+  
Sbjct: 7382 APEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDK---RITIENVP 7438

Query: 210  GVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSS 269
               T+ I  +   DT TY   A N  G+ +    V V                    L  
Sbjct: 7439 KKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV--------------------LDK 7478

Query: 270  MIPYTHFDVQFL--EKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESK 327
              P   FD+  +  E   +T+    +    K T  V    +R      W++    +K++ 
Sbjct: 7479 PGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVE--RRATDSEVWHKLSSTVKDTN 7536

Query: 328  WTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVT----GAP 383
            +              + L  + E ++ +   +  GV +         A P+        P
Sbjct: 7537 FKA------------TKLIPNKEYIFRVAAENMYGVGEPV------QASPITAKYQFDPP 7578

Query: 384  GAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYP 443
            G P  L+  D  +D V +TW  P+    SP+ GY+V+R +  T+ WV+CN  PVK   Y 
Sbjct: 7579 GPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYR 7638

Query: 444  VTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDD 503
            V GL   + Y FRV A N AG  +PS+ ++ +   DP+D                     
Sbjct: 7639 VKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPID--------------------- 7677

Query: 504  LEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPL-MYFIEKSVVGSGSWQRVNAQ 562
                   P PP      ++ +  V L+W  P   G   +  Y IE    G+  W RV   
Sbjct: 7678 ------PPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRV--A 7729

Query: 563  TAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASR 622
              V + ++ +  LMEG+ Y FRV + N+ G SEPSE + P+  ++    PS P  +    
Sbjct: 7730 EGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVIN 7789

Query: 623  NTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQY 680
             TK +  ++W  P+ +    +  Y V+        W+  +   +   +  V  LT G  Y
Sbjct: 7790 ITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVD-TTVKDTKCTVTPLTEGSLY 7848

Query: 681  IFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGS 740
            +FRV A NA+G S+ ++  D +  +   T P  PY + +++     + L W+ PK  GG 
Sbjct: 7849 VFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGR 7908

Query: 741  PILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPS 800
            PI  Y ++K+E     W +   +        V  + EG+  +F++ A N AG+G PS+P+
Sbjct: 7909 PIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPT 7968

Query: 801  EHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWI 860
            E    E  T P P P  DL   +     + + WK P  +G SP+ GY V+       +W+
Sbjct: 7969 EILSIEDPTSP-PSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWM 8027

Query: 861  TVNQTTTANRYLKVSD-LQQGKTYVFRVRAVNANGVGKPSDTSEPVLV---EARP----G 912
             VN     +   KV + +   K YV RVRAVNA GV +PS+ SE V+    + +P     
Sbjct: 8028 RVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLE 8087

Query: 913  TKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNP 972
            T +I     E+ +I + F    +   S   W K  +E+   +R  ++   DH   +L+ P
Sbjct: 8088 THDIIVIEGEKLSIPVPFRAVPVPTVS---WHKDGKEVKASDRLTMK--NDHISAHLEVP 8142

Query: 973  D--KEDLGTYSVSVSDTDGVSSSFV 995
               + D G Y++++ +  G +++ +
Sbjct: 8143 KSVRADAGIYTITLENKLGSATASI 8167



 Score =  268 bits (685), Expect = 3e-71
 Identities = 209/769 (27%), Positives = 337/769 (43%), Gaps = 83/769 (10%)

Query: 272  PYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKM 331
            P    DV+ L    V   + G  + L  T+   P+     P+  W + D++LK+ K   +
Sbjct: 7383 PEIFLDVKLLAGLTV---KAGTKIELPATVTGKPE-----PKITWTKADMILKQDKRITI 7434

Query: 332  FFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQC 391
                 +++++     + D G Y +  V+  G +     + V D        PG P     
Sbjct: 7435 ENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDK-------PGPPAAFDI 7487

Query: 392  HDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGR 451
             D   +  ++TW PP     S +  Y V+R    +  W + + + VK   +  T L   +
Sbjct: 7488 TDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLS-STVKDTNFKATKLIPNK 7546

Query: 452  SYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVP 511
             YIFRV A N  G+  P + S   A                       YQ D       P
Sbjct: 7547 EYIFRVAAENMYGVGEPVQASPITAK----------------------YQFD------PP 7578

Query: 512  GPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRY 570
            GPPT +  S+I+++ V L+W  P   G  P+  Y++E+    +  W R N +  V+   Y
Sbjct: 7579 GPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCN-KMPVKDTTY 7637

Query: 571  AVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVV 630
             V  L   K Y FRVL+ N  G  +PS+ T PI  +D    P  PG+       KTSV +
Sbjct: 7638 RVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRL 7697

Query: 631  QWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVN 688
             W +P+H+    +  Y ++    GT+ W     + +   + ++ GL  G++Y FRV+AVN
Sbjct: 7698 NWTKPEHDGGAKIESYVIEMLKTGTDEWVRV-AEGVPTTQHLLPGLMEGQEYSFRVRAVN 7756

Query: 689  AVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLD 748
              G SE S+ SD +  +  L  PS P  + ++N   ++  L W VP+  GGSPI  Y ++
Sbjct: 7757 KAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVE 7816

Query: 749  KREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAW 808
            KR+V  K W  V+++  K T  TV  LTEGSLY F++AA N  G  + ++  +    +  
Sbjct: 7817 KRDVRRKGWQTVDTT-VKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKD- 7874

Query: 809  TMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTA 868
            T   PGP Y L   +V    + + W+ P   G  P+  Y ++ +E     W+   +T   
Sbjct: 7875 TFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGP 7934

Query: 869  NRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVE--ARPGTKEISAGVDEQGNI 926
            +   +V+D+ +G    F+VRA N  GVG PS+ +E + +E    P +  +   V + G  
Sbjct: 7935 DCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRK 7994

Query: 927  YLGFDCQ---------------EMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKN 971
            ++    +               EM       W +       D +FK+E            
Sbjct: 7995 HIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEG--------VV 8046

Query: 972  PDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKS 1020
            PDKE    Y + V   + +    V +P E+   +   +    PTI L++
Sbjct: 8047 PDKE----YVLRVRAVNAIG---VSEPSEISENVVAKDPDCKPTIDLET 8088



 Score =  231 bits (588), Expect = 5e-60
 Identities = 228/871 (26%), Positives = 358/871 (41%), Gaps = 147/871 (16%)

Query: 164   TVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDD 223
             TV    +V L  TV G P P V W KDG+L+ + AE  K  ++ N  + TLE+   +  D
Sbjct: 13001 TVKAGTNVCLDATVFGKPMPTVSWKKDGTLL-KPAEGIKMAMQRN--LCTLELFSVNRKD 13057

Query: 224   TATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEK 283
             +  Y+  A N+ G  S    + V      ++P    G P  + ++ M         + ++
Sbjct: 13058 SGDYTITAENSSGSKSATIKLKVL-----DKP----GPPASVKINKM---------YSDR 13099

Query: 284   FGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFS 343
               +++    E    + T  +    +  +P               W ++       S S  
Sbjct: 13100 AMLSWEPPLEDGGSEITNYIVDKRETSRPN--------------WAQVSATVPITSCSVE 13145

Query: 344   HLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDA------DPLVTGAPGAPMDLQCHDANRD 397
              L +  E  + +   ++ GV D    +F   A      DP     PG        +  +D
Sbjct: 13146 KLIEGHEYQFRICAENKYGVGDP---VFTEPAIAKNPYDP-----PGRCDPPVISNITKD 13197

Query: 398   YVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRV 457
             ++ V+WKPP     SP+ GY +++ E    NW + N  P+       TGL EG  Y FRV
Sbjct: 13198 HMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRV 13257

Query: 458   RAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGV 517
              A+N AG  +PS  S A  A DP                              PGPP   
Sbjct: 13258 TAINKAGPGKPSDASKAAYARDP---------------------------QYPPGPPAFP 13290

Query: 518   HASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLM 576
                + +R+ V LSW  P   G  P++ Y +E     S +W R N    ++  R+ V  LM
Sbjct: 13291 KVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLM 13350

Query: 577   EGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV------- 629
             E   Y FRV + N+ G S+PS++      +D+ + P      L +   KT ++       
Sbjct: 13351 EDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGE---LDADLRKTLILRAGVTMR 13407

Query: 630   ------------VQWDRPK-HEEDLLGYYVDCCVAGTNL-WEPCNHKPIGYNRFVVHGLT 675
                         + W +P  +  D +G  +      T L  E  N    G          
Sbjct: 13408 LYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAG---------- 13457

Query: 676   TGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPK 735
                +YI  ++  N+ G  E +    V+KV   L  P  P  +T+      S  + W+ P 
Sbjct: 13458 ---KYILTLE--NSCGKKEYTI---VVKV---LDTPGPPVNVTVKEISKDSAYVTWEPPI 13506

Query: 736   FSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGE 795
               GGSPI+ Y + KR+   K+W  V +  SK T   V  L EG  Y F++ A N  GIG+
Sbjct: 13507 IDGGSPIINYVVQKRDAERKSWSTVTTECSK-TSFRVANLEEGKSYFFRVFAENEYGIGD 13565

Query: 796   PSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREED 855
             P +  +  K        PGP  DL    V  +S  + WK P   G S + GY VDF  E+
Sbjct: 13566 PGETRDAVKAS----QTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTEE 13621

Query: 856   AGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKE 915
               +W  V ++ +     K  DL +GK Y FRV A N NG G PS+    + V AR     
Sbjct: 13622 -NKWQRVMKSLSLQYSAK--DLTEGKEYTFRVSAENENGEGTPSE----ITVVARDDV-- 13672

Query: 916   ISAGVDEQGNIYLGFDCQEMTD-----------ASQFTWCKSYEEISDDERFKIETVGDH 964
             ++  +D +G   L +  +E ++           A   +W K  + ++ D R  +E+   +
Sbjct: 13673 VAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVN 13732

Query: 965   SKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
             + L + +  K D G Y++++ +  G     +
Sbjct: 13733 TTLIVYDCQKSDAGKYTITLKNVAGTKEGTI 13763



 Score =  226 bits (575), Expect = 2e-58
 Identities = 233/937 (24%), Positives = 390/937 (41%), Gaps = 106/937 (11%)

Query: 167  ERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTAT 226
            E++S+ + F  +  P P V W+KDG    +     +  +++++    LE+ ++   D   
Sbjct: 8097 EKLSIPVPF--RAVPVPTVSWHKDGK---EVKASDRLTMKNDHISAHLEVPKSVRADAGI 8151

Query: 227  YSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGV 286
            Y+    N  G  + +  V V                IGLP     P        + K   
Sbjct: 8152 YTITLENKLGSATASINVKV----------------IGLPG----PCKDIKASDITKSSC 8191

Query: 287  TFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLH 346
                E            TP L  V  R E  R         +  +  GE + S +   L 
Sbjct: 8192 KLTWEPPEFDGG-----TPILHYVLERREAGR-------RTYIPVMSGENKLSWTVKDLI 8239

Query: 347  KDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTG----APGAPMDLQCHDANRDYVIVT 402
             + E  + ++ V++ G  +     ++   +P++       P  P+D++ H+   + + +T
Sbjct: 8240 PNGEYFFRVKAVNKVGGGE-----YIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTIT 8294

Query: 403  WKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNS 462
            WKPP     S +MGY +++   G   W +CN+  V I  Y   GL EG+ Y FRVRA N+
Sbjct: 8295 WKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENA 8354

Query: 463  AGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPP----TGVH 518
            AGIS PSR +    A+DP+D  +   V L    E+    D++  DA + G P    T + 
Sbjct: 8355 AGISEPSRATPPTKAVDPIDAPK---VILRTSLEVK-RGDEIALDASISGSPYPTITWIK 8410

Query: 519  ASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSP-RYAVFDLME 577
               +     +     P  R +   +   E  V+     QR++   + +   +  V D + 
Sbjct: 8411 DENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLT--QRLSIDNSKKGESQLRVRDSLR 8468

Query: 578  GKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKH 637
                ++ +   N HG+++     S +        P  P   +     KTSV+ +W+ P  
Sbjct: 8469 PDHGLYMIKVENDHGIAKAPCTVSVLDT------PGPPINFVFEDIRKTSVLCKWEPPLD 8522

Query: 638  E--EDLLGYYVDCCVAGTNLWEPCNH-----KPIGYNRFVVHGLTTGEQYIFRVKAVNAV 690
            +   +++ Y ++      +  +P +        + + ++ V  L  G++Y+FRV+A N  
Sbjct: 8523 DGGSEIINYTLE----KKDKTKPDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRF 8578

Query: 691  GMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKR 750
            G         ++  +     P  P    + +   +SM + W  PK   GSPILGY+L+KR
Sbjct: 8579 GPGPPCVSKPLV-AKDPFGPPDAPDKPIVEDVTSNSMLVKWNEPK-DNGSPILGYWLEKR 8636

Query: 751  EVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTM 810
            EV+  +W  VN S        VDGL EG  Y F++ A N AG G+ S PS+  K     +
Sbjct: 8637 EVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDP-KTAHDPI 8695

Query: 811  PEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANR 870
              PGP       +   T++ + W+ P ++G   + GYFVD +     EW    +     R
Sbjct: 8696 SPPGPPIP-RVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVR 8754

Query: 871  YLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGF 930
               V ++++G  Y  RV AVNA G G P +T +PV V        +   V  +G I +  
Sbjct: 8755 QYTVKEIREGADYKLRVSAVNAAGEGPPGET-QPVTVAEPQEPPAVELDVSVKGGIQIMA 8813

Query: 931  DCQEMTDA-------SQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVS 983
                   A           W K   E+ D +R  I+ VG  S+L +K+  ++D G Y ++
Sbjct: 8814 GKTLRIPAVVTGRPVPTKVWTKEEGEL-DKDRVVIDNVGTKSELIIKDALRKDHGRYVIT 8872

Query: 984  VSDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSP 1043
             +++ G  S F     E+        ++  P + LK  +      K  +  W   E    
Sbjct: 8873 ATNSCG--SKFAAARVEV-------FDVPGPVLDLKPVVTNR---KMCLLNWSDPEDDGG 8920

Query: 1044 DASYRFIINDREV------SDSEIHRIKCDKATGIIE 1074
                 FII  ++          E  R KCD  TG++E
Sbjct: 8921 SEITGFIIERKDAKMHTWRQPIETERSKCD-ITGLLE 8956



 Score =  218 bits (554), Expect = 4e-56
 Identities = 194/813 (23%), Positives = 330/813 (40%), Gaps = 104/813 (12%)

Query: 328   WTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPM 387
             WT +       SL  + L + +E ++ +  V++ GV +      V   +P V   PG P 
Sbjct: 17461 WTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVL--PGPPK 17518

Query: 388   DLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGL 447
              L+  +  +D + V W  P++   S ++GY V++ +     W++CN   +   +  VTGL
Sbjct: 17519 SLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGL 17578

Query: 448   FEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGD 507
              E   Y FRV A N+AG+  PS  +    A DP+                          
Sbjct: 17579 TEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFK------------------------ 17614

Query: 508   AQVPGPPTGVHASEISRNYVVLSWEPPT-PRGKDPLMYFIEKSVVGSGSWQRVNAQTAVR 566
                PGPPT  H  + ++N + L+W  P    G + L Y +E        WQ V  QT +R
Sbjct: 17615 ---PGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLR 17671

Query: 567   SPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQD----------------VTV 610
               R+ +  L E + Y  RV + N+ GL E + +   ++ +D                + V
Sbjct: 17672 VTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVV 17731

Query: 611   VPSAPGRVLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFV 670
                   R+      + +  + W R +      G + D              K + Y +  
Sbjct: 17732 RAGGSARIHIPFKGRPTPEITWSREE------GEFTDKVQI---------EKGVNYTQLS 17776

Query: 671   VHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLG 730
             +      +   + +K  N+ G      +S  + V+  L  P  P  + +      S  L 
Sbjct: 17777 IDNCDRNDAGKYILKLENSSG-----SKSAFVTVKV-LDTPGPPQNLAVKEVRKDSAFLV 17830

Query: 731   WKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNL 790
             W+ P   GG+ +  Y +DKRE   K +  V+S  SK T   V+ LTEG++Y F++ A N 
Sbjct: 17831 WEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSK-TSFKVENLTEGAIYYFRVMAENE 17889

Query: 791   AGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVD 850
              G+G P +  +  K        P P   +T  +V  TS  ++W+ P + G S V GY V+
Sbjct: 17890 FGVGVPVETVDAVKAAE----PPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVE 17945

Query: 851   FREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVE-- 908
              + +   +W  V ++   N    V+ L  G+ Y FRV+A N  G   P     PV+ +  
Sbjct: 17946 MQPKGTEKWSIVAESKVCNAV--VTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDL 18003

Query: 909   -ARPGTK------EISAGVDEQGNI-YLGFDCQEMTDASQFTWCKSYEEISDDERFKIET 960
               +P  K       I AG D +  I  +G            +W K  E +    R  +E 
Sbjct: 18004 TIQPSLKLPFNTYSIQAGEDLKIEIPVIG------RPRPNISWVKDGEPLKQTTRVNVEE 18057

Query: 961   VGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIKNPTI-PLK 1019
                 + L++K  +K+D G Y+V+ +++ G ++         E L  +  E   P + P++
Sbjct: 18058 TATSTVLHIKEGNKDDFGKYTVTATNSAGTAT---------ENLSVIVLEKPGPPVGPVR 18108

Query: 1020  SELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGIIEMVMDR 1079
              +   E+     V  W    +        +I+  R+ + +  H +    A   I++   +
Sbjct: 18109 FD---EVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLK 18165

Query: 1080  FSIENEGTYTVQIHDGK-AKSQSSLVLIGDAFK 1111
                E +     +   GK A   S  V++   FK
Sbjct: 18166 TGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFK 18198



 Score =  216 bits (551), Expect = 1e-55
 Identities = 213/874 (24%), Positives = 350/874 (40%), Gaps = 152/874 (17%)

Query: 164   TVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDD 223
             T+    S++L  +V G P PV+ W K G  +   A      I++      L +++ +  D
Sbjct: 23152 TIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAI-----IDTTESYSLLIVDKVNRYD 23206

Query: 224   TATYSAVATNAHGQVSTNAAVVVRRFRGD-------EEPFRSVGLPIGLP-LSSMIPYTH 275
                Y+  A N  G+ S    V V    G        E    SV +   +P +    P  +
Sbjct: 23207 AGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNN 23266

Query: 276   FDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGE 335
             + V+  E     F+    TVT KC+  +      V+    ++R   +L E+      +G 
Sbjct: 23267 YIVEKREAAMRAFK----TVTTKCSKTLYRISGLVEGTMYYFR---VLPEN-----IYGI 23314

Query: 336   GQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDAN 395
             G+   +   +                                LV+  P  P  L+  D  
Sbjct: 23315 GEPCETSDAV--------------------------------LVSEVPLVPAKLEVVDVT 23342

Query: 396   RDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIF 455
             +  V + W+ P     S + GY ++ C+ GT  W++       + ++ VT L EG  Y+F
Sbjct: 23343 KSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLF 23402

Query: 456   RVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVP-GPP 514
             R+RA N  G+S P    + V A+   DLR L  + L    +  I+         VP G P
Sbjct: 23403 RIRAQNEKGVSEPR---ETVTAVTVQDLRVLPTIDLSTMPQKTIH---------VPAGRP 23450

Query: 515   TGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFD 574
               +      R     SW            +F    +  S   +RV  +T  +  +  + +
Sbjct: 23451 VELVIPIAGRPPPAASW------------FFAGSKLRES---ERVTVETHTKVAKLTIRE 23495

Query: 575   LMEGKSYVFRVLSANRHG----------LSEPSEITSPIQAQDVTVVPSAPGRVLASRNT 624
                  +  + +   N  G          L +P   T PI+  ++                
Sbjct: 23496 TTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDA-------------- 23541

Query: 625   KTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIF 682
              TS+ + W+ P+ +    L GY V+   A    W P +   +  + F    LT G +Y+F
Sbjct: 23542 -TSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSES-VTRSTFKFTRLTEGNEYVF 23599

Query: 683   RVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPI 742
             RV A N  G+    Q S+VI+ ++++ +P  P  + + +     MTL W  P+  GGS +
Sbjct: 23600 RVAATNRFGIGSYLQ-SEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQV 23658

Query: 743   LGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEH 802
              GY ++++EV    W  VN  P   T     GLTEG  YE ++ A+N  G G+PS PS+ 
Sbjct: 23659 TGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKP 23718

Query: 803   FKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITV 862
                     P PG   +    +   TS+ + W  P   G S V+GY ++ ++ D  EW   
Sbjct: 23719 IVAMDPIAP-PGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKC 23777

Query: 863   NQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISAGVDE 922
             N T T  R   ++ L QG  Y FRV A NA G G+P++          PGT +++  ++ 
Sbjct: 23778 NTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEV---------PGTVKVTEMLE- 23827

Query: 923   QGNIYLGFDCQEMTDASQFT---------------------WCKSYEEISDDERFKIETV 961
                 Y  ++  E      F                      W K  ++IS  +R  I T 
Sbjct: 23828 ----YPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDIS--KRAMIATS 23881

Query: 962   GDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
               H++L +K  D+ D GTY + + +  G  + ++
Sbjct: 23882 ETHTELVIKEADRGDSGTYDLVLENKCGKKAVYI 23915



 Score =  216 bits (549), Expect = 2e-55
 Identities = 172/613 (28%), Positives = 259/613 (42%), Gaps = 54/613 (8%)

Query: 302  LVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRG 361
            ++ P     +P A W   D +L+     KM      A L  S   + D+G+YTL++ +R 
Sbjct: 7109 ILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENR- 7167

Query: 362  GVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDR 421
             V   S      + D  V   P AP +L+  D  +D V +TW+PP+    SP+ GY V++
Sbjct: 7168 -VKTISG-----EIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEK 7221

Query: 422  CEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPL 481
             EV    W +  D  V   ++ V  L +G+ Y+F+V A N  G   P+ V + V    P 
Sbjct: 7222 REVSRKTWTKVMDF-VTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTP- 7279

Query: 482  DLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDP 541
                                      A VP PP  V   + + N + L+W+PP   G   
Sbjct: 7280 --------------------------ATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSR 7313

Query: 542  LM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEIT 600
            +  Y +E+   GS  W  V     V   +  V  L EGK Y +RV + NR G S+PS  T
Sbjct: 7314 IKGYIVERCPRGSDKW--VACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPT 7371

Query: 601  SPIQAQDVTVVPS--APGRVLASRNTKTSVVVQWDRP---KHEEDLLGYYVDCCVAGTNL 655
              IQA D    P      ++LA    K    ++       K E  +     D  +     
Sbjct: 7372 EEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKR 7431

Query: 656  WEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPY 715
                N         V    +    YI  ++AVN  G +    E +V      L  P  P 
Sbjct: 7432 ITIENVPKKSTVTIVDSKRSDTGTYI--IEAVNVCGRATAVVEVNV------LDKPGPPA 7483

Query: 716  GITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGL 775
               + +    S  L W  P+  GGS I  Y +++R    + WH++ SS  K T      L
Sbjct: 7484 AFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKL-SSTVKDTNFKATKL 7542

Query: 776  TEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKA 835
                 Y F++AA N+ G+GEP   S       +    PGP   L   ++   ++ + W  
Sbjct: 7543 IPNKEYIFRVAAENMYGVGEPVQASP--ITAKYQFDPPGPPTRLEPSDITKDAVTLTWCE 7600

Query: 836  PVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGV 895
            P   G SP++GY+V+  + D  +W+  N+    +   +V  L   K Y FRV A N  G 
Sbjct: 7601 PDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGP 7660

Query: 896  GKPSDTSEPVLVE 908
            GKPS ++EP+L++
Sbjct: 7661 GKPSKSTEPILIK 7673



 Score =  207 bits (526), Expect = 8e-53
 Identities = 199/842 (23%), Positives = 329/842 (39%), Gaps = 127/842 (15%)

Query: 177   VQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHG 236
             ++G P P V W KDG  + + A   +  I+S     TL +      D   Y    +N  G
Sbjct: 18426 IRGKPIPDVVWSKDGKELEETA--ARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGG 18483

Query: 237   QVSTNAAVVVRRFRGDEE-PFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETV 295
               S    V V    G  E P +  G+                                  
Sbjct: 18484 TKSIPITVKVLDRPGPPEGPLKVTGV---------------------------------T 18510

Query: 296   TLKCTMLVTPDLKRVQPRAEWYRDDVLLKES----KWTKMFFGEGQASLSFSHLHKDDEG 351
               KC +   P L+        Y   ++ K       WT++       +   + L   +E 
Sbjct: 18511 AEKCYLAWNPPLQDGGANISHY---IIEKRETSRLSWTQVSTEVQALNYKVTKLLPGNEY 18567

Query: 352   LYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTE 411
             ++ +  V++ G+ +      V   +P     PG P   +     +D ++VTW  P     
Sbjct: 18568 IFRVMAVNKYGIGEPLESGPVTACNPYKP--PGPPSTPEVSAITKDSMVVTWARPVDDGG 18625

Query: 412   SPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRV 471
             + + GY +++ +     W +CN   +   +  VTGL EG SY FRV A N+AG+  PS  
Sbjct: 18626 TEIEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEP 18685

Query: 472   SDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSW 531
             S    A D                  A+Y          PGPP+    ++ SR+ V L+W
Sbjct: 18686 SVFYRACD------------------ALYP---------PGPPSNPKVTDTSRSSVSLAW 18718

Query: 532   EPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANR 590
               P   G  P+  Y +E     +  W      T ++  ++ V  L E   Y FR+ + N 
Sbjct: 18719 SKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINS 18778

Query: 591   HGLSEPSEITSPIQAQD----------------VTVVPSAPGRVLASRNTKTSVVVQWDR 634
              G+ EP+ +   + AQ+                V +  SA  R+  +   +    V+W++
Sbjct: 18779 EGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEK 18838

Query: 635   PKHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSE 694
                 E +L       V  +            +   V+  +T  +   + +   N      
Sbjct: 18839 A---EGILTDRAQIEVTSS------------FTMLVIDNVTRFDSGRYNLTLEN------ 18877

Query: 695   NSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHH 754
             NS           L  PS P  +T+      S+TL W+ P   GG+ I  Y ++KRE   
Sbjct: 18878 NSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTR 18937

Query: 755   KNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPG 814
             K +  + ++ +K T   ++ L EG  Y F++ A N  GIG P++ +E  K     +P PG
Sbjct: 18938 KAYATITNNCTK-TTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEPPLP-PG 18995

Query: 815   PAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKV 874
                 +T  +V   +  + W+ P   G S ++GY V+ + + + +W T  Q  T      +
Sbjct: 18996 ---RVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLE--ATI 19050

Query: 875   SDLQQGKTYVFRVRAVNANGVGKPSDTSEPVL---VEARPGTK----EISAGVDEQGNIY 927
             S L  G+ YVFRV AVN  G   P     PV+   +E +P  +      +    EQ  I 
Sbjct: 19051 SGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKID 19110

Query: 928   LGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDT 987
             + F  +     +   W K  + + +  R  + +    + L +K   KED+GTY + VS++
Sbjct: 19111 VPFKGRPQATVN---WRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNS 19167

Query: 988   DG 989
              G
Sbjct: 19168 AG 19169



 Score =  206 bits (525), Expect = 1e-52
 Identities = 201/762 (26%), Positives = 307/762 (40%), Gaps = 95/762 (12%)

Query: 154   PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
             P + +   ++++     +K+   V G P P + W KDG  + Q     +  +E       
Sbjct: 18007 PSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTT---RVNVEETATSTV 18063

Query: 214   LEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPY 273
             L I   + DD   Y+  ATN+ G  + N +V+V      E+P    G P+G      + +
Sbjct: 18064 LHIKEGNKDDFGKYTVTATNSAGTATENLSVIVL-----EKP----GPPVG-----PVRF 18109

Query: 274   THFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFF 333
                   F     V    E    T  C +      KR      W+     +          
Sbjct: 18110 DEVSADF-----VVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATV---------- 18154

Query: 334   GEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPL-VTGAPGAPMDLQCH 392
                + ++  + L    E  + +   +R G S       V    P    G PG P      
Sbjct: 18155 --ARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGTPF---VT 18209

Query: 393   DANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRS 452
               ++D ++V W  P     + ++GY +++ E  +  WV+ N  P++  K+  TGL EG  
Sbjct: 18210 SISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLE 18269

Query: 453   YIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPG 512
             Y F+V A N  GI +PS+VS+   A DP D                              
Sbjct: 18270 YEFKVSAENIVGIGKPSKVSECFVARDPCD------------------------------ 18299

Query: 513   PPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYA 571
             PP    A  I+RN V L W+ P   G   +  Y +EK  +  G W + +  T V    + 
Sbjct: 18300 PPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASF-TNVLETEFT 18358

Query: 572   VFDLMEGKSYVFRVLSANRHG-LSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVV 630
             V  L+E + Y FRV++ N  G  SEPS+ +  I A+D      AP   L  +     VV 
Sbjct: 18359 VSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEI---DAPNASLDPKYKDVIVVH 18415

Query: 631   QWDRPKHEEDLLGYYVDCCV---AGTNLWEPCNH----KPIGYNRFVVHGL--TTGEQYI 681
               +    E D+ G  +   V    G  L E          I     VV     T G QYI
Sbjct: 18416 AGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYI 18475

Query: 682   FRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYG-ITLLNCDGHSMTLGWKVPKFSGGS 740
              ++  V          +S  I V+  L  P  P G + +         L W  P   GG+
Sbjct: 18476 LKLSNVGGT-------KSIPITVK-VLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGA 18527

Query: 741   PILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPS 800
              I  Y ++KRE    +W +V S+  +     V  L  G+ Y F++ AVN  GIGEP +  
Sbjct: 18528 NISHYIIEKRETSRLSWTQV-STEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESG 18586

Query: 801   EHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWI 860
                 C  +    PGP        +   S+V+ W  PV  G + + GY ++ R+++   W 
Sbjct: 18587 PVTACNPY--KPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWT 18644

Query: 861   TVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTS 902
               N+ T  +  L+V+ L +G +Y FRV A NA GVG+PS+ S
Sbjct: 18645 KCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPS 18686



 Score =  206 bits (525), Expect = 1e-52
 Identities = 205/865 (23%), Positives = 323/865 (37%), Gaps = 151/865 (17%)

Query: 170   SVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSA 229
             S+++   VQG P P V W+KDG    +  +     I    G  +L +  A  D    Y+ 
Sbjct: 21670 SLRIKALVQGRPVPRVTWFKDG---VEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTV 21726

Query: 230   VATNAHGQVSTNAAVVVRRFRGDEE-PFRSVGLP-------IGLPLSS-MIPYTHFDVQF 280
              A NA G       V V+   G    P R   +           PL+    P TH+ ++ 
Sbjct: 21727 EAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEK 21786

Query: 281   LEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASL 340
              E    T R     +  KC       +K +      +R   + K        FG G+   
Sbjct: 21787 RE----TSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNK--------FGVGRPL- 21833

Query: 341   SFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTG----APGAPMDLQCHDANR 396
                                              D+DP+V       P AP   +  +   
Sbjct: 21834 ---------------------------------DSDPVVAQIQYTVPDAPGIPEPSNITG 21860

Query: 397   DYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQC-NDAPVKICKYPVTGLFEGRSYIF 455
             + + +TW  P +   S +  Y ++R E  +  WV+  +  P+   ++ VTGL EG  Y F
Sbjct: 21861 NSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEF 21920

Query: 456   RVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPT 515
              V A N+AG+   S +S  +   +P++                            PGPPT
Sbjct: 21921 HVMAENAAGVGPASGISRLIKCREPVN---------------------------PPGPPT 21953

Query: 516   GVHASEISRNYVVLSWEPPT-PRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFD 574
              V  ++ S+  V L W  P    G + + Y IE      G W +VNA+  V++ RY V D
Sbjct: 21954 VVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKT-RYTVTD 22012

Query: 575   LMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPS----------------APGRV 618
             L  G+ Y FRV + N  G  +  E+T  I+A D    P                 A  R+
Sbjct: 22013 LQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRL 22072

Query: 619   LASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGE 678
               +   + +    W +P     L           T   E CN    G     V   +  +
Sbjct: 22073 FIAYQGRPTPTAVWSKPDSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSK 22132

Query: 679   QYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSG 738
                F VK                      L  P  P  IT  +    S TL W  P   G
Sbjct: 22133 SITFTVKV---------------------LDTPGPPGPITFKDVTRGSATLMWDAPLLDG 22171

Query: 739   GSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSD 798
             G+ I  Y ++KRE   ++W  ++   ++  I  V+ L EG  Y F+++AVN  G+GEP +
Sbjct: 22172 GARIHHYVVEKREASRRSWQVISEKCTRQ-IFKVNDLAEGVPYYFRVSAVNEYGVGEPYE 22230

Query: 799   PSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGE 858
               E          +P P   L   +   +S V+ W  P + G S ++GY ++ R++ +  
Sbjct: 22231 MPEPIVATE----QPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDF 22286

Query: 859   WITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISA 918
             W+    T        V  L +   Y FRV+A N  G  +P +    V+++      +I  
Sbjct: 22287 WVEAGHTKQLT--FTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKE----PQIEP 22340

Query: 919   GVDEQGNIYLGFDCQEMTD-----------ASQFTWCKSYEEISDDERFKIETVGDHSKL 967
               D  G       C+  +            A + TW      + + +R  I T  D + L
Sbjct: 22341 TADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTL 22400

Query: 968   YLKNPDKEDLGTYSVSVSDTDGVSS 992
              +K+  + D G Y +++ +T GV +
Sbjct: 22401 TVKDSMRGDSGRYFLTLENTAGVKT 22425



 Score =  206 bits (523), Expect = 2e-52
 Identities = 163/604 (26%), Positives = 252/604 (41%), Gaps = 58/604 (9%)

Query: 311   QPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFL 370
             +P+  W++D+  + E   T +       +L      + D G Y   +V          F 
Sbjct: 10542 KPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYC--VVVENSTGSRKGFC 10599

Query: 371   FVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWV 430
              V   D    G P  P+     +  +DY++++WKPP     S +  Y +++ EVG + W+
Sbjct: 10600 QVNVVDR--PGPPVGPVSFD--EVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWM 10655

Query: 431   QCNDAPVKI-CKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAV 489
                 A  K  CK  V+ L EG+ YIFR+ A N  GIS P  VSD++ A D          
Sbjct: 10656 PVTSASAKTTCK--VSKLLEGKDYIFRIHAENLYGISDPL-VSDSMKAKDRF-------- 10704

Query: 490   HLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKS 549
                                +VP  P     +E++++  +++W  P   GK    Y +EK 
Sbjct: 10705 -------------------RVPDAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKR 10745

Query: 550   VVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVT 609
                S  W RV         ++ V DL+EG  Y FRV + N  G+ +PS  + P+ A+D  
Sbjct: 10746 ETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPI 10805

Query: 610   VVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKP--IG 665
               PS P    A   T  SV + W  P+H+    +LGY V+    G   W   NH P    
Sbjct: 10806 AKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCP 10865

Query: 666   YNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGH 725
               ++ V GL  G+ Y FRV AVNA G S+ +   + + V+  L  P       +      
Sbjct: 10866 ETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHI 10925

Query: 726   SMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKI 785
              +    ++     G P       K +               PT   +D    GS  E + 
Sbjct: 10926 KVGDTLRLSAIIKGVPFPKVTWKKED------------RDAPTKARIDVTPVGSKLEIRN 10973

Query: 786   AAVNLAGI----GEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGS 841
             AA    GI     E    S+    +   + +PGP  DL   E+R  S  + WK P+  G 
Sbjct: 10974 AAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGG 11033

Query: 842   SPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDT 901
             S ++ Y V+ R+  + +W  ++ T+    +     L +G  Y+FRV A N  G G   +T
Sbjct: 11034 SVITNYVVERRDVASAQWSPLSATSKKKSHF-AKHLNEGNQYLFRVAAENQYGRGPFVET 11092

Query: 902   SEPV 905
              +P+
Sbjct: 11093 PKPI 11096



 Score =  204 bits (520), Expect = 4e-52
 Identities = 208/851 (24%), Positives = 344/851 (40%), Gaps = 108/851 (12%)

Query: 171   VKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLE------INRADFDDT 224
             +++   ++G PTP   W  DG    +A + G + I  +  + T E      I       T
Sbjct: 9523  IRIPAVIKGRPTPKSSWEFDGKAK-KAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHT 9581

Query: 225   ATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKF 284
               YS  A N  GQ + N  V V    G  +  +   +  G                    
Sbjct: 9582  GKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRG-------------------- 9621

Query: 285   GVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSH 344
                      +  L   M   PD         +  +   +    WTK+    G  +     
Sbjct: 9622  ---------SCRLSWKM---PDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPD 9669

Query: 345   LHKDDEGLYTLRIVSRGGVSDHSAFLFVRDA-DPLVTGAPGAPMDLQCHDANRDYVIVTW 403
             L  + +  + +R  +R G+      +    A DP+    P  P+ L+     ++ V ++W
Sbjct: 9670  LLSEQQYFFRVRAENRFGIGPPVETIQRTTARDPIYP--PDPPIKLKIGLITKNTVHLSW 9727

Query: 404   KPPNTTTESPVMGYFVDRCE---VGTNN--WVQCNDAPVKICKYPVTGLFEGRSYIFRVR 458
             KPP     SPV  Y V+       GT    W QCN   V+  ++ V  L EG  Y FRV+
Sbjct: 9728  KPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVK 9787

Query: 459   AVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGD--AQVPGPPTG 516
             AVN+AG+S+PS      A + P D +R         KE    ++    +  A++ G P  
Sbjct: 9788  AVNAAGVSKPS------ATVGPCDCQRPDMPPSIDLKEFMEVEEGTNVNIVAKIKGVP-- 9839

Query: 517   VHASEISRNYVVLSW---EPPTPRGKDPLMY--FIEKSVVGSGSWQRVNAQTAVRSPRYA 571
                      +  L+W    P  P  K+P++Y   + K VV       +       +  Y 
Sbjct: 9840  ---------FPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYT 9890

Query: 572   VFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQ 631
             +   +       + +  N   L  P     PI+ + V+                  + + 
Sbjct: 9891  I-TAVNNLGTASKEMRLNV--LGRPGPPVGPIKFESVSA---------------DQMTLS 9932

Query: 632   WDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNA 689
             W  PK +    +  Y ++   A    W   + +P     + +  L  G +Y+FR+ A N 
Sbjct: 9933  WFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECT-YTIPKLLEGHEYVFRIMAQNK 9991

Query: 690   VGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDK 749
              G+ E   +S+    +   +VP  P   T+ +   +SMT+ W+ P++ GGSP+ GY+L+ 
Sbjct: 9992  YGIGE-PLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEM 10050

Query: 750   REVHHKNWHEVNSSPSKPTIL----TVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
             ++   K W  VN  P K   L     V GL EGS Y+F++ A+N AG+G  S PS+    
Sbjct: 10051 KDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATA 10110

Query: 806   EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQT 865
                  P PGP +     +   +S  + W  P+  G S V+GY V+++EE   EW      
Sbjct: 10111 RDPIAP-PGPPFP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDK 10168

Query: 866   TTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEAR--PGTKEISAGVDEQ 923
                   L V+ L++G  Y FRVRAVN  G+G+P + ++ + ++ R      ++ A V ++
Sbjct: 10169 EVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDR 10228

Query: 924   GNIYLGFDCQEMTDAS-----QFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLG 978
               ++ G   + +   S       TW  +  E +  +   IET    S + +KN  +   G
Sbjct: 10229 IVVHAGGVIRIIAYVSGKPPPTVTW--NMNERTLPQEATIETTAISSSMVIKNCQRSHQG 10286

Query: 979   TYSVSVSDTDG 989
              YS+   +  G
Sbjct: 10287 VYSLLAKNEAG 10297



 Score =  203 bits (516), Expect = 1e-51
 Identities = 211/854 (24%), Positives = 339/854 (39%), Gaps = 152/854 (17%)

Query: 177   VQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFD-----------DTA 225
             V G P P ++W KDG  +               G   LEI  ADF            D+ 
Sbjct: 15180 VSGRPPPTMEWSKDGKEL--------------EGTAKLEIKIADFSTNLVNKDSTRRDSG 15225

Query: 226   TYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFG 285
              Y+  ATN  G       V V    G  E           PL+                 
Sbjct: 15226 AYTLTATNPGGFAKHIFNVKVLDRPGPPEG----------PLA----------------- 15258

Query: 286   VTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESK---WTKMFFGEGQASLSF 342
             VT     E  + KC +   P L     + + Y   V  +E+    WT +        L  
Sbjct: 15259 VT-----EVTSEKCVLSWFPPLDDGGAKIDHYI--VQKRETSRLAWTNVASEVQVTKLKV 15311

Query: 343   SHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVT 402
             + L K +E ++ +  V++ GV +      V   +P   G P  P + +     +D ++V 
Sbjct: 15312 TKLLKGNEYIFRVMAVNKYGVGEPLESEPVLAVNPY--GPPDPPKNPEVTTITKDSMVVC 15369

Query: 403   WKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNS 462
             W  P++   S ++ Y V+R +     W++CN   +   +Y V+GL EG  Y FR+ A N+
Sbjct: 15370 WGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENA 15429

Query: 463   AGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEI 522
             AGIS PS  S    A D                   +++         PGPP      + 
Sbjct: 15430 AGISAPSPTSPFYKACD------------------TVFK---------PGPPGNPRVLDT 15462

Query: 523   SRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSY 581
             SR+ + ++W  P   G   +  Y +E ++     WQ V     +++  Y +  L E + Y
Sbjct: 15463 SRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEY 15522

Query: 582   VFRVLSANRHGLSEPSEITSPIQAQD----------------VTVVPSAPGRVLASRNTK 625
               R+ + N  GL EP+ +    +A+D                VT+      R+      +
Sbjct: 15523 KIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGR 15582

Query: 626   TSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVK 685
              +  V+W R  H E L    ++   + T L           NRF         +YI  V+
Sbjct: 15583 PAPEVKWARD-HGESLDKASIESTSSYTLLIVG------NVNRF------DSGKYILTVE 15629

Query: 686   AVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGY 745
                    + +  +S  + V+  L  P  P  + +      S+TL W  P   GGS I  Y
Sbjct: 15630 -------NSSGSKSAFVNVRV-LDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNY 15681

Query: 746   YLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
              ++KRE   K +  V ++  K T   VD L EG  Y F++ A N  GIG P++ +E  K 
Sbjct: 15682 IVEKRESTRKAYSTVATNCHK-TSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKA 15740

Query: 806   EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQT 865
                 +P PG    +T  +V   S+ + W+ P + G S + GY V+ + + + +W T    
Sbjct: 15741 SERPLP-PGK---ITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATC--A 15794

Query: 866   TTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARP---------GTKEI 916
             T       ++ L QG+ Y FRV A N  G+  P   S PV+ +             T  +
Sbjct: 15795 TVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTV 15854

Query: 917   SAGVDEQGNI-YLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKE 975
              AG D + ++ ++G            TW K    +    R   E+  ++S L +K+  +E
Sbjct: 15855 LAGEDLKVDVPFIG------RPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACRE 15908

Query: 976   DLGTYSVSVSDTDG 989
             D+G Y V ++++ G
Sbjct: 15909 DVGHYVVKLTNSAG 15922



 Score =  200 bits (508), Expect = 1e-50
 Identities = 212/862 (24%), Positives = 330/862 (38%), Gaps = 118/862 (13%)

Query: 165   VWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVH----TLEINRAD 220
             V E  +V +   ++G P P + W+K         EP  Y    N  V     TL I ++ 
Sbjct: 9823  VEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSR 9882

Query: 221   FDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQF 280
               DT  Y+  A N  G  S    + V             G P+G P+        F+   
Sbjct: 9883  RSDTGLYTITAVNNLGTASKEMRLNV---------LGRPGPPVG-PIK-------FESVS 9925

Query: 281   LEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASL 340
              ++  +++    +    K T  V    KR   R  W       KE  +T     EG    
Sbjct: 9926  ADQMTLSWFPPKDDGGSKITNYVIE--KREANRKTWVHVSSEPKECTYTIPKLLEGHE-- 9981

Query: 341   SFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVI 400
                         Y  RI+++             +    +   PGAP         R+ + 
Sbjct: 9982  ------------YVFRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMT 10029

Query: 401   VTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKIC----KYPVTGLFEGRSYIFR 456
             V W+ P     SPV GY+++  +  +  W + N  P+K       Y VTGL EG  Y FR
Sbjct: 10030 VNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFR 10089

Query: 457   VRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTG 516
             V A+N+AG+   S  SD   A DP+                             PGPP  
Sbjct: 10090 VYAINAAGVGPASLPSDPATARDPI---------------------------APPGPPFP 10122

Query: 517   VHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDL 575
                ++ +++   L W PP   G   +  Y +E    G   W++      VR  +  V  L
Sbjct: 10123 -KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEK-GKDKEVRGTKLVVTGL 10180

Query: 576   MEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPS--------------APG--RVL 619
              EG  Y FRV + N  G+ EP E+T  I+ +D  V P               A G  R++
Sbjct: 10181 KEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRII 10240

Query: 620   ASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQ 679
             A  + K    V W+  +             ++ + + + C                   Q
Sbjct: 10241 AYVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVIKNCQRS---------------HQ 10285

Query: 680   YIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGG 739
              ++ + A N  G  + +   DV+ V   +  P   + +T  +C      L W  P+  GG
Sbjct: 10286 GVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCK-----LTWFSPEDDGG 10340

Query: 740   SPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDP 799
             SPI  Y ++KRE   + W  V  + ++    TV GL +G  Y F+IAA N  G+G   + 
Sbjct: 10341 SPITNYVIEKRESDRRAWTPVTYTVTRQNA-TVQGLIQGKAYFFRIAAENSIGMGPFVET 10399

Query: 800   SEHFKC-EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGE 858
             SE     E  T+PE     DL   EV   ++ + W  P Y G S +  Y ++ R     +
Sbjct: 10400 SEALVIREPITVPERPE--DLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEK 10457

Query: 859   WITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISA 918
             +  V      +R   V  L++G TY +RV AVN  G GKPS  ++P+  +       +  
Sbjct: 10458 FHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHL 10517

Query: 919   GVDEQGNIYLGFDCQEMTDA------SQFTWCKSYEEISDDERFKIETVGDHSKLYLKNP 972
                ++  I +G +   +T         + +W K   ++ +D+R  I+T      L     
Sbjct: 10518 DFRDKLTIRVG-EAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKA 10576

Query: 973   DKEDLGTYSVSVSDTDGVSSSF 994
              + D G Y V V ++ G    F
Sbjct: 10577 KRSDSGKYCVVVENSTGSRKGF 10598



 Score =  199 bits (506), Expect = 2e-50
 Identities = 202/839 (24%), Positives = 329/839 (39%), Gaps = 101/839 (12%)

Query: 170   SVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSA 229
             +V+    ++G P P  +W  DGS I        Y +E++     L I      DT  Y  
Sbjct: 11222 TVRFPAIIRGVPVPTAKWTTDGSEI---KTDEHYTVETDNFSSVLTIKNCLRRDTGEYQI 11278

Query: 230   VATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFR 289
               +NA G  +    + V    G          P G       P    DV           
Sbjct: 11279 TVSNAAGSKTVAVHLTVLDVPGP---------PTG-------PINILDVT---------- 11312

Query: 290   REGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDD 349
              E  T++ +      P      P   +  +    ++  W  +  G  +  L   HL K  
Sbjct: 11313 PEHMTISWQ-----PPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGC 11367

Query: 350   EGLYTLRIVSRGGVSDHSAFLFVRDADPLVT----GAPGAPMDLQCHDANRDYVIVTWKP 405
             E ++ +R  ++ GV          D+ P V       P  P      D   +   V+W  
Sbjct: 11368 EYVFRVRAENKIGVGPPL------DSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTL 11421

Query: 406   PNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGI 465
             P +   SP+ GY+++R EV T  WV+ N  P+   K+ VTGL+EG +Y FRV A N AG+
Sbjct: 11422 PKSDGGSPITGYYMERREV-TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGL 11480

Query: 466   SRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRN 525
             S+PS  SD + A  P+                           + PGPP      + SR 
Sbjct: 11481 SKPSPSSDPIKACRPI---------------------------KPPGPPINPKLKDKSRE 11513

Query: 526   YVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFR 584
                L W  P   G  P++ Y +E    G+  W R+N    +R   + V  L+EG  Y FR
Sbjct: 11514 TADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFR 11573

Query: 585   VLSANRHGLSEPSEITSPIQAQDVTVVPSAP-----GRVLASRNTKTSVVVQWDRPKHEE 639
             + +AN  G  EP E+   + A+D+   P          V+  R  +T  ++   + + E 
Sbjct: 11574 IKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEP 11633

Query: 640   DLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQES 699
             D+        +      +     P    +          +YI     ++A   S ++Q S
Sbjct: 11634 DITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYI-----ISAKNSSGHAQGS 11688

Query: 700   DVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHE 759
              ++ V   L  P     + + N    + T+ W+ P  +GGS I  + ++ R+ + K W  
Sbjct: 11689 AIVNV---LDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSI 11745

Query: 760   VNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDL 819
             V S  +K  I     L   + Y F++ A N  G+G P+  ++        +  PG   +L
Sbjct: 11746 VASDVTKRLIKA--NLLANNEYYFRVCAENKVGVG-PTIETKTPILAINPIDRPGEPENL 11802

Query: 820   TFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQ 879
                +   T + + W+ P Y G SP   Y V+ R + + +W  V++ +    +  V    +
Sbjct: 11803 HIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVE 11862

Query: 880   GKTYVFRVRAVNANG---------VGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGF 930
              + Y FRV+  N  G         V    D  +PVL     G   + AG  +   +  G 
Sbjct: 11863 NQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAG--DTIRLEAGV 11920

Query: 931   DCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
               +   + + +T  K   +++   R KI+T  D SK  L    + D G Y V+ ++T G
Sbjct: 11921 RGKPFPEVA-WTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAG 11978



 Score =  198 bits (503), Expect = 4e-50
 Identities = 178/670 (26%), Positives = 280/670 (41%), Gaps = 68/670 (10%)

Query: 254   EPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPR 313
             EP  S G PI +      P    DV+F +   V   + GE + +   +   P      P 
Sbjct: 19465 EPSESTG-PIIVKDDVEPPRVMMDVKFRDVIVV---KAGEVLKINADIAGRP-----LPV 19515

Query: 314   AEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVR 373
               W +D + ++E   T++   +    L+     + D G Y L + +  G    +    V 
Sbjct: 19516 ISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVL 19575

Query: 374   DADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCN 433
             D      G P  P+++    A +    ++W  P     + +  Y V++ E     W  C 
Sbjct: 19576 DK----PGPPAGPLEINGLTAEK--CSLSWGRPQEDGGADIDYYIVEKRETSHLAWTIC- 19628

Query: 434   DAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEG 493
             +  +++    VT L +G  YIFRV  VN  G+  P   S A+ ALDP             
Sbjct: 19629 EGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLE-SVAIKALDPF------------ 19675

Query: 494   EKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVG 552
                             VP PPT +  + +++  + L W  P   G   +  Y IE+    
Sbjct: 19676 ---------------TVPSPPTSLEITSVTKESMTLCWSRPESDGGSEISGYIIERREKN 19720

Query: 553   SGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVP 612
             S  W RVN +  V   R     L EG  Y +RV + N  GLS PSE +  I+A+D   +P
Sbjct: 19721 SLRWVRVN-KKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLP 19779

Query: 613   SAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFV 670
             S P +     + KT++ + W +P  +    + GY V+   +    W+       G   + 
Sbjct: 19780 SPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTSIQSLRG-TEYT 19838

Query: 671   VHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVP----SHPYGITLLNCDGHS 726
             + GLTTG +Y+FRVK+VN VG S+ S  SD    +     P          TL+   G S
Sbjct: 19839 ISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGAS 19898

Query: 727   MTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIA 786
              T+   VP    G P+      K +   +    V+++ S+ T LT++        ++ + 
Sbjct: 19899 FTM--TVP--FRGRPVPNVLWSKPDTDLRTRAYVDTTDSR-TSLTIENANRNDSGKYTLT 19953

Query: 787   AVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSG 846
               N+         +         +  PGP  ++T  +V   S V+ W  P   G +PV  
Sbjct: 19954 IQNVLS-------AASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKN 20006

Query: 847   YFVDFREEDAGEWITVNQTTTANRY-LKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPV 905
             Y ++ RE     W++V  T   NR   KV++LQ+G  Y FRV   N  GVG P++T E V
Sbjct: 20007 YHIEKREASKKAWVSV--TNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGV 20064

Query: 906   LVEARPGTKE 915
              +  +P   E
Sbjct: 20065 KITEKPSPPE 20074



 Score =  196 bits (497), Expect = 2e-49
 Identities = 206/843 (24%), Positives = 341/843 (40%), Gaps = 125/843 (14%)

Query: 170   SVKLCFTVQGFPTPVVQWYKD------GSLICQAAEPGKYRIESNYGVHTLEINRADFDD 223
             SVKL   + G P P ++WYKD       +L+C         +E+   + ++ I  AD  +
Sbjct: 20584 SVKLRAGISGKPAPTIEWYKDDKELQTNALVC---------VENTTDLASILIKDADRLN 20634

Query: 224   TATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEK 283
             +  Y     NA G  S    V +    G          P G P+        F     EK
Sbjct: 20635 SGCYELKLRNAMGSASATIRVQILDKPG----------PPGGPIE-------FKTVTAEK 20677

Query: 284   FGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFS 343
               + +R   +    K T  +    KR   R  W      L+E              ++ +
Sbjct: 20678 ITLLWRPPADDGGAKITHYIVE--KRETSRVVWSMVSEHLEE------------CIITTT 20723

Query: 344   HLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVT-GAPGAPMDLQCHDANRDYVIVT 402
              + K +E ++ +R V++ G+ +      V   +  VT G PG P   +     ++ + V 
Sbjct: 20724 KIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIP---EVTKITKNSMTVV 20780

Query: 403   WKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNS 462
             W  P     S + GYF+++ +  +  W +     ++  +  VTGL E   Y +RV AVN+
Sbjct: 20781 WSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNA 20840

Query: 463   AGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEI 522
             AG    S  S+   A DP+D                            PGPP  +  ++ 
Sbjct: 20841 AGQGPFSEPSEFYKAADPID---------------------------PPGPPAKIRIADS 20873

Query: 523   SRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSY 581
             +++ + L W  P   G   +  Y +E        W  V+ +  VR+  Y V +L  G +Y
Sbjct: 20874 TKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNY 20933

Query: 582   VFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAP------GRVLASRNTKTSVVVQWD-R 634
              FRV + N  G  EP E+  P+QA+D+   P           V+A       V++ +  R
Sbjct: 20934 YFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGR 20993

Query: 635   P------KHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVN 688
             P      + +E  LG      +  T+         +  N        TG+ YI  ++  N
Sbjct: 20994 PPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRN-------DTGK-YILTIE--N 21043

Query: 689   AVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLD 748
              VG  ++S  S  +KV   L  P+    + + +    ++TL W  P   GGSPI+ Y ++
Sbjct: 21044 GVGEPKSSTVS--VKV---LDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIE 21098

Query: 749   KREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAW 808
             KR+   + W  V+   S  +   +D L+E + + F++ A N  GIGEP + +E  K    
Sbjct: 21099 KRDATKRTWSVVSHKCSSTSFKLID-LSEKTPFFFRVLAENEIGIGEPCETTEPVKAAE- 21156

Query: 809   TMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTA 868
                 P P  DL+  +   TS+++ W  P + G S ++ Y V+ + +    W     + T 
Sbjct: 21157 ---VPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGISKTC 21213

Query: 869   NRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISAGVDEQG---- 924
                ++VS L++     FRV A N  G+  P  T  P+ V+    T E+    D  G    
Sbjct: 21214 E--IEVSQLKEQSVLEFRVFAKNEKGLSDPV-TIGPITVKELIITPEVDLS-DIPGAQVT 21269

Query: 925   -----NIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGT 979
                  N++L    +     S  +W K    + + E  +     +   L +KN  KE  G 
Sbjct: 21270 VRIGHNVHLELPYKGKPKPS-ISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGK 21328

Query: 980   YSV 982
             Y+V
Sbjct: 21329 YTV 21331



 Score =  194 bits (493), Expect = 5e-49
 Identities = 199/802 (24%), Positives = 323/802 (40%), Gaps = 126/802 (15%)

Query: 302   LVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRG 361
             L  P   R  P  +W + D  ++++    +       SL   ++++ D G YTL + +  
Sbjct: 16657 LFVPIKGRPTPEVKWGKVDGEIRDAAIIDVT--SSFTSLVLDNVNRYDSGKYTLTLENSS 16714

Query: 362   GVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDR 421
             G    SAF+ VR  D      P  P++L+  +  +D V +TW+PP     S +  Y V++
Sbjct: 16715 GTK--SAFVTVRVLD-----TPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEK 16767

Query: 422   CEVGTNNWVQCNDAPVKIC---KYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAAL 478
              E    ++     A V  C    + +  L EG SY FRV A N  GI  P++ +D +   
Sbjct: 16768 REATRKSYA----AVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKV- 16822

Query: 479   DPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRG 538
                                          A+VP PP  +   +++RN V LSW  P   G
Sbjct: 16823 -----------------------------AEVPQPPGKITVDDVTRNSVSLSWTKPEHDG 16853

Query: 539   KDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPS 597
                ++ Y +E     S  W        V+S +  + +L +G+ Y+FRV++ N  G S+P 
Sbjct: 16854 GSKIIQYIVEMQAKHSEKWSEC---ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPR 16910

Query: 598   EITSPIQAQDVTVVPS-----APGRVLASRNTKTSVVVQWDRPKHE----------EDLL 642
              +  PI A+D+ + P      +   V   ++ K  V +   RPK            +   
Sbjct: 16911 SLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPIS-GRPKPTITWTKDGLPLKQTT 16969

Query: 643   GYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVI 702
                V   +  T L     HK              G QY   +   N VG    S E    
Sbjct: 16970 RINVTDSLDLTTLSIKETHK------------DDGGQY--GITVANVVGQKTASIEI--- 17012

Query: 703   KVQAALTVPSHPYG-ITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVN 761
                  L  P  P G +   +    S+TL W  P ++GG  I  Y + KR+     W  V+
Sbjct: 17013 ---VTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVS 17069

Query: 762   SSPSKPTILTVDGLTEGSLYEFKIAAVNLAG--IGEPSDPSEHFKCEAWTMPEPGPAYDL 819
             ++ ++ T L V  L  G+ Y+F+I A N  G      SDP        +   EPGP    
Sbjct: 17070 ATVAR-TTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPI----VAQYPYKEPGPPGTP 17124

Query: 820   TFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQ 879
                 +   S+V+ W  PV +G SPV GY ++ +E ++  W  VN+T   +   K  +L++
Sbjct: 17125 FATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEE 17184

Query: 880   GKTYVFRVRAVNANGVGK---------------PSDTSEPVLVEARPGTKEISAGVDEQG 924
             G  Y FRV A N  GVGK               P  T EP++V+    T + +  V + G
Sbjct: 17185 GIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEPIMVKRNEITLQWTKPVYDGG 17244

Query: 925   NIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSV 984
             ++  G+   E  D     W K+      + +F +  + +  +   +   K   G  S   
Sbjct: 17245 SMITGY-IVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPS 17303

Query: 985   SDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAE-HLSP 1043
               T  +++                +E++ P I +  +    I       F L+A+ H  P
Sbjct: 17304 DSTGPITA---------------KDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKP 17348

Query: 1044  DASYRFIINDREVSDSEIHRIK 1065
               +  ++  D+E+ +S    IK
Sbjct: 17349 LPTIEWLRGDKEIEESARCEIK 17370



 Score =  193 bits (490), Expect = 1e-48
 Identities = 206/864 (23%), Positives = 336/864 (38%), Gaps = 147/864 (17%)

Query: 171   VKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAV 230
             +K+   + G P PV+ W KDG    +  E  +  I S      L +      DT  Y   
Sbjct: 19502 LKINADIAGRPLPVISWAKDG---IEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLT 19558

Query: 231   ATNAHG--QVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTF 288
               N  G   V+ N  V+       ++P    G P G                LE  G+T 
Sbjct: 19559 LKNVAGTRSVAVNCKVL-------DKP----GPPAGP---------------LEINGLTA 19592

Query: 289   RREGETVTLKCTMLVTPDLKRVQPRAEWYRD-DVLLKESK------WTKMFFGEGQ-ASL 340
                      KC+      L   +P+ +   D D  + E +      WT +  GE Q  S 
Sbjct: 19593 E--------KCS------LSWGRPQEDGGADIDYYIVEKRETSHLAWT-ICEGELQMTSC 19637

Query: 341   SFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVI 400
               + L K +E ++ +  V++ GV +    + ++  DP    +P  P  L+     ++ + 
Sbjct: 19638 KVTKLLKGNEYIFRVTGVNKYGVGEPLESVAIKALDPFTVPSP--PTSLEITSVTKESMT 19695

Query: 401   VTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAV 460
             + W  P +   S + GY ++R E  +  WV+ N  PV   +   TGL EG  Y +RV A 
Sbjct: 19696 LCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAE 19755

Query: 461   NSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHAS 520
             N+AG+S PS  S  + A DP+ L                           P PP+     
Sbjct: 19756 NAAGLSLPSETSPLIRAEDPVFL---------------------------PSPPSKPKIV 19788

Query: 521   EISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGK 579
             +  +  + ++W  P   G  P+  Y +E        W+   +  ++R   Y +  L  G 
Sbjct: 19789 DSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWK--TSIQSLRGTEYTISGLTTGA 19846

Query: 580   SYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV---------- 629
              YVFRV S N+ G S+PS+ + P  A++    P      + S   KT +V          
Sbjct: 19847 EYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFD---IDSEMRKTLIVKAGASFTMTV 19903

Query: 630   ---------VQWDRPKHEEDL-LGYYVDCCVAGTNLW-EPCNHKPIGYNRFVVHGLTTGE 678
                      V W +P  + DL    YVD   + T+L  E  N    G     +  + +  
Sbjct: 19904 PFRGRPVPNVLWSKP--DTDLRTRAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAA 19961

Query: 679   QYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSG 738
                  VK                      L  P  P  IT+ +    S  L W VP+  G
Sbjct: 19962 SLTLVVK---------------------VLDTPGPPTNITVQDVTKESAVLSWDVPENDG 20000

Query: 739   GSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSD 798
             G+P+  Y+++KRE   K W  V ++ ++ +   V  L EG++Y F+++  N  G+G P++
Sbjct: 20001 GAPVKNYHIEKREASKKAWVSVTNNCNRLS-YKVTNLQEGAIYYFRVSGENEFGVGIPAE 20059

Query: 799   PSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGE 858
               E  K       +P P   L    +   S+ + W  P + G S +  Y V+  E+    
Sbjct: 20060 TKEGVK----ITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKN 20115

Query: 859   WITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISA 918
             W  V      + +  VS L++   Y FRV A N  G+  P +   PVL++ +    EI  
Sbjct: 20116 W--VKCAVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDM 20173

Query: 919   GVDEQGNIYLGFDCQEMTD-------ASQFTWCKSYEEISDDERFKIETVGDHSKLYLKN 971
                    +Y+        D         + T  +    +    RF  E   ++  + LK 
Sbjct: 20174 KNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKE 20233

Query: 972   PDKEDLGTYSVSVSDTDGVSSSFV 995
                 D G Y ++ +++ G + +F+
Sbjct: 20234 SVTADAGRYEITAANSSGTTKAFI 20257



 Score =  192 bits (489), Expect = 2e-48
 Identities = 159/642 (24%), Positives = 274/642 (42%), Gaps = 79/642 (12%)

Query: 379   VTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVK 438
             +T  P  P  L     ++D V +TW  P     S ++ Y V+  E G  NWV+C  A  K
Sbjct: 20066 ITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKC--AVAK 20123

Query: 439   ICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIA 498
                + V+GL E   Y FRV A N AG+S P  +   V   + L+   +   +        
Sbjct: 20124 STHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYV 20183

Query: 499   IYQDDLEGDAQVPGPPTGVHASEISRNYVVL--SWEPPTPRGKDPLMYFIEKSVVGSGSW 556
                 +L+ D  + G P  +    +SR+ V L  +    T    + L   +++SV      
Sbjct: 20184 RAGSNLKVDIPISGKP--LPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGR 20241

Query: 557   QRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPG 616
               + A  +  +           K+++  V+      L  P   T P+   D+T       
Sbjct: 20242 YEITAANSSGTT----------KAFINIVV------LDRPGPPTGPVVISDIT------- 20278

Query: 617   RVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGL 674
                     + SV ++W+ PK++    +  Y +      T +W   +   +      V  L
Sbjct: 20279 --------EESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVS-ATVARTMMKVMKL 20329

Query: 675   TTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVP 734
             TTGE+Y FR+KA N  G+S++  +S  + V+   T P  P    + N    S+T+GW  P
Sbjct: 20330 TTGEEYQFRIKAENRFGISDHI-DSACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEP 20388

Query: 735   KFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIG 794
               +GGS ++GY+L+ ++ +   W + N    + T   V  ++ G +YEF++ A N AG+G
Sbjct: 20389 VSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVG 20448

Query: 795   EPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREE 854
             +PS PSE        +    P  ++   ++   S+ + W+ P + G S ++GY V+ R+ 
Sbjct: 20449 KPSHPSE----PVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDL 20504

Query: 855   DAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANG-VGKPSDTSEPV-------- 905
               G W   + T        +S L Q   Y FRV A NA G +  PS+   P+        
Sbjct: 20505 PDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGG 20564

Query: 906   -----------LVEARPGTK-EISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDD 953
                        +V+ R GT  ++ AG+  +              A    W K  +E+  +
Sbjct: 20565 PVIDLPLEYTEVVKYRAGTSVKLRAGISGK-------------PAPTIEWYKDDKELQTN 20611

Query: 954   ERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
                 +E   D + + +K+ D+ + G Y + + +  G +S+ +
Sbjct: 20612 ALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATI 20653



 Score =  191 bits (485), Expect = 4e-48
 Identities = 214/857 (24%), Positives = 337/857 (39%), Gaps = 113/857 (13%)

Query: 177  VQGFPTPVVQWYKDGSLI---CQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATN 233
            V G P P ++W K+ ++I     A +  K  +  +     L I +A  +D  TY+  A+N
Sbjct: 9117 VTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASN 9176

Query: 234  AHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGE 293
              G V  N  V         E +     P  L ++        D++  E   +T+    +
Sbjct: 9177 RLGSVFRNVHV---------EVYDRPSPPRNLAVT--------DIK-AESCYLTWDAPLD 9218

Query: 294  TVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLY 353
                + T  V       + +AEW        E ++                L  + +  +
Sbjct: 9219 NGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKRY------------GIWKLIPNGQYEF 9266

Query: 354  TLRIVSRGGVSDHSAFLFVRDADPL-VTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTES 412
             +R V++ G+SD      V   DP  + G PG P  L      +  ++V+W PP     S
Sbjct: 9267 RVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLA---RTKGSMLVSWTPPLDNGGS 9323

Query: 413  PVMGYFVDRCEVGTNNWVQCNDAPV-----KICKYPVTGLFEGRSYIFRVRAVNSAGISR 467
            P+ GY++++ E G+  W + + AP+     K  ++ V  L EG  Y FR  A+N+AGI  
Sbjct: 9324 PITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGP 9383

Query: 468  PSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYV 527
            PS  SD   A DP+                             PGPP+     + +++ +
Sbjct: 9384 PSEPSDPEVAGDPIF---------------------------PPGPPSCPEVKDKTKSSI 9416

Query: 528  VLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNA-QTAVRSPRYAVFDLMEGKSYVFRV 585
             L W+PP   G  P+  Y +E    G+  W+RVN     + +    V +L E + Y FRV
Sbjct: 9417 SLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCECVVPNLKELRKYRFRV 9476

Query: 586  LSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLA---------SRNTKTSVVVQWDRPK 636
             + N  G SEPS+ T  I A D+   P     + A         S+    +V+     PK
Sbjct: 9477 KAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPK 9536

Query: 637  HEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVV-----HGLTTGEQYIFRVKAVNAVG 691
               +  G        G +            N  V+         TG+   + + A N  G
Sbjct: 9537 SSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHTGK---YSITAKNKAG 9593

Query: 692  MSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKRE 751
                 Q++   +V+  + VP  P  + + +    S  L WK+P   GG  I GY ++KR 
Sbjct: 9594 -----QKTANCRVKV-MDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRT 9647

Query: 752  VHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMP 811
            +  K W +VN      T +  D L+E   Y F++ A N  GIG P +  +         P
Sbjct: 9648 IDGKAWTKVNPDCGSTTFVVPDLLSE-QQYFFRVRAENRFGIGPPVETIQRTTARDPIYP 9706

Query: 812  EPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREED-----AGEWITVNQTT 866
             P P   L    +   ++ + WK P   G SPV+ Y V+    D        W   N+  
Sbjct: 9707 -PDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRD 9765

Query: 867  TANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEIS----AGVDE 922
                   V DL +G  Y FRV+AVNA GV KPS T  P   +       I       V+E
Sbjct: 9766 VEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQRPDMPPSIDLKEFMEVEE 9825

Query: 923  QGNIYLGFDCQEMTDASQFTWCK-------SYEEISDDERFKIETVGDHSKLYLKNPDKE 975
              N+ +    + +   +  TW K       + E +  D       V D   L +    + 
Sbjct: 9826 GTNVNIVAKIKGVPFPT-LTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRS 9884

Query: 976  DLGTYSVSVSDTDGVSS 992
            D G Y+++  +  G +S
Sbjct: 9885 DTGLYTITAVNNLGTAS 9901



 Score =  188 bits (478), Expect = 3e-47
 Identities = 179/740 (24%), Positives = 304/740 (41%), Gaps = 121/740 (16%)

Query: 185  VQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAV 244
            VQW ++  ++ Q     K+++ S   +H L+I      D   Y  +A +   +     A 
Sbjct: 6637 VQWLRNNMVVVQG---DKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAA 6693

Query: 245  VVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVT 304
              +    D++    + + +G PL+ ++PY  +                            
Sbjct: 6694 APKIKTADQD----LVVDVGKPLTMVVPYDAYP--------------------------- 6722

Query: 305  PDLKRVQPRAEWYRDDVLLKESKWTKMFFGEG-QASLSFSHLHKDDEGLYTLRIVSRGGV 363
                  +  AEW++++  L     TK       Q S       K D+G Y + + ++ G 
Sbjct: 6723 ------KAEAEWFKENEPLS----TKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGK 6772

Query: 364  SDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCE 423
            ++    L V D        PG   +L+  +     V + W+ P T   S ++GY V+R +
Sbjct: 6773 AEGFINLKVIDV-------PGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRD 6825

Query: 424  VGTNNWVQCNDAPVKICKYPVTGLFEGR-SYIFRVRAVNSAGISRPSRVSDAVAALDPLD 482
            +    WV   D   + C++ VTGL +G   Y+FRV A N  G   P    + V A    D
Sbjct: 6826 IKRKTWVLATDR-AESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYD 6884

Query: 483  LRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPT-PRGKDP 541
                                       VPGPP  V  ++++R  V L+WEPP    G + 
Sbjct: 6885 ---------------------------VPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEI 6917

Query: 542  LMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITS 601
              Y IE     S  W       A       V D++EG+ Y FRV + NR G+ +PS  T 
Sbjct: 6918 TNYVIELRDKTSIRWDTAMTVRA-EDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATP 6976

Query: 602  PIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPC 659
             ++  D    PS P  + +S  T++SV ++W+ P  +    +LGY ++ C  G + W  C
Sbjct: 6977 FVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRC 7036

Query: 660  NHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQ-----ESDVIKVQAALTVPSHP 714
            N K +    + V GL  G +Y++RV A N  G+S+ S+      +D   V+  + + +  
Sbjct: 7037 NMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFK 7096

Query: 715  YGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNS-SPSKPTILTVD 773
             G+ ++  +  ++     VP      P   +    + +   +  ++ + S     +++  
Sbjct: 7097 DGLEVIVPNPITIL----VPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPS 7152

Query: 774  GLTEGSLYEFKI--------AAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVR 825
              ++  +Y  K+          +++  I  PS P E                 L F ++ 
Sbjct: 7153 ERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKE-----------------LKFGDIT 7195

Query: 826  DTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVF 885
              S+ + W+ P   G SP++GY V+ RE     W  V    T   +  V DL QGK Y+F
Sbjct: 7196 KDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEF-TVPDLVQGKEYLF 7254

Query: 886  RVRAVNANGVGKPSDTSEPV 905
            +V A N  G G+P+   EPV
Sbjct: 7255 KVCARNKCGPGEPAYVDEPV 7274



 Score =  188 bits (477), Expect = 4e-47
 Identities = 145/509 (28%), Positives = 233/509 (45%), Gaps = 82/509 (16%)

Query: 371   FVRDADPLVTG----APGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGT 426
             FV  ++ LV       P  P DL+  +  ++ V +TW PP     S ++ Y ++   +GT
Sbjct: 10396 FVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGT 10455

Query: 427   NNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAG------ISRPSRVSDAVAA--- 477
               + +  +  +   KY V GL EG +Y +RV AVN  G       ++P    D +A    
Sbjct: 10456 EKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTL 10515

Query: 478   ----LDPLDLRRLQAVHLEG-------------EKEIAIYQDDL---------------- 504
                  D L +R  +A  L G             + E  + +DD                 
Sbjct: 10516 HLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIK 10575

Query: 505   --------------------EGDAQV-----PGPPTG-VHASEISRNYVVLSWEPPTPRG 538
                                 +G  QV     PGPP G V   E++++Y+V+SW+PP   G
Sbjct: 10576 AKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLDDG 10635

Query: 539   KDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPS 597
                +  Y IEK  VG   W  V + +A  + +  V  L+EGK Y+FR+ + N +G+S+P 
Sbjct: 10636 GSKITNYIIEKKEVGKDVWMPVTSASAKTTCK--VSKLLEGKDYIFRIHAENLYGISDPL 10693

Query: 598   EITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNL 655
              ++  ++A+D   VP AP + + +  TK S +V W++P H+  + +  Y ++     +  
Sbjct: 10694 -VSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKP-HDGGKPITNYILEKRETMSKR 10751

Query: 656   WEPCNHKPIG-YNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHP 714
             W      PI  Y +F V  L  G QY FRV A N +G+ + S  S  +  +  +  PS P
Sbjct: 10752 WARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPP 10811

Query: 715   YGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSK--PTILTV 772
                  ++   +S+ L W+ P+  GGS ILGY ++ ++V  + W   N +P     T   V
Sbjct: 10812 VNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKV 10871

Query: 773   DGLTEGSLYEFKIAAVNLAGIGEPSDPSE 801
              GL +G  Y+F++ AVN AG  +P+   E
Sbjct: 10872 TGLRDGQTYKFRVLAVNAAGESDPAHVPE 10900



 Score =  187 bits (476), Expect = 5e-47
 Identities = 190/783 (24%), Positives = 312/783 (39%), Gaps = 105/783 (13%)

Query: 154   PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
             P + +   +  V  R  +K+    +G P   V W KDG  +    E  +  + S+  V +
Sbjct: 19090 PSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTL---KETTRVNVSSSKTVTS 19146

Query: 214   LEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPY 273
             L I  A  +D  TY    +N+ G ++    ++V    G   P R   +       S  P 
Sbjct: 19147 LSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPPGPIRIDEVSCDSITISWNPP 19206

Query: 274   THFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFF 333
              +     +  + +  ++E  + T                               W  +  
Sbjct: 19207 EYDGGCQISNY-IVEKKETTSTT-------------------------------WHIVSQ 19234

Query: 334   GEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHD 393
                + S+    L    E  + +   +R G S +S    V    P     PG P   +   
Sbjct: 19235 AVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPF--SPPGPPGTPKVVH 19292

Query: 394   ANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSY 453
             A +  ++VTW+ P     S V+GY ++  E  +  W + N   +   +  V+GL EG  Y
Sbjct: 19293 ATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLMY 19352

Query: 454   IFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGP 513
              +RV A N AGI + S+  + V A DP D                              P
Sbjct: 19353 EYRVYAENIAGIGKCSKSCEPVPARDPCD------------------------------P 19382

Query: 514   PTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAV 572
             P     + I+R  V L W  P   G   +  Y +E+  +  G W + N  T ++   + V
Sbjct: 19383 PGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCN-YTNIQETYFEV 19441

Query: 573   FDLMEGKSYVFRVLSAN-RHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQ 631
              +L E + Y FRV + N    +SEPSE T PI  +D       P RV+     +  +VV+
Sbjct: 19442 TELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKD----DVEPPRVMMDVKFRDVIVVK 19497

Query: 632   -WDRPKHEEDLLGY---YVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGE--------Q 679
               +  K   D+ G     +     G  + E    + I  +    H L T +        Q
Sbjct: 19498 AGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDN---HTLLTVKDCIRRDTGQ 19554

Query: 680   YIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGG 739
             Y+  +K  N  G    +    V+        P    G+T   C     +L W  P+  GG
Sbjct: 19555 YVLTLK--NVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKC-----SLSWGRPQEDGG 19607

Query: 740   SPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDP 799
             + I  Y ++KRE  H  W  +     + T   V  L +G+ Y F++  VN  G+GEP + 
Sbjct: 19608 ADIDYYIVEKRETSHLAW-TICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLES 19666

Query: 800   SEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEW 859
                   + +T+P P  + ++T   V   S+ + W  P   G S +SGY ++ RE+++  W
Sbjct: 19667 VAIKALDPFTVPSPPTSLEIT--SVTKESMTLCWSRPESDGGSEISGYIIERREKNSLRW 19724

Query: 860   ITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTS------EPVLVEARPGT 913
             + VN+    +  +K + L++G  Y +RV A NA G+  PS+TS      +PV + + P  
Sbjct: 19725 VRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSK 19784

Query: 914   KEI 916
              +I
Sbjct: 19785 PKI 19787



 Score =  187 bits (475), Expect = 6e-47
 Identities = 180/671 (26%), Positives = 294/671 (43%), Gaps = 73/671 (10%)

Query: 349   DEGL-YTLR-----IVSRGGVSDHSAFLFVRD-ADPLVTGAPGAPMDLQCHDANRDYVIV 401
             DEGL Y  +     IV  G  S  S     RD  DP     PG P  +      R+ V +
Sbjct: 18265 DEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDP-----PGRPEAIVI---TRNNVTL 18316

Query: 402   TWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVN 461
              WK P     S + GY V++ ++    W++ +   V   ++ V+GL E + Y FRV A N
Sbjct: 18317 KWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARN 18376

Query: 462   SAG-ISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDD---LEGDAQVPGPPTGV 517
             +AG  S PS  S A+ A D +D     ++  + +  I ++  +   LE D +    P  V
Sbjct: 18377 AAGNFSEPSDSSGAITARDEIDAPNA-SLDPKYKDVIVVHAGETFVLEADIRGKPIPDVV 18435

Query: 518   HASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLM- 576
              + +                GK+     +E++        R+  ++ ++     V D + 
Sbjct: 18436 WSKD----------------GKE-----LEETAA------RMEIKSTIQKTTLVVKDCIR 18468

Query: 577   -EGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRP 635
              +G  Y+ ++ +    G ++   IT  ++  D    P  P +V     T     + W+ P
Sbjct: 18469 TDGGQYILKLSNV---GGTKSIPIT--VKVLDRPGPPEGPLKVTGV--TAEKCYLAWNPP 18521

Query: 636   KHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMS 693
               +   ++  Y ++        W   + +    N + V  L  G +YIFRV AVN  G+ 
Sbjct: 18522 LQDGGANISHYIIEKRETSRLSWTQVSTEVQALN-YKVTKLLPGNEYIFRVMAVNKYGIG 18580

Query: 694   ENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVH 753
             E   ES  +        P  P    +      SM + W  P   GG+ I GY L+KR+  
Sbjct: 18581 E-PLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKE 18639

Query: 754   HKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFK-CEAWTMPE 812
                W + N        L V GLTEG  YEF++AA N AG+GEPS+PS  ++ C+A  +  
Sbjct: 18640 GVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDA--LYP 18697

Query: 813   PGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTT-TANRY 871
             PGP  +    +   +S+ + W  P+Y G +PV GY V+ +E  A EW T    T    + 
Sbjct: 18698 PGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQ 18757

Query: 872   LKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLG-- 929
               V+ L++   Y FR+ A+N+ GVG+P+     V+ + R    EI    D +  + L   
Sbjct: 18758 FTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRAS 18817

Query: 930   -----FDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSV 984
                  F   +     +  W K+   ++D  R +IE     + L + N  + D G Y++++
Sbjct: 18818 ATLRLFVTIKGRPEPEVKWEKAEGILTD--RAQIEVTSSFTMLVIDNVTRFDSGRYNLTL 18875

Query: 985   SDTDGVSSSFV 995
              +  G  ++FV
Sbjct: 18876 ENNSGSKTAFV 18886



 Score =  187 bits (474), Expect = 8e-47
 Identities = 169/652 (25%), Positives = 277/652 (42%), Gaps = 58/652 (8%)

Query: 357   IVSRGGVSDHSAFLFVRD-ADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVM 415
             IV  G  S  S     RD  DP     PG P   +     R+ V + WK P     S + 
Sbjct: 16115 IVGIGKPSKVSECYVARDPCDP-----PGRP---EAIIVTRNSVTLQWKKPTYDGGSKIT 16166

Query: 416   GYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGI-SRPSRVSDA 474
             GY V++ E+    W++ +   +    + VTGL E   Y FRV A N+AG+ S PS  + A
Sbjct: 16167 GYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGA 16226

Query: 475   VAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPP 534
             + A D +D  R+       +  +    +  + DA + G P              + W   
Sbjct: 16227 ITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPT-----------IQWI-- 16273

Query: 535   TPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLS 594
               +G   L       +  +     ++ + AVR         ++  +Y+ +  +     ++
Sbjct: 16274 --KGDQELSNTARLEIKSTDFATSLSVKDAVR---------VDSGNYILKAKN-----VA 16317

Query: 595   EPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAG 652
                 +T  ++  D    P  P  V+ S  T     + W  P  +   D++ Y V+     
Sbjct: 16318 GERSVTVNVKVLDRPGPPEGP--VVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETS 16375

Query: 653   TNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPS 712
               +W   +   +      V  L  G +Y FR+ AVN  G+ E   ES+ +  +    VP 
Sbjct: 16376 RLVWTVVDAN-VQTLSCKVTKLLEGNEYTFRIMAVNKYGVGE-PLESEPVVAKNPFVVPD 16433

Query: 713   HPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTV 772
              P    +      SM + W+ P   GGS ILGY L+KR+     W   +        L V
Sbjct: 16434 APKAPEVTTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRV 16493

Query: 773   DGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFK-CEAWTMPEPGPAYDLTFCEVRDTSLVM 831
              GL E   YEF+++A N AG+ EPS PS + K C+   + +PGP  +    ++  +S+ +
Sbjct: 16494 TGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACD--PIYKPGPPNNPKVIDITRSSVFL 16551

Query: 832   LWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANR-YLKVSDLQQGKTYVFRVRAV 890
              W  P+Y G   + GY V+  +   GEW      T  N+  ++V  L +   Y FR+ A+
Sbjct: 16552 SWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAI 16611

Query: 891   NANGVGKPSDTSEPVLVEARPGTKEISAGVDEQG--NIYLG-----FDCQEMTDASQFTW 943
             N  GVG+ +D   P++VE +    +I   ++ +   NI  G     F   +     +  W
Sbjct: 16612 NKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKW 16671

Query: 944   CKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
              K   EI D     I+     + L L N ++ D G Y++++ ++ G  S+FV
Sbjct: 16672 GKVDGEIRD--AAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFV 16721



 Score =  186 bits (473), Expect = 1e-46
 Identities = 191/764 (25%), Positives = 296/764 (38%), Gaps = 106/764 (13%)

Query: 154   PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
             P++     S++V     +K+   + G P P + W KDG  + Q     +  +  +  + T
Sbjct: 16925 PDVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTT---RINVTDSLDLTT 16981

Query: 214   LEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPY 273
             L I     DD   Y     N  GQ + +  +V                 +  P     P 
Sbjct: 16982 LSIKETHKDDGGQYGITVANVVGQKTASIEIVT----------------LDKPDPPKGPV 17025

Query: 274   THFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFF 333
                DV              E++TL     +     ++       RD      + W  +  
Sbjct: 17026 KFDDV------------SAESITLSWNPPLYTGGCQITNYIVQKRDTT---TTVWDVVSA 17070

Query: 334   GEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVT-------GAPGAP 386
                + +L  + L    E  + +   +R G S      F  ++DP+V        G PG P
Sbjct: 17071 TVARTTLKVTKLKTGTEYQFRIFAENRYGQS------FALESDPIVAQYPYKEPGPPGTP 17124

Query: 387   MDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTG 446
                     ++D +++ W  P     SPV+GY ++R E  +  W + N   +   ++    
Sbjct: 17125 F---ATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQN 17181

Query: 447   LFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEG 506
             L EG  Y FRV A N  G+ + S+ S+   A DP D                        
Sbjct: 17182 LEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCD------------------------ 17217

Query: 507   DAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAV 565
                 PG P  +    + RN + L W  P   G   +  Y +EK  +  G W + +  T V
Sbjct: 17218 ---PPGTPEPI---MVKRNEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASF-TNV 17270

Query: 566   RSPRYAVFDLMEGKSYVFRVLSANRHG-LSEPSEITSPIQAQDVTVVPSAPGRVLASRNT 624
                ++ V  L E + Y FRV++ N  G +S+PS+ T PI A+D   +P    R+      
Sbjct: 17271 IETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELP----RISMDPKF 17326

Query: 625   KTSVVVQ-WDRPKHEEDLLGYYVDCC--VAGTNLWEP---CNHKPIGYNRFVVHG---LT 675
             + ++VV   +  + E D+ G  +     + G    E    C  K   +   ++       
Sbjct: 17327 RDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRI 17386

Query: 676   TGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPK 735
              G QYI R  A N  G         V+        P    G+T   C     +L W  P 
Sbjct: 17387 DGGQYILR--ASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKC-----SLTWSPPL 17439

Query: 736   FSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGE 795
               GGS I  Y ++KRE     W  V +S      L V  L EG+ Y F+I AVN  G+GE
Sbjct: 17440 QDGGSDISHYVVEKRETSRLAW-TVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVGE 17498

Query: 796   PSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREED 855
             P + +       + +  PGP   L    +   S+ + W  P   G S + GY V+ R+  
Sbjct: 17499 PLESAPVLMKNPFVL--PGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRS 17556

Query: 856   AGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPS 899
                WI  N+    +  L+V+ L +   Y FRV A NA GVG+PS
Sbjct: 17557 GIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPS 17600



 Score =  186 bits (471), Expect = 2e-46
 Identities = 169/660 (25%), Positives = 282/660 (42%), Gaps = 64/660 (9%)

Query: 352   LYTLRIVSRGGVSDHSAFLFVRD-ADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTT 410
             +Y   IV  G  S +S     RD  DP     PG P  +      R+ + + W  P    
Sbjct: 17192 VYAENIVGVGKASKNSECYVARDPCDP-----PGTPEPIM---VKRNEITLQWTKPVYDG 17243

Query: 411   ESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAG-ISRPS 469
              S + GY V++ ++    W++ +   V   ++ V+GL E + Y FRV A N+AG IS+PS
Sbjct: 17244 GSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPS 17303

Query: 470   RVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVL 529
               +  + A D ++L R+       +  +    +    +A V G P              +
Sbjct: 17304 DSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPT-----------I 17352

Query: 530   SWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSAN 589
              W     RG   +       +  +     +  + A+R         ++G  Y+ R  +  
Sbjct: 17353 EWL----RGDKEIEESARCEIKNTDFKALLIVKDAIR---------IDGGQYILRASN-- 17397

Query: 590   RHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVD 647
                ++        ++  D    P  P +V    + K S+   W  P  +   D+  Y V+
Sbjct: 17398 ---VAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLT--WSPPLQDGGSDISHYVVE 17452

Query: 648   CCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAA 707
                     W     + +  N   V  L  G +Y+FR+ AVN  G+ E  + + V+ ++  
Sbjct: 17453 KRETSRLAWTVVASEVVT-NSLKVTKLLEGNEYVFRIMAVNKYGVGEPLESAPVL-MKNP 17510

Query: 708   LTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKP 767
               +P  P  + + N    SMT+ W  P   GGS I+GY ++KR+     W + N      
Sbjct: 17511 FVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITD 17570

Query: 768   TILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFK-CEAWTMPEPGPAYDLTFCEVRD 826
               L V GLTE   YEF+++A N AG+GEPS  + ++K C+   + +PGP  +    +   
Sbjct: 17571 LRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACD--PVFKPGPPTNAHIVDTTK 17628

Query: 827   TSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEW-ITVNQTTTANRYLKVSDLQQGKTYVF 885
              S+ + W  P+Y G S + GY V+  + D  EW I   QT       ++S L + + Y  
Sbjct: 17629 NSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKI 17688

Query: 886   RVRAVNANGVG---------KPSDTSE-PVLVEARPGTKEISAGVDEQGNIYLGFDCQEM 935
             RV A+N  G+G         KP D  E P L       K I         I++ F   + 
Sbjct: 17689 RVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPF---KG 17745

Query: 936   TDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
                 + TW +   E +D  + +IE   ++++L + N D+ D G Y + + ++ G  S+FV
Sbjct: 17746 RPTPEITWSREEGEFTD--KVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFV 17803



 Score =  186 bits (471), Expect = 2e-46
 Identities = 189/804 (23%), Positives = 332/804 (41%), Gaps = 87/804 (10%)

Query: 227   YSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLP-IGLPLSSMIPYTHFDVQFLEKFG 285
             +   A NA G +S  + VV     G      S G P I LPL     YT           
Sbjct: 20535 FRVFARNAVGSISNPSEVV-----GPITCIDSYGGPVIDLPLE----YTE---------- 20575

Query: 286   VTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHL 345
             V   R G +V L+  +   P      P  EWY+DD  L+ +    +      AS+     
Sbjct: 20576 VVKYRAGTSVKLRAGISGKP-----APTIEWYKDDKELQTNALVCVENTTDLASILIKDA 20630

Query: 346   HKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKP 405
              + + G Y L++  R  +   SA + V+  D    G PG P++ +   A +  + + W+P
Sbjct: 20631 DRLNSGCYELKL--RNAMGSASATIRVQILDK--PGPPGGPIEFKTVTAEK--ITLLWRP 20684

Query: 406   PNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGI 465
             P     + +  Y V++ E     W   ++  ++ C    T + +G  YIFRVRAVN  GI
Sbjct: 20685 PADDGGAKITHYIVEKRETSRVVWSMVSEH-LEECIITTTKIIKGNEYIFRVRAVNKYGI 20743

Query: 466   SRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRN 525
               P   SD+V A +                               PGPP     ++I++N
Sbjct: 20744 GEPLE-SDSVVAKNAF---------------------------VTPGPPGIPEVTKITKN 20775

Query: 526   YVVLSWEPP-TPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFR 584
              + + W  P    G D   YF+EK    S  W +V  +T +R  R  V  L E   Y +R
Sbjct: 20776 SMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKET-IRDTRQKVTGLTENSDYQYR 20834

Query: 585   VLSANRHG---LSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--E 639
             V + N  G    SEPSE     +A D    P  P ++  + +TK+S+ + W +P ++   
Sbjct: 20835 VCAVNAAGQGPFSEPSEF---YKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGS 20891

Query: 640   DLLGYYVDCCVAGTNLWEPCNHK-PIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQE 698
              + GY V+        W   + K  +    +VV  L  G  Y FRV AVN  G  E  + 
Sbjct: 20892 AVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEM 20951

Query: 699   SDVIKVQAALTVPSHPYGITL----LNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHH 754
             ++ ++ +  L  P     + L    +   G  + +   +P      P + +  D++ +  
Sbjct: 20952 NEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQV--LIPFKGRPPPTVTWRKDEKNLGS 21009

Query: 755   KNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPG 814
                + + ++ S  ++LT+  +T     ++ +   N  G+GEP   +   K     +  P 
Sbjct: 21010 DARYSIENTDSS-SLLTIPQVTRNDTGKYILTIEN--GVGEPKSSTVSVK----VLDTPA 21062

Query: 815   PAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKV 874
                 L    V   ++ +LW  P+  G SP+  Y ++ R+     W  V+   ++  + K+
Sbjct: 21063 ACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSSTSF-KL 21121

Query: 875   SDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPG-TKEISAGVDEQGNIYLGFDCQ 933
              DL +   + FRV A N  G+G+P +T+EPV     P   +++S     + ++ L +   
Sbjct: 21122 IDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKP 21181

Query: 934   EMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSS 993
             +    S  T      +   ++ +    +    ++ +    ++ +  + V   +  G+S  
Sbjct: 21182 DFDGGSVITEYVVERKGKGEQTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDP 21241

Query: 994   FVLDPEELERLMALSNEIKNPTIP 1017
               + P  ++ L+ ++ E+    IP
Sbjct: 21242 VTIGPITVKELI-ITPEVDLSDIP 21264



 Score =  185 bits (470), Expect = 2e-46
 Identities = 164/638 (25%), Positives = 263/638 (41%), Gaps = 91/638 (14%)

Query: 381   GAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKIC 440
             G PG P   +  +  ++   V+WK P     S + GY V+R E  +  WV+    PV   
Sbjct: 14265 GPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDL 14324

Query: 441   KYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIY 500
             +  VTGL EG +Y FRV A N AGI  PS  SD+V   D                     
Sbjct: 14325 RCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDA-------------------- 14364

Query: 501   QDDLEGDAQVPGPPTGVHASEISRNYVVLSW-EPPTPRGKDPLMYFIEKSVVGSGSWQRV 559
                    A  PGPP+  H ++ ++    L+W +P    G +   Y +E   VG  +W + 
Sbjct: 14365 -------AYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKD 14417

Query: 560   NAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPS--APGR 617
                TA+R  ++ V DL   + Y FR+ + N  G+ EP+ I       DV +V    AP  
Sbjct: 14418 TTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIP------DVEIVEREMAPDF 14471

Query: 618   VLASRNTKTSVVVQW----------DRPKHE----EDLLGYYVDCCVAGTNLWE-----P 658
              L +   +T VV              RP  E    +D +       +  T  +       
Sbjct: 14472 ELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESFTLLIIPE 14531

Query: 659   CNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGIT 718
             CN    G     +      +     V+ ++  G   N + +D+ K               
Sbjct: 14532 CNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITK--------------- 14576

Query: 719   LLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEG 778
                    S+TL W +P   GGS I  Y ++KRE   K++    +   K T   V GL+EG
Sbjct: 14577 ------DSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTKCHKCTY-KVTGLSEG 14629

Query: 779   SLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVY 838
               Y F++ A N  GIGEP++ +E  K        P P   L   ++  +++ + W  P +
Sbjct: 14630 CEYFFRVMAENEYGIGEPTETTEPVKASE----APSPPDSLNIMDITKSTVSLAWPKPKH 14685

Query: 839   SGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKP 898
              G S ++GY ++ + + + +W  +  TT       V +L +G+ Y F+V AVN+ G   P
Sbjct: 14686 DGGSKITGYVIEAQRKGSDQWTHI--TTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAP 14743

Query: 899   SDTSEPVLVEARPGTKEISA-GVDEQGNIYLGFDCQEMT------DASQFTWCKSYEEIS 951
              + S PV+V+ +    E+   G+ ++  I    D  ++            TW K  + + 
Sbjct: 14744 RE-SRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILK 14802

Query: 952   DDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
               +R   ET    + L +    + D G Y ++  +  G
Sbjct: 14803 QTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVG 14840



 Score =  185 bits (470), Expect = 2e-46
 Identities = 164/623 (26%), Positives = 257/623 (41%), Gaps = 58/623 (9%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
             P  P  +   D  R+ V ++W+ P     S ++GY V+    G++ W  C  A VK+ + 
Sbjct: 15744 PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATC--ATVKVTEA 15801

Query: 443   PVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQD 502
              +TGL +G  Y FRV A N  GIS P ++S  V A D   L    A  L       +  +
Sbjct: 15802 TITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKD---LVIPPAFKLLFNTFTVLAGE 15858

Query: 503   DLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQ 562
             DL+ D    G PT             ++W                K  V      RVNA+
Sbjct: 15859 DLKVDVPFIGRPTPA-----------VTWH---------------KDNVPLKQTTRVNAE 15892

Query: 563   TAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVV--PSAP-GRVL 619
             +   +    + D        + V   N  G          I+  +V V+  P  P G V 
Sbjct: 15893 STENNSLLTIKDACREDVGHYVVKLTNSAG--------EAIETLNVIVLDKPGPPTGPVK 15944

Query: 620   ASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTG 677
                 T  S+ + W  PK++    +  Y V+     T  W+  +   +         L TG
Sbjct: 15945 MDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVS-ATVARTTIKACRLKTG 16003

Query: 678   EQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFS 737
              +Y FR+ A N  G S        +  Q    VP  P    +      SM + W  P   
Sbjct: 16004 CEYQFRIAAENRYGKSTYLNSEPTV-AQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPISD 16062

Query: 738   GGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPS 797
             GGS ++GY+L+++E +   W ++N +P   T     GL EG  YEF+++A N+ GIG+PS
Sbjct: 16063 GGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPS 16122

Query: 798   DPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAG 857
               SE +       P   P   +    V   S+ + WK P Y G S ++GY V+ +E   G
Sbjct: 16123 KVSECYVARDPCDPPGRPEAII----VTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEG 16178

Query: 858   EWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGV-GKPSDTSEPVLVEARPGTKEI 916
              W+  + T   + + +V+ L +   Y FRV A NA GV  +PS+++  +          I
Sbjct: 16179 RWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRI 16238

Query: 917   SAGVDEQGNIYLGFDCQEMTDASQF-------TWCKSYEEISDDERFKIETVGDHSKLYL 969
             S     +  I +        DA  +        W K  +E+S+  R +I++    + L +
Sbjct: 16239 SMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSV 16298

Query: 970   KNPDKEDLGTYSVSVSDTDGVSS 992
             K+  + D G Y +   +  G  S
Sbjct: 16299 KDAVRVDSGNYILKAKNVAGERS 16321



 Score =  185 bits (469), Expect = 3e-46
 Identities = 198/834 (23%), Positives = 347/834 (41%), Gaps = 94/834 (11%)

Query: 170   SVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSA 229
             +++L   ++G P P V W K+         P K RI+       LEI  A  +D   YS 
Sbjct: 10930 TLRLSAIIKGVPFPKVTWKKE-----DRDAPTKARIDVTPVGSKLEIRNAAHEDGGIYSL 10984

Query: 230   VATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFR 289
                N  G  + +  V+V      ++P    G P  L +S +                  R
Sbjct: 10985 TVENPAGSKTVSVKVLVL-----DKP----GPPRDLEVSEI------------------R 11017

Query: 290   REGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDD 349
             ++   +T K  +    D   V       R DV    ++W+ +     + S    HL++ +
Sbjct: 11018 KDSCYLTWKEPL---DDGGSVITNYVVERRDVA--SAQWSPLSATSKKKSHFAKHLNEGN 11072

Query: 350   EGLYTLRIVSRGGVSDHSAFLF----VRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKP 405
             + L+ +   ++ G      F+     ++  DPL    PG P DL   D ++  V + W  
Sbjct: 11073 QYLFRVAAENQYG---RGPFVETPKPIKALDPL--HPPGPPKDLHHVDVDKTEVSLVWNK 11127

Query: 406   PNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGI 465
             P+    SP+ GY V+  E GT +W++        C   VTGL +G++Y FRV+A N  G+
Sbjct: 11128 PDRDGGSPITGYLVEYQEEGTQDWIKFKTVTNLECV--VTGLQQGKTYRFRVKAENIVGL 11185

Query: 466   SRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRN 525
               P           P++ +  + V    E ++ +    +EG     G  T V    I R 
Sbjct: 11186 GLPDTTI-------PIECQE-KLVPPSVELDVKL----IEGLVVKAG--TTVRFPAIIRG 11231

Query: 526   YVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRV 585
                     P P  K    +  + S + +   +    +T   S    + + +   +  +++
Sbjct: 11232 V-------PVPTAK----WTTDGSEIKTD--EHYTVETDNFSSVLTIKNCLRRDTGEYQI 11278

Query: 586   LSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLG 643
               +N  G      +   +   DV   P+ P  +L    T   + + W  PK +    ++ 
Sbjct: 11279 TVSNAAG---SKTVAVHLTVLDVPGPPTGPINILDV--TPEHMTISWQPPKDDGGSPVIN 11333

Query: 644   YYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIK 703
             Y V+      + W   +         + H L  G +Y+FRV+A N +G+      +  + 
Sbjct: 11334 YIVEKQDTRKDTWGVVSSGSSKTKLKIPH-LQKGCEYVFRVRAENKIGVGPPLDSTPTV- 11391

Query: 704   VQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSS 763
              +   + PS P    + +   ++ T+ W +PK  GGSPI GYY+++REV  K W  VN +
Sbjct: 11392 AKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREVTGK-WVRVNKT 11450

Query: 764   PSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCE 823
             P       V GL EG+ YEF++ A NLAG+ +PS  S+  K      P PGP  +    +
Sbjct: 11451 PIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKP-PGPPINPKLKD 11509

Query: 824   VRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANR-YLKVSDLQQGKT 882
                 +  ++W  P+  G SP+ GY V+ ++    +W  +N+     +   +V  L +G  
Sbjct: 11510 KSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNE 11569

Query: 883   YVFRVRAVNANGVGKPSDTSEPVLVE--ARPGTKEISAGVDEQGNIYLGFDCQEMTDAS- 939
             Y FR++A N  G G+P + +E V+ +    P   E+     +   + +G   + +     
Sbjct: 11570 YRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKG 11629

Query: 940   ----QFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
                   TW K  + +  ++R  +       +L +K   + D G Y +S  ++ G
Sbjct: 11630 RPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSG 11683



 Score =  185 bits (469), Expect = 3e-46
 Identities = 204/870 (23%), Positives = 337/870 (38%), Gaps = 134/870 (15%)

Query: 161   RSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRAD 220
             ++H V    S++L    QG PTP   W K  S +   A+     I +     TL +   +
Sbjct: 22060 QTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRAD-----IHTTDSFSTLTVENCN 22114

Query: 221   FDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFR-------SVGLPIGLPLSSMIPY 273
              +D   Y+    N  G  S    V V    G   P         S  L    PL      
Sbjct: 22115 RNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGAR 22174

Query: 274   THFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFF 333
              H  V  +EK   + RR  + ++ KCT  +                              
Sbjct: 22175 IHHYV--VEKREAS-RRSWQVISEKCTRQI------------------------------ 22201

Query: 334   GEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLV-TGAPGAPMDLQCH 392
                      + L +     + +  V+  GV +          +P+V T  P  P  L   
Sbjct: 22202 ------FKVNDLAEGVPYYFRVSAVNEYGVGEPYEM-----PEPIVATEQPAPPRRLDVV 22250

Query: 393   DANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRS 452
             D ++   ++ W  P+    S + GY ++  + G++ WV+      K   + V  L E   
Sbjct: 22251 DTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHT--KQLTFTVERLVEKTE 22308

Query: 453   YIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPG 512
             Y FRV+A N AG S P     +V   +P          +E   ++    + L       G
Sbjct: 22309 YEFRVKAKNDAGYSEPREAFSSVIIKEP---------QIEPTADLTGITNQLI--TCKAG 22357

Query: 513   PPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAV 572
              P  +      R    ++W+    R K+                 RV+  T        V
Sbjct: 22358 SPFTIDVPISGRPAPKVTWKLEEMRLKET---------------DRVSITTTKDRTTLTV 22402

Query: 573   FDLMEGKSYVFRVLSANRHG----------LSEPSEITSPIQAQDVTVVPSAPGRVLASR 622
              D M G S  + +   N  G          +  P  +T PI+   V+             
Sbjct: 22403 KDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSA------------ 22450

Query: 623   NTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQY 680
                 S V+ W  PK     ++  Y V+   +GT  W+  N   +   +  V  LT   +Y
Sbjct: 22451 ---ESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSS-VKRTQIKVTHLTKYMEY 22506

Query: 681   IFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGS 740
              FRV + N  G+S+  + + +I  +     PS P    + +   ++M++ W+ P   GGS
Sbjct: 22507 SFRVSSENRFGVSKPLESAPII-AEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGS 22565

Query: 741   PILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPS 800
              I+GY+++K+E +   W + N  P       V GL EG  Y+F+  A+N AG+ + S+ S
Sbjct: 22566 KIIGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEAS 22625

Query: 801   EHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFR---EEDAG 857
                  +   +  PG        +V  +++ ++W AP Y G S V GY ++ +   E   G
Sbjct: 22626 RPIMAQN-PVDAPGRP---EVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDG 22681

Query: 858   EWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGV-GKPSDTSEPVLV--EARPGTK 914
              W+  N T  ++ +  V+ L +G TY FRV A NA GV  K S+++ PV    E  P   
Sbjct: 22682 RWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKA 22741

Query: 915   EISAGV-DEQGNIYLGFDCQEMTDAS-------QFTWCKSYEEISDDERFKIETVGDHSK 966
             E+ A +  +   I  G D   + DA+       +  W K  +E+   E+  ++  G  + 
Sbjct: 22742 ELDARLHGDLVTIRAGSDL--VLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRAT 22799

Query: 967   LYLKNPDKEDLGTYSVSVSDTDGVSSSFVL 996
               +K  D+ D G Y+++V +  G  +  V+
Sbjct: 22800 AVIKFCDRSDSGKYTLTVKNASGTKAVSVM 22829



 Score =  184 bits (466), Expect = 7e-46
 Identities = 162/629 (25%), Positives = 274/629 (43%), Gaps = 63/629 (10%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
             PG  +DL+    ++    + WK P++   S ++GY VD      N W +   +     +Y
Sbjct: 13579 PGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFL-TEENKWQRVMKS--LSLQY 13635

Query: 443   PVTGLFEGRSYIFRVRAVNSAGISRPSRVS----DAVAALDPLDLRRLQAVHLEGEKEIA 498
                 L EG+ Y FRV A N  G   PS ++    D V A D LDL+ L  +         
Sbjct: 13636 SAKDLTEGKEYTFRVSAENENGEGTPSEITVVARDDVVAPD-LDLKGLPDL--------- 13685

Query: 499   IYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQR 558
              Y      + ++  P  G  A  +S       W+    +G+DPL            +  R
Sbjct: 13686 CYLAKENSNFRLKIPIKGKPAPSVS-------WK----KGEDPL-----------ATDTR 13723

Query: 559   VNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRV 618
             V+ +++  +    V+D  +  +  + +   N  G  E    T  I+      +P+ P  +
Sbjct: 13724 VSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEG---TISIKVVGKPGIPTGP--I 13778

Query: 619   LASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTT 676
                  T  ++ ++W  PK +   ++  Y ++   +  N W  C    +    F V  L  
Sbjct: 13779 KFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCA-SAVQKTTFRVTRLHE 13837

Query: 677   GEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKF 736
             G +Y FRV A N  G+ E  + S+ I  +    VP  P    +++    S++L W  PK 
Sbjct: 13838 GMEYTFRVSAENKYGVGEGLK-SEPIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKK 13896

Query: 737   SGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEP 796
             +GGSPI GY+L+ +E +   W   N +P +     V GLTEG  YEF++ A+NLAG+G+P
Sbjct: 13897 TGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKP 13956

Query: 797   SDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDA 856
             S PSE        +    P        +   S+ ++W  P Y G   ++GY V+ R+  +
Sbjct: 13957 SLPSE----PVVALDPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPS 14012

Query: 857   GEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVN-ANGVGKPSDTSEPVLV--EARPGT 913
               W+  N          V+DL +G  Y FR+RA N A  +  PS+++E ++   E    T
Sbjct: 14013 KSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPT 14072

Query: 914   KEISAGVDEQGNIYLGFDCQEMTDAS-------QFTWCKSYEEISDDERFKIETVGDHSK 966
               +   + +   I  G D   +   S       + +W K+ ++I   +  +I +    S 
Sbjct: 14073 IVLDPTIKDGLTIKAG-DTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSM 14131

Query: 967   LYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
             L +K   ++D G Y+++ ++  G     V
Sbjct: 14132 LTIKYATRKDAGEYTITATNPFGTKVEHV 14160



 Score =  184 bits (466), Expect = 7e-46
 Identities = 157/633 (24%), Positives = 259/633 (40%), Gaps = 56/633 (8%)

Query: 283   KFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSF 342
             K G+T +  G+T+ L    ++   L    P++ W +    ++ S  T++      + L+ 
Sbjct: 14080 KDGLTIKA-GDTIVLNAISILGKPL----PKSSWSKAGKDIRPSDITQITSTPTSSMLTI 14134

Query: 343   SHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVT 402
              +  + D G YT+   +  G         V      V   PG P  ++  + + +   +T
Sbjct: 14135 KYATRKDAGEYTITATNPFGTK-------VEHVKVTVLDVPGPPGPVEISNVSAEKATLT 14187

Query: 403   WKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNS 462
             W PP     SP+  Y +++ E     W   ++  ++ C++  T L +G  YIFRV AVN 
Sbjct: 14188 WTPPLEDGGSPIKSYILEKRETSRLLWTVVSE-DIQSCRHVATKLIQGNEYIFRVSAVNH 14246

Query: 463   AGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEI 522
              G   P + S+ V  +D                               PGPP     S +
Sbjct: 14247 YGKGEPVQ-SEPVKMVDRFG---------------------------PPGPPEKPEVSNV 14278

Query: 523   SRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSY 581
             ++N   +SW+ P   G   +  Y +E+    S  W R   +T V   R  V  L EG +Y
Sbjct: 14279 TKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRA-IKTPVSDLRCKVTGLQEGSTY 14337

Query: 582   VFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEE-- 639
              FRV + NR G+  PSE +  +  +D    P  P     +  TK S  + W +P ++   
Sbjct: 14338 EFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGL 14397

Query: 640   DLLGYYVDCCVAGTNLW-EPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQE 698
             ++ GY V+    G   W +      +   +FVV  L T E+Y FR+ A+N  G+ E +  
Sbjct: 14398 EITGYVVEHQKVGDEAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVI 14457

Query: 699   SDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWH 758
              DV  V+  +  P       L         L  ++     G P       K  ++ KN  
Sbjct: 14458 PDVEIVEREM-APDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRA 14516

Query: 759   EVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYD 818
              + ++ S  T+L +         +F +   N AG        +        +  PGP  +
Sbjct: 14517 NIENTESF-TLLIIPECNRYDTGKFVMTIENPAG-------KKSGFVNVRVLDTPGPVLN 14568

Query: 819   LTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQ 878
             L   ++   S+ + W  P+  G S ++ Y V+ RE     + T         Y KV+ L 
Sbjct: 14569 LRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTKCHKCTY-KVTGLS 14627

Query: 879   QGKTYVFRVRAVNANGVGKPSDTSEPVLVEARP 911
             +G  Y FRV A N  G+G+P++T+EPV     P
Sbjct: 14628 EGCEYFFRVMAENEYGIGEPTETTEPVKASEAP 14660



 Score =  184 bits (466), Expect = 7e-46
 Identities = 233/952 (24%), Positives = 374/952 (39%), Gaps = 107/952 (11%)

Query: 382   APGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDR---CEVGTNNWVQCNDAPVK 438
             APG P   +  D  R  V + W  P     S V+GY ++R    EVG   W++CN   V 
Sbjct: 22636 APGRP---EVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVS 22692

Query: 439   ICKYPVTGLFEGRSYIFRVRAVNSAG-ISRPSRVSDAVAALDPLDLRRLQA-VHLEGEKE 496
                + VT L EG +Y FRV A N+AG IS+ S  +  V   D     + +    L G+  
Sbjct: 22693 DNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLV 22752

Query: 497   IAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGK-DPLMYFIEKSVVGSGS 555
                   DL  DA V G P                 EP     K D  +   EK       
Sbjct: 22753 TIRAGSDLVLDAAVGGKP-----------------EPKIIWTKGDKELDLCEK------- 22788

Query: 556   WQRVNAQ-TAVRSPRYAVF-DLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPS 613
                V+ Q T  R+     F D  +   Y   V +A+  G    S +   + +      P 
Sbjct: 22789 ---VSLQYTGKRATAVIKFCDRSDSGKYTLTVKNAS--GTKAVSVMVKVLDS------PG 22837

Query: 614   APGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVV 671
               G++  SR T+    + W  P+ +   ++  Y V+        W     +    + +VV
Sbjct: 22838 PCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLS-YVV 22896

Query: 672   HGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGW 731
               L    +YIFRV+AVN  G      ES+ I  + + T+PS P     +      + + W
Sbjct: 22897 TRLIKNNEYIFRVRAVNKYGPGV-PVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQW 22955

Query: 732   KVPKFSGGSPILGYYLDKREVHHKNWHEVNSS-PSKPTILTVDGLTEGSLYEFKIAAVNL 790
               P+  GG+ I  Y +DKRE     W  VN       T L V  L EG  Y+F++ AVN 
Sbjct: 22956 TKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNA 23015

Query: 791   AGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVD 850
             AG  EPS+ S    C   +   PGP       +    S+ + W  P+Y G + + GY ++
Sbjct: 23016 AGNSEPSEASNFISCREPSYT-PGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLE 23074

Query: 851   FREEDAGEWITVN-QTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDT---SEPVL 906
              +E+D  +W  V+   T  N    V DL+ G+ Y FRV AVN  G+ + S++    EPV 
Sbjct: 23075 MQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVE 23134

Query: 907   VEARPGTKEISAGVDEQGNIYLGFDCQEMTDAS-----QFTWCKSYEEISDDERFKIETV 961
                 P   E++  + +   I  G   + M   S       TW K   +++   R  I+T 
Sbjct: 23135 RIEIPDL-ELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLA--SRAIIDTT 23191

Query: 962   GDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKSE 1021
               +S L +   ++ D G Y++   +  G  S+ VL             ++ +   P  S 
Sbjct: 23192 ESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVL------------VKVYDTPGPCPSV 23239

Query: 1022  LAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRI--KCDKA----TGIIEM 1075
                E+        W             +I+  RE +      +  KC K     +G++E 
Sbjct: 23240 KVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEG 23299

Query: 1076  VMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEY 1135
              M  F +  E  Y +    G+    S  VL+ +     L  A+ +  +  +         
Sbjct: 23300 TMYYFRVLPENIYGI----GEPCETSDAVLVSE---VPLVPAKLEVVDVTKS-----TVT 23347

Query: 1136  LHWD-VTEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNLERGICELLIPKLSKKD 1194
             L W+    +   RL   V    K    +W+K         +  L+  + E  +  L++ +
Sbjct: 23348 LAWEKPLYDGGSRLTGYVLEACKAGTERWMK---------VVTLKPTVLEHTVTSLNEGE 23398

Query: 1195  HGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLKVLCTPEGIRLQCFMK 1254
                ++   ++++G       +      D  L +      S  P K +  P G  ++  + 
Sbjct: 23399 QYLFRIRAQNEKGVSEPRETVTAVTVQD--LRVLPTIDLSTMPQKTIHVPAGRPVELVIP 23456

Query: 1255  YF-TDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEI 1305
                      +W    +K+  SE + +    ++A L I E T +D G+YT E+
Sbjct: 23457 IAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLEL 23508



 Score =  182 bits (462), Expect = 2e-45
 Identities = 157/621 (25%), Positives = 254/621 (40%), Gaps = 75/621 (12%)

Query: 302   LVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRG 361
             LV P   R  P A W+     L+ES+   +      A L+       D G YTL + +  
Sbjct: 23453 LVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVT 23512

Query: 362   GVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDR 421
             G +  +  + + D      G P  P+ +   DA    + ++W+PP     +P+ GY V++
Sbjct: 23513 GTTSETIKVIILDKP----GPPTGPIKIDEIDATS--ITISWEPPELDGGAPLSGYVVEQ 23566

Query: 422   CEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPL 481
              +     W+  +++  +   +  T L EG  Y+FRV A N  GI                
Sbjct: 23567 RDAHRPGWLPVSESVTR-STFKFTRLTEGNEYVFRVAATNRFGIGS-------------- 23611

Query: 482   DLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDP 541
                 LQ+  +E    I           ++PGPP  +   ++SR+ + L+W PP   G   
Sbjct: 23612 ---YLQSEVIECRSSI-----------RIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQ 23657

Query: 542   LM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEIT 600
             +  Y +E+  V +  W RVN +  V   RY    L EG  Y  RV + N  G  +PS  +
Sbjct: 23658 VTGYIVERKEVRADRWVRVN-KVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPS 23716

Query: 601   SPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEP 658
              PI A D    P  P     +  T+TSV + W  P+ E    + GY ++      + W  
Sbjct: 23717 KPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTK 23776

Query: 659   CNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPY--- 715
             CN  P     + +  L  G +Y FRV A NA G  E ++    +KV   L  P +     
Sbjct: 23777 CNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDER 23836

Query: 716   ---GITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTV 772
                GI +       +T+  K   F    PI  +  + +++  +     + + ++  I   
Sbjct: 23837 YQEGIFVRQGGVIRLTIPIKGKPF----PICKWTKEGQDISKRAMIATSETHTELVIKEA 23892

Query: 773   DGLTEGSLYEF--------KIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEV 824
             D    G+ Y+         K   + +  IG P+ P              GP   L + ++
Sbjct: 23893 DRGDSGT-YDLVLENKCGKKAVYIKVRVIGSPNSPE-------------GP---LEYDDI 23935

Query: 825   RDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYV 884
             +  S+ + W+ P   G + + GY ++ RE     W T++        L V  L++   Y 
Sbjct: 23936 QVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRVRGTS-LVVKGLKENVEYH 23994

Query: 885   FRVRAVNANGVGKPSDTSEPV 905
             FRV A N  G+ KP  + EPV
Sbjct: 23995 FRVSAENQFGISKPLKSEEPV 24015



 Score =  182 bits (461), Expect = 3e-45
 Identities = 173/685 (25%), Positives = 271/685 (39%), Gaps = 56/685 (8%)

Query: 238   VSTNAAVVVRRFRGDEEPFRSVGLPIGLPLS----SMIPYTHFDVQFLEKFGVTFRREGE 293
             VS N   V     GD   FR +       +S    S  P T  D     K  +  R  G+
Sbjct: 22691 VSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGD 22750

Query: 294   TVTLKCTMLVTPDLK---RVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDE 350
              VT++    +  D     + +P+  W + D  L   +   + +   +A+       + D 
Sbjct: 22751 LVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDS 22810

Query: 351   GLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTT 410
             G YTL + +  G    S  + V D+       PG    L      ++   + W  P    
Sbjct: 22811 GKYTLTVKNASGTKAVSVMVKVLDS-------PGPCGKLTVSRVTQEKCTLAWSLPQEDG 22863

Query: 411   ESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSR 470
              + +  Y V+R E    NWV   +       Y VT L +   YIFRVRAVN  G      
Sbjct: 22864 GAEITHYIVERRETSRLNWVIV-EGECPTLSYVVTRLIKNNEYIFRVRAVNKYG------ 22916

Query: 471   VSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLS 530
                               V +E E  +A           +P PP         + ++++ 
Sbjct: 22917 ----------------PGVPVESEPIVA------RNSFTIPSPPGIPEEVGTGKEHIIIQ 22954

Query: 531   W-EPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSAN 589
             W +P +  G +   Y ++K    S  W RVN    V   R  V  LMEG  Y FRV + N
Sbjct: 22955 WTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVN 23014

Query: 590   RHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVD 647
               G SEPSE ++ I  ++ +  P  P        TK S+ + W +P ++   D++GY ++
Sbjct: 23015 AAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLE 23074

Query: 648   CCVAGTNLWEPCN-HKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQA 706
                  T+ W   + +  I    F V  L  G++Y FRV AVN  GMSE S+    I+   
Sbjct: 23075 MQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVE 23134

Query: 707   ALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSK 766
              + +P       L            ++     G P       K+ +   +   ++++ S 
Sbjct: 23135 RIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESY 23194

Query: 767   PTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRD 826
              ++L VD +      ++ I A N +G        +           PGP   +   EV  
Sbjct: 23195 -SLLIVDKVNRYDAGKYTIEAENQSG-------KKSATVLVKVYDTPGPCPSVKVKEVSR 23246

Query: 827   TSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFR 886
              S+ + W+ P   G +PV+ Y V+ RE     + TV    +   Y ++S L +G  Y FR
Sbjct: 23247 DSVTITWEIPTIDGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLY-RISGLVEGTMYYFR 23305

Query: 887   VRAVNANGVGKPSDTSEPVLVEARP 911
             V   N  G+G+P +TS+ VLV   P
Sbjct: 23306 VLPENIYGIGEPCETSDAVLVSEVP 23330



 Score =  181 bits (460), Expect = 4e-45
 Identities = 159/669 (23%), Positives = 274/669 (40%), Gaps = 82/669 (12%)

Query: 376   DPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDA 435
             DP+    PG P + +  D  R  V + W  P     S V GY ++  +V  + W +CN  
Sbjct: 23723 DPIAP--PGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTT 23780

Query: 436   PVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLR--RLQAVHLEG 493
             P KI +Y +T L +G  Y FRV A N+ G   P+ V   V   + L+     L   + EG
Sbjct: 23781 PTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEG 23840

Query: 494   EKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGS 553
                I + Q    G  ++  P  G       + + +  W   T  G+D     I K     
Sbjct: 23841 ---IFVRQG---GVIRLTIPIKG-------KPFPICKW---TKEGQD-----ISK----- 23874

Query: 554   GSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHG----------LSEPSEITSPI 603
                 R    T+       + +   G S  + ++  N+ G          +  P+    P+
Sbjct: 23875 ----RAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIGSPNSPEGPL 23930

Query: 604   QAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNH 661
             +  D+ V                SV V W  P  +   D+LGY ++        W   + 
Sbjct: 23931 EYDDIQV---------------RSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDS 23975

Query: 662   KPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGIT-LL 720
             +  G +  VV GL    +Y FRV A N  G+S+  +  + +  +  L  P  P     +L
Sbjct: 23976 RVRGTS-LVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVL 24034

Query: 721   NCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSL 780
             +    S++L W  PK  GGS + GYY++++E     W   N +    T+ TV GL   + 
Sbjct: 24035 DVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAE 24094

Query: 781   YEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSG 840
             Y+F+I A N  G+ E S  SE   C+     +P    +L    +   S+ + W+ P   G
Sbjct: 24095 YQFRIIAQNDVGLSETSPASEPVVCKD-PFDKPSQPGELEILSISKDSVTLQWEKPECDG 24153

Query: 841   SSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSD 900
                + GY+V++R+     W   N+    ++   +  L +   Y FRV A N  G+ +P  
Sbjct: 24154 GKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRR 24213

Query: 901   TSEPVLVEARPG--------TKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISD 952
             T+  +  +   G         K+++  + E   +      + + D     W +  +E+  
Sbjct: 24214 TAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPD---IKWYRFGKELIQ 24270

Query: 953   DERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIK 1012
               ++K+ + G    L +   ++ED G Y+        ++++ V + E   +L+  +    
Sbjct: 24271 SRKYKMSSDGRTHTLTVMTEEQEDEGVYTC-------IATNEVGEVETSSKLLLQATPQF 24323

Query: 1013  NPTIPLKSE 1021
             +P  PLK +
Sbjct: 24324 HPGYPLKEK 24332



 Score =  179 bits (453), Expect = 2e-44
 Identities = 155/603 (25%), Positives = 260/603 (43%), Gaps = 78/603 (12%)

Query: 327  KWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGA---- 382
            +W ++  G          L +  E  + +R V++ G S+ S       +DP++       
Sbjct: 7724 EWVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPS-----EPSDPVLCREKLYP 7778

Query: 383  PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
            P  P  L+  +  ++   + W  P     SP+  Y V++ +V    W Q  D  VK  K 
Sbjct: 7779 PSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGW-QTVDTTVKDTKC 7837

Query: 443  PVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQD 502
             VT L EG  Y+FRV A N+ G S  + + D+V A D                       
Sbjct: 7838 TVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFT-------------------- 7877

Query: 503  DLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNA 561
                    PGPP  +   ++++ +V L WEPP   G  P+  Y IEK       W +   
Sbjct: 7878 -------TPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAG- 7929

Query: 562  QTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLAS 621
            +TA     + V D++EG    F+V + N  G+  PSE T  +  +D T  PS P  +  +
Sbjct: 7930 KTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVT 7989

Query: 622  RNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVH-GLTTGE 678
               +  + + W  P+      ++GY+V+ C  GT  W   N +PI   +F V  G+   +
Sbjct: 7990 DAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDK 8049

Query: 679  QYIFRVKAVNAVGMSENSQESDVIKVQ---AALTVPSHPYGITLLNCDGHSMTLGWKVPK 735
            +Y+ RV+AVNA+G+SE S+ S+ +  +      T+    + I ++  +G  +++   VP 
Sbjct: 8050 EYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHDIIVI--EGEKLSI--PVPF 8105

Query: 736  FSGGSPILGYYLDKREVHH------KNWHEVNSSPSKPTILTVDGLTEGSLYEFKI---- 785
             +   P + ++ D +EV        KN H +++    P  +  D        E K+    
Sbjct: 8106 RAVPVPTVSWHKDGKEVKASDRLTMKNDH-ISAHLEVPKSVRADAGIYTITLENKLGSAT 8164

Query: 786  AAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVS 845
            A++N+  IG P                 GP  D+   ++  +S  + W+ P + G +P+ 
Sbjct: 8165 ASINVKVIGLP-----------------GPCKDIKASDITKSSCKLTWEPPEFDGGTPIL 8207

Query: 846  GYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPV 905
             Y ++ RE     +I V        +  V DL     Y FRV+AVN  G G+  +   PV
Sbjct: 8208 HYVLERREAGRRTYIPVMSGENKLSW-TVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPV 8266

Query: 906  LVE 908
            + +
Sbjct: 8267 IAQ 8269



 Score =  177 bits (450), Expect = 5e-44
 Identities = 166/627 (26%), Positives = 257/627 (40%), Gaps = 66/627 (10%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICK- 441
             PG P   +  D  +  V + W  P     S ++GYFV+ C++  + WV+CN AP +I + 
Sbjct: 12888 PGKP---EVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQE 12944

Query: 442   -YPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIY 500
              Y  TGL E   Y FR  A  +  IS PS  SD V  L         A ++    ++++ 
Sbjct: 12945 EYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTIL---------AENVPPRIDLSVA 12995

Query: 501   QDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVN 560
                L       G    + A+   +    +SW+      KD  +    K   G     + N
Sbjct: 12996 MKSLL--TVKAGTNVCLDATVFGKPMPTVSWK------KDGTLL---KPAEGIKMAMQRN 13044

Query: 561   AQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLA 620
               T        +F +    S  + + + N  G       T  ++  D    P  P  V  
Sbjct: 13045 LCTL------ELFSVNRKDSGDYTITAENSSG---SKSATIKLKVLDK---PGPPASVKI 13092

Query: 621   SRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGE 678
             ++      ++ W+ P  +   ++  Y VD        W   +   +      V  L  G 
Sbjct: 13093 NKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVS-ATVPITSCSVEKLIEGH 13151

Query: 679   QYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGI----TLLNCDGHSMTLGWKVP 734
             +Y FR+ A N  G+ +      V    A    P  P G      + N     MT+ WK P
Sbjct: 13152 EYQFRICAENKYGVGD-----PVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPP 13206

Query: 735   KFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIG 794
                GGSPI GY L+KRE    NW +VN  P     L   GL EG+ YEF++ A+N AG G
Sbjct: 13207 ADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPG 13266

Query: 795   EPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREE 854
             +PSD S+         P   PA+   +   R +S+ + W  P Y G SP+ GY V+ +  
Sbjct: 13267 KPSDASKAAYARDPQYPPGPPAFPKVYDTTR-SSVSLSWGKPAYDGGSPIIGYLVEVKRA 13325

Query: 855   DAGEWITVN--QTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSE-----PVLV 907
             D+  W+  N  Q     R+ +V+ L +   Y FRV AVN  G   PSD  +      +L+
Sbjct: 13326 DSDNWVRCNLPQNLQKTRF-EVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILI 13384

Query: 908   EARPGTKEISAGVDEQGNIYLGFDCQEMTDAS-----QFTWCKSYEEISDDERFKIETVG 962
                P   E+ A + +   +  G   +           + TW K    + D     I++  
Sbjct: 13385 ---PPEGELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTD 13441

Query: 963   DHSKLYLKNPDKEDLGTYSVSVSDTDG 989
               + L  +N +K D G Y +++ ++ G
Sbjct: 13442 FDTFLRCENVNKYDAGKYILTLENSCG 13468



 Score =  176 bits (445), Expect = 2e-43
 Identities = 164/628 (26%), Positives = 264/628 (42%), Gaps = 59/628 (9%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
             PG P   +  +  R+ V + W  P       + GY V++ ++ + +W++ N   V  C +
Sbjct: 13972 PGKP---EVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAF 14028

Query: 443   PVTGLFEGRSYIFRVRAVNSAG-ISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQ 501
              VT L EG  Y FR+RA N+AG IS PS  ++ +   D            E E    +  
Sbjct: 14029 TVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKD------------EYEAPTIVLD 14076

Query: 502   DDLEGDAQVPGPPTGV--HASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRV 559
               ++    +    T V    S + +     SW   +  GKD     I + +  + +   +
Sbjct: 14077 PTIKDGLTIKAGDTIVLNAISILGKPLPKSSW---SKAGKDIRPSDITQ-ITSTPTSSML 14132

Query: 560   NAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTV--VPSAPGR 617
               + A R                     A  + ++  +   + ++   VTV  VP  PG 
Sbjct: 14133 TIKYATRK-------------------DAGEYTITATNPFGTKVEHVKVTVLDVPGPPGP 14173

Query: 618   VLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLT 675
             V  S  +     + W  P  +    +  Y ++       LW   + + I   R V   L 
Sbjct: 14174 VEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVS-EDIQSCRHVATKLI 14232

Query: 676   TGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPK 735
              G +YIFRV AVN  G  E  Q S+ +K+      P  P    + N   ++ T+ WK P 
Sbjct: 14233 QGNEYIFRVSAVNHYGKGEPVQ-SEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPV 14291

Query: 736   FSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGE 795
               GGS I GY++++RE     W     +P       V GL EGS YEF+++A N AGIG 
Sbjct: 14292 DDGGSEITGYHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGP 14351

Query: 796   PSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREED 855
             PS+ S+    +    P PGP  +    +    S  + W  P Y G   ++GY V+ ++  
Sbjct: 14352 PSEASDSVLMKDAAYP-PGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVG 14410

Query: 856   AGEWITVNQTTTANRYLK--VSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGT 913
                WI  + T TA R  +  V DLQ  + Y FR+ A+N  GVG+P+   +  +VE     
Sbjct: 14411 DEAWIK-DTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAP 14469

Query: 914   K-EISAGVDEQGNIYLGFDCQ-----EMTDASQFTWCKSYEEISDDERFKIETVGDHSKL 967
               E+ A +     +  G   +     +   A + TW K  + I+   R  IE     + L
Sbjct: 14470 DFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTK--DNINLKNRANIENTESFTLL 14527

Query: 968   YLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
              +   ++ D G + +++ +  G  S FV
Sbjct: 14528 IIPECNRYDTGKFVMTIENPAGKKSGFV 14555



 Score =  174 bits (442), Expect = 4e-43
 Identities = 154/640 (24%), Positives = 249/640 (38%), Gaps = 84/640 (13%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
             PG P   +    +++ + V W PP       + GYF+++ E  +  WV  N + +   + 
Sbjct: 12091 PGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRM 12150

Query: 443   PVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQD 502
              V  L     Y FRV+A N  GI  PS  S  V A DP++                    
Sbjct: 12151 KVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIE-------------------- 12190

Query: 503   DLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIE-KSVVGSGS----W 556
                     PGPPT     + +++ + L W  P   G  P++ Y +E +  +   S    W
Sbjct: 12191 -------PPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGW 12243

Query: 557   QRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPS--- 613
             +R NA   +    + V  L E + Y FRV + N+ G+  P+E+   I+ +++   P    
Sbjct: 12244 KRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDL 12303

Query: 614   -------------APGRVLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCN 660
                           P R+ A    + +  V W +   +  +    VD       L  P +
Sbjct: 12304 DASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNS 12363

Query: 661   HKPIGYNRFVVHGLTTGEQYIF-RVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITL 719
              +       +      GE+ +F  V+ ++  G   + + SDV K                
Sbjct: 12364 TRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKT--------------- 12408

Query: 720   LNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGS 779
                   S  + W  P+  GGS +  Y ++KRE   K W  V     K T   V  L  G+
Sbjct: 12409 ------SCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVKK-TSFHVTNLVPGN 12461

Query: 780   LYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYS 839
              Y F++ AVN  G G P+D  +        + EP P   L   E+   S  + W  P+  
Sbjct: 12462 EYYFRVTAVNEYGPGVPTDVPKPVLASD-PLSEPDPPRKLEVTEMTKNSATLAWLPPLRD 12520

Query: 840   GSSPVSGYFVDFREED--AGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGK 897
             G + + GY   +REE+  A  W     +   +  L V+ L++GK Y FRV A NA GV  
Sbjct: 12521 GGAKIDGYITSYREEEQPADRW--TEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSL 12578

Query: 898   PSDTSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDA-----SQFTWCKSYEEISD 952
             P +     + EA+         + EQ  I  G   +              W K  +E+  
Sbjct: 12579 PREAEG--VYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVT 12636

Query: 953   DERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSS 992
                  +      S L +K+  ++D G YS++  ++ G  +
Sbjct: 12637 SSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDT 12676



 Score =  173 bits (439), Expect = 1e-42
 Identities = 157/607 (25%), Positives = 254/607 (41%), Gaps = 62/607 (10%)

Query: 312   PRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLF 371
             P  +W + +  +  S    +   +  + L    + + D G Y+L   +  G       + 
Sbjct: 12623 PTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVV 12682

Query: 372   VRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQ 431
             V DA     G P  P D+   D + D   ++W  P     S +  Y V++C+V   +WV 
Sbjct: 12683 VMDAP----GPPQPPFDIS--DIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVT 12736

Query: 432   CNDAPVKI-CKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVH 490
                +  K  C+  V  L  G+ YIFRVRA N  GIS P                      
Sbjct: 12737 ALASVTKTSCR--VGKLIPGQEYIFRVRAENRFGISEP---------------------- 12772

Query: 491   LEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKS 549
             L   K +A +         VP  P     ++++++ + ++W+ P   G  P++ Y IE+ 
Sbjct: 12773 LTSPKMVAQFPFG------VPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERK 12826

Query: 550   VVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVT 609
                S  W + N  T VRS  Y    L+EG  Y FR+ + N+ G S PS+ T  + A+ + 
Sbjct: 12827 ERNSLLWVKAN-DTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTAR-MP 12884

Query: 610   VVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKP--IG 665
             V P  PG+      TK++V + W RPKH+    ++GY+V+ C    + W  CN  P  I 
Sbjct: 12885 VDP--PGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIP 12942

Query: 666   YNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNC--- 722
                +   GL    QY FR  A  AV +S  S+ SD + + A    P     + + +    
Sbjct: 12943 QEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTV 13002

Query: 723   -DGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLY 781
               G ++ L   V  F    P + +  D   +      ++    +  T L +  +      
Sbjct: 13003 KAGTNVCLDATV--FGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCT-LELFSVNRKDSG 13059

Query: 782   EFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGS 841
             ++ I A N +G       S+    +   + +PGP   +   ++     ++ W+ P+  G 
Sbjct: 13060 DYTITAENSSG-------SKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGG 13112

Query: 842   SPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDT 901
             S ++ Y VD RE     W  V+ T        V  L +G  Y FR+ A N  GVG P  T
Sbjct: 13113 SEITNYIVDKRETSRPNWAQVSATVPITS-CSVEKLIEGHEYQFRICAENKYGVGDPVFT 13171

Query: 902   SEPVLVE 908
              EP + +
Sbjct: 13172 -EPAIAK 13177



 Score =  172 bits (437), Expect = 2e-42
 Identities = 163/628 (25%), Positives = 259/628 (41%), Gaps = 61/628 (9%)

Query: 292   GETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQ-ASLSFSHLHKDDE 350
             GET  L+  +   P      P   W +D   L+E+          Q  +L      + D 
Sbjct: 18417 GETFVLEADIRGKPI-----PDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDG 18471

Query: 351   GLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTT 410
             G Y L++ + GG       + V D      G P  P+ +    A + Y+   W PP    
Sbjct: 18472 GQYILKLSNVGGTKSIPITVKVLDRP----GPPEGPLKVTGVTAEKCYL--AWNPPLQDG 18525

Query: 411   ESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSR 470
              + +  Y +++ E    +W Q +   V+   Y VT L  G  YIFRV AVN  GI  P  
Sbjct: 18526 GANISHYIIEKRETSRLSWTQVS-TEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLE 18584

Query: 471   VSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLS 530
              S  V A +P                            + PGPP+    S I+++ +V++
Sbjct: 18585 -SGPVTACNPY---------------------------KPPGPPSTPEVSAITKDSMVVT 18616

Query: 531   WEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSAN 589
             W  P   G   +  Y +EK       W + N +T +   R  V  L EG SY FRV + N
Sbjct: 18617 WARPVDDGGTEIEGYILEKRDKEGVRWTKCNKKT-LTDLRLRVTGLTEGHSYEFRVAAEN 18675

Query: 590   RHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVD 647
               G+ EPSE +   +A D    P  P     +  +++SV + W +P ++    + GY V+
Sbjct: 18676 AAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVE 18735

Query: 648   CCVAGTNLWEPCNHKPIGY--NRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQ 705
                A  + W  C   P G    +F V  L    +Y FR+ A+N+ G+ E +     +  Q
Sbjct: 18736 VKEAAADEWTTCT-PPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQ 18794

Query: 706   AALTVPSHPYGITLLNCD--GHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSS 763
               +  P       L        S TL   V       P + +   +  +  +   EV SS
Sbjct: 18795 ERIEPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSS 18854

Query: 764   PSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCE 823
                 T+L +D +T      + +   N +G       S+        +  P    +LT  E
Sbjct: 18855 ---FTMLVIDNVTRFDSGRYNLTLENNSG-------SKTAFVNVRVLDSPSAPVNLTIRE 18904

Query: 824   VRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTY 883
             V+  S+ + W+ P+  G + ++ Y V+ RE     + T+    T   + ++ +LQ+G +Y
Sbjct: 18905 VKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKTTF-RIENLQEGCSY 18963

Query: 884   VFRVRAVNANGVGKPSDTSEPVLVEARP 911
              FRV A N  G+G P++T+EPV V   P
Sbjct: 18964 YFRVLASNEYGIGLPAETTEPVKVSEPP 18991



 Score =  172 bits (436), Expect = 2e-42
 Identities = 149/603 (24%), Positives = 243/603 (40%), Gaps = 66/603 (10%)

Query: 309   RVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSA 368
             R  P   W R++    +    ++  G     LS  +  ++D G Y L++ +  G    SA
Sbjct: 17746 RPTPEITWSREEGEFTDK--VQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSG--SKSA 17801

Query: 369   FLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNN 428
             F+ V+  D      PG P +L   +  +D   + W+PP     + V  Y +D+ E     
Sbjct: 17802 FVTVKVLD-----TPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKA 17856

Query: 429   WVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQA 488
             +   +    K   + V  L EG  Y FRV A N  G+  P    DAV A +P        
Sbjct: 17857 YANVSSKCSKT-SFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEP-------- 17907

Query: 489   VHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIE 547
                                   P PP  V  +++S+    L WE P   G   ++ Y +E
Sbjct: 17908 ----------------------PSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVE 17945

Query: 548   KSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQD 607
                 G+  W  V       +    V  L  G+ Y FRV + N  G S+P  +  P+ A+D
Sbjct: 17946 MQPKGTEKWSIVAESKVCNA---VVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKD 18002

Query: 608   VTVVPSA-----PGRVLASRNTKTSV-VVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNH 661
             +T+ PS         + A  + K  + V+   RP          +     G  L +    
Sbjct: 18003 LTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPN---------ISWVKDGEPLKQTTRV 18053

Query: 662   KPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYG-ITLL 720
                      V  +  G +  F    V A   +  + E+  + V   L  P  P G +   
Sbjct: 18054 NVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIV---LEKPGPPVGPVRFD 18110

Query: 721   NCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSL 780
                   + + W+ P ++GG  I  Y ++KR+     WH V+++ ++ TI  +  L  G+ 
Sbjct: 18111 EVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTI-KITKLKTGTE 18169

Query: 781   YEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSG 840
             Y+F+I A N  G   P D         +   EPGP        +    +++ W  PV  G
Sbjct: 18170 YQFRIFAENRYGKSAPLDSKA--VIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDG 18227

Query: 841   SSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSD 900
              + + GY ++ +E+++  W+ +N+T   +   K + L +G  Y F+V A N  G+GKPS 
Sbjct: 18228 GTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSK 18287

Query: 901   TSE 903
              SE
Sbjct: 18288 VSE 18290



 Score =  172 bits (435), Expect = 3e-42
 Identities = 170/703 (24%), Positives = 284/703 (40%), Gaps = 123/703 (17%)

Query: 353   YTLRIVSRG--GVSDHSA-FLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTT 409
             Y  R+ +    GV + S   +F R  D L    PG P + +  D +R  V + W  P   
Sbjct: 18667 YEFRVAAENAAGVGEPSEPSVFYRACDALYP--PGPPSNPKVTDTSRSSVSLAWSKPIYD 18724

Query: 410   TESPVMGYFVDRCEVGTNNWVQCNDAP-VKICKYPVTGLFEGRSYIFRVRAVNSAGISRP 468
               +PV GY V+  E   + W  C     ++  ++ VT L E   Y FR+ A+NS G+  P
Sbjct: 18725 GGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEP 18784

Query: 469   SRVSDAVAALDPL---------DLRRLQA----------VHLEGEKEIAIYQDDLEG--- 506
             + +  +V A + +         DLR++            V ++G  E  +  +  EG   
Sbjct: 18785 ATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT 18844

Query: 507   -DAQV--------------------------------------------PGPPTGVHASE 521
               AQ+                                            P  P  +   E
Sbjct: 18845 DRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIRE 18904

Query: 522   ISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKS 580
             + ++ V LSWEPP   G   +  Y +EK      ++  +       +  + + +L EG S
Sbjct: 18905 VKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKTT--FRIENLQEGCS 18962

Query: 581   YVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE-- 638
             Y FRVL++N +G+  P+E T P++   V+  P  PGRV     T+ +  ++W++P+ +  
Sbjct: 18963 YYFRVLASNEYGIGLPAETTEPVK---VSEPPLPPGRVTLVDVTRNTATIKWEKPESDGG 19019

Query: 639   EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQ- 697
               + GY V+    G+  W  C    +      + GLT GE+Y+FRV AVN  G S+  Q 
Sbjct: 19020 SKITGYVVEMQTKGSEKWSTCTQ--VKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQL 19077

Query: 698   ----ESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVH 753
                  +  I+++ ++ +P H + +           L   VP        + +  D + + 
Sbjct: 19078 GVPVIARDIEIKPSVELPFHTFNVKARE------QLKIDVPFKGRPQATVNWRKDGQTL- 19130

Query: 754   HKNWHEVNSSPSKP-TILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPE 812
              K    VN S SK  T L++   ++  +  +++   N AG       S         +  
Sbjct: 19131 -KETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAG-------SITVPITIIVLDR 19182

Query: 813   PGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYL 872
             PGP   +   EV   S+ + W  P Y G   +S Y V+ +E  +  W  V+Q   A   +
Sbjct: 19183 PGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQ-AVARTSI 19241

Query: 873   KVSDLQQGKTYVFRVRAVNANGVGKPSDTSE-----PVLVEARPGTKEI----------- 916
             K+  L  G  Y FRV A N  G    S++S      P      PGT ++           
Sbjct: 19242 KIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVT 19301

Query: 917   -SAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKI 958
                 V++ G+  +G+   E  + S   W K+ + +  D + K+
Sbjct: 19302 WQVPVNDGGSRVIGYHL-EYKERSSILWSKANKILIADTQMKV 19343



 Score =  171 bits (434), Expect = 4e-42
 Identities = 161/542 (29%), Positives = 240/542 (44%), Gaps = 50/542 (9%)

Query: 376  DPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDA 435
            DPL  G P +P  L   +  +  + + WK P +   SP+ GY +++      ++ + N  
Sbjct: 8985 DPL--GPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKR 9042

Query: 436  PVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEK 495
                  + V  L E + Y FRV+AVN  G S PS   + V   D +       + + G+ 
Sbjct: 9043 LCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDT 9102

Query: 496  EIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGS 555
                  + +   A V G P  +   E S+N  V+  E PT    D L   I K  V    
Sbjct: 9103 IKVKAGEPVHIPADVTGLP--MPKIEWSKNETVI--EKPT----DALQ--ITKEEV---- 9148

Query: 556  WQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVV--PS 613
              R  A+T +  P+     + E K   + V ++NR G        S  +   V V   PS
Sbjct: 9149 -SRSEAKTELSIPK----AVREDKG-TYTVTASNRLG--------SVFRNVHVEVYDRPS 9194

Query: 614  APGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNL--WEPCNHKPIGYNRF 669
             P  +  +     S  + WD P      ++  Y +D   A      WE   +  +   R+
Sbjct: 9195 PPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAV-EKRY 9253

Query: 670  VVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTL 729
             +  L    QY FRV+AVN  G+S+   +SD + +Q    +P  P    +L     SM +
Sbjct: 9254 GIWKLIPNGQYEFRVRAVNKYGISDEC-KSDKVVIQDPYRLPGPPGKPKVLARTKGSMLV 9312

Query: 730  GWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSP-----SKPTILTVDGLTEGSLYEFK 784
             W  P  +GGSPI GY+L+KRE     W  V+ +P      K     V  L EG  Y+F+
Sbjct: 9313 SWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFR 9372

Query: 785  IAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPV 844
              A+N AGIG PS+PS+         P PGP       +   +S+ + WK P   G SP+
Sbjct: 9373 AMAINAAGIGPPSEPSDPEVAGDPIFP-PGPPSCPEVKDKTKSSISLGWKPPAKDGGSPI 9431

Query: 845  SGYFVDFREEDAGEWITVNQ----TTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSD 900
             GY V+ +EE   +W  VN+     TT      V +L++ + Y FRV+AVN  G  +PSD
Sbjct: 9432 KGYIVEMQEEGTTDWKRVNEPDKLITTCE--CVVPNLKELRKYRFRVKAVNEAGESEPSD 9489

Query: 901  TS 902
            T+
Sbjct: 9490 TT 9491



 Score =  171 bits (433), Expect = 5e-42
 Identities = 165/648 (25%), Positives = 245/648 (37%), Gaps = 83/648 (12%)

Query: 281   LEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVL--LKESKWTKMFFGEGQA 338
             L+  GV   + G+T+ L+  +   P      P   W +D     L  S   K+      +
Sbjct: 11900 LKLSGVLTVKAGDTIRLEAGVRGKPF-----PEVAWTKDKDATDLTRSPRVKIDTRADSS 11954

Query: 339   SLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDY 398
               S +   + D G Y +   +  G        FV  A   V   PG   +L+  D + D 
Sbjct: 11955 KFSLTKAKRSDGGKYVVTATNTAGS-------FVAYATVNVLDKPGPVRNLKIVDVSSDR 12007

Query: 399   VIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVR 458
               V W PP       +  Y +++CE     W     A V      VT L EG  YIFRVR
Sbjct: 12008 CTVCWDPPEDDGGCEIQNYILEKCETKRMVW-STYSATVLTPGTTVTRLIEGNEYIFRVR 12066

Query: 459   AVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVH 518
             A N  G   P+     +A                            +     PG P    
Sbjct: 12067 AENKIGTGPPTESKPVIA----------------------------KTKYDKPGRPDPPE 12098

Query: 519   ASEISRNYVVLSWEPPT-PRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLME 577
              +++S+  + + W PP    GK    YF+EK    S  W  VN ++A+   R  V +L+ 
Sbjct: 12099 VTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVN-KSAIPERRMKVQNLLP 12157

Query: 578   GKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKH 637
                Y FRV + N  G+ EPS  + P+ A+D    P  P        TK S+ + W +P +
Sbjct: 12158 DHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTKHSITLGWGKPVY 12217

Query: 638   E--EDLLGYYVD-----CCVAGTNLWEPCN-HKPIGYNRFVVHGLTTGEQYIFRVKAVNA 689
             +    ++GY V+        +    W+ CN    +    F V  L   ++Y FRV A N 
Sbjct: 12218 DGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQ 12277

Query: 690   VGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDK 749
             VG+   ++  + IK +  L  P      ++            K+     G PI  + + +
Sbjct: 12278 VGIGRPAELKEAIKPKEILEPPEIDLDASMR-----------KLVIVRAGCPIRLFAIVR 12326

Query: 750   -REVHHKNWHEVN----------SSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSD 798
              R      W +V                   L +   T     ++ +  VN AG      
Sbjct: 12327 GRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAG------ 12380

Query: 799   PSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGE 858
               +        +  PGP  DL   +V  TS  + W  P   G S V+ Y V+ RE D   
Sbjct: 12381 -EKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKT 12439

Query: 859   WITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVL 906
             W TV        +  V++L  G  Y FRV AVN  G G P+D  +PVL
Sbjct: 12440 WSTVTPEVKKTSF-HVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVL 12486



 Score =  171 bits (433), Expect = 5e-42
 Identities = 160/655 (24%), Positives = 271/655 (41%), Gaps = 62/655 (9%)

Query: 364   SDHSAFLFVRDADPL-VTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRC 422
             +++   L  + ADP+ V   P  P  +   D  R+ V ++W  P     S ++ Y V+  
Sbjct: 16806 NEYGIGLPAQTADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQ 16865

Query: 423   EVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLD 482
                +  W +C  A VK  +  +T L +G  Y+FRV AVN  G S P  ++  + A D + 
Sbjct: 16866 AKHSEKWSEC--ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLV- 16922

Query: 483   LRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPL 542
                   +  + +   + Y   +  D ++  P +G       R    ++W           
Sbjct: 16923 ------IEPDVKPAFSSYSVQVGQDLKIEVPISG-------RPKPTITWT---------- 16959

Query: 543   MYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSP 602
                  K  +      R+N   ++     ++ +  +     + +  AN  G     + T+ 
Sbjct: 16960 -----KDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVG-----QKTAS 17009

Query: 603   IQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEE--DLLGYYVDCCVAGTNLWEPCN 660
             I+   +       G V     +  S+ + W+ P +     +  Y V      T +W+  +
Sbjct: 17010 IEIVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVS 17069

Query: 661   HKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLL 720
                +      V  L TG +Y FR+ A N  G S  + ESD I  Q     P  P      
Sbjct: 17070 -ATVARTTLKVTKLKTGTEYQFRIFAENRYGQSF-ALESDPIVAQYPYKEPGPPGTPFAT 17127

Query: 721   NCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSL 780
                  SM + W  P  +GGSP++GY+L+++E +   W +VN +    T      L EG  
Sbjct: 17128 AISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIE 17187

Query: 781   YEFKIAAVNLAGIGEPSDPSEHF----KCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAP 836
             YEF++ A N+ G+G+ S  SE +     C+    PEP          V+   + + W  P
Sbjct: 17188 YEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEP--------IMVKRNEITLQWTKP 17239

Query: 837   VYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANG-V 895
             VY G S ++GY V+ R+   G W+  + T        VS L + + Y FRV A NA G +
Sbjct: 17240 VYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAI 17299

Query: 896   GKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDAS-------QFTWCKSYE 948
              KPSD++ P+  +       IS     +  I +        +A           W +  +
Sbjct: 17300 SKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDK 17359

Query: 949   EISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELER 1003
             EI +  R +I+     + L +K+  + D G Y +  S+  G S SF ++ + L+R
Sbjct: 17360 EIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAG-SKSFPVNVKVLDR 17413



 Score =  170 bits (431), Expect = 8e-42
 Identities = 168/685 (24%), Positives = 281/685 (41%), Gaps = 86/685 (12%)

Query: 305   PDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVS 364
             P + R +P   W +D   LK++    +        L     +KDD G YT+   +  G +
Sbjct: 18029 PVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTA 18088

Query: 365   DHSAFLFVRDADPLVTGAPGAPMD-LQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCE 423
               +  + V +        PG P+  ++  + + D+V+++W+PP  T    +  Y V++ +
Sbjct: 18089 TENLSVIVLEK-------PGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRD 18141

Query: 424   VGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDL 483
               T  W   + A V      +T L  G  Y FR+ A N  G S P               
Sbjct: 18142 TTTTTWHMVS-ATVARTTIKITKLKTGTEYQFRIFAENRYGKSAP--------------- 18185

Query: 484   RRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM 543
                    L+ +  I  Y        + PGPP     + IS++ +++ W  P   G   ++
Sbjct: 18186 -------LDSKAVIVQYP------FKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKII 18232

Query: 544   -YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSP 602
              Y +E+    S  W ++N +T ++  ++    L EG  Y F+V + N  G+ +PS+++  
Sbjct: 18233 GYHLEQKEKNSILWVKLN-KTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSEC 18291

Query: 603   IQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCN 660
               A+D    P  P  ++ +RN   +V ++W +P ++    + GY V+        W   +
Sbjct: 18292 FVARDPCDPPGRPEAIVITRN---NVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKAS 18348

Query: 661   HKPIGYNRFVVHGLTTGEQYIFRVKAVNAVG-MSENSQESDVIKVQAALTVPS----HPY 715
                +    F V GL   ++Y FRV A NA G  SE S  S  I  +  +  P+      Y
Sbjct: 18349 FTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKY 18408

Query: 716   GITLLNCDGHSMTLGWKVPKFSGGSPI--LGYYLDKREVHHKNWH-EVNSSPSKPTILTV 772
                ++   G +  L   +     G PI  + +  D +E+       E+ S+  K T++  
Sbjct: 18409 KDVIVVHAGETFVLEADI----RGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVK 18464

Query: 773   DGL-TEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAY-DLTFCEVRDTSLV 830
             D + T+G  Y  K++ V     G  S P          +  PGP    L    V      
Sbjct: 18465 DCIRTDGGQYILKLSNVG----GTKSIP-----ITVKVLDRPGPPEGPLKVTGVTAEKCY 18515

Query: 831   MLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAV 890
             + W  P+  G + +S Y ++ RE     W  V+    A  Y KV+ L  G  Y+FRV AV
Sbjct: 18516 LAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNY-KVTKLLPGNEYIFRVMAV 18574

Query: 891   NANGVGKPSDTS-----EPVLVEARPGTKEISA------------GVDEQGNIYLGFDCQ 933
             N  G+G+P ++       P      P T E+SA             VD+ G    G+   
Sbjct: 18575 NKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGY-IL 18633

Query: 934   EMTDASQFTWCKSYEEISDDERFKI 958
             E  D     W K  ++   D R ++
Sbjct: 18634 EKRDKEGVRWTKCNKKTLTDLRLRV 18658



 Score =  169 bits (429), Expect = 1e-41
 Identities = 139/511 (27%), Positives = 223/511 (43%), Gaps = 34/511 (6%)

Query: 677   GEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKF 736
             G +YIFRV+AVN  G+ E   ESD +  + A   P  P    +     +SMT+ W  P  
Sbjct: 20728 GNEYIFRVRAVNKYGIGE-PLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIA 20786

Query: 737   SGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEP 796
              GGS I GY+L+KR+     W +V     + T   V GLTE S Y++++ AVN AG G  
Sbjct: 20787 DGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPF 20846

Query: 797   SDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDA 856
             S+PSE +K  A  +  PGP   +   +   +S+ + W  PVY G S V+GY V+ R+ + 
Sbjct: 20847 SEPSEFYKA-ADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEE 20905

Query: 857   GEWITVNQ--TTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTK 914
              EW TV+         Y+ VS+L+ G  Y FRV AVN  G G+P + +EPV  +      
Sbjct: 20906 EEWTTVSTKGEVRTTEYV-VSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAP 20964

Query: 915   EISAGVDEQGNIY--LGFDCQEM-----TDASQFTWCKSYEEISDDERFKIETVGDHSKL 967
             EI   V  + ++    G D Q +           TW K  + +  D R+ IE     S L
Sbjct: 20965 EIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLL 21024

Query: 968   YLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSN-EIKN------------P 1014
              +    + D G Y +++ +  G   S  +  + L+   A    ++K+            P
Sbjct: 21025 TIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPP 21084

Query: 1015  TIPLKSELAYEIFDK--GRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGI 1072
              I   S +   + +K     R W    H     S++ I  D         R+  +   GI
Sbjct: 21085 LIDGGSPIINYVIEKRDATKRTWSVVSHKCSSTSFKLI--DLSEKTPFFFRVLAENEIGI 21142

Query: 1073  IEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHF 1132
              E       ++        I D   K  +   +I    K   +      +  + ++G   
Sbjct: 21143 GEPCETTEPVK-AAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGE 21201

Query: 1133  AEYLHWDVTEECEVRLVCKVANTKKETVFKW 1163
               + H  +++ CE+    +V+  K+++V ++
Sbjct: 21202 QTWSHAGISKTCEI----EVSQLKEQSVLEF 21228



 Score =  169 bits (429), Expect = 1e-41
 Identities = 160/636 (25%), Positives = 264/636 (41%), Gaps = 66/636 (10%)

Query: 302   LVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRG 361
             L  P   + +P   W +D + LKES++ +    E + +LS  +  K+  G YT+      
Sbjct: 21278 LELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTV------ 21331

Query: 362   GVSDHSAFLFVRDADPLVTGAPGAPMD-LQCHDANRDYVIVTWKPPNTTTESPVMGYFVD 420
              + D++          +  G P  P   ++  +   D VI++W  P       +  Y ++
Sbjct: 21332 -ILDNAVCRIAVPITVITLGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIE 21390

Query: 421   RCEVGTNNW-VQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALD 479
             + E    NW + C+       K P   L +   Y FRVRA N  G+S+P   S  VA   
Sbjct: 21391 KRETSQTNWKMVCSSVARTTFKVP--NLVKDAEYQFRVRAENRYGVSQPLVSSIIVA--- 21445

Query: 480   PLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGK 539
                                      +   ++PGPP       ++ + + L+W+ P   G 
Sbjct: 21446 -------------------------KHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGG 21480

Query: 540   DPLMYF-IEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSE 598
               +  F +EK    S  WQ+VN  + +    Y    L+EG  Y FRV + N  GLS PS+
Sbjct: 21481 SEVTGFHVEKKERNSILWQKVNT-SPISGREYRATGLVEGLDYQFRVYAENSAGLSSPSD 21539

Query: 599   ITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLW 656
              +    A      P  P  +  +R T   + ++W+ P  +    ++GY ++    G   W
Sbjct: 21540 PSKFTLAVSPVDPPGTPDYIDVTRET---ITLKWNPPLRDGGSKIVGYSIE-KRQGNERW 21595

Query: 657   EPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVG-MSENSQESDVIKVQAALTVPSHPY 715
               CN   +   ++ V GL+ G++Y FR+ A NAVG +S  SQ S +I  +     P   +
Sbjct: 21596 VRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEF 21655

Query: 716   GITLLNCDGHSMTLG--WKVPKFSGGSPI--LGYYLDKREVHHKNWHEVNSSPSKPTILT 771
             G      DG  +  G   ++     G P+  + ++ D  E+  +   E+       T L 
Sbjct: 21656 GPEYF--DGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGS-TSLF 21712

Query: 772   VDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAY-DLTFCEVRDTSLV 830
             V   T      + + A N +G       S   + +      PG     + F  +    + 
Sbjct: 21713 VRDATRDHRGVYTVEAKNASG-------SAKAEIKVKVQDTPGKVVGPIRFTNITGEKMT 21765

Query: 831   MLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAV 890
             + W AP+  G +P++ Y ++ RE     W  +     A  Y  +  L  G  Y FRV AV
Sbjct: 21766 LWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIK-LINGNEYQFRVSAV 21824

Query: 891   NANGVGKPSDTSEPVLVEARPGTKEISAGVDEQGNI 926
             N  GVG+P D S+PV+ + +  T   + G+ E  NI
Sbjct: 21825 NKFGVGRPLD-SDPVVAQIQ-YTVPDAPGIPEPSNI 21858



 Score =  169 bits (427), Expect = 2e-41
 Identities = 159/618 (25%), Positives = 253/618 (40%), Gaps = 50/618 (8%)

Query: 382   APGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICK 441
             AP  P  L   D  +  V + W  P     S + GY ++    G++ W       VK  +
Sbjct: 14659 APSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITT--VKGLE 14716

Query: 442   YPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQ 501
               V  L EG  Y F+V AVNSAG S P R S  V   +   L  L    +  +  IA   
Sbjct: 14717 CVVRNLTEGEEYTFQVMAVNSAGRSAP-RESRPVIVKEQTMLPELDLRGIYQKLVIAKAG 14775

Query: 502   DDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNA 561
             D+++ +  V G P              ++W+    +G   L              QRVN 
Sbjct: 14776 DNIKVEIPVLGRPKPT-----------VTWK----KGDQILK-----------QTQRVNF 14809

Query: 562   QTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLAS 621
             +T   S    + + +   S  + + + N  G  E  ++ + IQ  D+   P+ P  +   
Sbjct: 14810 ETTATSTILNINECVRSDSGPYPLTARNIVG--EVGDVIT-IQVHDIPGPPTGP--IKFD 14864

Query: 622   RNTKTSVVVQWDRPKHEED--LLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQ 679
               +   V   WD P+++    +  Y V+     +  W       I    +    LTTG +
Sbjct: 14865 EVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTVIR-TTYKATRLTTGLE 14923

Query: 680   YIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGG 739
             Y FRVKA N  G+      + ++       VP  P    +      SMT+ W  P   GG
Sbjct: 14924 YQFRVKAQNRYGVGPGITSACIV-ANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGG 14982

Query: 740   SPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDP 799
             SPILGY+++++E +   W  V+ +     I    GLT+G  YEF++ A N+AG  +PS P
Sbjct: 14983 SPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKP 15042

Query: 800   SEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEW 859
             SE         P PG    L    +   ++ + W  P Y+G   ++ Y V+ R+   G W
Sbjct: 15043 SEPMLALDPIDP-PGKPVPL---NITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRW 15098

Query: 860   ITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANG-VGKPSDTSEPVLVEARPGTKEISA 918
             +  N +        VS L +   Y FRV A NA G +  PS+ S+ +         +I  
Sbjct: 15099 LKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKV 15158

Query: 919   GVDEQGNIYL--GFDCQEMTDAS-----QFTWCKSYEEISDDERFKIETVGDHSKLYLKN 971
              V  +  + L  G   +   D S        W K  +E+    + +I+     + L  K+
Sbjct: 15159 DVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKD 15218

Query: 972   PDKEDLGTYSVSVSDTDG 989
               + D G Y+++ ++  G
Sbjct: 15219 STRRDSGAYTLTATNPGG 15236



 Score =  168 bits (426), Expect = 3e-41
 Identities = 145/581 (24%), Positives = 244/581 (41%), Gaps = 63/581 (10%)

Query: 335  EGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDA 394
            +G++ L      + D GLY +++ +  G++     + V D        PG P++    D 
Sbjct: 8456 KGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDT-------PGPPINFVFEDI 8508

Query: 395  NRDYVIVTWKPPNTTTESPVMGYFVDRCE--VGTNNWVQCNDAPVKICKYPVTGLFEGRS 452
             +  V+  W+PP     S ++ Y +++ +     + W+    + ++ CKY VT L EG+ 
Sbjct: 8509 RKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVT-STLRHCKYSVTKLIEGKE 8567

Query: 453  YIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPG 512
            Y+FRVRA N  G   P  VS  + A DP                         G    P 
Sbjct: 8568 YLFRVRAENRFGPGPPC-VSKPLVAKDPF------------------------GPPDAPD 8602

Query: 513  PPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAV 572
             P      +++ N +++ W  P   G   L Y++EK  V S  W RVN ++ + + +  V
Sbjct: 8603 KPI---VEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVN-KSLLNALKANV 8658

Query: 573  FDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQW 632
              L+EG +YVFRV + N  G  + S  + P  A D  + P  P     +  + T++ ++W
Sbjct: 8659 DGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTAHD-PISPPGPPIPRVTDTSSTTIELEW 8717

Query: 633  DRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAV 690
            + P      +++GY+VD  + GTN W  C  K I   ++ V  +  G  Y  RV AVNA 
Sbjct: 8718 EPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAA 8777

Query: 691  GMSENSQESDVIKVQAALTVPSHPYGITL-LNCDGHSMTLGWK---VPKFSGGSPILGYY 746
            G     +   V      +  P  P  + L ++  G    +  K   +P    G P+    
Sbjct: 8778 GEGPPGETQPV-----TVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKV 8832

Query: 747  LDKREVH-HKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
              K E    K+   +++  +K  ++  D L +     + I A N  G       S+    
Sbjct: 8833 WTKEEGELDKDRVVIDNVGTKSELIIKDALRKDH-GRYVITATNSCG-------SKFAAA 8884

Query: 806  EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQT 865
                   PGP  DL          ++ W  P   G S ++G+ ++ ++     W    +T
Sbjct: 8885 RVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIET 8944

Query: 866  TTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVL 906
              +     ++ L +G+ Y FRV A N  G G P +   P+L
Sbjct: 8945 ERSK--CDITGLLEGQEYKFRVIAKNKFGCGPPVEIG-PIL 8982



 Score =  167 bits (424), Expect = 5e-41
 Identities = 156/610 (25%), Positives = 250/610 (40%), Gaps = 58/610 (9%)

Query: 305   PDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVS 364
             P L R +P   W + D +LK+++            L+ +   + D G Y L   +R  V 
Sbjct: 14783 PVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPL--TARNIVG 14840

Query: 365   DHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEV 424
             +    + ++  D  + G P  P+     + + D+V  +W PP      P+  Y V+  + 
Sbjct: 14841 EVGDVITIQVHD--IPGPPTGPIKFD--EVSSDFVTFSWDPPENDGGVPISNYVVEMRQT 14896

Query: 425   GTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLR 484
              +  WV+     ++   Y  T L  G  Y FRV+A N  G+  P   S  + A  P    
Sbjct: 14897 DSTTWVELATTVIR-TTYKATRLTTGLEYQFRVKAQNRYGVG-PGITSACIVANYPF--- 14951

Query: 485   RLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM- 543
                                     +VPGPP     + ++++ + +SW  P   G  P++ 
Sbjct: 14952 ------------------------KVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILG 14987

Query: 544   YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPI 603
             Y +E+       WQ V ++  V    +    L +G +Y FRV++ N  G S+PS+ + P+
Sbjct: 14988 YHVERKERNGILWQTV-SKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPM 15046

Query: 604   QAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEE--DLLGYYVDCCVAGTNLWEPCNH 661
              A D       PG+ +    T+ +V ++W +P++     +  Y V+        W   N 
Sbjct: 15047 LALDPI---DPPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANF 15103

Query: 662   KPIGYNRFVVHGLTTGEQYIFRVKAVNAVG-MSENSQESDVIKVQAALTVPSHPYGI--- 717
               I  N F V GLT    Y FRV A NA G +S  S+ SD I  +  +  P     +   
Sbjct: 15104 SNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFK 15163

Query: 718   -TLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLT 776
              T++   G +  L   V       P + +  D +E+      E+  +     ++  D  T
Sbjct: 15164 DTVILKAGEAFRLEADVS--GRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDS-T 15220

Query: 777   EGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAP 836
                   + + A N  G  +       F  +    P P P   L   EV     V+ W  P
Sbjct: 15221 RRDSGAYTLTATNPGGFAK-----HIFNVKVLDRPGP-PEGPLAVTEVTSEKCVLSWFPP 15274

Query: 837   VYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVG 896
             +  G + +  Y V  RE     W  V       + LKV+ L +G  Y+FRV AVN  GVG
Sbjct: 15275 LDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTK-LKVTKLLKGNEYIFRVMAVNKYGVG 15333

Query: 897   KPSDTSEPVL 906
             +P + SEPVL
Sbjct: 15334 EPLE-SEPVL 15342



 Score =  167 bits (424), Expect = 5e-41
 Identities = 158/611 (25%), Positives = 256/611 (41%), Gaps = 64/611 (10%)

Query: 309   RVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSA 368
             R +P   W +D + LK++    +       +LS    HKDD G Y + + +  G    S 
Sbjct: 16951 RPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASI 17010

Query: 369   FLFVRDA-DPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTN 427
              +   D  DP     P  P+     D + + + ++W PP  T    +  Y V + +  T 
Sbjct: 17011 EIVTLDKPDP-----PKGPVKFD--DVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTT 17063

Query: 428   NWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQ 487
              W     A V      VT L  G  Y FR+ A N  G                      Q
Sbjct: 17064 VW-DVVSATVARTTLKVTKLKTGTEYQFRIFAENRYG----------------------Q 17100

Query: 488   AVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFI 546
             +  LE +  +A Y        + PGPP    A+ IS++ +V+ W  P   G  P++ Y +
Sbjct: 17101 SFALESDPIVAQYP------YKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHL 17154

Query: 547   EKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQ 606
             E+    S  W +VN +T +   ++   +L EG  Y FRV + N  G+ + S+ +    A+
Sbjct: 17155 ERKERNSILWTKVN-KTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVAR 17213

Query: 607   DVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEED--LLGYYVDCCVAGTNLWEPCNHKPI 664
             D    P  P  ++  RN    + +QW +P ++    + GY V+        W   +   +
Sbjct: 17214 DPCDPPGTPEPIMVKRN---EITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNV 17270

Query: 665   GYNRFVVHGLTTGEQYIFRVKAVNAVG-MSENSQESDVIKVQAALTVP----SHPYGITL 719
                +F V GLT  ++Y FRV A NA G +S+ S  +  I  +  + +P       +  T+
Sbjct: 17271 IETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTI 17330

Query: 720   LNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGL-TEG 778
             +   G +  L  +        P + +    +E+      E+ ++  K  ++  D +  +G
Sbjct: 17331 VVNAGETFRL--EADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDG 17388

Query: 779   SLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAY-DLTFCEVRDTSLVMLWKAPV 837
               Y  +  A N+AG       S+ F      +  PGP    +    V      + W  P+
Sbjct: 17389 GQYILR--ASNVAG-------SKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPPL 17439

Query: 838   YSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGK 897
               G S +S Y V+ RE     W  V      N  LKV+ L +G  YVFR+ AVN  GVG+
Sbjct: 17440 QDGGSDISHYVVEKRETSRLAWTVVASEVVTNS-LKVTKLLEGNEYVFRIMAVNKYGVGE 17498

Query: 898   PSDTSEPVLVE 908
             P + S PVL++
Sbjct: 17499 PLE-SAPVLMK 17508



 Score =  167 bits (423), Expect = 7e-41
 Identities = 161/636 (25%), Positives = 268/636 (42%), Gaps = 74/636 (11%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
             PG P+ L   +  R  V + W  P  T    +  Y V++ ++    W++ N + +   ++
Sbjct: 15055 PGKPVPL---NITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEF 15111

Query: 443   PVTGLFEGRSYIFRVRAVNSAG-ISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQ 501
              V+GL E  +Y FRV A N+AG IS PS  SDA+   D ++  +++ V ++ +  + +  
Sbjct: 15112 TVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIK-VDVKFKDTVILKA 15170

Query: 502   DD---LEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQR 558
              +   LE D     PPT             + W       +      I+   +   S   
Sbjct: 15171 GEAFRLEADVSGRPPPT-------------MEWSKDGKELEGTAKLEIK---IADFSTNL 15214

Query: 559   VNAQTAVR-SPRYAVFDLMEG--KSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAP 615
             VN  +  R S  Y +     G    ++F V   +R G  E                    
Sbjct: 15215 VNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPE-------------------- 15254

Query: 616   GRVLASRNTKTSVVVQWDRPKHEEDL-LGYYV-----DCCVAGTNLWEPCNHKPIGYNRF 669
             G +  +  T    V+ W  P  +    + +Y+        +A TN+        +   + 
Sbjct: 15255 GPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNV-----ASEVQVTKL 15309

Query: 670   VVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTL 729
              V  L  G +YIFRV AVN  G+ E  +   V+ V      P  P    +      SM +
Sbjct: 15310 KVTKLLKGNEYIFRVMAVNKYGVGEPLESEPVLAVNP-YGPPDPPKNPEVTTITKDSMVV 15368

Query: 730   GWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVN 789
              W  P   GGS I+ Y +++R+   + W + N          V GLTEG  YEF+I A N
Sbjct: 15369 CWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAEN 15428

Query: 790   LAGIGEPSDPSEHFK-CEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYF 848
              AGI  PS  S  +K C+  T+ +PGP  +    +   +S+ + W  P+Y G S ++GY 
Sbjct: 15429 AAGISAPSPTSPFYKACD--TVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYM 15486

Query: 849   VDFR--EEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVL 906
             V+    EED  + +T      A  Y  ++ L + + Y  R+ A+N+ G+G+P+       
Sbjct: 15487 VEIALPEEDEWQIVTPPAGLKATSY-TITGLTENQEYKIRIYAMNSEGLGEPALVPGTPK 15545

Query: 907   VEARPGTKEISAGVDEQGNIYLGFDCQ-------EMTDASQFTWCKSYEEISDDERFKIE 959
              E R    EI    D +  + +   C        +   A +  W + + E  D  +  IE
Sbjct: 15546 AEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLD--KASIE 15603

Query: 960   TVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
             +   ++ L + N ++ D G Y ++V ++ G  S+FV
Sbjct: 15604 STSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFV 15639



 Score =  167 bits (422), Expect = 9e-41
 Identities = 157/616 (25%), Positives = 246/616 (39%), Gaps = 58/616 (9%)

Query: 309   RVQPRAEWYR---DDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSD 365
             R  P+  W +   D+V+ K     ++   +  A L   +  +DD G Y+L +V+  G  +
Sbjct: 12328 RPAPKVTWRKVGIDNVVRKG----QVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAG--E 12381

Query: 366   HSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVG 425
              + F+ VR  D      PG   DL+  D  +    V+W PP     S V  Y V++ E  
Sbjct: 12382 KAVFVNVRVLD-----TPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREAD 12436

Query: 426   TNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRR 485
                W       VK   + VT L  G  Y FRV AVN  G   P+ V   V A DPL    
Sbjct: 12437 RKTWSTVTPE-VKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPL---- 12491

Query: 486   LQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYF 545
                                      P PP  +  +E+++N   L+W PP   G   +  +
Sbjct: 12492 -----------------------SEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGY 12528

Query: 546   IEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQA 605
             I           R    + V+     V  L EGK Y FRV + N  G+S P E     +A
Sbjct: 12529 ITSYREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEA 12588

Query: 606   QDVTVVPS--APGRVLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNHKP 663
             ++  + P    P ++      K  +        H         D  V  ++L     HK 
Sbjct: 12589 KEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHL---AVHKA 12645

Query: 664   IGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCD 723
                +  ++  +T  +   + + A N+ G   ++Q+  V+ V  A   P  P+ I+  + D
Sbjct: 12646 DSSSILIIKDVTRKDSGYYSLTAENSSG--TDTQKIKVV-VMDAPGPPQPPFDIS--DID 12700

Query: 724   GHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEF 783
               + +L W +P   GGS I  Y ++K +V   +W    +S +K T   V  L  G  Y F
Sbjct: 12701 ADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTK-TSCRVGKLIPGQEYIF 12759

Query: 784   KIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSP 843
             ++ A N  GI EP    +      +    P    +    +V    + + W  P   G SP
Sbjct: 12760 RVRAENRFGISEPLTSPK--MVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSP 12817

Query: 844   VSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSE 903
             + GY ++ +E ++  W+  N T   +     + L +G  Y FR+ A+N  G   PS  +E
Sbjct: 12818 IIGYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTE 12877

Query: 904   PVLVEA---RPGTKEI 916
              V        PG  E+
Sbjct: 12878 YVTARMPVDPPGKPEV 12893



 Score =  166 bits (420), Expect = 2e-40
 Identities = 155/611 (25%), Positives = 243/611 (39%), Gaps = 63/611 (10%)

Query: 312   PRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLF 371
             P  +W + D  L  +   ++   +   SLS     + D G Y L+  +  G    +  + 
Sbjct: 16268 PTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVK 16327

Query: 372   VRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQ 431
             V D      G P  P+ +    A +    + WKPP     S ++ Y V+R E     W  
Sbjct: 16328 VLDRP----GPPEGPVVISGVTAEK--CTLAWKPPLQDGGSDIINYIVERRETSRLVWTV 16381

Query: 432   CNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHL 491
               DA V+     VT L EG  Y FR+ AVN  G+  P   S+ V A +P           
Sbjct: 16382 V-DANVQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLE-SEPVVAKNPF---------- 16429

Query: 492   EGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWE-PPTPRGKDPLMYFIEKSV 550
                               VP  P     + ++++ +++ WE P +  G + L Y +EK  
Sbjct: 16430 -----------------VVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVLEKRD 16472

Query: 551   VGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTV 610
                  W R + +  +   R  V  L+E   Y FRV + N  GLSEPS  ++  +A D   
Sbjct: 16473 KEGIRWTRCHKRL-IGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACDPIY 16531

Query: 611   VPSAPGRVLASRNTKTSVVVQWDRPKHEE--DLLGYYVDCCVAGTNLWEPCNHKPIGYNR 668
              P  P        T++SV + W +P ++   ++ GY V+ C      W  C   P G N+
Sbjct: 16532 KPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCT-PPTGINK 16590

Query: 669   --FVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHS 726
                 V  L    +Y FR+ A+N  G+ E++     I V+  L  P     + L       
Sbjct: 16591 TNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKI---- 16646

Query: 727   MTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIA 786
                   +   +GGS  L   +  R      W +V+       I+ V      S     + 
Sbjct: 16647 ------INIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDV----TSSFTSLVLD 16696

Query: 787   AVNLAGIG------EPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSG 840
              VN    G      E S  ++        +  P P  +L   E+   S+ + W+ P+  G
Sbjct: 16697 NVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDG 16756

Query: 841   SSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSD 900
              S +  Y V+ RE     +  V      N + K+  LQ+G +Y FRV A N  G+G P+ 
Sbjct: 16757 GSKIKNYIVEKREATRKSYAAVVTNCHKNSW-KIDQLQEGCSYYFRVTAENEYGIGLPAQ 16815

Query: 901   TSEPVLVEARP 911
             T++P+ V   P
Sbjct: 16816 TADPIKVAEVP 16826



 Score =  165 bits (418), Expect = 3e-40
 Identities = 154/563 (27%), Positives = 231/563 (41%), Gaps = 60/563 (10%)

Query: 376   DPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDA 435
             DP+   AP  P   +  D  +    + W PP     S V GY V+  E G   W +  D 
Sbjct: 10112 DPI---APPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDK 10168

Query: 436   PVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEK 495
              V+  K  VTGL EG  Y FRVRAVN AGI  P  V+D +   D L              
Sbjct: 10169 EVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRL-------------- 10214

Query: 496   EIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGS 555
                    DL+ DA V      VHA  + R    +S +PP       + + + +  +    
Sbjct: 10215 ----VSPDLQLDASVRDRIV-VHAGGVIRIIAYVSGKPPPT-----VTWNMNERTLP--- 10261

Query: 556   WQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAP 615
              Q    +T   S    + +       V+ +L+ N  G  + + I       DV  VP   
Sbjct: 10262 -QEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIV------DVLDVPGPV 10314

Query: 616   GRVLASRN-TKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVH 672
             G    + N T  S  + W  P+ +    +  Y ++   +    W P  +     N   V 
Sbjct: 10315 GTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNA-TVQ 10373

Query: 673   GLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWK 732
             GL  G+ Y FR+ A N++GM    + S+ + ++  +TVP  P  + +     +++TL W 
Sbjct: 10374 GLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWN 10433

Query: 733   VPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAG 792
              PK+ GGS I+ Y L+ R +  + +H+V +        TV GL EG  YE++++AVN+ G
Sbjct: 10434 PPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVG 10493

Query: 793   IGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPV----YSGS-SPVSGY 847
              G+PS  ++   C+    P   P   L F   RD   + + +A      YSG   P   +
Sbjct: 10494 QGKPSFCTKPITCKDELAP---PTLHLDF---RDKLTIRVGEAFALTGRYSGKPKPKVSW 10547

Query: 848   FVDFRE--EDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPV 905
             F D  +  ED    I     T A   +K      GK  V     V  N  G      +  
Sbjct: 10548 FKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCV-----VVENSTGSRKGFCQVN 10602

Query: 906   LVEARPGTKEISAGVDEQGNIYL 928
             +V+ RPG        DE    Y+
Sbjct: 10603 VVD-RPGPPVGPVSFDEVTKDYM 10624



 Score =  162 bits (410), Expect = 2e-39
 Identities = 182/806 (22%), Positives = 327/806 (40%), Gaps = 96/806 (11%)

Query: 153   APEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVH 212
             AP I   ++  T     + +L   + G P P ++WY+ G  + Q+    KY++ S+   H
Sbjct: 24227 APGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSR---KYKMSSDGRTH 24283

Query: 213   TLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIP 272
             TL +   + +D   Y+ +ATN  G+V T++ ++++                        P
Sbjct: 24284 TLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQA----------------------TP 24321

Query: 273   YTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMF 332
               H      EK+   +   G T+ L    +  P      P   W+    LL+ S+   + 
Sbjct: 24322 QFHPGYPLKEKY---YGAVGSTLRLHVMYIGRP-----VPAMTWFHGQKLLQNSENITIE 24373

Query: 333   FGEGQASLSFSHLH-KDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQC 391
               E    L   ++  K   G Y +++ +  G  D    + ++D     TG    P+ ++ 
Sbjct: 24374 NTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTG----PIVIEA 24429

Query: 392   HDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGR 451
                N    +++WKPP     S +  Y V++CE       Q   + + +    +  L E  
Sbjct: 24430 LLKNS--AVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENA 24487

Query: 452   SYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVP 511
              Y FRV A N+ GIS P  VS  V    P +                            P
Sbjct: 24488 GYYFRVSAQNTFGISDPLEVSSVVIIKSPFEK---------------------------P 24520

Query: 512   GPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRY 570
             G P     + ++++  V++W+PP   G   +  Y++EK       W  V  +  +R   +
Sbjct: 24521 GAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEE-IRETVF 24579

Query: 571   AVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQ-DVTVVPSAPGRVLASRNTK--TS 627
             +V +L+EG  Y FRV   N  G SE SEI+ PI  + DV +        L + N +  ++
Sbjct: 24580 SVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSN 24639

Query: 628   VVVQWDRPKHEEDLLGYYVDCC-VAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKA 686
               +      H + ++ +Y     +    L         GY++ ++  +T  +  +++V+A
Sbjct: 24640 ATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRA 24699

Query: 687   VNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNC-DGHSMTLGWKVPKFSGGSPILGY 745
              N  G S +   S  ++V A + +P    G+  ++   G  +++  K+P      P++ +
Sbjct: 24700 TNQGG-SVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSI--KIPFSGKPDPVITW 24756

Query: 746   YLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
                +  + +   ++V  + S  +++  +G+       + + A N  GI + +        
Sbjct: 24757 QKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKT-------V 24809

Query: 806   EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQT 865
             E      P P   +   +V   S+ + W  P   G S ++ Y V+     A  W+ V Q 
Sbjct: 24810 ELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQ- 24868

Query: 866   TTANRYLKVSDLQQGKT-YVFRVRAVNANGVGKPSDTSEPVLV-EARPGTKEISAGVDEQ 923
                 RY  ++    GKT Y FRV A N  G+ KPS+ SEP +  E +         VDE 
Sbjct: 24869 ARETRYTVINLF--GKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDET 24926

Query: 924   GNIYLGFDCQEMTDASQFTWCKSYEE 949
               +        MT AS  +  + YE+
Sbjct: 24927 REV-------SMTKASHSSTKELYEK 24945



 Score =  161 bits (408), Expect = 4e-39
 Identities = 155/638 (24%), Positives = 255/638 (39%), Gaps = 72/638 (11%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
             PG P +L   D  + +V + W+ P+    SP + Y V+R   G+++W + +   +K   Y
Sbjct: 11796 PGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHY 11855

Query: 443   PVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALD----PLDLRRLQAVHLEGEKEIA 498
              V    E + Y FRV+  N  G S   +  + V   D     LDL+    + ++    I 
Sbjct: 11856 MVDRCVENQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIR 11915

Query: 499   IYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQR 558
             +       +A V G P           +  ++W               +K         R
Sbjct: 11916 L-------EAGVRGKP-----------FPEVAWTK-------------DKDATDLTRSPR 11944

Query: 559   VNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRV 618
             V   T   S ++++          + V + N  G            A     V   PG V
Sbjct: 11945 VKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAG---------SFVAYATVNVLDKPGPV 11995

Query: 619   LASRNTKTSVV------VQWDRPKHEE--DLLGYYVDCCVAGTNLWEPCNHKPIGYNRFV 670
                RN K   V      V WD P+ +   ++  Y ++ C     +W   +   +     V
Sbjct: 11996 ---RNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTV 12052

Query: 671   VHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLG 730
                L  G +YIFRV+A N +G    ++   VI  +     P  P    +       MT+ 
Sbjct: 12053 TR-LIEGNEYIFRVRAENKIGTGPPTESKPVI-AKTKYDKPGRPDPPEVTKVSKEEMTVV 12110

Query: 731   WKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNL 790
             W  P++ GG  I GY+L+K+E H   W  VN S      + V  L     Y+F++ A N 
Sbjct: 12111 WNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENE 12170

Query: 791   AGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVD 850
              GIGEPS PS     +    P PGP  +    +    S+ + W  PVY G +P+ GY V+
Sbjct: 12171 IGIGEPSLPSRPVVAKDPIEP-PGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVE 12229

Query: 851   FREEDAGE-----WITVNQTT-TANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEP 904
              R + A       W   N       +   V+ L + + Y FRV A N  G+G+P++  E 
Sbjct: 12230 MRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEA 12289

Query: 905   VLVE--ARPGTKEISAGVDEQGNIYLG-----FDCQEMTDASQFTWCKSYEEISDDERFK 957
             +  +    P   ++ A + +   +  G     F       A + TW K   + +   + +
Sbjct: 12290 IKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGID-NVVRKGQ 12348

Query: 958   IETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
             ++ V   + L + N  ++D G YS+++ +  G  + FV
Sbjct: 12349 VDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFV 12386



 Score =  161 bits (407), Expect = 5e-39
 Identities = 157/614 (25%), Positives = 257/614 (41%), Gaps = 62/614 (10%)

Query: 305   PDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVS 364
             P + R  P   W++D+V LK++        E  + L+     ++D G Y +++ +  G +
Sbjct: 15865 PFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEA 15924

Query: 365   DHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEV 424
               +  + V D      G P  P+ +   +   D + ++W PP     S +  Y V++ + 
Sbjct: 15925 IETLNVIVLDKP----GPPTGPVKMD--EVTADSITLSWGPPKYDGGSSINNYIVEKRDT 15978

Query: 425   GTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLR 484
              T  W Q   A V         L  G  Y FR+ A N  G                    
Sbjct: 15979 STTTW-QIVSATVARTTIKACRLKTGCEYQFRIAAENRYG-------------------- 16017

Query: 485   RLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSW-EPPTPRGKDPLM 543
               ++ +L  E  +A Y        +VPGPP     +  SR+ + + W EP +  G   + 
Sbjct: 16018 --KSTYLNSEPTVAQYP------FKVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIG 16069

Query: 544   YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPI 603
             Y +E+    S  W ++N +T +   ++    L EG  Y FRV + N  G+ +PS+++   
Sbjct: 16070 YHLERKERNSILWVKLN-KTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECY 16128

Query: 604   QAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNH 661
              A+D    P  P  ++ +RN   SV +QW +P ++    + GY V+        W   + 
Sbjct: 16129 VARDPCDPPGRPEAIIVTRN---SVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASF 16185

Query: 662   KPIGYNRFVVHGLTTGEQYIFRVKAVNAVGM-SENSQESDVIKVQAALTVP----SHPYG 716
               I    F V GL    +Y FRV A NA G+ SE S+ +  I  +  +  P       Y 
Sbjct: 16186 TNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYK 16245

Query: 717   ITLLNCDGHSMTLGWKVPKFSGGSPI--LGYYLDKREVHHKNWHEVNSSPSKPTILTVDG 774
              T++   G S    +KV     G PI  + +    +E+ +    E+ S+    ++   D 
Sbjct: 16246 DTIVVHAGES----FKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDA 16301

Query: 775   LTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWK 834
             +   S   + + A N+AG     + S     +    P P P   +    V      + WK
Sbjct: 16302 VRVDS-GNYILKAKNVAG-----ERSVTVNVKVLDRPGP-PEGPVVISGVTAEKCTLAWK 16354

Query: 835   APVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANG 894
              P+  G S +  Y V+ RE     W TV          KV+ L +G  Y FR+ AVN  G
Sbjct: 16355 PPLQDGGSDIINYIVERRETSRLVW-TVVDANVQTLSCKVTKLLEGNEYTFRIMAVNKYG 16413

Query: 895   VGKPSDTSEPVLVE 908
             VG+P + SEPV+ +
Sbjct: 16414 VGEPLE-SEPVVAK 16426



 Score =  160 bits (406), Expect = 6e-39
 Identities = 164/646 (25%), Positives = 251/646 (38%), Gaps = 84/646 (13%)

Query: 291  EGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDE 350
            EGE +++       P      P   W++D   +K S    M      A L      + D 
Sbjct: 8095 EGEKLSIPVPFRAVP-----VPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADA 8149

Query: 351  GLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTT 410
            G+YT+ + ++ G +  S        +  V G PG   D++  D  +    +TW+PP    
Sbjct: 8150 GIYTITLENKLGSATASI-------NVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDG 8202

Query: 411  ESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSR 470
             +P++ Y ++R E G   ++       K+  + V  L     Y FRV+AVN  G      
Sbjct: 8203 GTPILHYVLERREAGRRTYIPVMSGENKL-SWTVKDLIPNGEYFFRVKAVNKVGGGEYIE 8261

Query: 471  VSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLS 530
            + + V A DP                            Q P PP  V     +   + ++
Sbjct: 8262 LKNPVIAQDP---------------------------KQPPDPPVDVEVHNPTAEAMTIT 8294

Query: 531  WEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSAN 589
            W+PP   G   +M Y IEK   G   W+R N +  V    Y    L EGK Y FRV + N
Sbjct: 8295 WKPPLYDGGSKIMGYIIEKIAKGEERWKRCN-EHLVPILTYTAKGLEEGKEYQFRVRAEN 8353

Query: 590  RHGLSEPSEITSPIQAQDVTVVPSAPGRVL------------ASRNTKTSVVVQWDR--- 634
              G+SEPS  T P +A D    P    R              AS +      + W +   
Sbjct: 8354 AAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYPTITWIKDEN 8413

Query: 635  ---PKHEEDLLGYYVDCCVAGTNLWEP----------CNHKPIGYNRFVVHGLTTGEQYI 681
               P+  +      V          EP           ++   G ++  V      +  +
Sbjct: 8414 VIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGL 8473

Query: 682  FRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSP 741
            + +K  N  G+++      V      L  P  P      +    S+   W+ P   GGS 
Sbjct: 8474 YMIKVENDHGIAKAPCTVSV------LDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGSE 8527

Query: 742  ILGYYLDKRE--VHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDP 799
            I+ Y L+K++       W  V S+  +    +V  L EG  Y F++ A N  G G P   
Sbjct: 8528 IINYTLEKKDKTKPDSEWIVVTST-LRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVS 8586

Query: 800  SEHFKCEAWTMPEPGPAYDLTFCE-VRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGE 858
                  + +  P+   A D    E V   S+++ W  P  +G SP+ GY+++ RE ++  
Sbjct: 8587 KPLVAKDPFGPPD---APDKPIVEDVTSNSMLVKWNEPKDNG-SPILGYWLEKREVNSTH 8642

Query: 859  WITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEP 904
            W  VN++        V  L +G TYVFRV A NA G GK S  S+P
Sbjct: 8643 WSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDP 8688



 Score =  158 bits (399), Expect = 4e-38
 Identities = 128/444 (28%), Positives = 198/444 (44%), Gaps = 35/444 (7%)

Query: 511  PGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPR 569
            P  P  +   +I+++ V L+WEPP   G  PL  Y +EK  V   +W +V     V    
Sbjct: 7183 PSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV--MDFVTDLE 7240

Query: 570  YAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV 629
            + V DL++GK Y+F+V + N+ G  EP+ +  P+       VP  P  V     T  S+ 
Sbjct: 7241 FTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWRDRTANSIF 7300

Query: 630  VQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAV 687
            + WD PK++    + GY V+ C  G++ W  C  +P+   +  V GL  G+ Y +RVKA+
Sbjct: 7301 LTWDPPKNDGGSRIKGYIVERCPRGSDKWVACG-EPVAETKMEVTGLEEGKWYAYRVKAL 7359

Query: 688  NAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKV--PKFSGGSPILGY 745
            N  G S+ S+ ++ I+       P     + LL   G ++  G K+  P    G P    
Sbjct: 7360 NRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLL--AGLTVKAGTKIELPATVTGKPEPKI 7417

Query: 746  YLDKREVHHKNWHE--VNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHF 803
               K ++  K      + + P K T+  VD         + I AVN+ G           
Sbjct: 7418 TWTKADMILKQDKRITIENVPKKSTVTIVDS-KRSDTGTYIIEAVNVCGRATA------- 7469

Query: 804  KCEAWTMPEPGP--AYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWIT 861
              E   + +PGP  A+D+T  +V + S ++ W  P   G S ++ Y V+ R  D+  W  
Sbjct: 7470 VVEVNVLDKPGPPAAFDIT--DVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHK 7527

Query: 862  VNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISAGVD 921
            ++ T     + K + L   K Y+FRV A N  GVG+P        V+A P T +     D
Sbjct: 7528 LSSTVKDTNF-KATKLIPNKEYIFRVAAENMYGVGEP--------VQASPITAKYQ--FD 7576

Query: 922  EQGNIYLGFDCQEMTDASQFTWCK 945
              G            DA   TWC+
Sbjct: 7577 PPGPPTRLEPSDITKDAVTLTWCE 7600



 Score =  157 bits (397), Expect = 7e-38
 Identities = 168/638 (26%), Positives = 259/638 (40%), Gaps = 70/638 (10%)

Query: 372   VRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQ 431
             V+ A+P     P  P  +   D ++    + W+ P     S V+GY V+    GT  W  
Sbjct: 17902 VKAAEP-----PSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSI 17956

Query: 432   CNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHL 491
               ++  K+C   VTGL  G+ Y FRV+A N  G S P  +   V A D   L    ++ L
Sbjct: 17957 VAES--KVCNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKD---LTIQPSLKL 18011

Query: 492   EGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVV 551
                       +DL+ +  V G P              +SW     +  +PL         
Sbjct: 18012 PFNTYSIQAGEDLKIEIPVIGRPRPN-----------ISWV----KDGEPLK-------- 18048

Query: 552   GSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVF---RVLSANRHGLSEPSEITSPIQAQDV 608
                   RVN +    S    V  + EG    F    V + N  G +  +E  S I    V
Sbjct: 18049 ---QTTRVNVEETATS---TVLHIKEGNKDDFGKYTVTATNSAGTA--TENLSVI----V 18096

Query: 609   TVVPSAP-GRVLASRNTKTSVVVQWDRPKHEE--DLLGYYVDCCVAGTNLWEPCNHKPIG 665
                P  P G V     +   VV+ W+ P +     +  Y V+     T  W   +   + 
Sbjct: 18097 LEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVS-ATVA 18155

Query: 666   YNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGH 725
                  +  L TG +Y FR+ A N  G S       VI VQ     P  P    + +    
Sbjct: 18156 RTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVI-VQYPFKEPGPPGTPFVTSISKD 18214

Query: 726   SMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKI 785
              M + W  P   GG+ I+GY+L+++E +   W ++N +P + T     GL EG  YEFK+
Sbjct: 18215 QMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKV 18274

Query: 786   AAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVS 845
             +A N+ GIG+PS  SE F       P   P   +    +   ++ + WK P Y G S ++
Sbjct: 18275 SAENIVGIGKPSKVSECFVARDPCDPPGRPEAIV----ITRNNVTLKWKKPAYDGGSKIT 18330

Query: 846   GYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANG-VGKPSDTSEP 904
             GY V+ ++   G W+  + T        VS L + + Y FRV A NA G   +PSD+S  
Sbjct: 18331 GYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSG- 18389

Query: 905   VLVEARPGTKEISAGVDEQGNIYLGFDCQEM---------TDASQFTWCKSYEEISDD-E 954
               + AR      +A +D +    +     E                 W K  +E+ +   
Sbjct: 18390 -AITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAA 18448

Query: 955   RFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSS 992
             R +I++    + L +K+  + D G Y + +S+  G  S
Sbjct: 18449 RMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKS 18486



 Score =  151 bits (382), Expect = 4e-36
 Identities = 175/732 (23%), Positives = 295/732 (40%), Gaps = 58/732 (7%)

Query: 511  PGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPR 569
            PGPP      +I +  V+  WEPP   G   ++ Y +EK        + +   + +R  +
Sbjct: 8497 PGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCK 8556

Query: 570  YAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV 629
            Y+V  L+EGK Y+FRV + NR G   P  ++ P+ A+D    P AP + +    T  S++
Sbjct: 8557 YSVTKLIEGKEYLFRVRAENRFGPGPPC-VSKPLVAKDPFGPPDAPDKPIVEDVTSNSML 8615

Query: 630  VQWDRPK-HEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVN 688
            V+W+ PK +   +LGY+++     +  W   N   +   +  V GL  G  Y+FRV A N
Sbjct: 8616 VKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAEN 8675

Query: 689  AVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLD 748
            A G  + S  SD       ++ P  P    + +    ++ L W+ P F+GG  I+GY++D
Sbjct: 8676 AAGPGKFSPPSDPKTAHDPISPPGPPIP-RVTDTSSTTIELEWEPPAFNGGGEIVGYFVD 8734

Query: 749  KREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAW 808
            K+ V    W        K    TV  + EG+ Y+ +++AVN AG G P +       E  
Sbjct: 8735 KQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGETQPVTVAE-- 8792

Query: 809  TMPEPGPAYDLTFCEVRDTSLVMLWK-----APVYSGSSPVSGYFVDFREEDAGEWITVN 863
              P+  PA +L    V+    +M  K     A V     P   +  +  E D    +  N
Sbjct: 8793 --PQEPPAVELD-VSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDN 8849

Query: 864  QTTTANRYLKVSDLQQGKTYV----------FRVRAVNANGVGKPSDTSEPVLVEARPGT 913
              T +   +K +  +    YV          F    V    V  P    +PV+   +   
Sbjct: 8850 VGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCL 8909

Query: 914  KEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPD 973
               S   D+ G+   GF   E  DA   TW +  E     ER K +  G      L+  +
Sbjct: 8910 LNWSDPEDDGGSEITGF-IIERKDAKMHTWRQPIE----TERSKCDITG-----LLEGQE 8959

Query: 974  KEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVR 1033
             +    + V   +  G        P E+  ++A+ + +  PT P    L Y    K  + 
Sbjct: 8960 YK----FRVIAKNKFGCG-----PPVEIGPILAV-DPLGPPTSP--ERLTYTERTKSTIT 9007

Query: 1034 F-WLQAEHLSPDASYRFIINDREVSDSEIHRIK---CDKATGIIEMVMDRFSIENEGTYT 1089
              W +           +II  R     +  R+    C   + ++E + +    E      
Sbjct: 9008 LDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAV 9067

Query: 1090 VQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLV 1149
             +I + +     ++V+  D     ++     R + ++ +     E +H  +  +     +
Sbjct: 9068 NEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKA---GEPVH--IPADVTGLPM 9122

Query: 1150 CKVANTKKETVFKWLKDDVLYETETLPNLERGICELLIPKLSKKDHGEYKATLKDDRGQD 1209
             K+  +K ETV +    D L  T+   +      EL IPK  ++D G Y  T  +  G  
Sbjct: 9123 PKIEWSKNETVIE-KPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSV 9181

Query: 1210 VSILEIAGKVYD 1221
               + +  +VYD
Sbjct: 9182 FRNVHV--EVYD 9191



 Score =  151 bits (382), Expect = 4e-36
 Identities = 151/584 (25%), Positives = 239/584 (40%), Gaps = 82/584 (14%)

Query: 347  KDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPP 406
            + D G Y +   +  G    +A + V D        PG  +DL+    NR   ++ W  P
Sbjct: 8863 RKDHGRYVITATNSCGSKFAAARVEVFDV-------PGPVLDLKPVVTNRKMCLLNWSDP 8915

Query: 407  NTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGIS 466
                 S + G+ ++R +   + W Q  +     C   +TGL EG+ Y FRV A N  G  
Sbjct: 8916 EDDGGSEITGFIIERKDAKMHTWRQPIETERSKC--DITGLLEGQEYKFRVIAKNKFGCG 8973

Query: 467  RPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTG---VHASEIS 523
             P  +   + A+DPL                              GPPT    +  +E +
Sbjct: 8974 PPVEIG-PILAVDPL------------------------------GPPTSPERLTYTERT 9002

Query: 524  RNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYV 582
            ++ + L W+ P   G  P+  Y IEK       ++RVN +    +  + V +L E + Y 
Sbjct: 9003 KSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLC-PTTSFLVENLDEHQMYE 9061

Query: 583  FRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKH-EEDL 641
            FRV + N  G SEPS +   +  QD  V P+   R+    +T   + V+   P H   D+
Sbjct: 9062 FRVKAVNEIGESEPS-LPLNVVIQDDEVPPTIKLRLSVRGDT---IKVKAGEPVHIPADV 9117

Query: 642  LGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGE--------------QYIFRVKAV 687
             G  +       N  E    KP    +     ++  E              +  + V A 
Sbjct: 9118 TGLPMPKIEWSKN--ETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTAS 9175

Query: 688  NAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYL 747
            N +G    +   +V         PS P  + + +    S  L W  P  +GGS I  Y +
Sbjct: 9176 NRLGSVFRNVHVEV------YDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVI 9229

Query: 748  DKREVHHK--NWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
            DKR+   K   W EV ++  +     +  L     YEF++ AVN  GI +     +    
Sbjct: 9230 DKRDASRKKAEWEEVTNTAVEKR-YGIWKLIPNGQYEFRVRAVNKYGISDECKSDKVVIQ 9288

Query: 806  EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQT 865
            + + +P P P         + + LV  W  P+ +G SP++GY+++ REE +  W  V++ 
Sbjct: 9289 DPYRLPGP-PGKPKVLARTKGSMLVS-WTPPLDNGGSPITGYWLEKREEGSPYWSRVSRA 9346

Query: 866  TTANRYLK-----VSDLQQGKTYVFRVRAVNANGVGKPSDTSEP 904
                  LK     V  L +G  Y FR  A+NA G+G PS+ S+P
Sbjct: 9347 PITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDP 9390



 Score =  150 bits (379), Expect = 9e-36
 Identities = 109/444 (24%), Positives = 202/444 (45%), Gaps = 39/444 (8%)

Query: 563  TAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASR 622
            T      + + +  +G    ++++  N+HG +E       I  + + V    PG V    
Sbjct: 6742 TTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGF-----INLKVIDV----PGPVRNLE 6792

Query: 623  NTKT---SVVVQWDRPKHE--EDLLGYYVD-------CCVAGTNLWEPCNHKPIGYNRFV 670
             T+T    V + W+ P  +    ++GY V+         V  T+  E C         F 
Sbjct: 6793 VTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDRAESCE--------FT 6844

Query: 671  VHGLTTGE-QYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTL 729
            V GL  G  +Y+FRV A N VG  E  +  + ++ ++   VP  P  +T+ + +   ++L
Sbjct: 6845 VTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSL 6904

Query: 730  GWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVN 789
             W+ P++ GG+ I  Y ++ R+     W    +  ++    TV  + EG  Y F++ A N
Sbjct: 6905 TWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQN 6964

Query: 790  LAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFV 849
              G+G+PS  +   K  A  +  P P  +LT  +   +S+ + W+ P+  G SP+ GY +
Sbjct: 6965 RIGVGKPSAATPFVKV-ADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYII 7023

Query: 850  DFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEA 909
            +  EE    WI  N         KV+ L++G  Y++RV A N  GV  PS+   P+  + 
Sbjct: 7024 ERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADD 7083

Query: 910  R--PGTKEISAGVDEQGNIYLGFDCQEMTDASQF-----TWCKSYEEISDDERFKIETVG 962
                 T ++SA  D    + +      +  ++ +     TWC   + +   +R K++T+ 
Sbjct: 7084 AFVEPTMDLSAFKDGL-EVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLS 7142

Query: 963  DHSKLYLKNPDKEDLGTYSVSVSD 986
             +++L +   ++ D G Y++ + +
Sbjct: 7143 AYAELVISPSERSDKGIYTLKLEN 7166



 Score =  150 bits (378), Expect = 1e-35
 Identities = 138/520 (26%), Positives = 208/520 (40%), Gaps = 88/520 (16%)

Query: 375   ADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVD--RCEVGTNNWVQC 432
             +DPL    P  P  L+  +  ++   + W PP     + + GY       E   + W + 
Sbjct: 12488 SDPL--SEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEY 12545

Query: 433   NDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAA----LDPLDLRRLQ- 487
             +   VK     VTGL EG+ Y FRV A N+ G+S P        A    L P  L   Q 
Sbjct: 12546 S--VVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQI 12603

Query: 488   -------------------------------------AVHLEGEKEIAIYQDDLEGDA-- 508
                                                  AVH      I I +D    D+  
Sbjct: 12604 TIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGY 12663

Query: 509   ---------------------QVPGPPTG-VHASEISRNYVVLSWEPPTPRGKDPLM-YF 545
                                    PGPP      S+I  +   LSW  P   G   +  Y 
Sbjct: 12664 YSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHIPLEDGGSNITNYI 12723

Query: 546   IEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSP-IQ 604
             +EK  V  G W  V A  +V      V  L+ G+ Y+FRV + NR G+SEP  +TSP + 
Sbjct: 12724 VEKCDVSRGDW--VTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEP--LTSPKMV 12779

Query: 605   AQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHK 662
             AQ    VPS P     ++  K  + V WDRP  +    ++GY ++     + LW   N  
Sbjct: 12780 AQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVKANDT 12839

Query: 663   PIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNC 722
              +    +   GL  G +Y FR+ A+N  G S  S+ ++ +  +  +  P  P    +++ 
Sbjct: 12840 LVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKP---EVIDV 12896

Query: 723   DGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSK--PTILTVDGLTEGSL 780
                +++L W  PK  GGS I+GY+++  ++    W   N++P +      T  GL E + 
Sbjct: 12897 TKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQ 12956

Query: 781   YEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLT 820
             Y+F+  A     I  PS+PS+     A  +P   P  DL+
Sbjct: 12957 YQFRAIARTAVNISPPSEPSDPVTILAENVP---PRIDLS 12993



 Score =  149 bits (376), Expect = 2e-35
 Identities = 199/866 (22%), Positives = 327/866 (37%), Gaps = 118/866 (13%)

Query: 150   ISRAPEIL--VRLRSHTVWER-MSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIE 206
             I  APEI   V LR+  + +    V++    +G P P V W KD   +   A   +Y IE
Sbjct: 20960 ILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDA---RYSIE 21016

Query: 207   SNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLP 266
             +      L I +   +DT  Y     N                             +G P
Sbjct: 21017 NTDSSSLLTIPQVTRNDTGKYILTIENG----------------------------VGEP 21048

Query: 267   LSSMIPYTHFDVQFL-EKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKE 325
              SS +     D     +K  V     G TVTL   +   P +    P   +  +     +
Sbjct: 21049 KSSTVSVKVLDTPAACQKLQVKHVSRG-TVTL---LWDPPLIDGGSPIINYVIEKRDATK 21104

Query: 326   SKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGA 385
               W+ +      +S SF  +   ++  +  R+++   +            +P+      A
Sbjct: 21105 RTWSVV--SHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEP---CETTEPVKAAEVPA 21159

Query: 386   PM-DLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPV 444
             P+ DL   D+ +  VI++W  P+    S +  Y V+R   G   W     +  K C+  V
Sbjct: 21160 PIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGIS--KTCEIEV 21217

Query: 445   TGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDL 504
             + L E     FRV A N  G+S P         + P+ ++ L          I   + DL
Sbjct: 21218 SQLKEQSVLEFRVFAKNEKGLSDP-------VTIGPITVKEL----------IITPEVDL 21260

Query: 505   EGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTA 564
                + +PG    V    I  N   +  E P      P + +++  +              
Sbjct: 21261 ---SDIPGAQVTVR---IGHN---VHLELPYKGKPKPSISWLKDGL-------------P 21298

Query: 565   VRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQ--AQDVTVV----PSAP-GR 617
             ++   +  F   E K  +    +   HG      + + +   A  +TV+    PS P G 
Sbjct: 21299 LKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKGP 21358

Query: 618   VLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNHK----PIGYNRFVVHG 673
             +        SV++ WD P   ED  G  + C           N K     +    F V  
Sbjct: 21359 IRFDEIKADSVILSWDVP---EDNGGGEITCYSIEKRETSQTNWKMVCSSVARTTFKVPN 21415

Query: 674   LTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKV 733
             L    +Y FRV+A N  G+S+    S +I  +    +P  P    + N     M+L W  
Sbjct: 21416 LVKDAEYQFRVRAENRYGVSQ-PLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDA 21474

Query: 734   PKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGI 793
             P + GGS + G++++K+E +   W +VN+SP         GL EG  Y+F++ A N AG+
Sbjct: 21475 PVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGL 21534

Query: 794   GEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFRE 853
               PSDPS+     +   P   P Y     +V   ++ + W  P+  G S + GY ++ R+
Sbjct: 21535 SSPSDPSKFTLAVSPVDPPGTPDY----IDVTRETITLKWNPPLRDGGSKIVGYSIEKRQ 21590

Query: 854   EDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKP----------SDTSE 903
              +   W+  N T  +     V+ L  G  Y FR+ A NA G   P           D + 
Sbjct: 21591 GNE-RWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENV 21649

Query: 904   PVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGD 963
             P +VE   G +     + + G         +     + TW K   EI      +I  V  
Sbjct: 21650 PPIVEF--GPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLG 21707

Query: 964   HSKLYLKNPDKEDLGTYSVSVSDTDG 989
              + L++++  ++  G Y+V   +  G
Sbjct: 21708 STSLFVRDATRDHRGVYTVEAKNASG 21733



 Score =  149 bits (376), Expect = 2e-35
 Identities = 139/518 (26%), Positives = 220/518 (42%), Gaps = 56/518 (10%)

Query: 511   PGPPTG-VHASEISRNYVVLSWEPPTPRG-KDPLMYFIEKSVVGSGSWQRVNAQTAVRSP 568
             P  P G +   +I    V +SW PP   G  D L Y +E+  V   +W  ++++  VR  
Sbjct: 23923 PNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSR--VRGT 23980

Query: 569   RYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQ---DVTVVPSAPGRVLASRNTK 625
                V  L E   Y FRV + N+ G+S+P +   P+  +   +    PS P  VL    TK
Sbjct: 23981 SLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVLDV--TK 24038

Query: 626   TSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFR 683
             +SV + W RPK +    + GYY++     T+ W   N   I    + V GL    +Y FR
Sbjct: 24039 SSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFR 24098

Query: 684   VKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPIL 743
             + A N VG+SE S  S+ +  +     PS P  + +L+    S+TL W+ P+  GG  IL
Sbjct: 24099 IIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEIL 24158

Query: 744   GYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHF 803
             GY+++ R+     W + N    K    T+ GL E + YEF++ A N  G+  P   +   
Sbjct: 24159 GYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSI 24218

Query: 804   KCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVN 863
             K +  +   PG        E++D +  +        G +      +  R     +W    
Sbjct: 24219 KTKLTSGEAPGIRK-----EMKDVTTKL--------GEAAQLSCQIVGRPLPDIKWYRFG 24265

Query: 864   QTTTANRYLKVSDLQQGKTYVFRV-----------RAVNANGVGKPSDTSEPVLVEARP- 911
             +    +R  K+S    G+T+   V             +  N VG+  +TS  +L++A P 
Sbjct: 24266 KELIQSRKYKMS--SDGRTHTLTVMTEEQEDEGVYTCIATNEVGE-VETSSKLLLQATPQ 24322

Query: 912   -----GTKEISAGVD----EQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVG 962
                    KE   G          +Y+G     M      TW    + + + E   IE   
Sbjct: 24323 FHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAM------TWFHGQKLLQNSENITIENTE 24376

Query: 963   DHSKLYLKNPD-KEDLGTYSVSVSDTDGVSSSFVLDPE 999
              ++ L +KN   K   G Y V +S+  G   + +LD E
Sbjct: 24377 HYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDA-ILDVE 24413



 Score =  147 bits (371), Expect = 7e-35
 Identities = 164/689 (23%), Positives = 272/689 (39%), Gaps = 81/689 (11%)

Query: 250   RGDEEPFRSVGLP-----IGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVT 304
             +G  +P R +G+P     I +  S  +P+  F+V+  E+  +    +G            
Sbjct: 19069 KGRSDP-RQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKIDVPFKG------------ 19115

Query: 305   PDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVS 364
                 R Q    W +D   LKE+    +   +   SLS     K+D G Y L + +  G  
Sbjct: 19116 ----RPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSI 19171

Query: 365   DHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEV 424
                  + V D        PG P  ++  + + D + ++W PP       +  Y V++ E 
Sbjct: 19172 TVPITIIVLDR-------PGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKET 19224

Query: 425   GTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLR 484
              +  W   + A V      +  L  G  Y FRV A N  G S  S  S  VA        
Sbjct: 19225 TSTTWHIVSQA-VARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVA-------- 19275

Query: 485   RLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM- 543
                                 E     PGPP        +++ ++++W+ P   G   ++ 
Sbjct: 19276 --------------------EYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIG 19315

Query: 544   YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPI 603
             Y +E     S  W + N +  +   +  V  L EG  Y +RV + N  G+ + S+   P+
Sbjct: 19316 YHLEYKERSSILWSKAN-KILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPV 19374

Query: 604   QAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNH 661
              A+D       PG+   +  T+ SV ++W +P ++    + GY V+        W  CN+
Sbjct: 19375 PARDPC---DPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNY 19431

Query: 662   KPIGYNRFVVHGLTTGEQYIFRVKAVNAV-GMSENSQESDVIKVQAALTVPSHPYGITLL 720
               I    F V  LT  ++Y FRV A NA   +SE S+ +  I V+  +  P     +   
Sbjct: 19432 TNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFR 19491

Query: 721   NCDGHSMTLGWKVPKFSGGS--PILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEG 778
             +          K+     G   P++ +  D  E+  +   E+ S+ +  T+LTV      
Sbjct: 19492 DVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNH-TLLTVKDCIRR 19550

Query: 779   SLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVY 838
                ++ +   N+AG       S    C+    P P PA  L    +      + W  P  
Sbjct: 19551 DTGQYVLTLKNVAG-----TRSVAVNCKVLDKPGP-PAGPLEINGLTAEKCSLSWGRPQE 19604

Query: 839   SGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKP 898
              G + +  Y V+ RE     W T+ +        KV+ L +G  Y+FRV  VN  GVG+P
Sbjct: 19605 DGGADIDYYIVEKRETSHLAW-TICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEP 19663

Query: 899   SDT-----SEPVLVEARPGTKEISAGVDE 922
              ++      +P  V + P + EI++   E
Sbjct: 19664 LESVAIKALDPFTVPSPPTSLEITSVTKE 19692



 Score =  144 bits (364), Expect = 5e-34
 Identities = 163/681 (23%), Positives = 264/681 (38%), Gaps = 79/681 (11%)

Query: 312   PRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLF 371
             P+    RD V LK +            +++       D G Y +   +  G +     + 
Sbjct: 20201 PKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIV 20260

Query: 372   VRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQ 431
             V D      G P  P+ +   D   + V + W+PP     S V  Y + + E  T  W +
Sbjct: 20261 VLDRP----GPPTGPVVIS--DITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTE 20314

Query: 432   CNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHL 491
              + A V      V  L  G  Y FR++A N  GIS            D +D   +     
Sbjct: 20315 VS-ATVARTMMKVMKLTTGEEYQFRIKAENRFGIS------------DHIDSACVT---- 20357

Query: 492   EGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSV 550
                         ++     PGPP+    + ++R  + + W  P   G   ++ Y +E   
Sbjct: 20358 ------------VKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKD 20405

Query: 551   VGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTV 610
               S  WQ+ N +  +R+  + V  +  G  Y FRV + N  G+ +PS  + P+ A D   
Sbjct: 20406 RNSILWQKAN-KLVIRTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDAC- 20463

Query: 611   VPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNR 668
                 P  V  +  +K SV + W +P  +    + GY V+        W   +   +   +
Sbjct: 20464 --EPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQ 20521

Query: 669   FVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPY-GITLLNCDGHSM 727
             F++ GLT   QY FRV A NAVG   N   S+V+     +     P   + L   +    
Sbjct: 20522 FIISGLTQNSQYEFRVFARNAVGSISNP--SEVVGPITCIDSYGGPVIDLPLEYTEVVKY 20579

Query: 728   TLGWKVPKFSGGS----PILGYYLDKREVHHKNWHEVNSSPSKPTILTVDG--LTEGSLY 781
               G  V   +G S    P + +Y D +E+       V ++    +IL  D   L  G  Y
Sbjct: 20580 RAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGC-Y 20638

Query: 782   EFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGS 841
             E K+   N  G       S   + +    P P P   + F  V    + +LW+ P   G 
Sbjct: 20639 ELKLR--NAMG-----SASATIRVQILDKPGP-PGGPIEFKTVTAEKITLLWRPPADDGG 20690

Query: 842   SPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDT 901
             + ++ Y V+ RE     W  V++       +  + + +G  Y+FRVRAVN  G+G+P ++
Sbjct: 20691 AKITHYIVEKRETSRVVWSMVSEHLE-ECIITTTKIIKGNEYIFRVRAVNKYGIGEPLES 20749

Query: 902   SEPVLVEA-----RPGTKEI------------SAGVDEQGNIYLGFDCQEMTDASQFTWC 944
                V   A      PG  E+            S  + + G+   G+   E  D     W 
Sbjct: 20750 DSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGY-FLEKRDKKSLGWF 20808

Query: 945   KSYEEISDDERFKIETVGDHS 965
             K  +E   D R K+  + ++S
Sbjct: 20809 KVLKETIRDTRQKVTGLTENS 20829



 Score =  141 bits (355), Expect = 5e-33
 Identities = 122/473 (25%), Positives = 210/473 (44%), Gaps = 49/473 (10%)

Query: 511   PGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPR 569
             PGPP  +   E+ ++   L WEPP   G   +  Y I+K      ++  V+++ +  S  
Sbjct: 17811 PGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKTS-- 17868

Query: 570   YAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV 629
             + V +L EG  Y FRV++ N  G+  P E    ++A +    PS PG+V  +  ++TS  
Sbjct: 17869 FKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEP---PSPPGKVTLTDVSQTSAS 17925

Query: 630   VQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAV 687
             + W++P+H+    +LGY V+    GT  W       +     VV GL++G++Y FRVKA 
Sbjct: 17926 LMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVC--NAVVTGLSSGQEYQFRVKAY 17983

Query: 688   NAVGMSEN-----SQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPI 742
             N  G S+         +  + +Q +L +P + Y I      G  + +  ++P      P 
Sbjct: 17984 NEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQA----GEDLKI--EIPVIGRPRPN 18037

Query: 743   LGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEH 802
             + +  D   +       V  + +  T+L +    +    ++ + A N AG       +E+
Sbjct: 18038 ISWVKDGEPLKQTTRVNVEETATS-TVLHIKEGNKDDFGKYTVTATNSAGTA-----TEN 18091

Query: 803   FKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITV 862
                     P P P   + F EV    +V+ W+ P Y+G   +S Y V+ R+     W  V
Sbjct: 18092 LSVIVLEKPGP-PVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMV 18150

Query: 863   NQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVE------ARPGTKEI 916
             +  T A   +K++ L+ G  Y FR+ A N  G   P D S+ V+V+        PGT  +
Sbjct: 18151 S-ATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLD-SKAVIVQYPFKEPGPPGTPFV 18208

Query: 917   SA------------GVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFK 957
             ++             V++ G   +G+   E  + +   W K  +    D +FK
Sbjct: 18209 TSISKDQMLVQWHEPVNDGGTKIIGYHL-EQKEKNSILWVKLNKTPIQDTKFK 18260



 Score =  140 bits (353), Expect = 9e-33
 Identities = 116/421 (27%), Positives = 187/421 (44%), Gaps = 32/421 (7%)

Query: 511   PGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPR 569
             PGP   +  ++I+++ V L W+ P   G   +  Y +EK      S+    A T      
Sbjct: 14563 PGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYS--TATTKCHKCT 14620

Query: 570   YAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV 629
             Y V  L EG  Y FRV++ N +G+ EP+E T P++A +    PS P  +     TK++V 
Sbjct: 14621 YKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASE---APSPPDSLNIMDITKSTVS 14677

Query: 630   VQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAV 687
             + W +PKH+    + GY ++    G++ W   +   +     VV  LT GE+Y F+V AV
Sbjct: 14678 LAWPKPKHDGGSKITGYVIEAQRKGSDQW--THITTVKGLECVVRNLTEGEEYTFQVMAV 14735

Query: 688   NAVGMSENSQESDVIKVQAALTVPSHPYGI---TLLNCDGHSMTLGWKVPKFSGGSPILG 744
             N+ G S   +   VI  +  +       GI    ++   G ++ +  ++P      P + 
Sbjct: 14736 NSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKV--EIPVLGRPKPTVT 14793

Query: 745   YYLDKREVHHKNWHEVN-SSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHF 803
             +   K +   K    VN  + +  TIL ++         + + A N+ G     +  +  
Sbjct: 14794 W--KKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVG-----EVGDVI 14846

Query: 804   KCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVN 863
               +   +P P P   + F EV    +   W  P   G  P+S Y V+ R+ D+  W+ + 
Sbjct: 14847 TIQVHDIPGP-PTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELA 14905

Query: 864   QTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSE------PVLVEARPGTKEIS 917
              T     Y K + L  G  Y FRV+A N  GVG P  TS       P  V   PGT +++
Sbjct: 14906 TTVIRTTY-KATRLTTGLEYQFRVKAQNRYGVG-PGITSACIVANYPFKVPGPPGTPQVT 14963

Query: 918   A 918
             A
Sbjct: 14964 A 14964



 Score =  136 bits (343), Expect = 1e-31
 Identities = 112/417 (26%), Positives = 180/417 (43%), Gaps = 28/417 (6%)

Query: 511   PGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPR 569
             PGPP  +   E+++  V L+W+PP   G   +  Y +EK      ++  V   T      
Sbjct: 15647 PGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTV--ATNCHKTS 15704

Query: 570   YAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV 629
             + V  L EG SY FRVL+ N +G+  P+E    ++A +    P  PG++     T+ SV 
Sbjct: 15705 WKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASE---RPLPPGKITLMDVTRNSVS 15761

Query: 630   VQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAV 687
             + W++P+H+    +LGY V+    G++ W  C    +      + GL  GE+Y FRV A 
Sbjct: 15762 LSWEKPEHDGGSRILGYIVEMQTKGSDKWATC--ATVKVTEATITGLIQGEEYSFRVSAQ 15819

Query: 688   NAVGMSENSQESDVIKVQAALTVPSHPYGI-TLLNCDGHSMTLGWKVPKFSGGSPILGYY 746
             N  G+S+  Q S  +  +  +  P+      T     G  + +   VP     +P + ++
Sbjct: 15820 NEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKV--DVPFIGRPTPAVTWH 15877

Query: 747   LDKREVHHKNWHEVNS-SPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
              D   V  K    VN+ S    ++LT+       +  + +   N AG     +  E    
Sbjct: 15878 KD--NVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAG-----EAIETLNV 15930

Query: 806   EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQT 865
                  P P P   +   EV   S+ + W  P Y G S ++ Y V+ R+     W  V+  
Sbjct: 15931 IVLDKPGP-PTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVS-A 15988

Query: 866   TTANRYLKVSDLQQGKTYVFRVRAVNANGV-----GKPSDTSEPVLVEARPGTKEIS 917
             T A   +K   L+ G  Y FR+ A N  G       +P+    P  V   PGT  ++
Sbjct: 15989 TVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVT 16045



 Score =  134 bits (337), Expect = 6e-31
 Identities = 174/771 (22%), Positives = 294/771 (38%), Gaps = 127/771 (16%)

Query: 171   VKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT-LEINRADFDDTATYSA 229
             ++L   ++G P P+ +W K+G  I + A      + +    HT L I  AD  D+ TY  
Sbjct: 23849 IRLTIPIKGKPFPICKWTKEGQDISKRA------MIATSETHTELVIKEADRGDSGTYDL 23902

Query: 230   VATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFR 289
             V  N  G+ +    V V                IG P S   P  + D+Q +    V++R
Sbjct: 23903 VLENKCGKKAVYIKVRV----------------IGSPNSPEGPLEYDDIQ-VRSVRVSWR 23945

Query: 290   REGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDD 349
                +         +    +R  P+A WY  D  ++ +            SL    L ++ 
Sbjct: 23946 PPADDGGADILGYILE--RREVPKAAWYTIDSRVRGT------------SLVVKGLKENV 23991

Query: 350   EGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCH-----DANRDYVIVTWK 404
             E  + +   ++ G+S       ++  +P+    P  P +   +     D  +  V ++W 
Sbjct: 23992 EYHFRVSAENQFGISKP-----LKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWS 24046

Query: 405   PPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAG 464
              P     S V GY+++R E  T+ WV+ N   +    Y VTGL     Y FR+ A N  G
Sbjct: 24047 RPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVG 24106

Query: 465   ISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISR 524
             +S  S  S+ V   DP D                            P  P  +    IS+
Sbjct: 24107 LSETSPASEPVVCKDPFD---------------------------KPSQPGELEILSISK 24139

Query: 525   NYVVLSWE-PPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVF 583
             + V L WE P    GK+ L Y++E    G  +W++ N +  ++  ++ +  L+E   Y F
Sbjct: 24140 DSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKE-RIKDKQFTIGGLLEATEYEF 24198

Query: 584   RVLSANRHGLSEPSEITSPIQAQDVTVVPSAPG--RVLASRNTKTSVVVQWD-----RPK 636
             RV + N  GLS P      I+ +       APG  + +    TK     Q       RP 
Sbjct: 24199 RVFAENETGLSRPRRTAMSIKTK--LTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPL 24256

Query: 637   HEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQY---IFRVKAVNAVGMS 693
                D+  Y       G  L +   +K     R     + T EQ    ++   A N VG  
Sbjct: 24257 --PDIKWYRF-----GKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEV 24309

Query: 694   ENSQESDVIKVQAALTVPSHP--------YGITLLNCDGHSMTLGWKVPKFSGGSPILGY 745
             E S      K+    T   HP        YG        H M +G  VP  +       +
Sbjct: 24310 ETSS-----KLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMT-------W 24357

Query: 746   YLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
             +  ++ + +     + ++     ++  +   +    ++K+   N+ G  +          
Sbjct: 24358 FHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAI-----LDV 24412

Query: 806   EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFRE-EDAGEWITVNQ 864
             E    P+  P   +    +   S V+ WK P   G S ++ Y V+  E ++  EW  V+ 
Sbjct: 24413 EIQDKPDK-PTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSS 24471

Query: 865   TTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEA---RPG 912
               +     ++ +L +   Y FRV A N  G+  P + S  V++++   +PG
Sbjct: 24472 AISVTT-CRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPG 24521



 Score =  121 bits (304), Expect = 4e-27
 Identities = 113/424 (26%), Positives = 188/424 (44%), Gaps = 38/424 (8%)

Query: 493   GEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVV 551
             G+KE  I    L+     PGPP  V   EIS++   ++WEPP   G  P++ Y ++K   
Sbjct: 13468 GKKEYTIVVKVLD----TPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDA 13523

Query: 552   GSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVV 611
                SW  V  + +  S  + V +L EGKSY FRV + N +G+ +P E    ++A      
Sbjct: 13524 ERKSWSTVTTECSKTS--FRVANLEEGKSYFFRVFAENEYGIGDPGETRDAVKAS----- 13576

Query: 612   PSAPGRVL---ASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGY 666
                PG V+       +K+S  + W +P  +    ++GY VD  +   N W+    K +  
Sbjct: 13577 -QTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVD-FLTEENKWQRV-MKSLSL 13633

Query: 667   NRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIK---VQAALTVPSHPYGITLLNCD 723
              ++    LT G++Y FRV A N  G    S+ + V +   V   L +   P  +  L  +
Sbjct: 13634 -QYSAKDLTEGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLP-DLCYLAKE 13691

Query: 724   GHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEF 783
               +  L  K+P     +P + +   +  +       V SS    T++  D   +    ++
Sbjct: 13692 NSNFRL--KIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYD-CQKSDAGKY 13748

Query: 784   KIAAVNLAGIGEPSDPSEHFKCEAWTMPEPG-PAYDLTFCEVRDTSLVMLWKAPVYSGSS 842
              I   N+AG  E +            + +PG P   + F EV   ++ + W  P   G S
Sbjct: 13749 TITLKNVAGTKEGT-------ISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGS 13801

Query: 843   PVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTS 902
              ++ Y ++ R+    +W+T         + +V+ L +G  Y FRV A N  GVG+    S
Sbjct: 13802 EITNYILEKRDSVNNKWVTCASAVQKTTF-RVTRLHEGMEYTFRVSAENKYGVGE-GLKS 13859

Query: 903   EPVL 906
             EP++
Sbjct: 13860 EPIV 13863



 Score =  111 bits (278), Expect = 4e-24
 Identities = 93/324 (28%), Positives = 134/324 (41%), Gaps = 41/324 (12%)

Query: 152   RAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRI-ESNYG 210
             +AP     LR+  V  + +  L   V G P P+V+WY+ G  I   A+  KYRI E   G
Sbjct: 24621 QAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEII--ADGLKYRIQEFKGG 24678

Query: 211   VHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSM 270
              H L I     DD   Y   ATN  G VS  A+                 L + +P    
Sbjct: 24679 YHQLIIASVTDDDATVYQVRATNQGGSVSGTAS-----------------LEVEVPAKIH 24721

Query: 271   IPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTK 330
             +P T      LE  G      GE V++K      PD     P   W +   L+  +   +
Sbjct: 24722 LPKT------LEGMGAVHALRGEVVSIKIPFSGKPD-----PVITWQKGQDLIDNNGHYQ 24770

Query: 331   MFFGEGQASLSFSH-LHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDL 389
             +       SL F + + + D G Y +   +R G+   +  L V D        P  P  +
Sbjct: 24771 VIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADV-------PDPPRGV 24823

Query: 390   QCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFE 449
             +  D +RD V +TW  P +   S +  Y V++C      W++   A  +  +Y V  LF 
Sbjct: 24824 KVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQA--RETRYTVINLFG 24881

Query: 450   GRSYIFRVRAVNSAGISRPSRVSD 473
               SY FRV A N  G+S+PS  S+
Sbjct: 24882 KTSYQFRVIAENKFGLSKPSEPSE 24905



 Score = 95.5 bits (236), Expect = 3e-19
 Identities = 99/408 (24%), Positives = 161/408 (39%), Gaps = 25/408 (6%)

Query: 603   IQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEED--LLGYYVDCCVAGTNLWEPCN 660
             ++ QD    P+ P  ++     K S V+ W  P  +    +  Y V+ C A         
Sbjct: 24412 VEIQDKPDKPTGP--IVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLV 24469

Query: 661   HKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLL 720
                I      +  LT    Y FRV A N  G+S+  + S V+ +++    P  P   T+ 
Sbjct: 24470 SSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTIT 24529

Query: 721   NCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSL 780
                  S  + WK P   GG+ I  YYL+KRE     W  V +   + T+ +V  L EG  
Sbjct: 24530 AVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLE 24589

Query: 781   YEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAY--DLTFCEVRDTSLVMLWKAPVY 838
             YEF++   NL G  E S+ SE    ++  +P   P +  +L    VR  S   L    V 
Sbjct: 24590 YEFRVKCENLGGESEWSEISEPITPKS-DVPIQAPHFKEELRNLNVRYQSNATL-VCKVT 24647

Query: 839   SGSSPVSGYFVDFREEDA-GEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANG--- 894
                 P+  ++   +E  A G    + +       L ++ +      V++VRA N  G   
Sbjct: 24648 GHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVS 24707

Query: 895   ------VGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYE 948
                   V  P+    P  +E   G   + A   E  +I + F  +        TW K  +
Sbjct: 24708 GTASLEVEVPAKIHLPKTLE---GMGAVHALRGEVVSIKIPFSGK---PDPVITWQKGQD 24761

Query: 949   EISDDERFKIETVGDHSKLYLKN-PDKEDLGTYSVSVSDTDGVSSSFV 995
              I ++  +++      + L   N  +++D G Y V   +  G+    V
Sbjct: 24762 LIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTV 24809



 Score = 77.8 bits (190), Expect = 7e-14
 Identities = 113/534 (21%), Positives = 206/534 (38%), Gaps = 93/534 (17%)

Query: 930  FDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
            F+C+         W K+  EI   E+FKI   G   +L + N   ED   Y+  V   D 
Sbjct: 2855 FECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTF-VCGNDQ 2913

Query: 990  VSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRF 1049
            VS++  + P  +  ++   N  +  TI  +  + YE                    SY++
Sbjct: 2914 VSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYE------------------GISYKW 2955

Query: 1050 IINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDA 1109
            + N  E+  ++  +++  K T  + +    F    + T+      GKA S ++L +    
Sbjct: 2956 LKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVA----GKATSTATLYV---- 3007

Query: 1110 FKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDV- 1168
                    E +  EF +    H  +     V E+      C+V+  + +   +W+KDD  
Sbjct: 3008 --------EARHIEFRK----HIKDI---KVLEKKRAMFECEVS--EPDITVQWMKDDQE 3050

Query: 1169 LYETETLP-NLERGICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAM 1227
            L  T+ +    E+ +  LLIP     D G+Y        G +VS  ++  +  D  I ++
Sbjct: 3051 LQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVA----GGNVSTAKLFVEGRDVRIRSI 3106

Query: 1228 SRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSS--EHMRIGGSEEM 1285
             +        ++V+   E  R     +   D++  +W     +I+    E  +      +
Sbjct: 3107 KK-------EVQVI---EKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRI 3156

Query: 1286 AWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGR 1345
              + I E  + D G+YTF    G++    +L ++     +   E Q              
Sbjct: 3157 HRMFISETRQSDAGEYTFVA--GRNRSSVTLYVNAPEPPQVLQELQP------------- 3201

Query: 1346 LIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVK-VEQAKYVSMT 1404
                    VT+  GK       + G P P++ W+K +Q   LS  F  K +   +  ++ 
Sbjct: 3202 --------VTVQSGKPARFCAVISGRPQPKISWYKEEQ--LLSTGFKCKFLHDGQEYTLL 3251

Query: 1405 IKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAKPKLIPA 1458
            +     ED+  Y+   KN YG      ++SV     ++P++  P Q  P   PA
Sbjct: 3252 LIEAFPEDAAVYTCEAKNDYGVATTSASLSV-----EVPEVVSPDQEMPVYPPA 3300



 Score = 65.9 bits (159), Expect = 3e-10
 Identities = 67/248 (27%), Positives = 102/248 (41%), Gaps = 30/248 (12%)

Query: 30    DEYASKKRASTQASSQKSLSQRSSSQRASSQTSLGGTICRVCAKRVSTQEDEEQENRSRY 89
             +EY   K A  ++SS  S   R     + +   L   +  +   R    E+ E +   R 
Sbjct: 25944 EEYEISKHAQRESSSSASRLLRRRRSLSPTYIELMRPVSELIRSRPQPAEEYEDDTERRS 26003

Query: 90    QSLVAAYGEAKRQRFLSELAHLEEDVHLARSQARDKLDKYAIQQMMEDKLAWERHTFEER 149
              +      E  R R  S ++    +  L+R +   + D ++  + M+  L  ++ T E +
Sbjct: 26004 PT-----PERTRPRSPSPVS---SERSLSRFERSARFDIFSRYESMKAALKTQK-TSERK 26054

Query: 150   ----------ISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAE 199
                       +  AP I +R+RSH V    + +    VQ  PT  V+WY +G    +  E
Sbjct: 26055 YEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNG---VELQE 26111

Query: 200   PGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVV--------RRFRG 251
               K    +  GV TLEI     DD+ TY AV TN  G+ S  A + V           R 
Sbjct: 26112 SSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRR 26171

Query: 252   DEEPFRSV 259
             DEE  RSV
Sbjct: 26172 DEEVPRSV 26179



 Score = 65.9 bits (159), Expect = 3e-10
 Identities = 50/166 (30%), Positives = 76/166 (45%), Gaps = 22/166 (13%)

Query: 1262  VNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTF--EIFDGKDNHQRSLDLS 1319
             V W     ++++SE  R G S     L I + + +D+G  T   +  +G    Q  L LS
Sbjct: 26763 VKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLS 26822

Query: 1320  GQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWF 1379
              +  D          A AF  + R +          I EG+ +  TC + G P PE+ WF
Sbjct: 26823 KELSD----------APAFISQPRSQ---------NINEGQNVLFTCEISGEPSPEIEWF 26863

Query: 1380  KNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYG 1425
             KN+  I +S + S+   +  Y S+ I+  +  DSGKY+I  KN  G
Sbjct: 26864 KNNLPISISSNVSISRSRNVY-SLEIRNASVSDSGKYTIKAKNFRG 26908



 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 61/247 (24%), Positives = 97/247 (39%), Gaps = 22/247 (8%)

Query: 154  PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
            P  + +L++  + E   +++     G P P + W K+  +I     P K RIE   G   
Sbjct: 1510 PMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYP-KIRIEGTKGEAA 1568

Query: 214  LEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPY 273
            L+I+     D+A Y+A A N  G+ +T   V V     + EP R + +P G   +  I  
Sbjct: 1569 LKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAA 1628

Query: 274  THFDVQFLE------KFGVTFRREGETVTLKCTMLVTPDLKRVQPR-------------- 313
               +   L       + G  + +E +        L +  LKR  P               
Sbjct: 1629 PELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTM 1688

Query: 314  -AEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFV 372
              EW  D   L+ +   +M    G  SL +   +  D G+ T R  ++ G    SA L V
Sbjct: 1689 VVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIV 1748

Query: 373  RDADPLV 379
            +D   LV
Sbjct: 1749 KDEKSLV 1755



 Score = 62.0 bits (149), Expect = 4e-09
 Identities = 42/125 (33%), Positives = 59/125 (47%), Gaps = 5/125 (4%)

Query: 123   RDKLDKYAIQQMMEDKLAWERHTFEERI-SRAPEILVRLRSHTVWERMSVKLCFTVQGFP 181
             R+  D Y  + M + K    R T   R+  R PE  + L + T +   +V+   T+   P
Sbjct: 25357 REVYDYYCRRTMKKIK----RRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHP 25412

Query: 182   TPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTN 241
              P V WYK G  I       KY  ES+ G++ L IN    DD A Y+ VA N +G+ S  
Sbjct: 25413 EPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCK 25472

Query: 242   AAVVV 246
             A + V
Sbjct: 25473 AKLTV 25477



 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 73/333 (21%), Positives = 124/333 (37%), Gaps = 48/333 (14%)

Query: 76    STQEDEEQENRSRYQSLVA--AYGEAKRQRFLS-ELAHLEEDVHLARSQARDKLDKYAIQ 132
             ++Q  +E+  RS +  L    AY  +  ++    E +    +V    ++ R+ L  Y   
Sbjct: 26167 ASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHS 26226

Query: 133   QMMEDK-LAWERHTFEERISR-------APEILVRLRSHTVWERMSVKLCFTVQGFPTPV 184
                E K  A E  + EE+ +        A  IL + RS TV+E  S +      G P P 
Sbjct: 26227 ASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPT 26286

Query: 185   VQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAV 244
             V W + G ++  +A   ++++ +     T EI+     D   YS V  N+ G+      +
Sbjct: 26287 VTWLRKGQVLSTSA---RHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTL 26343

Query: 245   VVRRFRGDEEPFRS----------------------VGLPIGLPLSSMIP---------- 272
              +++ R  E+   S                      V  P      ++ P          
Sbjct: 26344 TIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEK 26403

Query: 273   YTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMF 332
               H  V    K     + E      K T +V   + R +    WY+D   LKE+   +  
Sbjct: 26404 VQHLPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAK-EVTWYKDGKKLKENGHFQFH 26462

Query: 333   FG-EGQASLSFSHLHKDDEGLYTLRIVSRGGVS 364
             +  +G   L  ++L + D+G Y   I   GG S
Sbjct: 26463 YSADGTYELKINNLTESDQGEYVCEISGEGGTS 26495



 Score = 61.2 bits (147), Expect = 7e-09
 Identities = 32/84 (38%), Positives = 47/84 (55%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             D+VTI  G  L L   V G P+P++IW K D+++ L E  S++    K  +  IK     
Sbjct: 22750 DLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQY-TGKRATAVIKFCDRS 22808

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             DSGKY++ +KN  G + + V V V
Sbjct: 22809 DSGKYTLTVKNASGTKAVSVMVKV 22832



 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 24/201 (11%)

Query: 154  PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
            P++L  L+  TV      + C  + G P P + WYK+  L+       K +   +   +T
Sbjct: 3193 PQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGF---KCKFLHDGQEYT 3249

Query: 214  LEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPY 273
            L +  A  +D A Y+  A N +G  +T+A++             SV +P  +     +P 
Sbjct: 3250 LLLIEAFPEDAAVYTCEAKNDYGVATTSASL-------------SVEVPEVVSPDQEMPV 3296

Query: 274  THFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFF 333
              +    +     T   EG+    +C +  T DLK       WY  D  +K S++ +M  
Sbjct: 3297 --YPPAIITPLQDTVTSEGQPARFQCRVSGT-DLK-----VSWYSKDKKIKPSRFFRMTQ 3348

Query: 334  GEGQASLSFSHLHKDDEGLYT 354
             E    L  +  + +DEG YT
Sbjct: 3349 FEDTYQLEIAEAYPEDEGTYT 3369



 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 73/337 (21%), Positives = 124/337 (36%), Gaps = 49/337 (14%)

Query: 1129  GPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKW------LKDDVLYETETLPNLERGI 1182
             GP   + +H    E   V+ VCK+ N  + T   W      L++   YE       E G+
Sbjct: 25263 GPVSGQIMHAVGEEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEI----TYEDGV 25318

Query: 1183  CELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGK----VYDDMILAMSRVCGKSASPL 1238
               L +  ++K D G Y+  + +D G+D S  E+  K    VYD       +   +    +
Sbjct: 25319 AILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTM 25378

Query: 1239  KVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWL---QICEPTE 1295
             ++L  P    L  + K           +    +     + +     + W    Q  +P +
Sbjct: 25379 RLLERPPEFTLPLYNK---------TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGD 25429

Query: 1296  KDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKN-RGRLIGGLPDVV 1354
              DK KYTFE     D     L ++    D+  AE+       + E + + +L   L    
Sbjct: 25430 NDK-KYTFE----SDKGLYQLTINSVTTDDD-AEYTVVARNKYGEDSCKAKLTVTLHPPP 25483

Query: 1355  T----------------IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQA 1398
             T                  EG+++     V G P P + W K+ Q + L  +  +  E  
Sbjct: 25484 TDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGL 25543

Query: 1399  KYVSMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
              Y ++ I+    ED+G Y +   N  G       + V
Sbjct: 25544 DYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 25580



 Score = 58.9 bits (141), Expect = 3e-08
 Identities = 104/506 (20%), Positives = 199/506 (39%), Gaps = 98/506 (19%)

Query: 930  FDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
            F+C+  T+ ++  W ++ E I D  ++ I        L +++   +D   Y+VS+++  G
Sbjct: 6354 FNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRG 6413

Query: 990  VS----SSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDA 1045
             +    ++ +++ E+L  +            PLK     E  +K  V FW +   L+   
Sbjct: 6414 ENVKSAANLIVEEEDLRIVE-----------PLKD---IETMEKKSVTFWCKVNRLN--V 6457

Query: 1046 SYRFIINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVL 1105
            + ++  N  EV        + DK   ++ +    F   +EG Y V    G+ KS + L++
Sbjct: 6458 TLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFP--DEGEYIVTA--GQDKSVAELLI 6513

Query: 1106 IGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKW-- 1163
            I         EA  +  E L  Q           VTE  +    C+++  K     KW  
Sbjct: 6514 I---------EAPTEFVEHLEDQ----------TVTEFDDAVFSCQLSREKANV--KWYR 6552

Query: 1164 ----LKDDVLYETETLPNLERGICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKV 1219
                +K+   Y+ E   ++ R    L+I      D  EY   ++D + +       A   
Sbjct: 6553 NGREIKEGKKYKFEKDGSIHR----LIIKDCRLDDECEYACGVEDRKSR-------ARLF 6601

Query: 1220 YDDMILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRI 1279
             +++ + + R       P  +L  P G  +    +   D+++V W   +  +   +  ++
Sbjct: 6602 VEEIPVEIIR------PPQDILEAP-GADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQM 6654

Query: 1280 GGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFA 1339
                ++  LQIC+   +D+G+Y F   D                 EA A+ +   A    
Sbjct: 6655 MSEGKIHRLQICDIKPRDQGEYRFIAKD----------------KEARAKLELAAAPKIK 6698

Query: 1340 EKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAK 1399
              ++  ++    DV     GK L +       P  E  WFK ++ +  ++      EQ  
Sbjct: 6699 TADQDLVV----DV-----GKPLTMVVPYDAYPKAEAEWFKENEPLS-TKTIDTTAEQTS 6748

Query: 1400 YVSMTIKGVTSEDSGKYSINIKNKYG 1425
            +  +  K     D G+Y I ++NK+G
Sbjct: 6749 FRILEAK---KGDKGRYKIVLQNKHG 6771



 Score = 58.5 bits (140), Expect = 4e-08
 Identities = 36/101 (35%), Positives = 61/101 (60%), Gaps = 6/101 (5%)

Query: 154 PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
           P  + RL+S TV +   V+L   V G PTPVV++Y+DG+ I  + +   ++I     +++
Sbjct: 104 PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLD---FQISQEGDLYS 160

Query: 214 LEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEE 254
           L I  A  +D+ TYS  ATN+ G+ ++ A ++V   +G+EE
Sbjct: 161 LLIAEAYPEDSGTYSVNATNSVGRATSTAELLV---QGEEE 198



 Score = 58.2 bits (139), Expect = 6e-08
 Identities = 33/106 (31%), Positives = 49/106 (46%), Gaps = 3/106 (2%)

Query: 148   ERISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIES 207
             E IS  P I+  L+  TV      K      G P P   W KDG  I Q    GKY++  
Sbjct: 26541 EPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQG---GKYKLSE 26597

Query: 208   NYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDE 253
             + G   LEI++ D  D+  Y+    N+ G VS++  + ++  +  E
Sbjct: 26598 DKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTE 26643



 Score = 57.0 bits (136), Expect = 1e-07
 Identities = 109/586 (18%), Positives = 215/586 (36%), Gaps = 97/586 (16%)

Query: 873  KVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEAR--------PGTKEISAGVDEQG 924
            KV    +GK +   +R V     G+   T++     A           TK +     E+G
Sbjct: 5935 KVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEG 5994

Query: 925  NIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSV 984
               +  +C+   + ++  W K+  EI   ++++I   G   KL + +   ED+ TY+   
Sbjct: 5995 ATAV-LECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDA 6053

Query: 985  SDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPD 1044
             D    S +  + P  +E L  L++               ++ +K   RF  + E    +
Sbjct: 6054 KDFK-TSCNLNVVPPHVEFLRPLTD--------------LQVREKEMARF--ECELSREN 6096

Query: 1045 ASYRFIINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLV 1104
            A  ++  +  E+   + + I    A  I  +V+++  +++E  Y+ ++   +        
Sbjct: 6097 AKVKWFKDGAEIKKGKKYDIISKGAVRI--LVINKCLLDDEAEYSCEVRTART------- 6147

Query: 1105 LIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWL 1164
                   TVLEE     K              + +V+E   ++LVC+V+    E +  W 
Sbjct: 6148 ---SGMLTVLEEEAVFTKNL-----------ANIEVSETDTIKLVCEVSKPGAEVI--WY 6191

Query: 1165 K-DDVLYETETLPNLERGICELL-IPKLSKKDHGEYKATLKDDRGQ-DVSILEIAGKVYD 1221
            K D+ + ET     L  G   +L I     +D G Y   L   R    V + E+A +   
Sbjct: 6192 KGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFI- 6250

Query: 1222 DMILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGG 1281
                            L++L   EG + +       +   V W   D  + S +   +  
Sbjct: 6251 -----------SKPQNLEIL---EGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIA 6296

Query: 1282 SEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEK 1341
              +   L + + T +D G Y   +   +                         AA     
Sbjct: 6297 DGKKRVLVVKDATLQDMGTYVVMVGAAR------------------------AAAHLTVI 6332

Query: 1342 NRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYV 1401
             + R++  L D   + E + +   C V      +  WF+N++ I  S  + +  +   Y 
Sbjct: 6333 EKLRIVVPLKD-TRVKEQQEVVFNCEV-NTEGAKAKWFRNEEAIFDSSKYIILQKDLVY- 6389

Query: 1402 SMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAP 1447
            ++ I+    +D   Y++++ N + GE +    ++    E +  + P
Sbjct: 6390 TLRIRDAHLDDQANYNVSLTN-HRGENVKSAANLIVEEEDLRIVEP 6434



 Score = 56.2 bits (134), Expect = 2e-07
 Identities = 98/501 (19%), Positives = 188/501 (37%), Gaps = 63/501 (12%)

Query: 948   EEISD----DERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELER 1003
             EEIS      E  K+       KL LK    + L +  V  S    +  S V   EE+ +
Sbjct: 26665 EEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIV--HEEITK 26722

Query: 1004  LMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHR 1063
                 S E++     +K+       ++G+ R  L+A +++     ++++N  E+++SE +R
Sbjct: 26723 TSQASEEVRTHA-EIKAFSTQMSINEGQ-RLVLKA-NIAGATDVKWVLNGVELTNSEEYR 26779

Query: 1064  IKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKE 1123
                  +   + +       E   T   +  +G  K Q  L L                KE
Sbjct: 26780 YGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTL---------------SKE 26824

Query: 1124  FLRKQGPHF-AEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNLERG- 1181
                   P F ++    ++ E   V   C+++      + +W K+++     +  ++ R  
Sbjct: 26825 L--SDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEI-EWFKNNLPISISSNVSISRSR 26881

Query: 1182  -ICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLKV 1240
              +  L I   S  D G+Y    K+ RGQ  +   +       M+L +     +      V
Sbjct: 26882 NVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASL-------MVLPLVEEPSREV----V 26930

Query: 1241  LCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGK 1300
             L T     LQ    + +  ++++   ++A  SS          EM +  +   +      
Sbjct: 26931 LRTSGDTSLQG--SFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSM-- 26986

Query: 1301  YTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRG-----RLIGGLPDVVT 1355
                         +  +++S  +F    +   Q +++       G       I  LP  ++
Sbjct: 26987 -----------QESFVEMSSSSF-MGISNMTQLESSTSKMLKAGIRGIPPKIEALPSDIS 27034

Query: 1356  IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQA-KYVSMTIKGVTSEDSG 1414
             I EGK L + C   G P PEV W    + I   E     +E      ++ I  V  +D G
Sbjct: 27035 IDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGG 27094

Query: 1415  KYSINIKNKYGGEKIDVTVSV 1435
              Y++++ N++G +   V + +
Sbjct: 27095 LYTLSLGNEFGSDSATVNIHI 27115



 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 40/202 (19%), Positives = 91/202 (45%), Gaps = 11/202 (5%)

Query: 1247  IRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIF 1306
             ++  C ++ +    +V W     ++ +SE   I   + +A L + + T+ D G Y  ++ 
Sbjct: 25280 VKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVV 25339

Query: 1307  DGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEK-NRGRLIGGLPDVV------TIMEG 1359
             +         +L  +   E +  + +        + +  RL+   P+        T   G
Sbjct: 25340 NDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVG 25399

Query: 1360  KTLNLTCTVFGNPDPEVIWFKNDQDIQLSEH---FSVKVEQAKYVSMTIKGVTSEDSGKY 1416
             + +    T+  +P+P V W+K+ Q I+  ++   ++ + ++  Y  +TI  VT++D  +Y
Sbjct: 25400 ENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLY-QLTINSVTTDDDAEY 25458

Query: 1417  SINIKNKYGGEKIDVTVSVYKH 1438
             ++  +NKYG +     ++V  H
Sbjct: 25459 TVVARNKYGEDSCKAKLTVTLH 25480



 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 69/264 (26%), Positives = 108/264 (40%), Gaps = 19/264 (7%)

Query: 12    RHRHFDQSYRNIQTRYLLDEYASKKRASTQASSQKSLS-QRSSSQRASSQTSLGGTICRV 70
             R      S    Q +  L E ASK   S +     + S ++S      ++TS      R 
Sbjct: 26673 RSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRT 26732

Query: 71    CA--KRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHLEE--------DVHLARS 120
              A  K  STQ    +  R   ++ +A   + K      EL + EE        D  L   
Sbjct: 26733 HAEIKAFSTQMSINEGQRLVLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIK 26792

Query: 121   QA--RDKLDKYAIQQMMEDKLAWERH-TFEERISRAPEILVRLRSHTVWERMSVKLCFTV 177
             QA  RD+     I +  E  +  +   T  + +S AP  + + RS  + E  +V     +
Sbjct: 26793 QASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEI 26852

Query: 178   QGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQ 237
              G P+P ++W+K+   I  ++      I  +  V++LEI  A   D+  Y+  A N  GQ
Sbjct: 26853 SGEPSPEIEWFKNNLPISISS---NVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQ 26909

Query: 238   VSTNAAVVVRRFRGDEEPFRSVGL 261
              S  A+++V      EEP R V L
Sbjct: 26910 CSATASLMVLPL--VEEPSREVVL 26931



 Score = 55.1 bits (131), Expect = 5e-07
 Identities = 30/86 (34%), Positives = 46/86 (53%), Gaps = 3/86 (3%)

Query: 1350  LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVT 1409
             +P+ +TI  GK L +   V+G P P   W K + ++  S H +V    +  + + IK VT
Sbjct: 12599 MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSI-LIIKDVT 12657

Query: 1410  SEDSGKYSINIKNKYG--GEKIDVTV 1433
              +DSG YS+  +N  G   +KI V V
Sbjct: 12658 RKDSGYYSLTAENSSGTDTQKIKVVV 12683



 Score = 54.7 bits (130), Expect = 6e-07
 Identities = 61/243 (25%), Positives = 101/243 (41%), Gaps = 29/243 (11%)

Query: 154  PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
            P ++  L++ TV E  SV L   + G+P+P V WY++   I  + +   ++I    G+  
Sbjct: 897  PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSID---FQITFQSGIAR 953

Query: 214  LEINRADFDDTATYSAVATNAHGQVSTNAAVVVR--------------RFRGDEEPFRS- 258
            L I  A  +D+  ++  A N  G VST+  + V+              +F  +E+ F   
Sbjct: 954  LMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVES 1013

Query: 259  ---VGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAE 315
               V     L      P       F+ K  V    EG +V   C +   P     +P   
Sbjct: 1014 RDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNP-----KPHVY 1068

Query: 316  WYRDDVLLKESKWTKMFFGE--GQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVR 373
            W +  V L      K+ + +  G+  L  S    DD G YT+ + ++ G +  SA L + 
Sbjct: 1069 WKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL-LE 1127

Query: 374  DAD 376
            +AD
Sbjct: 1128 EAD 1130



 Score = 52.4 bits (124), Expect = 3e-06
 Identities = 26/80 (32%), Positives = 47/80 (58%), Gaps = 2/80 (2%)

Query: 1346 LIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTI 1405
            L+ GL +V T++EG+++ L C + G P P V W++ D  I+ S  F +   Q+    + I
Sbjct: 899  LVSGLKNV-TVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITF-QSGIARLMI 956

Query: 1406 KGVTSEDSGKYSINIKNKYG 1425
            +   +EDSG+++ +  N+ G
Sbjct: 957  REAFAEDSGRFTCSAVNEAG 976



 Score = 52.0 bits (123), Expect = 4e-06
 Identities = 51/223 (22%), Positives = 91/223 (40%), Gaps = 31/223 (13%)

Query: 151 SRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYG 210
           ++AP     L+S  V E  +      + GFP P V W++DG +I  +  PG  +I  + G
Sbjct: 3   TQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPG-VQISFSDG 61

Query: 211 VHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSM 270
              L I      ++  YS  ATN  GQ ++ A ++V   + +  P               
Sbjct: 62  RAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLV---KAETAP--------------- 103

Query: 271 IPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTK 330
                    F+++      R+G  V L+  +   P      P  ++YRD   ++ S   +
Sbjct: 104 -------PNFVQRLQSMTVRQGSQVRLQVRVTGIP-----TPVVKFYRDGAEIQSSLDFQ 151

Query: 331 MFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVR 373
           +       SL  +  + +D G Y++   +  G +  +A L V+
Sbjct: 152 ISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 52.0 bits (123), Expect = 4e-06
 Identities = 48/207 (23%), Positives = 83/207 (40%), Gaps = 27/207 (13%)

Query: 1245 EGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFE 1304
            E + L+C +  +     V W  +D +I SS   +I     +A L I E   +D G++T  
Sbjct: 912  ESVTLECHISGYPSPT-VTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCS 970

Query: 1305 IFDGKDNHQRSLDLSGQAFDE-----------------AFAEFQQ--FKAAAFAEKNRGR 1345
              +       S  L+ Q  +E                  F E +       +  E+  G 
Sbjct: 971  AVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGP 1030

Query: 1346 LIGGLPDVVT------IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKV-EQA 1398
                 P  +T      ++EG ++   C V GNP P V W K+   +     + V   +Q 
Sbjct: 1031 GEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQT 1090

Query: 1399 KYVSMTIKGVTSEDSGKYSINIKNKYG 1425
                + I    ++D+G+Y+I ++NK+G
Sbjct: 1091 GECKLVISMTFADDAGEYTIVVRNKHG 1117



 Score = 50.8 bits (120), Expect = 9e-06
 Identities = 113/619 (18%), Positives = 230/619 (37%), Gaps = 109/619 (17%)

Query: 872  LKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARP---GTKEISAGVDEQGNIYL 928
            L + D+    +    V+A+N  G    + +   +LV+A+     T+E+   V ++ +   
Sbjct: 2090 LVIRDVTAEDSASIMVKAINIAG---ETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMA 2146

Query: 929  GFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTD 988
             F+C+      +  W K   E+ + +++++ +      L +   D  D   YS  + + +
Sbjct: 2147 TFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDE 2206

Query: 989  GVSSS-----------FVLDPEELERLMALSNEIK-------------NPTIPLKSELAY 1024
             V ++           FV + +++E   + S E++             +  + LKS   Y
Sbjct: 2207 NVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKY 2266

Query: 1025 EIFDK-GRVRFWLQAEHLSPDASYRFIIN----------------------DREVSDSEI 1061
             I  + GR    ++         Y F+I+                      D++V + +I
Sbjct: 2267 TITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDI 2326

Query: 1062 HRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQR 1121
             +++   +   +E V  +   E + +  V I   K   QS ++LI D  K       F  
Sbjct: 2327 VQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDK---QSHMLLIEDMTKEDAGNYSFTI 2383

Query: 1122 KEFLRKQGPHFAEYL--------HWDVTEECEVRLVCKVANTKKETVFKWLKDDVLYETE 1173
                       + Y           +V E  +  L CKV+     +V  +L D+ +   +
Sbjct: 2384 PALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDD 2443

Query: 1174 TLPNLERGICE-LLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCG 1232
             +  + +G  + L+I +    D G YK               I G+V  +  L++ ++  
Sbjct: 2444 RVQAIVKGTKQRLVINRTHASDEGPYKL--------------IVGRVETNCNLSVEKI-- 2487

Query: 1233 KSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICE 1292
            K    L+ L   E   +   ++     + V W  KD +I  S   +I    ++  L +  
Sbjct: 2488 KIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLN 2547

Query: 1293 PTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPD 1352
              + D+GKYTF  + G++     L ++G A  +   +                       
Sbjct: 2548 MMKDDEGKYTF--YAGENMTSGKLTVAGGAISKPLTD----------------------- 2582

Query: 1353 VVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSED 1412
              T+ E +     C V  NPD +  W ++ + + L+ +   + +  K   + I     +D
Sbjct: 2583 -QTVAESQEAVFECEV-ANPDSKGEWLRDGKHLPLTNNIRSESDGHKR-RLIIAATKLDD 2639

Query: 1413 SGKYSINIKNKYGGEKIDV 1431
             G+Y+  +       K+ V
Sbjct: 2640 IGEYTYKVATSKTSAKLKV 2658



 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 85/412 (20%), Positives = 150/412 (36%), Gaps = 66/412 (16%)

Query: 930  FDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
            F+C+         W K  +E+   +R KI+      +L + +    D G Y+V       
Sbjct: 3031 FECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVS 3090

Query: 990  VSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASY-- 1047
             +  FV   +   R+ ++  E+             ++ +K R     +      DA +  
Sbjct: 3091 TAKLFVEGRDV--RIRSIKKEV-------------QVIEKQRAVVEFEVNEDDVDAHWYK 3135

Query: 1048 -----RFIINDRE--VSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQ 1100
                  F + +R   V +  IHR           M +      + G YT        +++
Sbjct: 3136 DGIEINFQVQERHKYVVERRIHR-----------MFISETRQSDAGEYTFVA----GRNR 3180

Query: 1101 SSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETV 1160
            SS+ L  +A                  + P   + L     +  +    C V + + +  
Sbjct: 3181 SSVTLYVNA-----------------PEPPQVLQELQPVTVQSGKPARFCAVISGRPQPK 3223

Query: 1161 FKWLKDDVLYETETLPNLERGICE--LLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGK 1218
              W K++ L  T           E  LL+ +   +D   Y    K+D G   +   ++ +
Sbjct: 3224 ISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVE 3283

Query: 1219 VYDDMILAMSRVCGKSA--SPLKVLCTPEG--IRLQCFMKYFTDEMKVNWCHKDAKISSS 1274
            V + +           A  +PL+   T EG   R QC  +    ++KV+W  KD KI  S
Sbjct: 3284 VPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQC--RVSGTDLKVSWYSKDKKIKPS 3341

Query: 1275 EHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFD--GKDNHQRSLDLSGQAFD 1324
               R+   E+   L+I E   +D+G YTF   +  G+ +   +L L  QA D
Sbjct: 3342 RFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEVQALD 3393



 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 28/107 (26%), Positives = 52/107 (48%), Gaps = 6/107 (5%)

Query: 1351  PDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTS 1410
             P  +T+ EG++   +C   G P P V W +  Q +  S    V   + K  +  I  V +
Sbjct: 26262 PRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYK-STFEISSVQA 26320

Query: 1411  EDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMA---PPQQAKPK 1454
              D G YS+ ++N  G ++ + T+++ K   ++ + A   PP+   P+
Sbjct: 26321 SDEGNYSVVVENSEGKQEAEFTLTIQK--ARVTEKAVTSPPRVKSPE 26365



 Score = 48.9 bits (115), Expect = 4e-05
 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 2/75 (2%)

Query: 1351 PDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTS 1410
            P+ V ++EG+T    C V G P P+V W+ N Q I+ S+ F V+ +   Y  + I    S
Sbjct: 1801 PEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHY--LDIVDCKS 1858

Query: 1411 EDSGKYSINIKNKYG 1425
             D+G+  +  +N  G
Sbjct: 1859 YDTGEVKVTAENPEG 1873



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 55/207 (26%), Positives = 88/207 (42%), Gaps = 26/207 (12%)

Query: 1261 KVNWCHKDAKISSSE--HMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDL 1318
            +V+W      IS+S    ++I  S+  A L I   T+ + G+Y+ +  +G          
Sbjct: 36   EVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNG---------- 85

Query: 1319 SGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIW 1378
            SGQA   A       +    AE      +  L  + T+ +G  + L   V G P P V +
Sbjct: 86   SGQATSTA-------ELLVKAETAPPNFVQRLQSM-TVRQGSQVRLQVRVTGIPTPVVKF 137

Query: 1379 FKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKH 1438
            +++  +IQ S  F +  E   Y S+ I     EDSG YS+N  N  G  +   T  +   
Sbjct: 138  YRDGAEIQSSLDFQISQEGDLY-SLLIAEAYPEDSGTYSVNATNSVG--RATSTAELLVQ 194

Query: 1439 GEKIPDMAPPQQAKPKLIPASASAAGQ 1465
            GE   +  P ++ K  +  A  S + Q
Sbjct: 195  GE---EEVPAKKTKTIVSTAQISESRQ 218



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 124/606 (20%), Positives = 230/606 (37%), Gaps = 106/606 (17%)

Query: 832  LWKAPVYSGSSPVSGYFVDFREEDA-GEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAV 890
            L+   V+ G +  + + ++  E D  G+W    Q  TA+   ++  ++ GK ++  +   
Sbjct: 5452 LYGVEVFVGET--AHFEIELSEPDVHGQWKLKGQPLTASPDCEI--IEDGKKHILILHNC 5507

Query: 891  NANGVGKPSDTSEPVLVEARPGTKEIS-------AGVDEQGNIYLGFDCQEMTDASQFTW 943
                 G+ S  +      A    KE+        + V         F+C+   +   F W
Sbjct: 5508 QLGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRW 5567

Query: 944  CKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELER 1003
             K  +EI+ D+RF++   G    + +K+   ED   Y     D    S   +++   L+ 
Sbjct: 5568 LKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKH-TSGKLIIEGIRLKF 5626

Query: 1004 LMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHR 1063
            L            PLK   A E   K    F ++  H   +   ++  ND+ +  +    
Sbjct: 5627 L-----------TPLKDVTAKE---KESAVFTVELSH--DNIRVKWFKNDQRLHTTRSVS 5670

Query: 1064 IKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKE 1123
            ++ +  T  I       SI++     V+          ++ +  +A  TVLE        
Sbjct: 5671 MQDEGKTHSI--TFKDLSIDDTSQIRVE----------AMGMSSEAKLTVLE-------- 5710

Query: 1124 FLRKQGPHFAEYLH-WDVTEECEVRLVCKVANTKKETVFKWLKD--DVLYETETLPNLER 1180
                  P+F   L  +   E+ EV L C++  +K +   KW KD  ++      +   + 
Sbjct: 5711 ----GDPYFTGKLQDYTGVEKDEVILQCEI--SKADAPVKWFKDGKEIKPSKNAVIKADG 5764

Query: 1181 GICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKV-YDDMILAMSRVCGKSASPLK 1239
                L++ K  K D G+Y      D G D    + +GK+  +D  + + R       PL 
Sbjct: 5765 KKRMLILKKALKSDIGQYTC----DCGTD----KTSGKLDIEDREIKLVR-------PLH 5809

Query: 1240 VLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKG 1299
             +   E    +   +   D++  NW  K                  A LQ  +   K++G
Sbjct: 5810 SVEVMETETARFETEISEDDIHANWKLKGE----------------ALLQTPDCEIKEEG 5853

Query: 1300 KYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAE-KNRGRLIGGLPDV--VTI 1356
            K    +      H   LD +G        +FQ     + A  + + R+IG L  +  VT+
Sbjct: 5854 KIHSLVL-----HNCRLDQTGG------VDFQAANVKSSAHLRVKPRVIGLLRPLKDVTV 5902

Query: 1357 MEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKY 1416
              G+T    C +    D  V W+   + ++ S+   V   + K  ++T++ V  ED+G+ 
Sbjct: 5903 TAGETATFDCEL-SYEDIPVEWYLKGKKLEPSDKV-VPRSEGKVHTLTLRDVKLEDAGEV 5960

Query: 1417 SINIKN 1422
             +  K+
Sbjct: 5961 QLTAKD 5966



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             D +TI  G+   LT    G P P+V WFK++ D+   +   +K   A      IK   S 
Sbjct: 10521 DKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRS- 10579

Query: 1412  DSGKYSINIKNKYGGEK 1428
             DSGKY + ++N  G  K
Sbjct: 10580 DSGKYCVVVENSTGSRK 10596



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             D + +  G++  +   ++G P P + W K DQ++  +    +K       S+++K     
Sbjct: 16246 DTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFA-TSLSVKDAVRV 16304

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             DSG Y +  KN  G   + V V V
Sbjct: 16305 DSGNYILKAKNVAGERSVTVNVKV 16328



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 39/145 (26%), Positives = 65/145 (44%), Gaps = 15/145 (10%)

Query: 1293  PTEKDKGKYTFEIFDGKDNHQRSLDLSGQA-FDEAFAEFQQFKAAAFAEKNRGRLIGGLP 1351
             P  K   KY+F +         ++++ G + + E+ AE +  +     +     L   L 
Sbjct: 23100 PDLKMGQKYSFRV--------AAVNVKGMSEYSESIAEIEPVERIEIPDLE---LADDLK 23148

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
               VTI  G +L L  +V G P P + W K  Q I L+    +   ++ Y  + +  V   
Sbjct: 23149 KTVTIRAGASLRLMVSVSGRPPPVITWSK--QGIDLASRAIIDTTES-YSLLIVDKVNRY 23205

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSVY 1436
             D+GKY+I  +N+ G +   V V VY
Sbjct: 23206 DAGKYTIEAENQSGKKSATVLVKVY 23230



 Score = 48.1 bits (113), Expect = 6e-05
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 7/105 (6%)

Query: 1354 VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAK-YVSMTIKGVTSED 1412
            V I EG  L +     GNP+P+++W KN   I   ++  +++E  K   ++ I    S+D
Sbjct: 1519 VNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQD 1578

Query: 1413 SGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAKPKLIP 1457
            S  Y+    NK G +     V+V        + A P+  +  +IP
Sbjct: 1579 SAWYTATAINKAGRDTTRCKVNVE------VEFAEPEPERKLIIP 1617



 Score = 48.1 bits (113), Expect = 6e-05
 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 3/86 (3%)

Query: 1350  LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVT 1409
             L  ++ I  G +L L   + G P PEV W K D +I+ +    V    + + S+ +  V 
Sbjct: 16643 LRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVT---SSFTSLVLDNVN 16699

Query: 1410  SEDSGKYSINIKNKYGGEKIDVTVSV 1435
               DSGKY++ ++N  G +   VTV V
Sbjct: 16700 RYDSGKYTLTLENSSGTKSAFVTVRV 16725



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 91/436 (20%), Positives = 177/436 (40%), Gaps = 67/436 (15%)

Query: 999  EELERLMALSNEIKNPTI-PLKSEL-----AYEIFDKGRVRFWLQAEHLSPDASYRFIIN 1052
            EE ++ +A   +I  PT  P K EL     A +IF+    R   Q      DA +R  + 
Sbjct: 2001 EEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFE----RIQSQTVGQGSDAHFRVRVV 2056

Query: 1053 DREVSDSEIHR--IKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAF 1110
             +   + E ++  +K +++  I       +    +    + I D  A+  +S+++     
Sbjct: 2057 GKPDPECEWYKNGVKIERSDRIY------WYWPEDNVCELVIRDVTAEDSASIMV----- 2105

Query: 1111 KTVLEEAEFQRKEFLRKQGPH---FAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDD 1167
            K +    E     FL  Q      F + L   V +E +     +   ++     KW KD 
Sbjct: 2106 KAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDG 2165

Query: 1168 V-LYETETLP-NLERGICELLIPKLSKKDHGEYKATLKDDRG-QDVSILEIAGKVYDDMI 1224
            + ++E +    + +R +  L I  +   D  +Y   L +D   +  + L + G V + + 
Sbjct: 2166 MEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFV- 2224

Query: 1225 LAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEE 1284
                    K    ++V  +  G  L+C +    + ++  W H D ++ S+    I     
Sbjct: 2225 --------KELQDIEVPESYSG-ELECIVS--PENIEGKWYHNDVELKSNGKYTITSRRG 2273

Query: 1285 MAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRG 1344
               L + + T++D+G+Y+F + DGK    +                 + K    A     
Sbjct: 2274 RQNLTVKDVTKEDQGEYSF-VIDGKKTTCK----------------LKMKPRPIA----- 2311

Query: 1345 RLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMT 1404
             ++ GL D   + EG  + L   V      E +W K+ Q++Q S+   + +++  ++ + 
Sbjct: 2312 -ILQGLSD-QKVCEGDIVQLEVKV-SLESVEGVWMKDGQEVQPSDRVHIVIDKQSHM-LL 2367

Query: 1405 IKGVTSEDSGKYSINI 1420
            I+ +T ED+G YS  I
Sbjct: 2368 IEDMTKEDAGNYSFTI 2383



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 116/553 (20%), Positives = 198/553 (35%), Gaps = 103/553 (18%)

Query: 930  FDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYS--VSVSDT 987
            F+C      +  TW K    I +  + +    G   KL++ +    D G Y+  + + + 
Sbjct: 4833 FECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNK 4892

Query: 988  DGVSSSFVLDPEELERLMALSNE----IKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSP 1043
            +  S++ ++  E   R +    E    +K   + L  EL     +K R   W +   +  
Sbjct: 4893 EKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSCEL-----NKERDVVWRKDGKIVV 4947

Query: 1044 DASYRFI-----------INDREVSDS--------EIHRIKCDKATGIIEMVMDRFSIEN 1084
            +   R +           IND + +D+          + ++C     ++E++ D      
Sbjct: 4948 EKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWL---- 5003

Query: 1085 EGTYTVQIHDGKAKSQSSLVLIGDAFKTVLE----------EAEFQRKEFLRKQGPHF-- 1132
                   I D   K + + +   D  K               AE   K  + + G H   
Sbjct: 5004 ----VKPIRDQHVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYL 5059

Query: 1133 --AEYLHWDVTE---ECE-VRLVCKVANTKKET-VFKWLKDDVLYETET----------- 1174
                 +  D+ E   E E  R   K+   ++E  + K ++D  +YE E+           
Sbjct: 5060 KIKNAMPEDIAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEAD 5119

Query: 1175 LPNLERGICELLIPKLS---KKDHGEYKATL-KDDRGQDVSILEIAGKVYDDMILAMSRV 1230
            +P   +   ELL P  +   K + G+   TL K    Q   +L  A       IL +  +
Sbjct: 5120 IPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEI 5179

Query: 1231 CGKSASPLKVLCTPEG--IRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWL 1288
                A PLK +  PE    R +C +   T E  V W      I SS+   I    +   L
Sbjct: 5180 ELDFAVPLKDVTVPERRQARFECVL---TREANVIWSKGPDIIKSSDKFDIIADGKKHIL 5236

Query: 1289 QICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIG 1348
             I +    D+G YT E+                       E ++  A  F    R + + 
Sbjct: 5237 VINDSQFDDEGVYTAEV-----------------------EGKKTSARLFVTGIRLKFMS 5273

Query: 1349 GLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGV 1408
             L D  T+ EG+T    C +  +    V+WFKND  +  S    +  E  K   + +K V
Sbjct: 5274 PLEDQ-TVKEGETATFVCEL-SHEKMHVVWFKNDAKLHTSRTVLISSE-GKTHKLEMKEV 5330

Query: 1409 TSEDSGKYSINIK 1421
            T +D  +    +K
Sbjct: 5331 TLDDISQIKAQVK 5343



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             DV+T+  G+T+ +   V G P+P++ W K  + +   +   + ++    V + IK     
Sbjct: 11611 DVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDL-IQDLPRVELQIKEAVRA 11669

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             D GKY I+ KN  G  +    V+V
Sbjct: 11670 DHGKYIISAKNSSGHAQGSAIVNV 11693



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 48/209 (22%), Positives = 81/209 (38%), Gaps = 22/209 (10%)

Query: 1238  LKVLCTPEGIRLQCFMKYFTDEMK-VNWCHKDAKISSSEHMRIGGSEEMAW-LQICEPTE 1295
             LK   + E  +L C ++      K V W     K+  + H +   S +  + L+I   TE
Sbjct: 26419 LKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTE 26478

Query: 1296  KDKGKYTFEIFDGKDNHQRSLDLSGQAF----------DEAFAEFQQFKAAAFAEKNRGR 1345
              D+G+Y  EI       + +L   GQAF           E     Q+   +    K   +
Sbjct: 26479 SDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPK 26538

Query: 1346  L---IGGLPDVVTIMEGKTLN------LTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVE 1396
                 I   P +VT ++  T++            G P P  IW K+ + I     + +  +
Sbjct: 26539 APEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSED 26598

Query: 1397  QAKYVSMTIKGVTSEDSGKYSINIKNKYG 1425
             +  +  + I    + DSG Y+  +KN  G
Sbjct: 26599 KGGFF-LEIHKTDTSDSGLYTCTVKNSAG 26626



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 5/91 (5%)

Query: 1345  RLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMT 1404
             +LI GL     +  G T+     + G P P   W  +  +I+  EH++V+ +    V +T
Sbjct: 11210 KLIEGL----VVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSV-LT 11264

Query: 1405  IKGVTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
             IK     D+G+Y I + N  G + + V ++V
Sbjct: 11265 IKNCLRRDTGEYQITVSNAAGSKTVAVHLTV 11295



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 24/79 (30%), Positives = 39/79 (49%)

Query: 1357 MEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKY 1416
            +EG+T      V G P PE  WF + Q I       V +++    S+ I   T  DSG++
Sbjct: 1423 LEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEW 1482

Query: 1417 SINIKNKYGGEKIDVTVSV 1435
            ++  +N+ G   I V ++V
Sbjct: 1483 TVVAQNRAGRSSISVILTV 1501



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 47/177 (26%), Positives = 74/177 (41%), Gaps = 37/177 (20%)

Query: 181  PTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVST 240
            P   V+WYKDG    +  E  KYR+ S+  VH L I   D  D   YS V       V T
Sbjct: 2155 PFVKVKWYKDGM---EVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDE-NVKT 2210

Query: 241  NAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCT 300
             A ++V                      +++ +    V+ L+   V     GE   L+C 
Sbjct: 2211 TAKLIVE--------------------GAVVEF----VKELQDIEVPESYSGE---LEC- 2242

Query: 301  MLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRI 357
             +V+P+        +WY +DV LK +    +    G+ +L+   + K+D+G Y+  I
Sbjct: 2243 -IVSPE----NIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVI 2294



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 48/202 (23%), Positives = 87/202 (43%), Gaps = 25/202 (12%)

Query: 1257 TDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEP-TEKDKGKYTFEIFDGKDNHQRS 1315
            T+  +VNW  ++  + S E  +    +    L I +  TE  +G+Y  E          +
Sbjct: 4459 TNAKEVNWYFENKLVPSDEKFKCLQDQNTYTLVIDKVNTEDHQGEYVCE----------A 4508

Query: 1316 LDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPE 1375
            L+ SG+    A  +    K AA   K +        + + +  G     TC +   P+  
Sbjct: 4509 LNDSGKTATSA--KLTVVKRAAPVIKRK-------IEPLEVALGHLAKFTCEIQSAPNVR 4559

Query: 1376 VIWFKNDQDIQLSEHFSVKVEQAKYV-SMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVS 1434
              WFK  ++I  S+  S++   +KY+ S+ I      D G+Y+    N+YG      T++
Sbjct: 4560 FQWFKAGREIYESDKCSIR--SSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLT 4617

Query: 1435 VYKHG--EKIPDMAPPQQAKPK 1454
            V   G  +K+  + P ++ +PK
Sbjct: 4618 VTVPGGEKKVRKLLPERKPEPK 4639



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 1350  LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVT 1409
             L  VV +    TL L  T+ G P+PEV W K +    L++   ++V  + +  + I  VT
Sbjct: 18808 LRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEG--ILTDRAQIEV-TSSFTMLVIDNVT 18864

Query: 1410  SEDSGKYSINIKNKYGGEKIDVTVSV 1435
               DSG+Y++ ++N  G +   V V V
Sbjct: 18865 RFDSGRYNLTLENNSGSKTAFVNVRV 18890



 Score = 45.4 bits (106), Expect = 4e-04
 Identities = 86/402 (21%), Positives = 144/402 (35%), Gaps = 53/402 (13%)

Query: 12   RHRHFDQSYR-NIQTRYLLDEYASKKRASTQASSQKSLSQRSSSQRASSQTSLGGTICRV 70
            R   F+ +Y+  I   Y  DE      AS       S +  S   +A  + S G  + R 
Sbjct: 3345 RMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEVQALDRQSSGKDV-RE 3403

Query: 71   CAKRVSTQEDE--EQENRSRYQSLVAAYGEAKRQRFLSELAHLEEDVHLARSQARDKLDK 128
             AK  +  +    ++E++   + + +  G +         +  +  +H A S    +L  
Sbjct: 3404 SAKSQAVADSSFTKEESKISQKEIKSFQGSSYEYEVQVFESVSQSSIHTAASVQDTQLCH 3463

Query: 129  YAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWY 188
             A    + +     +   +E    AP+I + L+  TV    + +    ++      V W 
Sbjct: 3464 TASLSQIAESTELSKECAKESTGEAPKIFLHLQDVTVKCGDTAQFLCVLKDDSFIDVTWT 3523

Query: 189  KDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRR 248
             +G+ I    E  + +   N  +  L I      D   YS +  N  G+ +T+A + V  
Sbjct: 3524 HEGAKI---EESERLKQSQNGNIQFLTICNVQLVDQGLYSCIVHNDCGERTTSAVLSVEG 3580

Query: 249  -------------------------FRGDEEPFRSVGLPIG-----LPLSSMIPY--THF 276
                                        +EE   S  L +      L L S  P   T F
Sbjct: 3581 APESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYPTKF 3640

Query: 277  DVQFLEKFGVTFRRE--------GETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKW 328
            D +  E  G  F +E        G+  TL  T++  P     +P+ +W+ + VLL  S  
Sbjct: 3641 DSE-KEGTGPIFIKEVSNADISMGDVATLSVTVIGIP-----KPKIQWFFNGVLLTPSAD 3694

Query: 329  TKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFL 370
             K  F     SL       +DEG YT    +  G +  SA+L
Sbjct: 3695 YKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYL 3736



 Score = 45.4 bits (106), Expect = 4e-04
 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 3/80 (3%)

Query: 1356  IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGK 1415
             I  G TL L+  + G P P+V W K D+D        V    +K   + I+    ED G 
Sbjct: 10925 IKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGSK---LEIRNAAHEDGGI 10981

Query: 1416  YSINIKNKYGGEKIDVTVSV 1435
             YS+ ++N  G + + V V V
Sbjct: 10982 YSLTVENPAGSKTVSVKVLV 11001



 Score = 45.1 bits (105), Expect = 5e-04
 Identities = 91/479 (18%), Positives = 176/479 (36%), Gaps = 75/479 (15%)

Query: 943  WCKSYEEISDDERFKIETVGDH-SKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEEL 1001
            W K+  +I   +R       D+  +L +++   ED  +  V   +  G +SS      + 
Sbjct: 2065 WYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQA 2124

Query: 1002 ERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEI 1061
            ++L+  + E+++     K  +A             + E   P    ++  +  EV + + 
Sbjct: 2125 KQLITFTQELQDVVAKEKDTMAT-----------FECETSEPFVKVKWYKDGMEVHEGDK 2173

Query: 1062 HRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQR 1121
            +R+  D+    + ++    S + E    V + D   K+ + L++ G   + V E  + + 
Sbjct: 2174 YRMHSDRKVHFLSILTIDTS-DAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIE- 2231

Query: 1122 KEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNL--E 1179
                              V E     L C V+    E   KW  +DV  ++     +   
Sbjct: 2232 ------------------VPESYSGELECIVSPENIEG--KWYHNDVELKSNGKYTITSR 2271

Query: 1180 RGICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLK 1239
            RG   L +  ++K+D GEY   + D +     +      +     L+  +VC        
Sbjct: 2272 RGRQNLTVKDVTKEDQGEYSFVI-DGKKTTCKLKMKPRPIAILQGLSDQKVC-------- 2322

Query: 1240 VLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKG 1299
                 EG  +Q  +K   + ++  W     ++  S+ + I   ++   L I + T++D G
Sbjct: 2323 -----EGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAG 2377

Query: 1300 KYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEG 1359
             Y+F I         +L LS       ++                 +I  L D V ++EG
Sbjct: 2378 NYSFTI--------PALGLSTSGRVSVYSV---------------DVITPLKD-VNVIEG 2413

Query: 1360 KTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSI 1418
                L C V       V W+ ND+ I+  +     V+  K   + I    + D G Y +
Sbjct: 2414 TKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQ-RLVINRTHASDEGPYKL 2471



 Score = 45.1 bits (105), Expect = 5e-04
 Identities = 21/84 (25%), Positives = 42/84 (50%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             DV+ +  G+T  L   + G P P+V+W K+ ++++ +          +  ++ +K     
Sbjct: 18410 DVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRT 18469

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             D G+Y + + N  G + I +TV V
Sbjct: 18470 DGGQYILKLSNVGGTKSIPITVKV 18493



 Score = 44.7 bits (104), Expect = 7e-04
 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 1354 VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAK-YVSMTIKGVTSED 1412
            V ++EG T      + G P PEV WF++ Q I  S    V++  +     +TI  VT  +
Sbjct: 15   VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKAN 74

Query: 1413 SGKYSINIKNKYG 1425
            SG+YS+   N  G
Sbjct: 75   SGRYSLKATNGSG 87



 Score = 44.7 bits (104), Expect = 7e-04
 Identities = 113/572 (19%), Positives = 200/572 (34%), Gaps = 122/572 (21%)

Query: 940  QFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPE 999
            + +W K  + +S   + K    G    L L     ED   Y+    +  GV+++      
Sbjct: 3223 KISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSV 3282

Query: 1000 ELERLMALSNEIKNPTIPLKSELAYEIFDKGR-VRFWLQAEHLSPDASYRFIINDREVSD 1058
            E+  +++   E+      + + L   +  +G+  RF  Q      D    +   D+++  
Sbjct: 3283 EVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARF--QCRVSGTDLKVSWYSKDKKIKP 3340

Query: 1059 SEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHD--GKAKSQSSLVL----------- 1105
            S   R+   + T  +E+       E+EGTYT    +  G+  S ++L L           
Sbjct: 3341 SRFFRMTQFEDTYQLEIA--EAYPEDEGTYTFVASNAVGQVSSTANLSLEVQALDRQSSG 3398

Query: 1106 -----------IGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVAN 1154
                       + D+  T  EE++  +KE    QG  +          E EV++   V+ 
Sbjct: 3399 KDVRESAKSQAVADSSFTK-EESKISQKEIKSFQGSSY----------EYEVQVFESVSQ 3447

Query: 1155 TKKETVFKWLKDDVLYETETLPNLERGICELLIPKLSKKDHGEYKATLKDDRGQDVSILE 1214
            +   T    ++D  L  T +L  +          +LSK+         K+  G+      
Sbjct: 3448 SSIHTAAS-VQDTQLCHTASLSQIAEST------ELSKE-------CAKESTGE------ 3487

Query: 1215 IAGKVYDDMILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSS 1274
             A K++    L +  V  K     + LC  +          F D   V W H+ AKI  S
Sbjct: 3488 -APKIF----LHLQDVTVKCGDTAQFLCVLKD-------DSFID---VTWTHEGAKIEES 3532

Query: 1275 EHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFA------ 1328
            E ++   +  + +L IC     D+G Y+  + +       S  LS +   E+        
Sbjct: 3533 ERLKQSQNGNIQFLTICNVQLVDQGLYSCIVHNDCGERTTSAVLSVEGAPESILHERIEQ 3592

Query: 1329 ----EFQQFKAAAFAEKNRG---------------RLIGGLPDVVT-------------- 1355
                E ++F ++  + +  G                L+   P   T              
Sbjct: 3593 EIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYPTKFDSEKEGTGPIFI 3652

Query: 1356 -------IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGV 1408
                   I  G    L+ TV G P P++ WF N   +  S  +    +   + S+ I   
Sbjct: 3653 KEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDH-SLIILFT 3711

Query: 1409 TSEDSGKYSINIKNKYGGEKIDVTVSVYKHGE 1440
              ED G+Y+    N YG       + +   GE
Sbjct: 3712 KLEDEGEYTCMASNDYGKTICSAYLKINSKGE 3743



 Score = 44.7 bits (104), Expect = 7e-04
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             D + I  G++L +   V G P P V WFK+  +I+   +  +  +     S+ ++  T +
Sbjct: 21661 DGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEI-TDVLGSTSLFVRDATRD 21719

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
               G Y++  KN  G  K ++ V V
Sbjct: 21720 HRGVYTVEAKNASGSAKAEIKVKV 21743



 Score = 44.3 bits (103), Expect = 9e-04
 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             D + +  G+T  L   V G P P + W + D++I+ S    +K    K + + +K     
Sbjct: 17328 DTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKAL-LIVKDAIRI 17386

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             D G+Y +   N  G +   V V V
Sbjct: 17387 DGGQYILRASNVAGSKSFPVNVKV 17410



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 29/92 (31%), Positives = 39/92 (42%), Gaps = 2/92 (2%)

Query: 167   ERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTAT 226
             E  SV     V G P P ++W KDG  +  +  P    I      + L I     +DT  
Sbjct: 25503 EGQSVCFEIRVSGIPPPTLKWEKDGQPL--SLGPNIEIIHEGLDYYALHIRDTLPEDTGY 25560

Query: 227   YSAVATNAHGQVSTNAAVVVRRFRGDEEPFRS 258
             Y   ATN  G  S  A + V R R  ++ F+S
Sbjct: 25561 YRVTATNTAGSTSCQAHLQVERLRYKKQEFKS 25592



 Score = 43.5 bits (101), Expect = 0.001
 Identities = 60/266 (22%), Positives = 105/266 (39%), Gaps = 54/266 (20%)

Query: 179  GFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQV 238
            G PT VV+W  DG  +  A    + R+ + +G  +L+   A   D+   +  ATN +G  
Sbjct: 1684 GDPTMVVEWLHDGKPLEAA---NRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTD 1740

Query: 239  STNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKF----------GVTF 288
             T+A ++V+    DE+          L   S +P     +Q +E+           GVT 
Sbjct: 1741 HTSATLIVK----DEK---------SLVEESQLPEGRKGLQRIEELERMAHEGALTGVTT 1787

Query: 289  RR------------------EGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTK 330
             +                  EGET   +C +   P     QP+  WY +  L+++SK  +
Sbjct: 1788 DQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYP-----QPKVNWYLNGQLIRKSKRFR 1842

Query: 331  MFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVR---DADPLVTGAPGAPM 387
            + + +G   L        D G   +   +  GV +H   L ++   D   ++  AP    
Sbjct: 1843 VRY-DGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRP 1901

Query: 388  DLQCHDANR-DYVIVTWKPPNTTTES 412
            +   H+  +  + +     P  TTE+
Sbjct: 1902 EFHVHEPGKLQFEVQKVDRPVDTTET 1927



 Score = 43.5 bits (101), Expect = 0.001
 Identities = 38/141 (26%), Positives = 61/141 (43%), Gaps = 8/141 (5%)

Query: 107  ELAHLEEDVHLARSQARDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVW 166
            EL H  +++     +A  +  K  I     DK+             AP+I  R++S TV 
Sbjct: 1991 ELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSM------EAPKIFERIQSQTVG 2044

Query: 167  ERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTAT 226
            +         V G P P  +WYK+G  I ++     Y  E N  V  L I     +D+A+
Sbjct: 2045 QGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDN--VCELVIRDVTAEDSAS 2102

Query: 227  YSAVATNAHGQVSTNAAVVVR 247
                A N  G+ S++A ++V+
Sbjct: 2103 IMVKAINIAGETSSHAFLLVQ 2123



 Score = 43.5 bits (101), Expect = 0.001
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 1356  IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGK 1415
             +  G +  +T    G P P V+W K D D++   +      +    S+TI+     DSGK
Sbjct: 19893 VKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRT---SLTIENANRNDSGK 19949

Query: 1416  YSINIKNKYGGEKIDVTVSV 1435
             Y++ I+N      + + V V
Sbjct: 19950 YTLTIQNVLSAASLTLVVKV 19969



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 33/94 (35%), Positives = 46/94 (48%), Gaps = 8/94 (8%)

Query: 291  EGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKM-FFGEGQASLSFSHLHKDD 349
            EG  VT  C M   P      P+  WY+D   +K  +  +M F  +G+ASL    +  +D
Sbjct: 1258 EGMGVTFHCKMSGYP-----LPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPED 1312

Query: 350  EGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAP 383
            EG+YT    +  G +  S  L+V  A PL  GAP
Sbjct: 1313 EGIYTAFASNIKGNAICSGKLYVEPAAPL--GAP 1344



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 8/115 (6%)

Query: 145  TFEERISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYR 204
            T +++  + P+I++      V E  + +    V G+P P V WY +G LI ++    ++R
Sbjct: 1786 TTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSK---RFR 1842

Query: 205  IESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSV 259
            +  + G+H L+I      DT      A N  G +     + +++     E FRSV
Sbjct: 1843 VRYD-GIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQ----REDFRSV 1892



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 80/376 (21%), Positives = 138/376 (36%), Gaps = 82/376 (21%)

Query: 905  VLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDH 964
            VL E    TK + A ++      +   C+     ++  W K  EEI +  R++I T G  
Sbjct: 6153 VLEEEAVFTKNL-ANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRK 6211

Query: 965  SKLYLKNPDKEDLGTYSVSV--SDTDG------VSSSFVLDPEELERLMALSNE----IK 1012
              L ++N   ED G Y+  +  S TDG      +++ F+  P+ LE L     E    I 
Sbjct: 6212 RILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAEFVCSIS 6271

Query: 1013 NPTIP---------LKSELAYEIFDKGRVRFWL--------------------QAEHLSP 1043
              + P         L+S   Y++   G+ R  +                     A HL+ 
Sbjct: 6272 KESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTV 6331

Query: 1044 DASYRFII--NDREVSDSEIHRIKCDKATGII--------EMVMDR---FSIENEGTYTV 1090
                R ++   D  V + +     C+  T           E + D      ++ +  YT+
Sbjct: 6332 IEKLRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTL 6391

Query: 1091 QIHDGKAKSQSSLVL---------IGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVT 1141
            +I D     Q++  +         +  A   ++EE + +  E L+            +  
Sbjct: 6392 RIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLK----------DIETM 6441

Query: 1142 EECEVRLVCKVANTKKETVFKWLK--DDVLYETETLPNLERGICELLIPKLSKKDHGEYK 1199
            E+  V   CKV   +     KW K  ++V ++      +++    L I      D GEY 
Sbjct: 6442 EKKSVTFWCKV--NRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYI 6499

Query: 1200 ATLKDDRGQDVSILEI 1215
             T     GQD S+ E+
Sbjct: 6500 VT----AGQDKSVAEL 6511



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 20/80 (25%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 1356  IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGK 1415
             +  G ++ L     G P P  +W K D ++ L            + ++T++     D+GK
Sbjct: 22064 VRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTT---DSFSTLTVENCNRNDAGK 22120

Query: 1416  YSINIKNKYGGEKIDVTVSV 1435
             Y++ ++N  G + I  TV V
Sbjct: 22121 YTLTVENNSGSKSITFTVKV 22140



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 27/87 (31%), Positives = 39/87 (44%), Gaps = 1/87 (1%)

Query: 1350  LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVE-QAKYVSMTIKGV 1408
             L  V+T+  G T+ L   V G P PEV W K+     L+    VK++ +A     ++   
Sbjct: 11902 LSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKA 11961

Query: 1409  TSEDSGKYSINIKNKYGGEKIDVTVSV 1435
                D GKY +   N  G      TV+V
Sbjct: 11962 KRSDGGKYVVTATNTAGSFVAYATVNV 11988



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 1350  LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVT 1409
             +  ++T+  G  + L  TVFG P P V W K+   ++ +E   + + Q    ++ +  V 
Sbjct: 12996 MKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAM-QRNLCTLELFSVN 13054

Query: 1410  SEDSGKYSINIKNKYGGEKIDVTVSV 1435
              +DSG Y+I  +N  G +   + + V
Sbjct: 13055 RKDSGDYTITAENSSGSKSATIKLKV 13080



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 6/99 (6%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
             V  + G+ +++     G PDP + W K    I  + H+ V V ++    +   GV  +D+
Sbjct: 24732 VHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDA 24791

Query: 1414  GKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAK 1452
             G Y +  KN++G ++  V + V      +PD  PP+  K
Sbjct: 24792 GFYVVCAKNRFGIDQKTVELDV----ADVPD--PPRGVK 24824



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             DV+ +  G+ L +   + G P P + W K+  +I+      + +    +  +T+K     
Sbjct: 19492 DVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEI-ISTDNHTLLTVKDCIRR 19550

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             D+G+Y + +KN  G   + V   V
Sbjct: 19551 DTGQYVLTLKNVAGTRSVAVNCKV 19574



 Score = 42.0 bits (97), Expect = 0.004
 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 10/98 (10%)

Query: 1354 VTIMEGKTLNLTCTVFGNPDPEVIWFKN----DQDIQLSEHFSVKVEQAKYVSMTIKGVT 1409
            + IM GKTL +   V G P P  +W K     D+D  + ++   K E      + IK   
Sbjct: 8809 IQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSE------LIIKDAL 8862

Query: 1410 SEDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAP 1447
             +D G+Y I   N  G +     V V+     + D+ P
Sbjct: 8863 RKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKP 8900



 Score = 42.0 bits (97), Expect = 0.004
 Identities = 27/87 (31%), Positives = 46/87 (52%), Gaps = 2/87 (2%)

Query: 1350  LPDVVTIMEGKTLNLTC-TVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGV 1408
             + D +TI  G T+ L   ++ G P P+  W K  +DI+ S+   +       + +TIK  
Sbjct: 14079 IKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSM-LTIKYA 14137

Query: 1409  TSEDSGKYSINIKNKYGGEKIDVTVSV 1435
             T +D+G+Y+I   N +G +   V V+V
Sbjct: 14138 TRKDAGEYTITATNPFGTKVEHVKVTV 14164



 Score = 42.0 bits (97), Expect = 0.004
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
             + +  G+ + L   + G P P   WF     ++ SE  +V+    K   +TI+  T  D+
Sbjct: 23443 IHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETH-TKVAKLTIRETTIRDT 23501

Query: 1414  GKYSINIKNKYG 1425
             G+Y++ +KN  G
Sbjct: 23502 GEYTLELKNVTG 23513



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 2/88 (2%)

Query: 1349  GLPDVVTIM-EGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKG 1407
             GLPD+  +  E     L   + G P P V W K +  +      SV+   A   ++ +  
Sbjct: 13681 GLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVE-SSAVNTTLIVYD 13739

Query: 1408  VTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
                 D+GKY+I +KN  G ++  +++ V
Sbjct: 13740 CQKSDAGKYTITLKNVAGTKEGTISIKV 13767



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 32/105 (30%), Positives = 47/105 (44%), Gaps = 9/105 (8%)

Query: 1350  LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVT 1409
             L  VVTI    TL L   + G P PEV W ++    +  +  S++   + Y  + +  V 
Sbjct: 15561 LRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHG--ESLDKASIE-STSSYTLLIVGNVN 15617

Query: 1410  SEDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAKPK 1454
               DSGKY + ++N  G +   V V V      +    PPQ  K K
Sbjct: 15618 RFDSGKYILTVENSSGSKSAFVNVRV------LDTPGPPQDLKVK 15656



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 21/84 (25%), Positives = 40/84 (47%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             +VV    G ++ L   + G P P + W+K+D+++Q +    V+       S+ IK     
Sbjct: 20575 EVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVE-NTTDLASILIKDADRL 20633

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             +SG Y + ++N  G     + V +
Sbjct: 20634 NSGCYELKLRNAMGSASATIRVQI 20657



 Score = 41.2 bits (95), Expect = 0.007
 Identities = 22/90 (24%), Positives = 43/90 (47%), Gaps = 1/90 (1%)

Query: 1346  LIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTI 1405
             L G    ++T   G    +   + G P P+V W   +  ++ ++  S+   + +  ++T+
Sbjct: 22344 LTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDR-TTLTV 22402

Query: 1406  KGVTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
             K     DSG+Y + ++N  G +   VTV V
Sbjct: 22403 KDSMRGDSGRYFLTLENTAGVKTFSVTVVV 22432



 Score = 40.8 bits (94), Expect = 0.010
 Identities = 37/149 (24%), Positives = 63/149 (42%), Gaps = 2/149 (1%)

Query: 1287 WLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRL 1346
            W+   EP  + K + T  + +GK    R   L+ Q   +     ++ +A    E     L
Sbjct: 7329 WVACGEPVAETKMEVT-GLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFL 7387

Query: 1347 IGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIK 1406
               L   +T+  G  + L  TV G P+P++ W K D  ++  +  +++    K  ++TI 
Sbjct: 7388 DVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIE-NVPKKSTVTIV 7446

Query: 1407 GVTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
                 D+G Y I   N  G     V V+V
Sbjct: 7447 DSKRSDTGTYIIEAVNVCGRATAVVEVNV 7475



 Score = 40.4 bits (93), Expect = 0.013
 Identities = 68/297 (22%), Positives = 116/297 (39%), Gaps = 49/297 (16%)

Query: 1150 CKVANTKKETVFKWLKDDVL----YETETLPNLERGICELLIPKLSKKDHGEYKATLKDD 1205
            C+V    K  V+ W K  V     Y  +   N + G C+L+I      D GEY   +++ 
Sbjct: 1057 CQVGGNPKPHVY-WKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNK 1115

Query: 1206 RGQ---DVSILEIAG-----KVYDDMILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFT 1257
             G+     S+LE A      K   +M L  ++V      P KV  T  G     + K + 
Sbjct: 1116 HGETSASASLLEEADYELLMKSQQEM-LYQTQVTAFVQEP-KVGETAPGFVYSEYEKEYE 1173

Query: 1258 DEMKV--NWCHKDAKISSS----EHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDN 1311
             E  +      KD  +  +    +   I   EE    ++ +  E    K T E    +D 
Sbjct: 1174 KEQALIRKKMAKDTVVVRTYVEDQEFHISSFEE----RLIKEIEYRIIKTTLEELLEEDG 1229

Query: 1312 HQR-SLDLS-GQAFDEAF-AEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTV 1368
             ++ ++D+S  +A +  F +  + ++                     I+EG  +   C +
Sbjct: 1230 EEKMAVDISESEAVESGFDSRIKNYR---------------------ILEGMGVTFHCKM 1268

Query: 1369 FGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYG 1425
             G P P++ W+K+ + I+  E + +   Q    S+ I  V  ED G Y+    N  G
Sbjct: 1269 SGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKG 1325



 Score = 40.4 bits (93), Expect = 0.013
 Identities = 29/109 (26%), Positives = 49/109 (44%), Gaps = 11/109 (10%)

Query: 159  RLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIE-SNYGVHTLEIN 217
            R++++ + E M V     + G+P P + WYKDG  I       +Y+++    G  +L I 
Sbjct: 1250 RIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGE---RYQMDFLQDGRASLRIP 1306

Query: 218  RADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLP 266
                +D   Y+A A+N  G    +  + V       EP   +G P  +P
Sbjct: 1307 VVLPEDEGIYTAFASNIKGNAICSGKLYV-------EPAAPLGAPTYIP 1348



 Score = 40.4 bits (93), Expect = 0.013
 Identities = 21/71 (29%), Positives = 32/71 (45%)

Query: 1355 TIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSG 1414
            T+ +G   +    V G PDPE  W+KN   I+ S+       +     + I+ VT+EDS 
Sbjct: 2042 TVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSA 2101

Query: 1415 KYSINIKNKYG 1425
               +   N  G
Sbjct: 2102 SIMVKAINIAG 2112



 Score = 40.4 bits (93), Expect = 0.013
 Identities = 31/121 (25%), Positives = 55/121 (45%), Gaps = 18/121 (14%)

Query: 1332  QFKAAAFAEKNRG--RLIG--------------GLP-DVVTIMEGKTLNLTCTVFGNPDP 1374
             QF+  A+ EK +   R++G               LP +  +I  G+ L +   V G P P
Sbjct: 17977 QFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRP 18036

Query: 1375  EVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVS 1434
              + W K+ + ++ +   +V+ E A    + IK    +D GKY++   N  G    +++V 
Sbjct: 18037 NISWVKDGEPLKQTTRVNVE-ETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVI 18095

Query: 1435  V 1435
             V
Sbjct: 18096 V 18096



 Score = 40.0 bits (92), Expect = 0.017
 Identities = 21/82 (25%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 1354 VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
            + ++EG+ L++       P P V W K+ ++++ S+  ++K +         K V + D+
Sbjct: 8091 IIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRA-DA 8149

Query: 1414 GKYSINIKNKYGGEKIDVTVSV 1435
            G Y+I ++NK G     + V V
Sbjct: 8150 GIYTITLENKLGSATASINVKV 8171



 Score = 40.0 bits (92), Expect = 0.017
 Identities = 22/93 (23%), Positives = 43/93 (46%), Gaps = 3/93 (3%)

Query: 1344  GRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKY-VS 1402
             G L   L   + +  G T+ L   V G P P++ W K   ++ L +   + ++   +   
Sbjct: 13388 GELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSK--PNVNLRDRIGLDIKSTDFDTF 13445

Query: 1403  MTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
             +  + V   D+GKY + ++N  G ++  + V V
Sbjct: 13446 LRCENVNKYDAGKYILTLENSCGKKEYTIVVKV 13478



 Score = 40.0 bits (92), Expect = 0.017
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 1359  GKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSI 1418
             G+ + +     G P P V W K+++++     +S++   +  + +TI  VT  D+GKY +
Sbjct: 20981 GEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSL-LTIPQVTRNDTGKYIL 21039

Query: 1419  NIKNKYGGEKIDVTVSV 1435
              I+N  G  K   TVSV
Sbjct: 21040 TIENGVGEPK-SSTVSV 21055



 Score = 39.7 bits (91), Expect = 0.022
 Identities = 47/191 (24%), Positives = 75/191 (39%), Gaps = 27/191 (14%)

Query: 1263  NWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQA 1322
             +W    A +  S  ++ GGS+   ++       K++GK  +E   GKD   R   L    
Sbjct: 10126 DWTKSSADLEWSPPLKDGGSKVTGYIV----EYKEEGKEEWE--KGKDKEVRGTKLVVTG 10179

Query: 1323  FDE-AFAEFQ--QFKAAAFAEKN--------RGRLIG-------GLPDVVTIMEGKTLNL 1364
               E AF +F+      A   E          + RL+         + D + +  G  + +
Sbjct: 10180 LKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRI 10239

Query: 1365  TCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKY 1424
                V G P P V W  N++   L +  +++   A   SM IK       G YS+  KN+ 
Sbjct: 10240 IAYVSGKPPPTVTWNMNER--TLPQEATIET-TAISSSMVIKNCQRSHQGVYSLLAKNEA 10296

Query: 1425  GGEKIDVTVSV 1435
             G  K  + V V
Sbjct: 10297 GERKKTIIVDV 10307



 Score = 39.3 bits (90), Expect = 0.028
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 3/82 (3%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
             + + +G  + LT  + G P P   W K  QDI  S+   +   +  +  + IK     DS
Sbjct: 23841 IFVRQGGVIRLTIPIKGKPFPICKWTKEGQDI--SKRAMIATSET-HTELVIKEADRGDS 23897

Query: 1414  GKYSINIKNKYGGEKIDVTVSV 1435
             G Y + ++NK G + + + V V
Sbjct: 23898 GTYDLVLENKCGKKAVYIKVRV 23919



 Score = 39.3 bits (90), Expect = 0.028
 Identities = 60/321 (18%), Positives = 118/321 (36%), Gaps = 50/321 (15%)

Query: 68    CRVCAKRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHLEEDVHLARSQARDKL- 126
             C++  K +  ++ E Q+  ++  S +    +A  Q  +S+ A   E++ ++ +++++KL 
Sbjct: 26632 CKLTIKAI--KDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLA 26689

Query: 127   -----DKYAIQQMMEDKLAW--ERHTFEERISRAPEILVRLRSHTVWERMSV-------- 171
                   K  I + ++   A   E+    E I++  +    +R+H   +  S         
Sbjct: 26690 LKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQ 26749

Query: 172   KLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVA 231
             +L           V+W  +G  +  + E   YR   +    TL I +A   D    + ++
Sbjct: 26750 RLVLKANIAGATDVKWVLNGVELTNSEE---YRYGVSGSDQTLTIKQASHRDEGILTCIS 26806

Query: 232   TNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRRE 291
                 G V     + + +   D   F      I  P S  I                   E
Sbjct: 26807 KTKEGIVKCQYDLTLSKELSDAPAF------ISQPRSQNI------------------NE 26842

Query: 292   GETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEG 351
             G+ V   C +   P      P  EW+++++ +  S    +       SL   +    D G
Sbjct: 26843 GQNVLFTCEISGEPS-----PEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSG 26897

Query: 352   LYTLRIVSRGGVSDHSAFLFV 372
              YT++  +  G    +A L V
Sbjct: 26898 KYTIKAKNFRGQCSATASLMV 26918



 Score = 38.9 bits (89), Expect = 0.037
 Identities = 26/104 (25%), Positives = 44/104 (42%), Gaps = 15/104 (14%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAK---YVSMTIKGVTS 1410
             + +  G +  +     G P PE+ W + + +      F+ KV+  K   Y  ++I     
Sbjct: 17729 IVVRAGGSARIHIPFKGRPTPEITWSREEGE------FTDKVQIEKGVNYTQLSIDNCDR 17782

Query: 1411  EDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAKPK 1454
              D+GKY + ++N  G +   VTV V      +    PPQ    K
Sbjct: 17783 NDAGKYILKLENSSGSKSAFVTVKV------LDTPGPPQNLAVK 17820



 Score = 38.5 bits (88), Expect = 0.048
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
             VT+  G  ++L     G P P + W K+   ++ SE       + K ++++IK    E  
Sbjct: 21268 VTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENK-ITLSIKNAKKEHG 21326

Query: 1414  GKYSINIKNKYGGEKIDVTV 1433
             GKY++ + N      + +TV
Sbjct: 21327 GKYTVILDNAVCRIAVPITV 21346



 Score = 38.5 bits (88), Expect = 0.048
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 1359  GKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE-DSGKYS 1417
             G TL L     G P P + WF   + +Q SE+ +++     Y  + +K V  +  +GKY 
Sbjct: 24338 GSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIE-NTEHYTHLVMKNVQRKTHAGKYK 24396

Query: 1418  INIKNKYG 1425
             + + N +G
Sbjct: 24397 VQLSNVFG 24404



 Score = 38.1 bits (87), Expect = 0.063
 Identities = 25/75 (33%), Positives = 34/75 (45%), Gaps = 3/75 (4%)

Query: 172  KLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVA 231
            K    +Q  P    QW+K G  I    E  K  I S+  + +LEI R    D   Y+  A
Sbjct: 4547 KFTCEIQSAPNVRFQWFKAGREIY---ESDKCSIRSSKYISSLEILRTQVVDCGEYTCKA 4603

Query: 232  TNAHGQVSTNAAVVV 246
            +N +G VS  A + V
Sbjct: 4604 SNEYGSVSCTATLTV 4618



 Score = 38.1 bits (87), Expect = 0.063
 Identities = 22/90 (24%), Positives = 42/90 (46%), Gaps = 5/90 (5%)

Query: 1352 DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQL-SEHFSVKVEQAK----YVSMTIK 1406
            D + +  G+ +++   V G P P++ W KN+  I+  ++   +  E+         ++I 
Sbjct: 9101 DTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIP 9160

Query: 1407 GVTSEDSGKYSINIKNKYGGEKIDVTVSVY 1436
                ED G Y++   N+ G    +V V VY
Sbjct: 9161 KAVREDKGTYTVTASNRLGSVFRNVHVEVY 9190



 Score = 38.1 bits (87), Expect = 0.063
 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             D V +  G+   L   V G P P + W K+ ++++ +    +K+      ++  K  T  
Sbjct: 15164 DTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFS-TNLVNKDSTRR 15222

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             DSG Y++   N  G  K    V V
Sbjct: 15223 DSGAYTLTATNPGGFAKHIFNVKV 15246



 Score = 38.1 bits (87), Expect = 0.063
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 3/72 (4%)

Query: 1355  TIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVS-MTIKGVTSEDS 1413
             T++ G+ L +     G P P V W K+  ++ L +   V  E  +  S +TIK    ED 
Sbjct: 15853 TVLAGEDLKVDVPFIGRPTPAVTWHKD--NVPLKQTTRVNAESTENNSLLTIKDACREDV 15910

Query: 1414  GKYSINIKNKYG 1425
             G Y + + N  G
Sbjct: 15911 GHYVVKLTNSAG 15922



 Score = 37.0 bits (84), Expect = 0.14
 Identities = 26/93 (27%), Positives = 42/93 (45%), Gaps = 2/93 (2%)

Query: 1353  VVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSED 1412
             +V +  G  + L   V G P P+V W K   D  + +     V+   +  + I   T +D
Sbjct: 12310 LVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAF--LVIPNSTRDD 12367

Query: 1413  SGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDM 1445
             SGKYS+ + N  G + + V V V      + D+
Sbjct: 12368 SGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDL 12400



 Score = 37.0 bits (84), Expect = 0.14
 Identities = 16/79 (20%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 1355  TIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSG 1414
             ++  G+ L +   + G P P + W K+   ++ +   +V  +     +++IK    +D G
Sbjct: 16935 SVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINV-TDSLDLTTLSIKETHKDDGG 16993

Query: 1415  KYSINIKNKYGGEKIDVTV 1433
             +Y I + N  G +   + +
Sbjct: 16994 QYGITVANVVGQKTASIEI 17012



 Score = 37.0 bits (84), Expect = 0.14
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 907   VEARPGTKEISAGVDEQGNIYLGFDC--QEMTDASQFTWCKSYEEISDDERFKIETVGDH 964
             +E  P + +I   V E+G  ++ + C  +    ++Q TW     ++ + E+++I      
Sbjct: 25260 IEIGPVSGQIMHAVGEEGG-HVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGV 25318

Query: 965   SKLYLKNPDKEDLGTYSVSVSDTDGVSSSF 994
             + LY+K+  K D GTY   V +  G  SS+
Sbjct: 25319 AILYVKDITKLDDGTYRCKVVNDYGEDSSY 25348



 Score = 36.6 bits (83), Expect = 0.18
 Identities = 110/564 (19%), Positives = 213/564 (37%), Gaps = 96/564 (17%)

Query: 879  QGKTYVFRVRAVNANGVGKP-------SDTSEPVLVEARP--GTKEISAGVDEQGNIYLG 929
            +GKT+   ++ V  + + +        S T++  ++EA P    K       E+  I L 
Sbjct: 5319 EGKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITL- 5377

Query: 930  FDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
              C+   D     W K  EEI    ++ I+  G    L +K  D +D G Y V    TD 
Sbjct: 5378 -KCEVSKDVP-VKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEY-VCDCGTDK 5434

Query: 990  VSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRF 1049
              ++  ++     RL+ +   +    + +     +EI            E   PD   ++
Sbjct: 5435 TKANVTVEA----RLIKVEKPLYGVEVFVGETAHFEI------------ELSEPDVHGQW 5478

Query: 1050 IINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDA 1109
             +  + ++ S    I  D    I+  ++    +   G  + Q  + K+ +   +  +   
Sbjct: 5479 KLKGQPLTASPDCEIIEDGKKHIL--ILHNCQLGMTGEVSFQAANAKSAANLKVKELPLI 5536

Query: 1110 FKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDVL 1169
            F T L + +                     V E+ E +  C+V+   K   F+WLK    
Sbjct: 5537 FITPLSDVK---------------------VFEKDEAKFECEVSREPK--TFRWLKG--- 5570

Query: 1170 YETETLPNLERGICELLIPKLSKKDHGEYKATLKDDRGQDVS--ILEIAGKVYDDMILAM 1227
              T+ +   +R   EL+      KD  ++   +K    +D +  + E   K +    L +
Sbjct: 5571 --TQEITGDDR--FELI------KDGTKHSMVIKSAAFEDEAKYMFEAEDK-HTSGKLII 5619

Query: 1228 SRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAW 1287
              +  K  +PLK +   E       ++   D ++V W   D ++ ++  + +        
Sbjct: 5620 EGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSM-------- 5671

Query: 1288 LQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLI 1347
                    +D+GK     F  KD    S+D + Q   EA     + K      +      
Sbjct: 5672 --------QDEGKTHSITF--KD---LSIDDTSQIRVEAMGMSSEAKLTVL--EGDPYFT 5716

Query: 1348 GGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKG 1407
            G L D   + + + + L C +    D  V WFK+ ++I+ S++  +K +  K + + +K 
Sbjct: 5717 GKLQDYTGVEKDEVI-LQCEI-SKADAPVKWFKDGKEIKPSKNAVIKADGKKRM-LILKK 5773

Query: 1408 VTSEDSGKYSINIKNKYGGEKIDV 1431
                D G+Y+ +        K+D+
Sbjct: 5774 ALKSDIGQYTCDCGTDKTSGKLDI 5797



 Score = 36.6 bits (83), Expect = 0.18
 Identities = 42/144 (29%), Positives = 64/144 (44%), Gaps = 24/144 (16%)

Query: 186  QWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVV 245
            +W+++   I  ++   KY I     V+TL I  A  DD A Y+   TN  G+   +AA +
Sbjct: 6366 KWFRNEEAIFDSS---KYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANL 6422

Query: 246  VRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTF--RREGETVTLKCTM-- 301
            +     +EE  R V      PL         D++ +EK  VTF  +     VTLK T   
Sbjct: 6423 I----VEEEDLRIVE-----PLK--------DIETMEKKSVTFWCKVNRLNVTLKWTKNG 6465

Query: 302  LVTPDLKRVQPRAEWYRDDVLLKE 325
               P   RV  R + Y+  + +K+
Sbjct: 6466 EEVPFDNRVSYRVDKYKHMLTIKD 6489



 Score = 36.6 bits (83), Expect = 0.18
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 1370  GNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYV-SMTIKGVTSEDSGKYSINIKNKYGGEK 1428
             G P   V W K+ Q   L E   V V  +K V S++IK  + ED G Y + + N  G   
Sbjct: 19115 GRPQATVNWRKDGQT--LKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSIT 19172

Query: 1429  IDVTVSV 1435
             + +T+ V
Sbjct: 19173 VPITIIV 19179



 Score = 36.6 bits (83), Expect = 0.18
 Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 1364  LTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAK--YVSMTIKGVTSEDSGKYSINIK 1421
             L C V G+P P V W++  ++I +++    ++++ K  Y  + I  VT +D+  Y +   
Sbjct: 24642 LVCKVTGHPKPIVKWYRQGKEI-IADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRAT 24700

Query: 1422  NKYG 1425
             N+ G
Sbjct: 24701 NQGG 24704



 Score = 36.2 bits (82), Expect = 0.24
 Identities = 20/84 (23%), Positives = 36/84 (42%), Gaps = 1/84 (1%)

Query: 1353  VVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSED 1412
             +V    G  + +   V G P P V W K DQ ++ ++  + +      + + I      D
Sbjct: 14769 LVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTI-LNINECVRSD 14827

Query: 1413  SGKYSINIKNKYGGEKIDVTVSVY 1436
             SG Y +  +N  G     +T+ V+
Sbjct: 14828 SGPYPLTARNIVGEVGDVITIQVH 14851



 Score = 36.2 bits (82), Expect = 0.24
 Identities = 17/72 (23%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
             VT   G+   L+C + G P P++ W++  +++  S  + +  +   + ++T+     ED 
Sbjct: 24237 VTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTH-TLTVMTEEQEDE 24295

Query: 1414  GKYSINIKNKYG 1425
             G Y+    N+ G
Sbjct: 24296 GVYTCIATNEVG 24307



 Score = 35.4 bits (80), Expect = 0.41
 Identities = 28/97 (28%), Positives = 41/97 (42%), Gaps = 9/97 (9%)

Query: 153  APEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVH 212
            AP  + +     + E  SV     V G P P V W K G  +        YR + +Y   
Sbjct: 1035 APYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTG-----YRYKVSYNKQ 1089

Query: 213  T----LEINRADFDDTATYSAVATNAHGQVSTNAAVV 245
            T    L I+    DD   Y+ V  N HG+ S +A+++
Sbjct: 1090 TGECKLVISMTFADDAGEYTIVVRNKHGETSASASLL 1126



 Score = 35.4 bits (80), Expect = 0.41
 Identities = 46/222 (20%), Positives = 81/222 (36%), Gaps = 34/222 (15%)

Query: 145  TFEERISRA--PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGK 202
            T E ++ R   P  +++  S    E  + +    V G P P   W+ DG  I       K
Sbjct: 1400 TDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVN-DYTHK 1458

Query: 203  YRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLP 262
              I+ + G  +L I  A   D+  ++ VA N  G+ S +  + V       +P       
Sbjct: 1459 VVIKED-GTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKP------- 1510

Query: 263  IGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVL 322
                             F+EK      +EG  + +K      P+     P   W ++  +
Sbjct: 1511 ----------------MFVEKLKNVNIKEGSRLEMKVRATGNPN-----PDIVWLKNSDI 1549

Query: 323  LKESKWTKMFF--GEGQASLSFSHLHKDDEGLYTLRIVSRGG 362
            +   K+ K+     +G+A+L        D   YT   +++ G
Sbjct: 1550 IVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAG 1591



 Score = 35.0 bits (79), Expect = 0.53
 Identities = 55/234 (23%), Positives = 82/234 (35%), Gaps = 50/234 (21%)

Query: 185  VQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAV 244
            V+W+KDG+ I +     KY I S   V  L IN+   DD A YS     A          
Sbjct: 6099 VKWFKDGAEIKKGK---KYDIISKGAVRILVINKCLLDDEAEYSCEVRTAR--------- 6146

Query: 245  VVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVT 304
                                   S M+     +  F +        E +T+ L C +   
Sbjct: 6147 ----------------------TSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEV--- 6181

Query: 305  PDLKRVQPRAE--WYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSR-- 360
                  +P AE  WY+ D  + E+   ++     +  L   + H +D G Y  R+ S   
Sbjct: 6182 -----SKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRT 6236

Query: 361  -GGVSDHS-AFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTES 412
             G V  H  A  F+     L     G   +  C   +++   V WK  + T ES
Sbjct: 6237 DGKVKVHELAAEFISKPQNLEI-LEGEKAEFVC-SISKESFPVQWKRDDKTLES 6288



 Score = 34.7 bits (78), Expect = 0.69
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 4/73 (5%)

Query: 175  FTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESN-YGVHTLEINRADFDDTATYSAVATN 233
            +TV G P P V W+K+   +C +     Y I  N  G  T  +N    +D+  Y   A N
Sbjct: 3788 YTVVGEPAPTVTWFKENKQLCTSV---YYTIIHNPNGSGTFIVNDPQREDSGLYICKAEN 3844

Query: 234  AHGQVSTNAAVVV 246
              G+ +  A ++V
Sbjct: 3845 MLGESTCAAELLV 3857



 Score = 33.9 bits (76), Expect = 1.2
 Identities = 17/59 (28%), Positives = 27/59 (45%)

Query: 1367 TVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYG 1425
            TV G P P V WFK ++ +  S ++++        +  +     EDSG Y    +N  G
Sbjct: 3789 TVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLG 3847



 Score = 33.9 bits (76), Expect = 1.2
 Identities = 19/78 (24%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 1345 RLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMT 1404
            R +  L + VT+++G+ L L+C +  N + +V+W K+ + +       V        ++T
Sbjct: 4908 RFVKTLEEEVTVVKGQPLYLSCEL--NKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALT 4965

Query: 1405 IKGVTSEDSGKYSINIKN 1422
            I      D+G Y++ ++N
Sbjct: 4966 INDADDTDAGTYTVTVEN 4983



 Score = 33.5 bits (75), Expect = 1.5
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 6/90 (6%)

Query: 154  PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKY-RIESNYGVH 212
            P I+  L+     E    +    V G    V  + KD  +     +P ++ R+      +
Sbjct: 3299 PAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKI-----KPSRFFRMTQFEDTY 3353

Query: 213  TLEINRADFDDTATYSAVATNAHGQVSTNA 242
             LEI  A  +D  TY+ VA+NA GQVS+ A
Sbjct: 3354 QLEIAEAYPEDEGTYTFVASNAVGQVSSTA 3383



 Score = 33.1 bits (74), Expect = 2.0
 Identities = 25/93 (26%), Positives = 36/93 (38%), Gaps = 3/93 (3%)

Query: 154   PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
             P   +   + TV     +K+     G PTP V W+KD   + Q         E+N     
Sbjct: 15843 PAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENN---SL 15899

Query: 214   LEINRADFDDTATYSAVATNAHGQVSTNAAVVV 246
             L I  A  +D   Y    TN+ G+      V+V
Sbjct: 15900 LTIKDACREDVGHYVVKLTNSAGEAIETLNVIV 15932



 Score = 32.0 bits (71), Expect = 4.5
 Identities = 24/108 (22%), Positives = 42/108 (38%), Gaps = 28/108 (25%)

Query: 1356 IMEGKTLNLTCTVFGNPDPEVIWFKNDQ--------------------DIQLSEHFSVKV 1395
            +  G  + L  ++ G+P P + W K++                     ++Q  E F + +
Sbjct: 8386 VKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPL 8445

Query: 1396 EQAKYVSMTIKGVTS--------EDSGKYSINIKNKYGGEKIDVTVSV 1435
             Q   +  + KG +          D G Y I ++N +G  K   TVSV
Sbjct: 8446 TQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSV 8493



 Score = 32.0 bits (71), Expect = 4.5
 Identities = 24/105 (22%), Positives = 44/105 (41%), Gaps = 10/105 (9%)

Query: 1350 LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFK-------NDQDIQLSEHFSVKVEQAKYVS 1402
            L + + + EG  +N+   + G P P + WFK       N + +    H + K+      +
Sbjct: 9817 LKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVN-KLVVDDTCT 9875

Query: 1403 MTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAP 1447
            + I      D+G Y+I   N  G    ++ ++V   G   P + P
Sbjct: 9876 LVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVL--GRPGPPVGP 9918



 Score = 32.0 bits (71), Expect = 4.5
 Identities = 22/99 (22%), Positives = 45/99 (45%), Gaps = 3/99 (3%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
             + +  G ++ +   + G P PEV W K+  +I L    +++  ++ +  + I      D+
Sbjct: 14481 LVVRAGLSIRIFVPIKGRPAPEVTWTKD--NINLKNRANIENTES-FTLLIIPECNRYDT 14537

Query: 1414  GKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAK 1452
             GK+ + I+N  G +   V V V      + ++ P    K
Sbjct: 14538 GKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITK 14576



 Score = 32.0 bits (71), Expect = 4.5
 Identities = 18/70 (25%), Positives = 31/70 (44%), Gaps = 2/70 (2%)

Query: 1364  LTCTVFGNP--DPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIK 1421
             LTC V  +     EV W+K+ + ++ + HF           + I  +T  D G+Y   I 
Sbjct: 26430 LTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEIS 26489

Query: 1422  NKYGGEKIDV 1431
              + G  K ++
Sbjct: 26490 GEGGTSKTNL 26499


>gi|110349713 titin isoform novex-1 [Homo sapiens]
          Length = 27051

 Score =  269 bits (688), Expect = 1e-71
 Identities = 229/865 (26%), Positives = 373/865 (43%), Gaps = 101/865 (11%)

Query: 153  APEILVRLR---SHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNY 209
            APEI + ++     TV     ++L  TV G P P + W K   ++ Q     +  IE+  
Sbjct: 7315 APEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDK---RITIENVP 7371

Query: 210  GVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSS 269
               T+ I  +   DT TY   A N  G+ +    V V                    L  
Sbjct: 7372 KKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV--------------------LDK 7411

Query: 270  MIPYTHFDVQFL--EKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESK 327
              P   FD+  +  E   +T+    +    K T  V    +R      W++    +K++ 
Sbjct: 7412 PGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVE--RRATDSEVWHKLSSTVKDTN 7469

Query: 328  WTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVT----GAP 383
            +              + L  + E ++ +   +  GV +         A P+        P
Sbjct: 7470 FKA------------TKLIPNKEYIFRVAAENMYGVGEPV------QASPITAKYQFDPP 7511

Query: 384  GAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYP 443
            G P  L+  D  +D V +TW  P+    SP+ GY+V+R +  T+ WV+CN  PVK   Y 
Sbjct: 7512 GPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYR 7571

Query: 444  VTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDD 503
            V GL   + Y FRV A N AG  +PS+ ++ +   DP+D                     
Sbjct: 7572 VKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPID--------------------- 7610

Query: 504  LEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPL-MYFIEKSVVGSGSWQRVNAQ 562
                   P PP      ++ +  V L+W  P   G   +  Y IE    G+  W RV   
Sbjct: 7611 ------PPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRV--A 7662

Query: 563  TAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASR 622
              V + ++ +  LMEG+ Y FRV + N+ G SEPSE + P+  ++    PS P  +    
Sbjct: 7663 EGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVIN 7722

Query: 623  NTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQY 680
             TK +  ++W  P+ +    +  Y V+        W+  +   +   +  V  LT G  Y
Sbjct: 7723 ITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVD-TTVKDTKCTVTPLTEGSLY 7781

Query: 681  IFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGS 740
            +FRV A NA+G S+ ++  D +  +   T P  PY + +++     + L W+ PK  GG 
Sbjct: 7782 VFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGR 7841

Query: 741  PILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPS 800
            PI  Y ++K+E     W +   +        V  + EG+  +F++ A N AG+G PS+P+
Sbjct: 7842 PIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPT 7901

Query: 801  EHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWI 860
            E    E  T P P P  DL   +     + + WK P  +G SP+ GY V+       +W+
Sbjct: 7902 EILSIEDPTSP-PSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWM 7960

Query: 861  TVNQTTTANRYLKVSD-LQQGKTYVFRVRAVNANGVGKPSDTSEPVLV---EARP----G 912
             VN     +   KV + +   K YV RVRAVNA GV +PS+ SE V+    + +P     
Sbjct: 7961 RVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLE 8020

Query: 913  TKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNP 972
            T +I     E+ +I + F    +   S   W K  +E+   +R  ++   DH   +L+ P
Sbjct: 8021 THDIIVIEGEKLSIPVPFRAVPVPTVS---WHKDGKEVKASDRLTMK--NDHISAHLEVP 8075

Query: 973  D--KEDLGTYSVSVSDTDGVSSSFV 995
               + D G Y++++ +  G +++ +
Sbjct: 8076 KSVRADAGIYTITLENKLGSATASI 8100



 Score =  268 bits (685), Expect = 3e-71
 Identities = 209/769 (27%), Positives = 337/769 (43%), Gaps = 83/769 (10%)

Query: 272  PYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKM 331
            P    DV+ L    V   + G  + L  T+   P+     P+  W + D++LK+ K   +
Sbjct: 7316 PEIFLDVKLLAGLTV---KAGTKIELPATVTGKPE-----PKITWTKADMILKQDKRITI 7367

Query: 332  FFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQC 391
                 +++++     + D G Y +  V+  G +     + V D        PG P     
Sbjct: 7368 ENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDK-------PGPPAAFDI 7420

Query: 392  HDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGR 451
             D   +  ++TW PP     S +  Y V+R    +  W + + + VK   +  T L   +
Sbjct: 7421 TDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLS-STVKDTNFKATKLIPNK 7479

Query: 452  SYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVP 511
             YIFRV A N  G+  P + S   A                       YQ D       P
Sbjct: 7480 EYIFRVAAENMYGVGEPVQASPITAK----------------------YQFD------PP 7511

Query: 512  GPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRY 570
            GPPT +  S+I+++ V L+W  P   G  P+  Y++E+    +  W R N +  V+   Y
Sbjct: 7512 GPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCN-KMPVKDTTY 7570

Query: 571  AVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVV 630
             V  L   K Y FRVL+ N  G  +PS+ T PI  +D    P  PG+       KTSV +
Sbjct: 7571 RVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRL 7630

Query: 631  QWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVN 688
             W +P+H+    +  Y ++    GT+ W     + +   + ++ GL  G++Y FRV+AVN
Sbjct: 7631 NWTKPEHDGGAKIESYVIEMLKTGTDEWVRV-AEGVPTTQHLLPGLMEGQEYSFRVRAVN 7689

Query: 689  AVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLD 748
              G SE S+ SD +  +  L  PS P  + ++N   ++  L W VP+  GGSPI  Y ++
Sbjct: 7690 KAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVE 7749

Query: 749  KREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAW 808
            KR+V  K W  V+++  K T  TV  LTEGSLY F++AA N  G  + ++  +    +  
Sbjct: 7750 KRDVRRKGWQTVDTT-VKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKD- 7807

Query: 809  TMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTA 868
            T   PGP Y L   +V    + + W+ P   G  P+  Y ++ +E     W+   +T   
Sbjct: 7808 TFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGP 7867

Query: 869  NRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVE--ARPGTKEISAGVDEQGNI 926
            +   +V+D+ +G    F+VRA N  GVG PS+ +E + +E    P +  +   V + G  
Sbjct: 7868 DCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRK 7927

Query: 927  YLGFDCQ---------------EMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKN 971
            ++    +               EM       W +       D +FK+E            
Sbjct: 7928 HIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEG--------VV 7979

Query: 972  PDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKS 1020
            PDKE    Y + V   + +    V +P E+   +   +    PTI L++
Sbjct: 7980 PDKE----YVLRVRAVNAIG---VSEPSEISENVVAKDPDCKPTIDLET 8021



 Score =  231 bits (588), Expect = 5e-60
 Identities = 228/871 (26%), Positives = 358/871 (41%), Gaps = 147/871 (16%)

Query: 164   TVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDD 223
             TV    +V L  TV G P P V W KDG+L+ + AE  K  ++ N  + TLE+   +  D
Sbjct: 12934 TVKAGTNVCLDATVFGKPMPTVSWKKDGTLL-KPAEGIKMAMQRN--LCTLELFSVNRKD 12990

Query: 224   TATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEK 283
             +  Y+  A N+ G  S    + V      ++P    G P  + ++ M         + ++
Sbjct: 12991 SGDYTITAENSSGSKSATIKLKVL-----DKP----GPPASVKINKM---------YSDR 13032

Query: 284   FGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFS 343
               +++    E    + T  +    +  +P               W ++       S S  
Sbjct: 13033 AMLSWEPPLEDGGSEITNYIVDKRETSRPN--------------WAQVSATVPITSCSVE 13078

Query: 344   HLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDA------DPLVTGAPGAPMDLQCHDANRD 397
              L +  E  + +   ++ GV D    +F   A      DP     PG        +  +D
Sbjct: 13079 KLIEGHEYQFRICAENKYGVGDP---VFTEPAIAKNPYDP-----PGRCDPPVISNITKD 13130

Query: 398   YVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRV 457
             ++ V+WKPP     SP+ GY +++ E    NW + N  P+       TGL EG  Y FRV
Sbjct: 13131 HMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRV 13190

Query: 458   RAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGV 517
              A+N AG  +PS  S A  A DP                              PGPP   
Sbjct: 13191 TAINKAGPGKPSDASKAAYARDP---------------------------QYPPGPPAFP 13223

Query: 518   HASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLM 576
                + +R+ V LSW  P   G  P++ Y +E     S +W R N    ++  R+ V  LM
Sbjct: 13224 KVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLM 13283

Query: 577   EGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV------- 629
             E   Y FRV + N+ G S+PS++      +D+ + P      L +   KT ++       
Sbjct: 13284 EDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGE---LDADLRKTLILRAGVTMR 13340

Query: 630   ------------VQWDRPK-HEEDLLGYYVDCCVAGTNL-WEPCNHKPIGYNRFVVHGLT 675
                         + W +P  +  D +G  +      T L  E  N    G          
Sbjct: 13341 LYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAG---------- 13390

Query: 676   TGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPK 735
                +YI  ++  N+ G  E +    V+KV   L  P  P  +T+      S  + W+ P 
Sbjct: 13391 ---KYILTLE--NSCGKKEYTI---VVKV---LDTPGPPVNVTVKEISKDSAYVTWEPPI 13439

Query: 736   FSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGE 795
               GGSPI+ Y + KR+   K+W  V +  SK T   V  L EG  Y F++ A N  GIG+
Sbjct: 13440 IDGGSPIINYVVQKRDAERKSWSTVTTECSK-TSFRVANLEEGKSYFFRVFAENEYGIGD 13498

Query: 796   PSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREED 855
             P +  +  K        PGP  DL    V  +S  + WK P   G S + GY VDF  E+
Sbjct: 13499 PGETRDAVKAS----QTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTEE 13554

Query: 856   AGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKE 915
               +W  V ++ +     K  DL +GK Y FRV A N NG G PS+    + V AR     
Sbjct: 13555 -NKWQRVMKSLSLQYSAK--DLTEGKEYTFRVSAENENGEGTPSE----ITVVARDDV-- 13605

Query: 916   ISAGVDEQGNIYLGFDCQEMTD-----------ASQFTWCKSYEEISDDERFKIETVGDH 964
             ++  +D +G   L +  +E ++           A   +W K  + ++ D R  +E+   +
Sbjct: 13606 VAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVN 13665

Query: 965   SKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
             + L + +  K D G Y++++ +  G     +
Sbjct: 13666 TTLIVYDCQKSDAGKYTITLKNVAGTKEGTI 13696



 Score =  226 bits (575), Expect = 2e-58
 Identities = 233/937 (24%), Positives = 390/937 (41%), Gaps = 106/937 (11%)

Query: 167  ERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTAT 226
            E++S+ + F  +  P P V W+KDG    +     +  +++++    LE+ ++   D   
Sbjct: 8030 EKLSIPVPF--RAVPVPTVSWHKDGK---EVKASDRLTMKNDHISAHLEVPKSVRADAGI 8084

Query: 227  YSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGV 286
            Y+    N  G  + +  V V                IGLP     P        + K   
Sbjct: 8085 YTITLENKLGSATASINVKV----------------IGLPG----PCKDIKASDITKSSC 8124

Query: 287  TFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLH 346
                E            TP L  V  R E  R         +  +  GE + S +   L 
Sbjct: 8125 KLTWEPPEFDGG-----TPILHYVLERREAGR-------RTYIPVMSGENKLSWTVKDLI 8172

Query: 347  KDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTG----APGAPMDLQCHDANRDYVIVT 402
             + E  + ++ V++ G  +     ++   +P++       P  P+D++ H+   + + +T
Sbjct: 8173 PNGEYFFRVKAVNKVGGGE-----YIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTIT 8227

Query: 403  WKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNS 462
            WKPP     S +MGY +++   G   W +CN+  V I  Y   GL EG+ Y FRVRA N+
Sbjct: 8228 WKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENA 8287

Query: 463  AGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPP----TGVH 518
            AGIS PSR +    A+DP+D  +   V L    E+    D++  DA + G P    T + 
Sbjct: 8288 AGISEPSRATPPTKAVDPIDAPK---VILRTSLEVK-RGDEIALDASISGSPYPTITWIK 8343

Query: 519  ASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSP-RYAVFDLME 577
               +     +     P  R +   +   E  V+     QR++   + +   +  V D + 
Sbjct: 8344 DENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLT--QRLSIDNSKKGESQLRVRDSLR 8401

Query: 578  GKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKH 637
                ++ +   N HG+++     S +        P  P   +     KTSV+ +W+ P  
Sbjct: 8402 PDHGLYMIKVENDHGIAKAPCTVSVLDT------PGPPINFVFEDIRKTSVLCKWEPPLD 8455

Query: 638  E--EDLLGYYVDCCVAGTNLWEPCNH-----KPIGYNRFVVHGLTTGEQYIFRVKAVNAV 690
            +   +++ Y ++      +  +P +        + + ++ V  L  G++Y+FRV+A N  
Sbjct: 8456 DGGSEIINYTLE----KKDKTKPDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRF 8511

Query: 691  GMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKR 750
            G         ++  +     P  P    + +   +SM + W  PK   GSPILGY+L+KR
Sbjct: 8512 GPGPPCVSKPLV-AKDPFGPPDAPDKPIVEDVTSNSMLVKWNEPK-DNGSPILGYWLEKR 8569

Query: 751  EVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTM 810
            EV+  +W  VN S        VDGL EG  Y F++ A N AG G+ S PS+  K     +
Sbjct: 8570 EVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDP-KTAHDPI 8628

Query: 811  PEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANR 870
              PGP       +   T++ + W+ P ++G   + GYFVD +     EW    +     R
Sbjct: 8629 SPPGPPIP-RVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVR 8687

Query: 871  YLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGF 930
               V ++++G  Y  RV AVNA G G P +T +PV V        +   V  +G I +  
Sbjct: 8688 QYTVKEIREGADYKLRVSAVNAAGEGPPGET-QPVTVAEPQEPPAVELDVSVKGGIQIMA 8746

Query: 931  DCQEMTDA-------SQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVS 983
                   A           W K   E+ D +R  I+ VG  S+L +K+  ++D G Y ++
Sbjct: 8747 GKTLRIPAVVTGRPVPTKVWTKEEGEL-DKDRVVIDNVGTKSELIIKDALRKDHGRYVIT 8805

Query: 984  VSDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSP 1043
             +++ G  S F     E+        ++  P + LK  +      K  +  W   E    
Sbjct: 8806 ATNSCG--SKFAAARVEV-------FDVPGPVLDLKPVVTNR---KMCLLNWSDPEDDGG 8853

Query: 1044 DASYRFIINDREV------SDSEIHRIKCDKATGIIE 1074
                 FII  ++          E  R KCD  TG++E
Sbjct: 8854 SEITGFIIERKDAKMHTWRQPIETERSKCD-ITGLLE 8889



 Score =  218 bits (554), Expect = 4e-56
 Identities = 194/813 (23%), Positives = 330/813 (40%), Gaps = 104/813 (12%)

Query: 328   WTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPM 387
             WT +       SL  + L + +E ++ +  V++ GV +      V   +P V   PG P 
Sbjct: 17394 WTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVL--PGPPK 17451

Query: 388   DLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGL 447
              L+  +  +D + V W  P++   S ++GY V++ +     W++CN   +   +  VTGL
Sbjct: 17452 SLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGL 17511

Query: 448   FEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGD 507
              E   Y FRV A N+AG+  PS  +    A DP+                          
Sbjct: 17512 TEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFK------------------------ 17547

Query: 508   AQVPGPPTGVHASEISRNYVVLSWEPPT-PRGKDPLMYFIEKSVVGSGSWQRVNAQTAVR 566
                PGPPT  H  + ++N + L+W  P    G + L Y +E        WQ V  QT +R
Sbjct: 17548 ---PGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLR 17604

Query: 567   SPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQD----------------VTV 610
               R+ +  L E + Y  RV + N+ GL E + +   ++ +D                + V
Sbjct: 17605 VTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVV 17664

Query: 611   VPSAPGRVLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFV 670
                   R+      + +  + W R +      G + D              K + Y +  
Sbjct: 17665 RAGGSARIHIPFKGRPTPEITWSREE------GEFTDKVQI---------EKGVNYTQLS 17709

Query: 671   VHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLG 730
             +      +   + +K  N+ G      +S  + V+  L  P  P  + +      S  L 
Sbjct: 17710 IDNCDRNDAGKYILKLENSSG-----SKSAFVTVKV-LDTPGPPQNLAVKEVRKDSAFLV 17763

Query: 731   WKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNL 790
             W+ P   GG+ +  Y +DKRE   K +  V+S  SK T   V+ LTEG++Y F++ A N 
Sbjct: 17764 WEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSK-TSFKVENLTEGAIYYFRVMAENE 17822

Query: 791   AGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVD 850
              G+G P +  +  K        P P   +T  +V  TS  ++W+ P + G S V GY V+
Sbjct: 17823 FGVGVPVETVDAVKAAE----PPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVE 17878

Query: 851   FREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVE-- 908
              + +   +W  V ++   N    V+ L  G+ Y FRV+A N  G   P     PV+ +  
Sbjct: 17879 MQPKGTEKWSIVAESKVCNAV--VTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDL 17936

Query: 909   -ARPGTK------EISAGVDEQGNI-YLGFDCQEMTDASQFTWCKSYEEISDDERFKIET 960
               +P  K       I AG D +  I  +G            +W K  E +    R  +E 
Sbjct: 17937 TIQPSLKLPFNTYSIQAGEDLKIEIPVIG------RPRPNISWVKDGEPLKQTTRVNVEE 17990

Query: 961   VGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIKNPTI-PLK 1019
                 + L++K  +K+D G Y+V+ +++ G ++         E L  +  E   P + P++
Sbjct: 17991 TATSTVLHIKEGNKDDFGKYTVTATNSAGTAT---------ENLSVIVLEKPGPPVGPVR 18041

Query: 1020  SELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGIIEMVMDR 1079
              +   E+     V  W    +        +I+  R+ + +  H +    A   I++   +
Sbjct: 18042 FD---EVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLK 18098

Query: 1080  FSIENEGTYTVQIHDGK-AKSQSSLVLIGDAFK 1111
                E +     +   GK A   S  V++   FK
Sbjct: 18099 TGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFK 18131



 Score =  216 bits (551), Expect = 1e-55
 Identities = 213/874 (24%), Positives = 350/874 (40%), Gaps = 152/874 (17%)

Query: 164   TVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDD 223
             T+    S++L  +V G P PV+ W K G  +   A      I++      L +++ +  D
Sbjct: 23085 TIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAI-----IDTTESYSLLIVDKVNRYD 23139

Query: 224   TATYSAVATNAHGQVSTNAAVVVRRFRGD-------EEPFRSVGLPIGLP-LSSMIPYTH 275
                Y+  A N  G+ S    V V    G        E    SV +   +P +    P  +
Sbjct: 23140 AGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNN 23199

Query: 276   FDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGE 335
             + V+  E     F+    TVT KC+  +      V+    ++R   +L E+      +G 
Sbjct: 23200 YIVEKREAAMRAFK----TVTTKCSKTLYRISGLVEGTMYYFR---VLPEN-----IYGI 23247

Query: 336   GQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDAN 395
             G+   +   +                                LV+  P  P  L+  D  
Sbjct: 23248 GEPCETSDAV--------------------------------LVSEVPLVPAKLEVVDVT 23275

Query: 396   RDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIF 455
             +  V + W+ P     S + GY ++ C+ GT  W++       + ++ VT L EG  Y+F
Sbjct: 23276 KSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLF 23335

Query: 456   RVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVP-GPP 514
             R+RA N  G+S P    + V A+   DLR L  + L    +  I+         VP G P
Sbjct: 23336 RIRAQNEKGVSEPR---ETVTAVTVQDLRVLPTIDLSTMPQKTIH---------VPAGRP 23383

Query: 515   TGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFD 574
               +      R     SW            +F    +  S   +RV  +T  +  +  + +
Sbjct: 23384 VELVIPIAGRPPPAASW------------FFAGSKLRES---ERVTVETHTKVAKLTIRE 23428

Query: 575   LMEGKSYVFRVLSANRHG----------LSEPSEITSPIQAQDVTVVPSAPGRVLASRNT 624
                  +  + +   N  G          L +P   T PI+  ++                
Sbjct: 23429 TTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDA-------------- 23474

Query: 625   KTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIF 682
              TS+ + W+ P+ +    L GY V+   A    W P +   +  + F    LT G +Y+F
Sbjct: 23475 -TSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSES-VTRSTFKFTRLTEGNEYVF 23532

Query: 683   RVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPI 742
             RV A N  G+    Q S+VI+ ++++ +P  P  + + +     MTL W  P+  GGS +
Sbjct: 23533 RVAATNRFGIGSYLQ-SEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQV 23591

Query: 743   LGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEH 802
              GY ++++EV    W  VN  P   T     GLTEG  YE ++ A+N  G G+PS PS+ 
Sbjct: 23592 TGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKP 23651

Query: 803   FKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITV 862
                     P PG   +    +   TS+ + W  P   G S V+GY ++ ++ D  EW   
Sbjct: 23652 IVAMDPIAP-PGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKC 23710

Query: 863   NQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISAGVDE 922
             N T T  R   ++ L QG  Y FRV A NA G G+P++          PGT +++  ++ 
Sbjct: 23711 NTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEV---------PGTVKVTEMLE- 23760

Query: 923   QGNIYLGFDCQEMTDASQFT---------------------WCKSYEEISDDERFKIETV 961
                 Y  ++  E      F                      W K  ++IS  +R  I T 
Sbjct: 23761 ----YPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDIS--KRAMIATS 23814

Query: 962   GDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
               H++L +K  D+ D GTY + + +  G  + ++
Sbjct: 23815 ETHTELVIKEADRGDSGTYDLVLENKCGKKAVYI 23848



 Score =  216 bits (549), Expect = 2e-55
 Identities = 172/613 (28%), Positives = 259/613 (42%), Gaps = 54/613 (8%)

Query: 302  LVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRG 361
            ++ P     +P A W   D +L+     KM      A L  S   + D+G+YTL++ +R 
Sbjct: 7042 ILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENR- 7100

Query: 362  GVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDR 421
             V   S      + D  V   P AP +L+  D  +D V +TW+PP+    SP+ GY V++
Sbjct: 7101 -VKTISG-----EIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEK 7154

Query: 422  CEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPL 481
             EV    W +  D  V   ++ V  L +G+ Y+F+V A N  G   P+ V + V    P 
Sbjct: 7155 REVSRKTWTKVMDF-VTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTP- 7212

Query: 482  DLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDP 541
                                      A VP PP  V   + + N + L+W+PP   G   
Sbjct: 7213 --------------------------ATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSR 7246

Query: 542  LM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEIT 600
            +  Y +E+   GS  W  V     V   +  V  L EGK Y +RV + NR G S+PS  T
Sbjct: 7247 IKGYIVERCPRGSDKW--VACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPT 7304

Query: 601  SPIQAQDVTVVPS--APGRVLASRNTKTSVVVQWDRP---KHEEDLLGYYVDCCVAGTNL 655
              IQA D    P      ++LA    K    ++       K E  +     D  +     
Sbjct: 7305 EEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKR 7364

Query: 656  WEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPY 715
                N         V    +    YI  ++AVN  G +    E +V      L  P  P 
Sbjct: 7365 ITIENVPKKSTVTIVDSKRSDTGTYI--IEAVNVCGRATAVVEVNV------LDKPGPPA 7416

Query: 716  GITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGL 775
               + +    S  L W  P+  GGS I  Y +++R    + WH++ SS  K T      L
Sbjct: 7417 AFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKL-SSTVKDTNFKATKL 7475

Query: 776  TEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKA 835
                 Y F++AA N+ G+GEP   S       +    PGP   L   ++   ++ + W  
Sbjct: 7476 IPNKEYIFRVAAENMYGVGEPVQASP--ITAKYQFDPPGPPTRLEPSDITKDAVTLTWCE 7533

Query: 836  PVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGV 895
            P   G SP++GY+V+  + D  +W+  N+    +   +V  L   K Y FRV A N  G 
Sbjct: 7534 PDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGP 7593

Query: 896  GKPSDTSEPVLVE 908
            GKPS ++EP+L++
Sbjct: 7594 GKPSKSTEPILIK 7606



 Score =  207 bits (526), Expect = 8e-53
 Identities = 199/842 (23%), Positives = 329/842 (39%), Gaps = 127/842 (15%)

Query: 177   VQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHG 236
             ++G P P V W KDG  + + A   +  I+S     TL +      D   Y    +N  G
Sbjct: 18359 IRGKPIPDVVWSKDGKELEETA--ARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGG 18416

Query: 237   QVSTNAAVVVRRFRGDEE-PFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETV 295
               S    V V    G  E P +  G+                                  
Sbjct: 18417 TKSIPITVKVLDRPGPPEGPLKVTGV---------------------------------T 18443

Query: 296   TLKCTMLVTPDLKRVQPRAEWYRDDVLLKES----KWTKMFFGEGQASLSFSHLHKDDEG 351
               KC +   P L+        Y   ++ K       WT++       +   + L   +E 
Sbjct: 18444 AEKCYLAWNPPLQDGGANISHY---IIEKRETSRLSWTQVSTEVQALNYKVTKLLPGNEY 18500

Query: 352   LYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTE 411
             ++ +  V++ G+ +      V   +P     PG P   +     +D ++VTW  P     
Sbjct: 18501 IFRVMAVNKYGIGEPLESGPVTACNPYKP--PGPPSTPEVSAITKDSMVVTWARPVDDGG 18558

Query: 412   SPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRV 471
             + + GY +++ +     W +CN   +   +  VTGL EG SY FRV A N+AG+  PS  
Sbjct: 18559 TEIEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEP 18618

Query: 472   SDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSW 531
             S    A D                  A+Y          PGPP+    ++ SR+ V L+W
Sbjct: 18619 SVFYRACD------------------ALYP---------PGPPSNPKVTDTSRSSVSLAW 18651

Query: 532   EPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANR 590
               P   G  P+  Y +E     +  W      T ++  ++ V  L E   Y FR+ + N 
Sbjct: 18652 SKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINS 18711

Query: 591   HGLSEPSEITSPIQAQD----------------VTVVPSAPGRVLASRNTKTSVVVQWDR 634
              G+ EP+ +   + AQ+                V +  SA  R+  +   +    V+W++
Sbjct: 18712 EGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEK 18771

Query: 635   PKHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSE 694
                 E +L       V  +            +   V+  +T  +   + +   N      
Sbjct: 18772 A---EGILTDRAQIEVTSS------------FTMLVIDNVTRFDSGRYNLTLEN------ 18810

Query: 695   NSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHH 754
             NS           L  PS P  +T+      S+TL W+ P   GG+ I  Y ++KRE   
Sbjct: 18811 NSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTR 18870

Query: 755   KNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPG 814
             K +  + ++ +K T   ++ L EG  Y F++ A N  GIG P++ +E  K     +P PG
Sbjct: 18871 KAYATITNNCTK-TTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEPPLP-PG 18928

Query: 815   PAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKV 874
                 +T  +V   +  + W+ P   G S ++GY V+ + + + +W T  Q  T      +
Sbjct: 18929 ---RVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLE--ATI 18983

Query: 875   SDLQQGKTYVFRVRAVNANGVGKPSDTSEPVL---VEARPGTK----EISAGVDEQGNIY 927
             S L  G+ YVFRV AVN  G   P     PV+   +E +P  +      +    EQ  I 
Sbjct: 18984 SGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKID 19043

Query: 928   LGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDT 987
             + F  +     +   W K  + + +  R  + +    + L +K   KED+GTY + VS++
Sbjct: 19044 VPFKGRPQATVN---WRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNS 19100

Query: 988   DG 989
              G
Sbjct: 19101 AG 19102



 Score =  206 bits (525), Expect = 1e-52
 Identities = 201/762 (26%), Positives = 307/762 (40%), Gaps = 95/762 (12%)

Query: 154   PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
             P + +   ++++     +K+   V G P P + W KDG  + Q     +  +E       
Sbjct: 17940 PSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTT---RVNVEETATSTV 17996

Query: 214   LEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPY 273
             L I   + DD   Y+  ATN+ G  + N +V+V      E+P    G P+G      + +
Sbjct: 17997 LHIKEGNKDDFGKYTVTATNSAGTATENLSVIVL-----EKP----GPPVG-----PVRF 18042

Query: 274   THFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFF 333
                   F     V    E    T  C +      KR      W+     +          
Sbjct: 18043 DEVSADF-----VVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATV---------- 18087

Query: 334   GEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPL-VTGAPGAPMDLQCH 392
                + ++  + L    E  + +   +R G S       V    P    G PG P      
Sbjct: 18088 --ARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGTPF---VT 18142

Query: 393   DANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRS 452
               ++D ++V W  P     + ++GY +++ E  +  WV+ N  P++  K+  TGL EG  
Sbjct: 18143 SISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLE 18202

Query: 453   YIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPG 512
             Y F+V A N  GI +PS+VS+   A DP D                              
Sbjct: 18203 YEFKVSAENIVGIGKPSKVSECFVARDPCD------------------------------ 18232

Query: 513   PPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYA 571
             PP    A  I+RN V L W+ P   G   +  Y +EK  +  G W + +  T V    + 
Sbjct: 18233 PPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASF-TNVLETEFT 18291

Query: 572   VFDLMEGKSYVFRVLSANRHG-LSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVV 630
             V  L+E + Y FRV++ N  G  SEPS+ +  I A+D      AP   L  +     VV 
Sbjct: 18292 VSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEI---DAPNASLDPKYKDVIVVH 18348

Query: 631   QWDRPKHEEDLLGYYVDCCV---AGTNLWEPCNH----KPIGYNRFVVHGL--TTGEQYI 681
               +    E D+ G  +   V    G  L E          I     VV     T G QYI
Sbjct: 18349 AGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYI 18408

Query: 682   FRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYG-ITLLNCDGHSMTLGWKVPKFSGGS 740
              ++  V          +S  I V+  L  P  P G + +         L W  P   GG+
Sbjct: 18409 LKLSNVGGT-------KSIPITVK-VLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGA 18460

Query: 741   PILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPS 800
              I  Y ++KRE    +W +V S+  +     V  L  G+ Y F++ AVN  GIGEP +  
Sbjct: 18461 NISHYIIEKRETSRLSWTQV-STEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESG 18519

Query: 801   EHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWI 860
                 C  +    PGP        +   S+V+ W  PV  G + + GY ++ R+++   W 
Sbjct: 18520 PVTACNPY--KPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWT 18577

Query: 861   TVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTS 902
               N+ T  +  L+V+ L +G +Y FRV A NA GVG+PS+ S
Sbjct: 18578 KCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPS 18619



 Score =  206 bits (525), Expect = 1e-52
 Identities = 205/865 (23%), Positives = 323/865 (37%), Gaps = 151/865 (17%)

Query: 170   SVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSA 229
             S+++   VQG P P V W+KDG    +  +     I    G  +L +  A  D    Y+ 
Sbjct: 21603 SLRIKALVQGRPVPRVTWFKDG---VEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTV 21659

Query: 230   VATNAHGQVSTNAAVVVRRFRGDEE-PFRSVGLP-------IGLPLSS-MIPYTHFDVQF 280
              A NA G       V V+   G    P R   +           PL+    P TH+ ++ 
Sbjct: 21660 EAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEK 21719

Query: 281   LEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASL 340
              E    T R     +  KC       +K +      +R   + K        FG G+   
Sbjct: 21720 RE----TSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNK--------FGVGRPL- 21766

Query: 341   SFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTG----APGAPMDLQCHDANR 396
                                              D+DP+V       P AP   +  +   
Sbjct: 21767 ---------------------------------DSDPVVAQIQYTVPDAPGIPEPSNITG 21793

Query: 397   DYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQC-NDAPVKICKYPVTGLFEGRSYIF 455
             + + +TW  P +   S +  Y ++R E  +  WV+  +  P+   ++ VTGL EG  Y F
Sbjct: 21794 NSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEF 21853

Query: 456   RVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPT 515
              V A N+AG+   S +S  +   +P++                            PGPPT
Sbjct: 21854 HVMAENAAGVGPASGISRLIKCREPVN---------------------------PPGPPT 21886

Query: 516   GVHASEISRNYVVLSWEPPT-PRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFD 574
              V  ++ S+  V L W  P    G + + Y IE      G W +VNA+  V++ RY V D
Sbjct: 21887 VVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKT-RYTVTD 21945

Query: 575   LMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPS----------------APGRV 618
             L  G+ Y FRV + N  G  +  E+T  I+A D    P                 A  R+
Sbjct: 21946 LQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRL 22005

Query: 619   LASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGE 678
               +   + +    W +P     L           T   E CN    G     V   +  +
Sbjct: 22006 FIAYQGRPTPTAVWSKPDSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSK 22065

Query: 679   QYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSG 738
                F VK                      L  P  P  IT  +    S TL W  P   G
Sbjct: 22066 SITFTVKV---------------------LDTPGPPGPITFKDVTRGSATLMWDAPLLDG 22104

Query: 739   GSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSD 798
             G+ I  Y ++KRE   ++W  ++   ++  I  V+ L EG  Y F+++AVN  G+GEP +
Sbjct: 22105 GARIHHYVVEKREASRRSWQVISEKCTRQ-IFKVNDLAEGVPYYFRVSAVNEYGVGEPYE 22163

Query: 799   PSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGE 858
               E          +P P   L   +   +S V+ W  P + G S ++GY ++ R++ +  
Sbjct: 22164 MPEPIVATE----QPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDF 22219

Query: 859   WITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISA 918
             W+    T        V  L +   Y FRV+A N  G  +P +    V+++      +I  
Sbjct: 22220 WVEAGHTKQLT--FTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKE----PQIEP 22273

Query: 919   GVDEQGNIYLGFDCQEMTD-----------ASQFTWCKSYEEISDDERFKIETVGDHSKL 967
               D  G       C+  +            A + TW      + + +R  I T  D + L
Sbjct: 22274 TADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTL 22333

Query: 968   YLKNPDKEDLGTYSVSVSDTDGVSS 992
              +K+  + D G Y +++ +T GV +
Sbjct: 22334 TVKDSMRGDSGRYFLTLENTAGVKT 22358



 Score =  206 bits (523), Expect = 2e-52
 Identities = 163/604 (26%), Positives = 252/604 (41%), Gaps = 58/604 (9%)

Query: 311   QPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFL 370
             +P+  W++D+  + E   T +       +L      + D G Y   +V          F 
Sbjct: 10475 KPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYC--VVVENSTGSRKGFC 10532

Query: 371   FVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWV 430
              V   D    G P  P+     +  +DY++++WKPP     S +  Y +++ EVG + W+
Sbjct: 10533 QVNVVDR--PGPPVGPVSFD--EVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWM 10588

Query: 431   QCNDAPVKI-CKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAV 489
                 A  K  CK  V+ L EG+ YIFR+ A N  GIS P  VSD++ A D          
Sbjct: 10589 PVTSASAKTTCK--VSKLLEGKDYIFRIHAENLYGISDPL-VSDSMKAKDRF-------- 10637

Query: 490   HLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKS 549
                                +VP  P     +E++++  +++W  P   GK    Y +EK 
Sbjct: 10638 -------------------RVPDAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKR 10678

Query: 550   VVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVT 609
                S  W RV         ++ V DL+EG  Y FRV + N  G+ +PS  + P+ A+D  
Sbjct: 10679 ETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPI 10738

Query: 610   VVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKP--IG 665
               PS P    A   T  SV + W  P+H+    +LGY V+    G   W   NH P    
Sbjct: 10739 AKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCP 10798

Query: 666   YNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGH 725
               ++ V GL  G+ Y FRV AVNA G S+ +   + + V+  L  P       +      
Sbjct: 10799 ETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHI 10858

Query: 726   SMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKI 785
              +    ++     G P       K +               PT   +D    GS  E + 
Sbjct: 10859 KVGDTLRLSAIIKGVPFPKVTWKKED------------RDAPTKARIDVTPVGSKLEIRN 10906

Query: 786   AAVNLAGI----GEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGS 841
             AA    GI     E    S+    +   + +PGP  DL   E+R  S  + WK P+  G 
Sbjct: 10907 AAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGG 10966

Query: 842   SPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDT 901
             S ++ Y V+ R+  + +W  ++ T+    +     L +G  Y+FRV A N  G G   +T
Sbjct: 10967 SVITNYVVERRDVASAQWSPLSATSKKKSHF-AKHLNEGNQYLFRVAAENQYGRGPFVET 11025

Query: 902   SEPV 905
              +P+
Sbjct: 11026 PKPI 11029



 Score =  204 bits (520), Expect = 4e-52
 Identities = 208/851 (24%), Positives = 344/851 (40%), Gaps = 108/851 (12%)

Query: 171   VKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLE------INRADFDDT 224
             +++   ++G PTP   W  DG    +A + G + I  +  + T E      I       T
Sbjct: 9456  IRIPAVIKGRPTPKSSWEFDGKAK-KAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHT 9514

Query: 225   ATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKF 284
               YS  A N  GQ + N  V V    G  +  +   +  G                    
Sbjct: 9515  GKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRG-------------------- 9554

Query: 285   GVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSH 344
                      +  L   M   PD         +  +   +    WTK+    G  +     
Sbjct: 9555  ---------SCRLSWKM---PDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPD 9602

Query: 345   LHKDDEGLYTLRIVSRGGVSDHSAFLFVRDA-DPLVTGAPGAPMDLQCHDANRDYVIVTW 403
             L  + +  + +R  +R G+      +    A DP+    P  P+ L+     ++ V ++W
Sbjct: 9603  LLSEQQYFFRVRAENRFGIGPPVETIQRTTARDPIYP--PDPPIKLKIGLITKNTVHLSW 9660

Query: 404   KPPNTTTESPVMGYFVDRCE---VGTNN--WVQCNDAPVKICKYPVTGLFEGRSYIFRVR 458
             KPP     SPV  Y V+       GT    W QCN   V+  ++ V  L EG  Y FRV+
Sbjct: 9661  KPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVK 9720

Query: 459   AVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGD--AQVPGPPTG 516
             AVN+AG+S+PS      A + P D +R         KE    ++    +  A++ G P  
Sbjct: 9721  AVNAAGVSKPS------ATVGPCDCQRPDMPPSIDLKEFMEVEEGTNVNIVAKIKGVP-- 9772

Query: 517   VHASEISRNYVVLSW---EPPTPRGKDPLMY--FIEKSVVGSGSWQRVNAQTAVRSPRYA 571
                      +  L+W    P  P  K+P++Y   + K VV       +       +  Y 
Sbjct: 9773  ---------FPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYT 9823

Query: 572   VFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQ 631
             +   +       + +  N   L  P     PI+ + V+                  + + 
Sbjct: 9824  I-TAVNNLGTASKEMRLNV--LGRPGPPVGPIKFESVSA---------------DQMTLS 9865

Query: 632   WDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNA 689
             W  PK +    +  Y ++   A    W   + +P     + +  L  G +Y+FR+ A N 
Sbjct: 9866  WFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECT-YTIPKLLEGHEYVFRIMAQNK 9924

Query: 690   VGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDK 749
              G+ E   +S+    +   +VP  P   T+ +   +SMT+ W+ P++ GGSP+ GY+L+ 
Sbjct: 9925  YGIGE-PLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEM 9983

Query: 750   REVHHKNWHEVNSSPSKPTIL----TVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
             ++   K W  VN  P K   L     V GL EGS Y+F++ A+N AG+G  S PS+    
Sbjct: 9984  KDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATA 10043

Query: 806   EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQT 865
                  P PGP +     +   +S  + W  P+  G S V+GY V+++EE   EW      
Sbjct: 10044 RDPIAP-PGPPFP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDK 10101

Query: 866   TTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEAR--PGTKEISAGVDEQ 923
                   L V+ L++G  Y FRVRAVN  G+G+P + ++ + ++ R      ++ A V ++
Sbjct: 10102 EVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDR 10161

Query: 924   GNIYLGFDCQEMTDAS-----QFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLG 978
               ++ G   + +   S       TW  +  E +  +   IET    S + +KN  +   G
Sbjct: 10162 IVVHAGGVIRIIAYVSGKPPPTVTW--NMNERTLPQEATIETTAISSSMVIKNCQRSHQG 10219

Query: 979   TYSVSVSDTDG 989
              YS+   +  G
Sbjct: 10220 VYSLLAKNEAG 10230



 Score =  203 bits (516), Expect = 1e-51
 Identities = 211/854 (24%), Positives = 339/854 (39%), Gaps = 152/854 (17%)

Query: 177   VQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFD-----------DTA 225
             V G P P ++W KDG  +               G   LEI  ADF            D+ 
Sbjct: 15113 VSGRPPPTMEWSKDGKEL--------------EGTAKLEIKIADFSTNLVNKDSTRRDSG 15158

Query: 226   TYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFG 285
              Y+  ATN  G       V V    G  E           PL+                 
Sbjct: 15159 AYTLTATNPGGFAKHIFNVKVLDRPGPPEG----------PLA----------------- 15191

Query: 286   VTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESK---WTKMFFGEGQASLSF 342
             VT     E  + KC +   P L     + + Y   V  +E+    WT +        L  
Sbjct: 15192 VT-----EVTSEKCVLSWFPPLDDGGAKIDHYI--VQKRETSRLAWTNVASEVQVTKLKV 15244

Query: 343   SHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVT 402
             + L K +E ++ +  V++ GV +      V   +P   G P  P + +     +D ++V 
Sbjct: 15245 TKLLKGNEYIFRVMAVNKYGVGEPLESEPVLAVNPY--GPPDPPKNPEVTTITKDSMVVC 15302

Query: 403   WKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNS 462
             W  P++   S ++ Y V+R +     W++CN   +   +Y V+GL EG  Y FR+ A N+
Sbjct: 15303 WGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENA 15362

Query: 463   AGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEI 522
             AGIS PS  S    A D                   +++         PGPP      + 
Sbjct: 15363 AGISAPSPTSPFYKACD------------------TVFK---------PGPPGNPRVLDT 15395

Query: 523   SRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSY 581
             SR+ + ++W  P   G   +  Y +E ++     WQ V     +++  Y +  L E + Y
Sbjct: 15396 SRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEY 15455

Query: 582   VFRVLSANRHGLSEPSEITSPIQAQD----------------VTVVPSAPGRVLASRNTK 625
               R+ + N  GL EP+ +    +A+D                VT+      R+      +
Sbjct: 15456 KIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGR 15515

Query: 626   TSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVK 685
              +  V+W R  H E L    ++   + T L           NRF         +YI  V+
Sbjct: 15516 PAPEVKWARD-HGESLDKASIESTSSYTLLIVG------NVNRF------DSGKYILTVE 15562

Query: 686   AVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGY 745
                    + +  +S  + V+  L  P  P  + +      S+TL W  P   GGS I  Y
Sbjct: 15563 -------NSSGSKSAFVNVRV-LDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNY 15614

Query: 746   YLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
              ++KRE   K +  V ++  K T   VD L EG  Y F++ A N  GIG P++ +E  K 
Sbjct: 15615 IVEKRESTRKAYSTVATNCHK-TSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKA 15673

Query: 806   EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQT 865
                 +P PG    +T  +V   S+ + W+ P + G S + GY V+ + + + +W T    
Sbjct: 15674 SERPLP-PGK---ITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATC--A 15727

Query: 866   TTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARP---------GTKEI 916
             T       ++ L QG+ Y FRV A N  G+  P   S PV+ +             T  +
Sbjct: 15728 TVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTV 15787

Query: 917   SAGVDEQGNI-YLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKE 975
              AG D + ++ ++G            TW K    +    R   E+  ++S L +K+  +E
Sbjct: 15788 LAGEDLKVDVPFIG------RPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACRE 15841

Query: 976   DLGTYSVSVSDTDG 989
             D+G Y V ++++ G
Sbjct: 15842 DVGHYVVKLTNSAG 15855



 Score =  200 bits (508), Expect = 1e-50
 Identities = 212/862 (24%), Positives = 330/862 (38%), Gaps = 118/862 (13%)

Query: 165   VWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVH----TLEINRAD 220
             V E  +V +   ++G P P + W+K         EP  Y    N  V     TL I ++ 
Sbjct: 9756  VEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSR 9815

Query: 221   FDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQF 280
               DT  Y+  A N  G  S    + V             G P+G P+        F+   
Sbjct: 9816  RSDTGLYTITAVNNLGTASKEMRLNV---------LGRPGPPVG-PIK-------FESVS 9858

Query: 281   LEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASL 340
              ++  +++    +    K T  V    KR   R  W       KE  +T     EG    
Sbjct: 9859  ADQMTLSWFPPKDDGGSKITNYVIE--KREANRKTWVHVSSEPKECTYTIPKLLEGHE-- 9914

Query: 341   SFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVI 400
                         Y  RI+++             +    +   PGAP         R+ + 
Sbjct: 9915  ------------YVFRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMT 9962

Query: 401   VTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKIC----KYPVTGLFEGRSYIFR 456
             V W+ P     SPV GY+++  +  +  W + N  P+K       Y VTGL EG  Y FR
Sbjct: 9963  VNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFR 10022

Query: 457   VRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTG 516
             V A+N+AG+   S  SD   A DP+                             PGPP  
Sbjct: 10023 VYAINAAGVGPASLPSDPATARDPI---------------------------APPGPPFP 10055

Query: 517   VHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDL 575
                ++ +++   L W PP   G   +  Y +E    G   W++      VR  +  V  L
Sbjct: 10056 -KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEK-GKDKEVRGTKLVVTGL 10113

Query: 576   MEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPS--------------APG--RVL 619
              EG  Y FRV + N  G+ EP E+T  I+ +D  V P               A G  R++
Sbjct: 10114 KEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRII 10173

Query: 620   ASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQ 679
             A  + K    V W+  +             ++ + + + C                   Q
Sbjct: 10174 AYVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVIKNCQRS---------------HQ 10218

Query: 680   YIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGG 739
              ++ + A N  G  + +   DV+ V   +  P   + +T  +C      L W  P+  GG
Sbjct: 10219 GVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCK-----LTWFSPEDDGG 10273

Query: 740   SPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDP 799
             SPI  Y ++KRE   + W  V  + ++    TV GL +G  Y F+IAA N  G+G   + 
Sbjct: 10274 SPITNYVIEKRESDRRAWTPVTYTVTRQNA-TVQGLIQGKAYFFRIAAENSIGMGPFVET 10332

Query: 800   SEHFKC-EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGE 858
             SE     E  T+PE     DL   EV   ++ + W  P Y G S +  Y ++ R     +
Sbjct: 10333 SEALVIREPITVPERPE--DLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEK 10390

Query: 859   WITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISA 918
             +  V      +R   V  L++G TY +RV AVN  G GKPS  ++P+  +       +  
Sbjct: 10391 FHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHL 10450

Query: 919   GVDEQGNIYLGFDCQEMTDA------SQFTWCKSYEEISDDERFKIETVGDHSKLYLKNP 972
                ++  I +G +   +T         + +W K   ++ +D+R  I+T      L     
Sbjct: 10451 DFRDKLTIRVG-EAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKA 10509

Query: 973   DKEDLGTYSVSVSDTDGVSSSF 994
              + D G Y V V ++ G    F
Sbjct: 10510 KRSDSGKYCVVVENSTGSRKGF 10531



 Score =  199 bits (506), Expect = 2e-50
 Identities = 202/839 (24%), Positives = 329/839 (39%), Gaps = 101/839 (12%)

Query: 170   SVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSA 229
             +V+    ++G P P  +W  DGS I        Y +E++     L I      DT  Y  
Sbjct: 11155 TVRFPAIIRGVPVPTAKWTTDGSEI---KTDEHYTVETDNFSSVLTIKNCLRRDTGEYQI 11211

Query: 230   VATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFR 289
               +NA G  +    + V    G          P G       P    DV           
Sbjct: 11212 TVSNAAGSKTVAVHLTVLDVPGP---------PTG-------PINILDVT---------- 11245

Query: 290   REGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDD 349
              E  T++ +      P      P   +  +    ++  W  +  G  +  L   HL K  
Sbjct: 11246 PEHMTISWQ-----PPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGC 11300

Query: 350   EGLYTLRIVSRGGVSDHSAFLFVRDADPLVT----GAPGAPMDLQCHDANRDYVIVTWKP 405
             E ++ +R  ++ GV          D+ P V       P  P      D   +   V+W  
Sbjct: 11301 EYVFRVRAENKIGVGPPL------DSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTL 11354

Query: 406   PNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGI 465
             P +   SP+ GY+++R EV T  WV+ N  P+   K+ VTGL+EG +Y FRV A N AG+
Sbjct: 11355 PKSDGGSPITGYYMERREV-TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGL 11413

Query: 466   SRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRN 525
             S+PS  SD + A  P+                           + PGPP      + SR 
Sbjct: 11414 SKPSPSSDPIKACRPI---------------------------KPPGPPINPKLKDKSRE 11446

Query: 526   YVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFR 584
                L W  P   G  P++ Y +E    G+  W R+N    +R   + V  L+EG  Y FR
Sbjct: 11447 TADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFR 11506

Query: 585   VLSANRHGLSEPSEITSPIQAQDVTVVPSAP-----GRVLASRNTKTSVVVQWDRPKHEE 639
             + +AN  G  EP E+   + A+D+   P          V+  R  +T  ++   + + E 
Sbjct: 11507 IKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEP 11566

Query: 640   DLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQES 699
             D+        +      +     P    +          +YI     ++A   S ++Q S
Sbjct: 11567 DITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYI-----ISAKNSSGHAQGS 11621

Query: 700   DVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHE 759
              ++ V   L  P     + + N    + T+ W+ P  +GGS I  + ++ R+ + K W  
Sbjct: 11622 AIVNV---LDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSI 11678

Query: 760   VNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDL 819
             V S  +K  I     L   + Y F++ A N  G+G P+  ++        +  PG   +L
Sbjct: 11679 VASDVTKRLIKA--NLLANNEYYFRVCAENKVGVG-PTIETKTPILAINPIDRPGEPENL 11735

Query: 820   TFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQ 879
                +   T + + W+ P Y G SP   Y V+ R + + +W  V++ +    +  V    +
Sbjct: 11736 HIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVE 11795

Query: 880   GKTYVFRVRAVNANG---------VGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGF 930
              + Y FRV+  N  G         V    D  +PVL     G   + AG  +   +  G 
Sbjct: 11796 NQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAG--DTIRLEAGV 11853

Query: 931   DCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
               +   + + +T  K   +++   R KI+T  D SK  L    + D G Y V+ ++T G
Sbjct: 11854 RGKPFPEVA-WTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAG 11911



 Score =  198 bits (503), Expect = 4e-50
 Identities = 178/670 (26%), Positives = 280/670 (41%), Gaps = 68/670 (10%)

Query: 254   EPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPR 313
             EP  S G PI +      P    DV+F +   V   + GE + +   +   P      P 
Sbjct: 19398 EPSESTG-PIIVKDDVEPPRVMMDVKFRDVIVV---KAGEVLKINADIAGRP-----LPV 19448

Query: 314   AEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVR 373
               W +D + ++E   T++   +    L+     + D G Y L + +  G    +    V 
Sbjct: 19449 ISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVL 19508

Query: 374   DADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCN 433
             D      G P  P+++    A +    ++W  P     + +  Y V++ E     W  C 
Sbjct: 19509 DK----PGPPAGPLEINGLTAEK--CSLSWGRPQEDGGADIDYYIVEKRETSHLAWTIC- 19561

Query: 434   DAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEG 493
             +  +++    VT L +G  YIFRV  VN  G+  P   S A+ ALDP             
Sbjct: 19562 EGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLE-SVAIKALDPF------------ 19608

Query: 494   EKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVG 552
                             VP PPT +  + +++  + L W  P   G   +  Y IE+    
Sbjct: 19609 ---------------TVPSPPTSLEITSVTKESMTLCWSRPESDGGSEISGYIIERREKN 19653

Query: 553   SGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVP 612
             S  W RVN +  V   R     L EG  Y +RV + N  GLS PSE +  I+A+D   +P
Sbjct: 19654 SLRWVRVN-KKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLP 19712

Query: 613   SAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFV 670
             S P +     + KT++ + W +P  +    + GY V+   +    W+       G   + 
Sbjct: 19713 SPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTSIQSLRG-TEYT 19771

Query: 671   VHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVP----SHPYGITLLNCDGHS 726
             + GLTTG +Y+FRVK+VN VG S+ S  SD    +     P          TL+   G S
Sbjct: 19772 ISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGAS 19831

Query: 727   MTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIA 786
              T+   VP    G P+      K +   +    V+++ S+ T LT++        ++ + 
Sbjct: 19832 FTM--TVP--FRGRPVPNVLWSKPDTDLRTRAYVDTTDSR-TSLTIENANRNDSGKYTLT 19886

Query: 787   AVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSG 846
               N+         +         +  PGP  ++T  +V   S V+ W  P   G +PV  
Sbjct: 19887 IQNVLS-------AASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKN 19939

Query: 847   YFVDFREEDAGEWITVNQTTTANRY-LKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPV 905
             Y ++ RE     W++V  T   NR   KV++LQ+G  Y FRV   N  GVG P++T E V
Sbjct: 19940 YHIEKREASKKAWVSV--TNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGV 19997

Query: 906   LVEARPGTKE 915
              +  +P   E
Sbjct: 19998 KITEKPSPPE 20007



 Score =  196 bits (497), Expect = 2e-49
 Identities = 206/843 (24%), Positives = 341/843 (40%), Gaps = 125/843 (14%)

Query: 170   SVKLCFTVQGFPTPVVQWYKD------GSLICQAAEPGKYRIESNYGVHTLEINRADFDD 223
             SVKL   + G P P ++WYKD       +L+C         +E+   + ++ I  AD  +
Sbjct: 20517 SVKLRAGISGKPAPTIEWYKDDKELQTNALVC---------VENTTDLASILIKDADRLN 20567

Query: 224   TATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEK 283
             +  Y     NA G  S    V +    G          P G P+        F     EK
Sbjct: 20568 SGCYELKLRNAMGSASATIRVQILDKPG----------PPGGPIE-------FKTVTAEK 20610

Query: 284   FGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFS 343
               + +R   +    K T  +    KR   R  W      L+E              ++ +
Sbjct: 20611 ITLLWRPPADDGGAKITHYIVE--KRETSRVVWSMVSEHLEE------------CIITTT 20656

Query: 344   HLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVT-GAPGAPMDLQCHDANRDYVIVT 402
              + K +E ++ +R V++ G+ +      V   +  VT G PG P   +     ++ + V 
Sbjct: 20657 KIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIP---EVTKITKNSMTVV 20713

Query: 403   WKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNS 462
             W  P     S + GYF+++ +  +  W +     ++  +  VTGL E   Y +RV AVN+
Sbjct: 20714 WSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNA 20773

Query: 463   AGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEI 522
             AG    S  S+   A DP+D                            PGPP  +  ++ 
Sbjct: 20774 AGQGPFSEPSEFYKAADPID---------------------------PPGPPAKIRIADS 20806

Query: 523   SRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSY 581
             +++ + L W  P   G   +  Y +E        W  V+ +  VR+  Y V +L  G +Y
Sbjct: 20807 TKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNY 20866

Query: 582   VFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAP------GRVLASRNTKTSVVVQWD-R 634
              FRV + N  G  EP E+  P+QA+D+   P           V+A       V++ +  R
Sbjct: 20867 YFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGR 20926

Query: 635   P------KHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVN 688
             P      + +E  LG      +  T+         +  N        TG+ YI  ++  N
Sbjct: 20927 PPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRN-------DTGK-YILTIE--N 20976

Query: 689   AVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLD 748
              VG  ++S  S  +KV   L  P+    + + +    ++TL W  P   GGSPI+ Y ++
Sbjct: 20977 GVGEPKSSTVS--VKV---LDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIE 21031

Query: 749   KREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAW 808
             KR+   + W  V+   S  +   +D L+E + + F++ A N  GIGEP + +E  K    
Sbjct: 21032 KRDATKRTWSVVSHKCSSTSFKLID-LSEKTPFFFRVLAENEIGIGEPCETTEPVKAAE- 21089

Query: 809   TMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTA 868
                 P P  DL+  +   TS+++ W  P + G S ++ Y V+ + +    W     + T 
Sbjct: 21090 ---VPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGISKTC 21146

Query: 869   NRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISAGVDEQG---- 924
                ++VS L++     FRV A N  G+  P  T  P+ V+    T E+    D  G    
Sbjct: 21147 E--IEVSQLKEQSVLEFRVFAKNEKGLSDPV-TIGPITVKELIITPEVDLS-DIPGAQVT 21202

Query: 925   -----NIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGT 979
                  N++L    +     S  +W K    + + E  +     +   L +KN  KE  G 
Sbjct: 21203 VRIGHNVHLELPYKGKPKPS-ISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGK 21261

Query: 980   YSV 982
             Y+V
Sbjct: 21262 YTV 21264



 Score =  194 bits (493), Expect = 5e-49
 Identities = 199/802 (24%), Positives = 323/802 (40%), Gaps = 126/802 (15%)

Query: 302   LVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRG 361
             L  P   R  P  +W + D  ++++    +       SL   ++++ D G YTL + +  
Sbjct: 16590 LFVPIKGRPTPEVKWGKVDGEIRDAAIIDVT--SSFTSLVLDNVNRYDSGKYTLTLENSS 16647

Query: 362   GVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDR 421
             G    SAF+ VR  D      P  P++L+  +  +D V +TW+PP     S +  Y V++
Sbjct: 16648 GTK--SAFVTVRVLD-----TPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEK 16700

Query: 422   CEVGTNNWVQCNDAPVKIC---KYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAAL 478
              E    ++     A V  C    + +  L EG SY FRV A N  GI  P++ +D +   
Sbjct: 16701 REATRKSYA----AVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKV- 16755

Query: 479   DPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRG 538
                                          A+VP PP  +   +++RN V LSW  P   G
Sbjct: 16756 -----------------------------AEVPQPPGKITVDDVTRNSVSLSWTKPEHDG 16786

Query: 539   KDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPS 597
                ++ Y +E     S  W        V+S +  + +L +G+ Y+FRV++ N  G S+P 
Sbjct: 16787 GSKIIQYIVEMQAKHSEKWSEC---ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPR 16843

Query: 598   EITSPIQAQDVTVVPS-----APGRVLASRNTKTSVVVQWDRPKHE----------EDLL 642
              +  PI A+D+ + P      +   V   ++ K  V +   RPK            +   
Sbjct: 16844 SLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPIS-GRPKPTITWTKDGLPLKQTT 16902

Query: 643   GYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVI 702
                V   +  T L     HK              G QY   +   N VG    S E    
Sbjct: 16903 RINVTDSLDLTTLSIKETHK------------DDGGQY--GITVANVVGQKTASIEI--- 16945

Query: 703   KVQAALTVPSHPYG-ITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVN 761
                  L  P  P G +   +    S+TL W  P ++GG  I  Y + KR+     W  V+
Sbjct: 16946 ---VTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVS 17002

Query: 762   SSPSKPTILTVDGLTEGSLYEFKIAAVNLAG--IGEPSDPSEHFKCEAWTMPEPGPAYDL 819
             ++ ++ T L V  L  G+ Y+F+I A N  G      SDP        +   EPGP    
Sbjct: 17003 ATVAR-TTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPI----VAQYPYKEPGPPGTP 17057

Query: 820   TFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQ 879
                 +   S+V+ W  PV +G SPV GY ++ +E ++  W  VN+T   +   K  +L++
Sbjct: 17058 FATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEE 17117

Query: 880   GKTYVFRVRAVNANGVGK---------------PSDTSEPVLVEARPGTKEISAGVDEQG 924
             G  Y FRV A N  GVGK               P  T EP++V+    T + +  V + G
Sbjct: 17118 GIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEPIMVKRNEITLQWTKPVYDGG 17177

Query: 925   NIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSV 984
             ++  G+   E  D     W K+      + +F +  + +  +   +   K   G  S   
Sbjct: 17178 SMITGY-IVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPS 17236

Query: 985   SDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAE-HLSP 1043
               T  +++                +E++ P I +  +    I       F L+A+ H  P
Sbjct: 17237 DSTGPITA---------------KDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKP 17281

Query: 1044  DASYRFIINDREVSDSEIHRIK 1065
               +  ++  D+E+ +S    IK
Sbjct: 17282 LPTIEWLRGDKEIEESARCEIK 17303



 Score =  193 bits (490), Expect = 1e-48
 Identities = 206/864 (23%), Positives = 336/864 (38%), Gaps = 147/864 (17%)

Query: 171   VKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAV 230
             +K+   + G P PV+ W KDG    +  E  +  I S      L +      DT  Y   
Sbjct: 19435 LKINADIAGRPLPVISWAKDG---IEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLT 19491

Query: 231   ATNAHG--QVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTF 288
               N  G   V+ N  V+       ++P    G P G                LE  G+T 
Sbjct: 19492 LKNVAGTRSVAVNCKVL-------DKP----GPPAGP---------------LEINGLTA 19525

Query: 289   RREGETVTLKCTMLVTPDLKRVQPRAEWYRD-DVLLKESK------WTKMFFGEGQ-ASL 340
                      KC+      L   +P+ +   D D  + E +      WT +  GE Q  S 
Sbjct: 19526 E--------KCS------LSWGRPQEDGGADIDYYIVEKRETSHLAWT-ICEGELQMTSC 19570

Query: 341   SFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVI 400
               + L K +E ++ +  V++ GV +    + ++  DP    +P  P  L+     ++ + 
Sbjct: 19571 KVTKLLKGNEYIFRVTGVNKYGVGEPLESVAIKALDPFTVPSP--PTSLEITSVTKESMT 19628

Query: 401   VTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAV 460
             + W  P +   S + GY ++R E  +  WV+ N  PV   +   TGL EG  Y +RV A 
Sbjct: 19629 LCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAE 19688

Query: 461   NSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHAS 520
             N+AG+S PS  S  + A DP+ L                           P PP+     
Sbjct: 19689 NAAGLSLPSETSPLIRAEDPVFL---------------------------PSPPSKPKIV 19721

Query: 521   EISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGK 579
             +  +  + ++W  P   G  P+  Y +E        W+   +  ++R   Y +  L  G 
Sbjct: 19722 DSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWK--TSIQSLRGTEYTISGLTTGA 19779

Query: 580   SYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV---------- 629
              YVFRV S N+ G S+PS+ + P  A++    P      + S   KT +V          
Sbjct: 19780 EYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFD---IDSEMRKTLIVKAGASFTMTV 19836

Query: 630   ---------VQWDRPKHEEDL-LGYYVDCCVAGTNLW-EPCNHKPIGYNRFVVHGLTTGE 678
                      V W +P  + DL    YVD   + T+L  E  N    G     +  + +  
Sbjct: 19837 PFRGRPVPNVLWSKP--DTDLRTRAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAA 19894

Query: 679   QYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSG 738
                  VK                      L  P  P  IT+ +    S  L W VP+  G
Sbjct: 19895 SLTLVVK---------------------VLDTPGPPTNITVQDVTKESAVLSWDVPENDG 19933

Query: 739   GSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSD 798
             G+P+  Y+++KRE   K W  V ++ ++ +   V  L EG++Y F+++  N  G+G P++
Sbjct: 19934 GAPVKNYHIEKREASKKAWVSVTNNCNRLS-YKVTNLQEGAIYYFRVSGENEFGVGIPAE 19992

Query: 799   PSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGE 858
               E  K       +P P   L    +   S+ + W  P + G S +  Y V+  E+    
Sbjct: 19993 TKEGVK----ITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKN 20048

Query: 859   WITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISA 918
             W  V      + +  VS L++   Y FRV A N  G+  P +   PVL++ +    EI  
Sbjct: 20049 W--VKCAVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDM 20106

Query: 919   GVDEQGNIYLGFDCQEMTD-------ASQFTWCKSYEEISDDERFKIETVGDHSKLYLKN 971
                    +Y+        D         + T  +    +    RF  E   ++  + LK 
Sbjct: 20107 KNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKE 20166

Query: 972   PDKEDLGTYSVSVSDTDGVSSSFV 995
                 D G Y ++ +++ G + +F+
Sbjct: 20167 SVTADAGRYEITAANSSGTTKAFI 20190



 Score =  192 bits (489), Expect = 2e-48
 Identities = 159/642 (24%), Positives = 274/642 (42%), Gaps = 79/642 (12%)

Query: 379   VTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVK 438
             +T  P  P  L     ++D V +TW  P     S ++ Y V+  E G  NWV+C  A  K
Sbjct: 19999 ITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKC--AVAK 20056

Query: 439   ICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIA 498
                + V+GL E   Y FRV A N AG+S P  +   V   + L+   +   +        
Sbjct: 20057 STHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYV 20116

Query: 499   IYQDDLEGDAQVPGPPTGVHASEISRNYVVL--SWEPPTPRGKDPLMYFIEKSVVGSGSW 556
                 +L+ D  + G P  +    +SR+ V L  +    T    + L   +++SV      
Sbjct: 20117 RAGSNLKVDIPISGKP--LPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGR 20174

Query: 557   QRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPG 616
               + A  +  +           K+++  V+      L  P   T P+   D+T       
Sbjct: 20175 YEITAANSSGTT----------KAFINIVV------LDRPGPPTGPVVISDIT------- 20211

Query: 617   RVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGL 674
                     + SV ++W+ PK++    +  Y +      T +W   +   +      V  L
Sbjct: 20212 --------EESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVS-ATVARTMMKVMKL 20262

Query: 675   TTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVP 734
             TTGE+Y FR+KA N  G+S++  +S  + V+   T P  P    + N    S+T+GW  P
Sbjct: 20263 TTGEEYQFRIKAENRFGISDHI-DSACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEP 20321

Query: 735   KFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIG 794
               +GGS ++GY+L+ ++ +   W + N    + T   V  ++ G +YEF++ A N AG+G
Sbjct: 20322 VSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVG 20381

Query: 795   EPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREE 854
             +PS PSE        +    P  ++   ++   S+ + W+ P + G S ++GY V+ R+ 
Sbjct: 20382 KPSHPSE----PVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDL 20437

Query: 855   DAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANG-VGKPSDTSEPV-------- 905
               G W   + T        +S L Q   Y FRV A NA G +  PS+   P+        
Sbjct: 20438 PDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGG 20497

Query: 906   -----------LVEARPGTK-EISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDD 953
                        +V+ R GT  ++ AG+  +              A    W K  +E+  +
Sbjct: 20498 PVIDLPLEYTEVVKYRAGTSVKLRAGISGK-------------PAPTIEWYKDDKELQTN 20544

Query: 954   ERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
                 +E   D + + +K+ D+ + G Y + + +  G +S+ +
Sbjct: 20545 ALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATI 20586



 Score =  191 bits (485), Expect = 4e-48
 Identities = 214/857 (24%), Positives = 337/857 (39%), Gaps = 113/857 (13%)

Query: 177  VQGFPTPVVQWYKDGSLI---CQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATN 233
            V G P P ++W K+ ++I     A +  K  +  +     L I +A  +D  TY+  A+N
Sbjct: 9050 VTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASN 9109

Query: 234  AHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGE 293
              G V  N  V         E +     P  L ++        D++  E   +T+    +
Sbjct: 9110 RLGSVFRNVHV---------EVYDRPSPPRNLAVT--------DIK-AESCYLTWDAPLD 9151

Query: 294  TVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLY 353
                + T  V       + +AEW        E ++                L  + +  +
Sbjct: 9152 NGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKRY------------GIWKLIPNGQYEF 9199

Query: 354  TLRIVSRGGVSDHSAFLFVRDADPL-VTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTES 412
             +R V++ G+SD      V   DP  + G PG P  L      +  ++V+W PP     S
Sbjct: 9200 RVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLA---RTKGSMLVSWTPPLDNGGS 9256

Query: 413  PVMGYFVDRCEVGTNNWVQCNDAPV-----KICKYPVTGLFEGRSYIFRVRAVNSAGISR 467
            P+ GY++++ E G+  W + + AP+     K  ++ V  L EG  Y FR  A+N+AGI  
Sbjct: 9257 PITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGP 9316

Query: 468  PSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYV 527
            PS  SD   A DP+                             PGPP+     + +++ +
Sbjct: 9317 PSEPSDPEVAGDPIF---------------------------PPGPPSCPEVKDKTKSSI 9349

Query: 528  VLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNA-QTAVRSPRYAVFDLMEGKSYVFRV 585
             L W+PP   G  P+  Y +E    G+  W+RVN     + +    V +L E + Y FRV
Sbjct: 9350 SLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCECVVPNLKELRKYRFRV 9409

Query: 586  LSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLA---------SRNTKTSVVVQWDRPK 636
             + N  G SEPS+ T  I A D+   P     + A         S+    +V+     PK
Sbjct: 9410 KAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPK 9469

Query: 637  HEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVV-----HGLTTGEQYIFRVKAVNAVG 691
               +  G        G +            N  V+         TG+   + + A N  G
Sbjct: 9470 SSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHTGK---YSITAKNKAG 9526

Query: 692  MSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKRE 751
                 Q++   +V+  + VP  P  + + +    S  L WK+P   GG  I GY ++KR 
Sbjct: 9527 -----QKTANCRVKV-MDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRT 9580

Query: 752  VHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMP 811
            +  K W +VN      T +  D L+E   Y F++ A N  GIG P +  +         P
Sbjct: 9581 IDGKAWTKVNPDCGSTTFVVPDLLSE-QQYFFRVRAENRFGIGPPVETIQRTTARDPIYP 9639

Query: 812  EPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREED-----AGEWITVNQTT 866
             P P   L    +   ++ + WK P   G SPV+ Y V+    D        W   N+  
Sbjct: 9640 -PDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRD 9698

Query: 867  TANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEIS----AGVDE 922
                   V DL +G  Y FRV+AVNA GV KPS T  P   +       I       V+E
Sbjct: 9699 VEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQRPDMPPSIDLKEFMEVEE 9758

Query: 923  QGNIYLGFDCQEMTDASQFTWCK-------SYEEISDDERFKIETVGDHSKLYLKNPDKE 975
              N+ +    + +   +  TW K       + E +  D       V D   L +    + 
Sbjct: 9759 GTNVNIVAKIKGVPFPT-LTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRS 9817

Query: 976  DLGTYSVSVSDTDGVSS 992
            D G Y+++  +  G +S
Sbjct: 9818 DTGLYTITAVNNLGTAS 9834



 Score =  188 bits (478), Expect = 3e-47
 Identities = 179/740 (24%), Positives = 304/740 (41%), Gaps = 121/740 (16%)

Query: 185  VQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAV 244
            VQW ++  ++ Q     K+++ S   +H L+I      D   Y  +A +   +     A 
Sbjct: 6570 VQWLRNNMVVVQG---DKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAA 6626

Query: 245  VVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVT 304
              +    D++    + + +G PL+ ++PY  +                            
Sbjct: 6627 APKIKTADQD----LVVDVGKPLTMVVPYDAYP--------------------------- 6655

Query: 305  PDLKRVQPRAEWYRDDVLLKESKWTKMFFGEG-QASLSFSHLHKDDEGLYTLRIVSRGGV 363
                  +  AEW++++  L     TK       Q S       K D+G Y + + ++ G 
Sbjct: 6656 ------KAEAEWFKENEPLS----TKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGK 6705

Query: 364  SDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCE 423
            ++    L V D        PG   +L+  +     V + W+ P T   S ++GY V+R +
Sbjct: 6706 AEGFINLKVIDV-------PGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRD 6758

Query: 424  VGTNNWVQCNDAPVKICKYPVTGLFEGR-SYIFRVRAVNSAGISRPSRVSDAVAALDPLD 482
            +    WV   D   + C++ VTGL +G   Y+FRV A N  G   P    + V A    D
Sbjct: 6759 IKRKTWVLATDR-AESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYD 6817

Query: 483  LRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPT-PRGKDP 541
                                       VPGPP  V  ++++R  V L+WEPP    G + 
Sbjct: 6818 ---------------------------VPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEI 6850

Query: 542  LMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITS 601
              Y IE     S  W       A       V D++EG+ Y FRV + NR G+ +PS  T 
Sbjct: 6851 TNYVIELRDKTSIRWDTAMTVRA-EDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATP 6909

Query: 602  PIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPC 659
             ++  D    PS P  + +S  T++SV ++W+ P  +    +LGY ++ C  G + W  C
Sbjct: 6910 FVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRC 6969

Query: 660  NHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQ-----ESDVIKVQAALTVPSHP 714
            N K +    + V GL  G +Y++RV A N  G+S+ S+      +D   V+  + + +  
Sbjct: 6970 NMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFK 7029

Query: 715  YGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNS-SPSKPTILTVD 773
             G+ ++  +  ++     VP      P   +    + +   +  ++ + S     +++  
Sbjct: 7030 DGLEVIVPNPITIL----VPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPS 7085

Query: 774  GLTEGSLYEFKI--------AAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVR 825
              ++  +Y  K+          +++  I  PS P E                 L F ++ 
Sbjct: 7086 ERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKE-----------------LKFGDIT 7128

Query: 826  DTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVF 885
              S+ + W+ P   G SP++GY V+ RE     W  V    T   +  V DL QGK Y+F
Sbjct: 7129 KDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEF-TVPDLVQGKEYLF 7187

Query: 886  RVRAVNANGVGKPSDTSEPV 905
            +V A N  G G+P+   EPV
Sbjct: 7188 KVCARNKCGPGEPAYVDEPV 7207



 Score =  188 bits (477), Expect = 4e-47
 Identities = 145/509 (28%), Positives = 233/509 (45%), Gaps = 82/509 (16%)

Query: 371   FVRDADPLVTG----APGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGT 426
             FV  ++ LV       P  P DL+  +  ++ V +TW PP     S ++ Y ++   +GT
Sbjct: 10329 FVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGT 10388

Query: 427   NNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAG------ISRPSRVSDAVAA--- 477
               + +  +  +   KY V GL EG +Y +RV AVN  G       ++P    D +A    
Sbjct: 10389 EKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTL 10448

Query: 478   ----LDPLDLRRLQAVHLEG-------------EKEIAIYQDDL---------------- 504
                  D L +R  +A  L G             + E  + +DD                 
Sbjct: 10449 HLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIK 10508

Query: 505   --------------------EGDAQV-----PGPPTG-VHASEISRNYVVLSWEPPTPRG 538
                                 +G  QV     PGPP G V   E++++Y+V+SW+PP   G
Sbjct: 10509 AKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLDDG 10568

Query: 539   KDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPS 597
                +  Y IEK  VG   W  V + +A  + +  V  L+EGK Y+FR+ + N +G+S+P 
Sbjct: 10569 GSKITNYIIEKKEVGKDVWMPVTSASAKTTCK--VSKLLEGKDYIFRIHAENLYGISDPL 10626

Query: 598   EITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNL 655
              ++  ++A+D   VP AP + + +  TK S +V W++P H+  + +  Y ++     +  
Sbjct: 10627 -VSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKP-HDGGKPITNYILEKRETMSKR 10684

Query: 656   WEPCNHKPIG-YNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHP 714
             W      PI  Y +F V  L  G QY FRV A N +G+ + S  S  +  +  +  PS P
Sbjct: 10685 WARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPP 10744

Query: 715   YGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSK--PTILTV 772
                  ++   +S+ L W+ P+  GGS ILGY ++ ++V  + W   N +P     T   V
Sbjct: 10745 VNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKV 10804

Query: 773   DGLTEGSLYEFKIAAVNLAGIGEPSDPSE 801
              GL +G  Y+F++ AVN AG  +P+   E
Sbjct: 10805 TGLRDGQTYKFRVLAVNAAGESDPAHVPE 10833



 Score =  187 bits (476), Expect = 5e-47
 Identities = 190/783 (24%), Positives = 312/783 (39%), Gaps = 105/783 (13%)

Query: 154   PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
             P + +   +  V  R  +K+    +G P   V W KDG  +    E  +  + S+  V +
Sbjct: 19023 PSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTL---KETTRVNVSSSKTVTS 19079

Query: 214   LEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPY 273
             L I  A  +D  TY    +N+ G ++    ++V    G   P R   +       S  P 
Sbjct: 19080 LSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPPGPIRIDEVSCDSITISWNPP 19139

Query: 274   THFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFF 333
              +     +  + +  ++E  + T                               W  +  
Sbjct: 19140 EYDGGCQISNY-IVEKKETTSTT-------------------------------WHIVSQ 19167

Query: 334   GEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHD 393
                + S+    L    E  + +   +R G S +S    V    P     PG P   +   
Sbjct: 19168 AVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPF--SPPGPPGTPKVVH 19225

Query: 394   ANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSY 453
             A +  ++VTW+ P     S V+GY ++  E  +  W + N   +   +  V+GL EG  Y
Sbjct: 19226 ATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLMY 19285

Query: 454   IFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGP 513
              +RV A N AGI + S+  + V A DP D                              P
Sbjct: 19286 EYRVYAENIAGIGKCSKSCEPVPARDPCD------------------------------P 19315

Query: 514   PTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAV 572
             P     + I+R  V L W  P   G   +  Y +E+  +  G W + N  T ++   + V
Sbjct: 19316 PGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCN-YTNIQETYFEV 19374

Query: 573   FDLMEGKSYVFRVLSAN-RHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQ 631
              +L E + Y FRV + N    +SEPSE T PI  +D       P RV+     +  +VV+
Sbjct: 19375 TELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKD----DVEPPRVMMDVKFRDVIVVK 19430

Query: 632   -WDRPKHEEDLLGY---YVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGE--------Q 679
               +  K   D+ G     +     G  + E    + I  +    H L T +        Q
Sbjct: 19431 AGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDN---HTLLTVKDCIRRDTGQ 19487

Query: 680   YIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGG 739
             Y+  +K  N  G    +    V+        P    G+T   C     +L W  P+  GG
Sbjct: 19488 YVLTLK--NVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKC-----SLSWGRPQEDGG 19540

Query: 740   SPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDP 799
             + I  Y ++KRE  H  W  +     + T   V  L +G+ Y F++  VN  G+GEP + 
Sbjct: 19541 ADIDYYIVEKRETSHLAW-TICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLES 19599

Query: 800   SEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEW 859
                   + +T+P P  + ++T   V   S+ + W  P   G S +SGY ++ RE+++  W
Sbjct: 19600 VAIKALDPFTVPSPPTSLEIT--SVTKESMTLCWSRPESDGGSEISGYIIERREKNSLRW 19657

Query: 860   ITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTS------EPVLVEARPGT 913
             + VN+    +  +K + L++G  Y +RV A NA G+  PS+TS      +PV + + P  
Sbjct: 19658 VRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSK 19717

Query: 914   KEI 916
              +I
Sbjct: 19718 PKI 19720



 Score =  187 bits (475), Expect = 6e-47
 Identities = 180/671 (26%), Positives = 294/671 (43%), Gaps = 73/671 (10%)

Query: 349   DEGL-YTLR-----IVSRGGVSDHSAFLFVRD-ADPLVTGAPGAPMDLQCHDANRDYVIV 401
             DEGL Y  +     IV  G  S  S     RD  DP     PG P  +      R+ V +
Sbjct: 18198 DEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDP-----PGRPEAIVI---TRNNVTL 18249

Query: 402   TWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVN 461
              WK P     S + GY V++ ++    W++ +   V   ++ V+GL E + Y FRV A N
Sbjct: 18250 KWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARN 18309

Query: 462   SAG-ISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDD---LEGDAQVPGPPTGV 517
             +AG  S PS  S A+ A D +D     ++  + +  I ++  +   LE D +    P  V
Sbjct: 18310 AAGNFSEPSDSSGAITARDEIDAPNA-SLDPKYKDVIVVHAGETFVLEADIRGKPIPDVV 18368

Query: 518   HASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLM- 576
              + +                GK+     +E++        R+  ++ ++     V D + 
Sbjct: 18369 WSKD----------------GKE-----LEETAA------RMEIKSTIQKTTLVVKDCIR 18401

Query: 577   -EGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRP 635
              +G  Y+ ++ +    G ++   IT  ++  D    P  P +V     T     + W+ P
Sbjct: 18402 TDGGQYILKLSNV---GGTKSIPIT--VKVLDRPGPPEGPLKVTGV--TAEKCYLAWNPP 18454

Query: 636   KHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMS 693
               +   ++  Y ++        W   + +    N + V  L  G +YIFRV AVN  G+ 
Sbjct: 18455 LQDGGANISHYIIEKRETSRLSWTQVSTEVQALN-YKVTKLLPGNEYIFRVMAVNKYGIG 18513

Query: 694   ENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVH 753
             E   ES  +        P  P    +      SM + W  P   GG+ I GY L+KR+  
Sbjct: 18514 E-PLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKE 18572

Query: 754   HKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFK-CEAWTMPE 812
                W + N        L V GLTEG  YEF++AA N AG+GEPS+PS  ++ C+A  +  
Sbjct: 18573 GVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDA--LYP 18630

Query: 813   PGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTT-TANRY 871
             PGP  +    +   +S+ + W  P+Y G +PV GY V+ +E  A EW T    T    + 
Sbjct: 18631 PGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQ 18690

Query: 872   LKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLG-- 929
               V+ L++   Y FR+ A+N+ GVG+P+     V+ + R    EI    D +  + L   
Sbjct: 18691 FTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRAS 18750

Query: 930   -----FDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSV 984
                  F   +     +  W K+   ++D  R +IE     + L + N  + D G Y++++
Sbjct: 18751 ATLRLFVTIKGRPEPEVKWEKAEGILTD--RAQIEVTSSFTMLVIDNVTRFDSGRYNLTL 18808

Query: 985   SDTDGVSSSFV 995
              +  G  ++FV
Sbjct: 18809 ENNSGSKTAFV 18819



 Score =  187 bits (474), Expect = 8e-47
 Identities = 169/652 (25%), Positives = 277/652 (42%), Gaps = 58/652 (8%)

Query: 357   IVSRGGVSDHSAFLFVRD-ADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVM 415
             IV  G  S  S     RD  DP     PG P   +     R+ V + WK P     S + 
Sbjct: 16048 IVGIGKPSKVSECYVARDPCDP-----PGRP---EAIIVTRNSVTLQWKKPTYDGGSKIT 16099

Query: 416   GYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGI-SRPSRVSDA 474
             GY V++ E+    W++ +   +    + VTGL E   Y FRV A N+AG+ S PS  + A
Sbjct: 16100 GYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGA 16159

Query: 475   VAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPP 534
             + A D +D  R+       +  +    +  + DA + G P              + W   
Sbjct: 16160 ITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPT-----------IQWI-- 16206

Query: 535   TPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLS 594
               +G   L       +  +     ++ + AVR         ++  +Y+ +  +     ++
Sbjct: 16207 --KGDQELSNTARLEIKSTDFATSLSVKDAVR---------VDSGNYILKAKN-----VA 16250

Query: 595   EPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAG 652
                 +T  ++  D    P  P  V+ S  T     + W  P  +   D++ Y V+     
Sbjct: 16251 GERSVTVNVKVLDRPGPPEGP--VVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETS 16308

Query: 653   TNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPS 712
               +W   +   +      V  L  G +Y FR+ AVN  G+ E   ES+ +  +    VP 
Sbjct: 16309 RLVWTVVDAN-VQTLSCKVTKLLEGNEYTFRIMAVNKYGVGE-PLESEPVVAKNPFVVPD 16366

Query: 713   HPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTV 772
              P    +      SM + W+ P   GGS ILGY L+KR+     W   +        L V
Sbjct: 16367 APKAPEVTTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRV 16426

Query: 773   DGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFK-CEAWTMPEPGPAYDLTFCEVRDTSLVM 831
              GL E   YEF+++A N AG+ EPS PS + K C+   + +PGP  +    ++  +S+ +
Sbjct: 16427 TGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACD--PIYKPGPPNNPKVIDITRSSVFL 16484

Query: 832   LWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANR-YLKVSDLQQGKTYVFRVRAV 890
              W  P+Y G   + GY V+  +   GEW      T  N+  ++V  L +   Y FR+ A+
Sbjct: 16485 SWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAI 16544

Query: 891   NANGVGKPSDTSEPVLVEARPGTKEISAGVDEQG--NIYLG-----FDCQEMTDASQFTW 943
             N  GVG+ +D   P++VE +    +I   ++ +   NI  G     F   +     +  W
Sbjct: 16545 NKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKW 16604

Query: 944   CKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
              K   EI D     I+     + L L N ++ D G Y++++ ++ G  S+FV
Sbjct: 16605 GKVDGEIRD--AAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFV 16654



 Score =  186 bits (473), Expect = 1e-46
 Identities = 191/764 (25%), Positives = 296/764 (38%), Gaps = 106/764 (13%)

Query: 154   PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
             P++     S++V     +K+   + G P P + W KDG  + Q     +  +  +  + T
Sbjct: 16858 PDVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTT---RINVTDSLDLTT 16914

Query: 214   LEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPY 273
             L I     DD   Y     N  GQ + +  +V                 +  P     P 
Sbjct: 16915 LSIKETHKDDGGQYGITVANVVGQKTASIEIVT----------------LDKPDPPKGPV 16958

Query: 274   THFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFF 333
                DV              E++TL     +     ++       RD      + W  +  
Sbjct: 16959 KFDDV------------SAESITLSWNPPLYTGGCQITNYIVQKRDTT---TTVWDVVSA 17003

Query: 334   GEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVT-------GAPGAP 386
                + +L  + L    E  + +   +R G S      F  ++DP+V        G PG P
Sbjct: 17004 TVARTTLKVTKLKTGTEYQFRIFAENRYGQS------FALESDPIVAQYPYKEPGPPGTP 17057

Query: 387   MDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTG 446
                     ++D +++ W  P     SPV+GY ++R E  +  W + N   +   ++    
Sbjct: 17058 F---ATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQN 17114

Query: 447   LFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEG 506
             L EG  Y FRV A N  G+ + S+ S+   A DP D                        
Sbjct: 17115 LEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCD------------------------ 17150

Query: 507   DAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAV 565
                 PG P  +    + RN + L W  P   G   +  Y +EK  +  G W + +  T V
Sbjct: 17151 ---PPGTPEPI---MVKRNEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASF-TNV 17203

Query: 566   RSPRYAVFDLMEGKSYVFRVLSANRHG-LSEPSEITSPIQAQDVTVVPSAPGRVLASRNT 624
                ++ V  L E + Y FRV++ N  G +S+PS+ T PI A+D   +P    R+      
Sbjct: 17204 IETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELP----RISMDPKF 17259

Query: 625   KTSVVVQ-WDRPKHEEDLLGYYVDCC--VAGTNLWEP---CNHKPIGYNRFVVHG---LT 675
             + ++VV   +  + E D+ G  +     + G    E    C  K   +   ++       
Sbjct: 17260 RDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRI 17319

Query: 676   TGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPK 735
              G QYI R  A N  G         V+        P    G+T   C     +L W  P 
Sbjct: 17320 DGGQYILR--ASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKC-----SLTWSPPL 17372

Query: 736   FSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGE 795
               GGS I  Y ++KRE     W  V +S      L V  L EG+ Y F+I AVN  G+GE
Sbjct: 17373 QDGGSDISHYVVEKRETSRLAW-TVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVGE 17431

Query: 796   PSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREED 855
             P + +       + +  PGP   L    +   S+ + W  P   G S + GY V+ R+  
Sbjct: 17432 PLESAPVLMKNPFVL--PGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRS 17489

Query: 856   AGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPS 899
                WI  N+    +  L+V+ L +   Y FRV A NA GVG+PS
Sbjct: 17490 GIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPS 17533



 Score =  186 bits (471), Expect = 2e-46
 Identities = 169/660 (25%), Positives = 282/660 (42%), Gaps = 64/660 (9%)

Query: 352   LYTLRIVSRGGVSDHSAFLFVRD-ADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTT 410
             +Y   IV  G  S +S     RD  DP     PG P  +      R+ + + W  P    
Sbjct: 17125 VYAENIVGVGKASKNSECYVARDPCDP-----PGTPEPIM---VKRNEITLQWTKPVYDG 17176

Query: 411   ESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAG-ISRPS 469
              S + GY V++ ++    W++ +   V   ++ V+GL E + Y FRV A N+AG IS+PS
Sbjct: 17177 GSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPS 17236

Query: 470   RVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVL 529
               +  + A D ++L R+       +  +    +    +A V G P              +
Sbjct: 17237 DSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPT-----------I 17285

Query: 530   SWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSAN 589
              W     RG   +       +  +     +  + A+R         ++G  Y+ R  +  
Sbjct: 17286 EWL----RGDKEIEESARCEIKNTDFKALLIVKDAIR---------IDGGQYILRASN-- 17330

Query: 590   RHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVD 647
                ++        ++  D    P  P +V    + K S+   W  P  +   D+  Y V+
Sbjct: 17331 ---VAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLT--WSPPLQDGGSDISHYVVE 17385

Query: 648   CCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAA 707
                     W     + +  N   V  L  G +Y+FR+ AVN  G+ E  + + V+ ++  
Sbjct: 17386 KRETSRLAWTVVASEVVT-NSLKVTKLLEGNEYVFRIMAVNKYGVGEPLESAPVL-MKNP 17443

Query: 708   LTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKP 767
               +P  P  + + N    SMT+ W  P   GGS I+GY ++KR+     W + N      
Sbjct: 17444 FVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITD 17503

Query: 768   TILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFK-CEAWTMPEPGPAYDLTFCEVRD 826
               L V GLTE   YEF+++A N AG+GEPS  + ++K C+   + +PGP  +    +   
Sbjct: 17504 LRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACD--PVFKPGPPTNAHIVDTTK 17561

Query: 827   TSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEW-ITVNQTTTANRYLKVSDLQQGKTYVF 885
              S+ + W  P+Y G S + GY V+  + D  EW I   QT       ++S L + + Y  
Sbjct: 17562 NSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKI 17621

Query: 886   RVRAVNANGVG---------KPSDTSE-PVLVEARPGTKEISAGVDEQGNIYLGFDCQEM 935
             RV A+N  G+G         KP D  E P L       K I         I++ F   + 
Sbjct: 17622 RVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPF---KG 17678

Query: 936   TDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
                 + TW +   E +D  + +IE   ++++L + N D+ D G Y + + ++ G  S+FV
Sbjct: 17679 RPTPEITWSREEGEFTD--KVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFV 17736



 Score =  186 bits (471), Expect = 2e-46
 Identities = 189/804 (23%), Positives = 332/804 (41%), Gaps = 87/804 (10%)

Query: 227   YSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLP-IGLPLSSMIPYTHFDVQFLEKFG 285
             +   A NA G +S  + VV     G      S G P I LPL     YT           
Sbjct: 20468 FRVFARNAVGSISNPSEVV-----GPITCIDSYGGPVIDLPLE----YTE---------- 20508

Query: 286   VTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHL 345
             V   R G +V L+  +   P      P  EWY+DD  L+ +    +      AS+     
Sbjct: 20509 VVKYRAGTSVKLRAGISGKP-----APTIEWYKDDKELQTNALVCVENTTDLASILIKDA 20563

Query: 346   HKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKP 405
              + + G Y L++  R  +   SA + V+  D    G PG P++ +   A +  + + W+P
Sbjct: 20564 DRLNSGCYELKL--RNAMGSASATIRVQILDK--PGPPGGPIEFKTVTAEK--ITLLWRP 20617

Query: 406   PNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGI 465
             P     + +  Y V++ E     W   ++  ++ C    T + +G  YIFRVRAVN  GI
Sbjct: 20618 PADDGGAKITHYIVEKRETSRVVWSMVSEH-LEECIITTTKIIKGNEYIFRVRAVNKYGI 20676

Query: 466   SRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRN 525
               P   SD+V A +                               PGPP     ++I++N
Sbjct: 20677 GEPLE-SDSVVAKNAF---------------------------VTPGPPGIPEVTKITKN 20708

Query: 526   YVVLSWEPP-TPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFR 584
              + + W  P    G D   YF+EK    S  W +V  +T +R  R  V  L E   Y +R
Sbjct: 20709 SMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKET-IRDTRQKVTGLTENSDYQYR 20767

Query: 585   VLSANRHG---LSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--E 639
             V + N  G    SEPSE     +A D    P  P ++  + +TK+S+ + W +P ++   
Sbjct: 20768 VCAVNAAGQGPFSEPSEF---YKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGS 20824

Query: 640   DLLGYYVDCCVAGTNLWEPCNHK-PIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQE 698
              + GY V+        W   + K  +    +VV  L  G  Y FRV AVN  G  E  + 
Sbjct: 20825 AVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEM 20884

Query: 699   SDVIKVQAALTVPSHPYGITL----LNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHH 754
             ++ ++ +  L  P     + L    +   G  + +   +P      P + +  D++ +  
Sbjct: 20885 NEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQV--LIPFKGRPPPTVTWRKDEKNLGS 20942

Query: 755   KNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPG 814
                + + ++ S  ++LT+  +T     ++ +   N  G+GEP   +   K     +  P 
Sbjct: 20943 DARYSIENTDSS-SLLTIPQVTRNDTGKYILTIEN--GVGEPKSSTVSVK----VLDTPA 20995

Query: 815   PAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKV 874
                 L    V   ++ +LW  P+  G SP+  Y ++ R+     W  V+   ++  + K+
Sbjct: 20996 ACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSSTSF-KL 21054

Query: 875   SDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPG-TKEISAGVDEQGNIYLGFDCQ 933
              DL +   + FRV A N  G+G+P +T+EPV     P   +++S     + ++ L +   
Sbjct: 21055 IDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKP 21114

Query: 934   EMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSS 993
             +    S  T      +   ++ +    +    ++ +    ++ +  + V   +  G+S  
Sbjct: 21115 DFDGGSVITEYVVERKGKGEQTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDP 21174

Query: 994   FVLDPEELERLMALSNEIKNPTIP 1017
               + P  ++ L+ ++ E+    IP
Sbjct: 21175 VTIGPITVKELI-ITPEVDLSDIP 21197



 Score =  185 bits (470), Expect = 2e-46
 Identities = 164/638 (25%), Positives = 263/638 (41%), Gaps = 91/638 (14%)

Query: 381   GAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKIC 440
             G PG P   +  +  ++   V+WK P     S + GY V+R E  +  WV+    PV   
Sbjct: 14198 GPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDL 14257

Query: 441   KYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIY 500
             +  VTGL EG +Y FRV A N AGI  PS  SD+V   D                     
Sbjct: 14258 RCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDA-------------------- 14297

Query: 501   QDDLEGDAQVPGPPTGVHASEISRNYVVLSW-EPPTPRGKDPLMYFIEKSVVGSGSWQRV 559
                    A  PGPP+  H ++ ++    L+W +P    G +   Y +E   VG  +W + 
Sbjct: 14298 -------AYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKD 14350

Query: 560   NAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPS--APGR 617
                TA+R  ++ V DL   + Y FR+ + N  G+ EP+ I       DV +V    AP  
Sbjct: 14351 TTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIP------DVEIVEREMAPDF 14404

Query: 618   VLASRNTKTSVVVQW----------DRPKHE----EDLLGYYVDCCVAGTNLWE-----P 658
              L +   +T VV              RP  E    +D +       +  T  +       
Sbjct: 14405 ELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESFTLLIIPE 14464

Query: 659   CNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGIT 718
             CN    G     +      +     V+ ++  G   N + +D+ K               
Sbjct: 14465 CNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITK--------------- 14509

Query: 719   LLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEG 778
                    S+TL W +P   GGS I  Y ++KRE   K++    +   K T   V GL+EG
Sbjct: 14510 ------DSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTKCHKCTY-KVTGLSEG 14562

Query: 779   SLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVY 838
               Y F++ A N  GIGEP++ +E  K        P P   L   ++  +++ + W  P +
Sbjct: 14563 CEYFFRVMAENEYGIGEPTETTEPVKASE----APSPPDSLNIMDITKSTVSLAWPKPKH 14618

Query: 839   SGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKP 898
              G S ++GY ++ + + + +W  +  TT       V +L +G+ Y F+V AVN+ G   P
Sbjct: 14619 DGGSKITGYVIEAQRKGSDQWTHI--TTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAP 14676

Query: 899   SDTSEPVLVEARPGTKEISA-GVDEQGNIYLGFDCQEMT------DASQFTWCKSYEEIS 951
              + S PV+V+ +    E+   G+ ++  I    D  ++            TW K  + + 
Sbjct: 14677 RE-SRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILK 14735

Query: 952   DDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
               +R   ET    + L +    + D G Y ++  +  G
Sbjct: 14736 QTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVG 14773



 Score =  185 bits (470), Expect = 2e-46
 Identities = 164/623 (26%), Positives = 257/623 (41%), Gaps = 58/623 (9%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
             P  P  +   D  R+ V ++W+ P     S ++GY V+    G++ W  C  A VK+ + 
Sbjct: 15677 PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATC--ATVKVTEA 15734

Query: 443   PVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQD 502
              +TGL +G  Y FRV A N  GIS P ++S  V A D   L    A  L       +  +
Sbjct: 15735 TITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKD---LVIPPAFKLLFNTFTVLAGE 15791

Query: 503   DLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQ 562
             DL+ D    G PT             ++W                K  V      RVNA+
Sbjct: 15792 DLKVDVPFIGRPTPA-----------VTWH---------------KDNVPLKQTTRVNAE 15825

Query: 563   TAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVV--PSAP-GRVL 619
             +   +    + D        + V   N  G          I+  +V V+  P  P G V 
Sbjct: 15826 STENNSLLTIKDACREDVGHYVVKLTNSAG--------EAIETLNVIVLDKPGPPTGPVK 15877

Query: 620   ASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTG 677
                 T  S+ + W  PK++    +  Y V+     T  W+  +   +         L TG
Sbjct: 15878 MDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVS-ATVARTTIKACRLKTG 15936

Query: 678   EQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFS 737
              +Y FR+ A N  G S        +  Q    VP  P    +      SM + W  P   
Sbjct: 15937 CEYQFRIAAENRYGKSTYLNSEPTV-AQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPISD 15995

Query: 738   GGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPS 797
             GGS ++GY+L+++E +   W ++N +P   T     GL EG  YEF+++A N+ GIG+PS
Sbjct: 15996 GGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPS 16055

Query: 798   DPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAG 857
               SE +       P   P   +    V   S+ + WK P Y G S ++GY V+ +E   G
Sbjct: 16056 KVSECYVARDPCDPPGRPEAII----VTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEG 16111

Query: 858   EWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGV-GKPSDTSEPVLVEARPGTKEI 916
              W+  + T   + + +V+ L +   Y FRV A NA GV  +PS+++  +          I
Sbjct: 16112 RWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRI 16171

Query: 917   SAGVDEQGNIYLGFDCQEMTDASQF-------TWCKSYEEISDDERFKIETVGDHSKLYL 969
             S     +  I +        DA  +        W K  +E+S+  R +I++    + L +
Sbjct: 16172 SMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSV 16231

Query: 970   KNPDKEDLGTYSVSVSDTDGVSS 992
             K+  + D G Y +   +  G  S
Sbjct: 16232 KDAVRVDSGNYILKAKNVAGERS 16254



 Score =  185 bits (469), Expect = 3e-46
 Identities = 198/834 (23%), Positives = 347/834 (41%), Gaps = 94/834 (11%)

Query: 170   SVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSA 229
             +++L   ++G P P V W K+         P K RI+       LEI  A  +D   YS 
Sbjct: 10863 TLRLSAIIKGVPFPKVTWKKE-----DRDAPTKARIDVTPVGSKLEIRNAAHEDGGIYSL 10917

Query: 230   VATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFR 289
                N  G  + +  V+V      ++P    G P  L +S +                  R
Sbjct: 10918 TVENPAGSKTVSVKVLVL-----DKP----GPPRDLEVSEI------------------R 10950

Query: 290   REGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDD 349
             ++   +T K  +    D   V       R DV    ++W+ +     + S    HL++ +
Sbjct: 10951 KDSCYLTWKEPL---DDGGSVITNYVVERRDVA--SAQWSPLSATSKKKSHFAKHLNEGN 11005

Query: 350   EGLYTLRIVSRGGVSDHSAFLF----VRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKP 405
             + L+ +   ++ G      F+     ++  DPL    PG P DL   D ++  V + W  
Sbjct: 11006 QYLFRVAAENQYG---RGPFVETPKPIKALDPL--HPPGPPKDLHHVDVDKTEVSLVWNK 11060

Query: 406   PNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGI 465
             P+    SP+ GY V+  E GT +W++        C   VTGL +G++Y FRV+A N  G+
Sbjct: 11061 PDRDGGSPITGYLVEYQEEGTQDWIKFKTVTNLECV--VTGLQQGKTYRFRVKAENIVGL 11118

Query: 466   SRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRN 525
               P           P++ +  + V    E ++ +    +EG     G  T V    I R 
Sbjct: 11119 GLPDTTI-------PIECQE-KLVPPSVELDVKL----IEGLVVKAG--TTVRFPAIIRG 11164

Query: 526   YVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRV 585
                     P P  K    +  + S + +   +    +T   S    + + +   +  +++
Sbjct: 11165 V-------PVPTAK----WTTDGSEIKTD--EHYTVETDNFSSVLTIKNCLRRDTGEYQI 11211

Query: 586   LSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLG 643
               +N  G      +   +   DV   P+ P  +L    T   + + W  PK +    ++ 
Sbjct: 11212 TVSNAAG---SKTVAVHLTVLDVPGPPTGPINILDV--TPEHMTISWQPPKDDGGSPVIN 11266

Query: 644   YYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIK 703
             Y V+      + W   +         + H L  G +Y+FRV+A N +G+      +  + 
Sbjct: 11267 YIVEKQDTRKDTWGVVSSGSSKTKLKIPH-LQKGCEYVFRVRAENKIGVGPPLDSTPTV- 11324

Query: 704   VQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSS 763
              +   + PS P    + +   ++ T+ W +PK  GGSPI GYY+++REV  K W  VN +
Sbjct: 11325 AKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREVTGK-WVRVNKT 11383

Query: 764   PSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCE 823
             P       V GL EG+ YEF++ A NLAG+ +PS  S+  K      P PGP  +    +
Sbjct: 11384 PIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKP-PGPPINPKLKD 11442

Query: 824   VRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANR-YLKVSDLQQGKT 882
                 +  ++W  P+  G SP+ GY V+ ++    +W  +N+     +   +V  L +G  
Sbjct: 11443 KSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNE 11502

Query: 883   YVFRVRAVNANGVGKPSDTSEPVLVE--ARPGTKEISAGVDEQGNIYLGFDCQEMTDAS- 939
             Y FR++A N  G G+P + +E V+ +    P   E+     +   + +G   + +     
Sbjct: 11503 YRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKG 11562

Query: 940   ----QFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
                   TW K  + +  ++R  +       +L +K   + D G Y +S  ++ G
Sbjct: 11563 RPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSG 11616



 Score =  185 bits (469), Expect = 3e-46
 Identities = 204/870 (23%), Positives = 337/870 (38%), Gaps = 134/870 (15%)

Query: 161   RSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRAD 220
             ++H V    S++L    QG PTP   W K  S +   A+     I +     TL +   +
Sbjct: 21993 QTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRAD-----IHTTDSFSTLTVENCN 22047

Query: 221   FDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFR-------SVGLPIGLPLSSMIPY 273
              +D   Y+    N  G  S    V V    G   P         S  L    PL      
Sbjct: 22048 RNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGAR 22107

Query: 274   THFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFF 333
              H  V  +EK   + RR  + ++ KCT  +                              
Sbjct: 22108 IHHYV--VEKREAS-RRSWQVISEKCTRQI------------------------------ 22134

Query: 334   GEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLV-TGAPGAPMDLQCH 392
                      + L +     + +  V+  GV +          +P+V T  P  P  L   
Sbjct: 22135 ------FKVNDLAEGVPYYFRVSAVNEYGVGEPYEM-----PEPIVATEQPAPPRRLDVV 22183

Query: 393   DANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRS 452
             D ++   ++ W  P+    S + GY ++  + G++ WV+      K   + V  L E   
Sbjct: 22184 DTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHT--KQLTFTVERLVEKTE 22241

Query: 453   YIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPG 512
             Y FRV+A N AG S P     +V   +P          +E   ++    + L       G
Sbjct: 22242 YEFRVKAKNDAGYSEPREAFSSVIIKEP---------QIEPTADLTGITNQLI--TCKAG 22290

Query: 513   PPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAV 572
              P  +      R    ++W+    R K+                 RV+  T        V
Sbjct: 22291 SPFTIDVPISGRPAPKVTWKLEEMRLKET---------------DRVSITTTKDRTTLTV 22335

Query: 573   FDLMEGKSYVFRVLSANRHG----------LSEPSEITSPIQAQDVTVVPSAPGRVLASR 622
              D M G S  + +   N  G          +  P  +T PI+   V+             
Sbjct: 22336 KDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSA------------ 22383

Query: 623   NTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQY 680
                 S V+ W  PK     ++  Y V+   +GT  W+  N   +   +  V  LT   +Y
Sbjct: 22384 ---ESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSS-VKRTQIKVTHLTKYMEY 22439

Query: 681   IFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGS 740
              FRV + N  G+S+  + + +I  +     PS P    + +   ++M++ W+ P   GGS
Sbjct: 22440 SFRVSSENRFGVSKPLESAPII-AEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGS 22498

Query: 741   PILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPS 800
              I+GY+++K+E +   W + N  P       V GL EG  Y+F+  A+N AG+ + S+ S
Sbjct: 22499 KIIGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEAS 22558

Query: 801   EHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFR---EEDAG 857
                  +   +  PG        +V  +++ ++W AP Y G S V GY ++ +   E   G
Sbjct: 22559 RPIMAQN-PVDAPGRP---EVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDG 22614

Query: 858   EWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGV-GKPSDTSEPVLV--EARPGTK 914
              W+  N T  ++ +  V+ L +G TY FRV A NA GV  K S+++ PV    E  P   
Sbjct: 22615 RWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKA 22674

Query: 915   EISAGV-DEQGNIYLGFDCQEMTDAS-------QFTWCKSYEEISDDERFKIETVGDHSK 966
             E+ A +  +   I  G D   + DA+       +  W K  +E+   E+  ++  G  + 
Sbjct: 22675 ELDARLHGDLVTIRAGSDL--VLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRAT 22732

Query: 967   LYLKNPDKEDLGTYSVSVSDTDGVSSSFVL 996
               +K  D+ D G Y+++V +  G  +  V+
Sbjct: 22733 AVIKFCDRSDSGKYTLTVKNASGTKAVSVM 22762



 Score =  184 bits (466), Expect = 7e-46
 Identities = 162/629 (25%), Positives = 274/629 (43%), Gaps = 63/629 (10%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
             PG  +DL+    ++    + WK P++   S ++GY VD      N W +   +     +Y
Sbjct: 13512 PGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFL-TEENKWQRVMKS--LSLQY 13568

Query: 443   PVTGLFEGRSYIFRVRAVNSAGISRPSRVS----DAVAALDPLDLRRLQAVHLEGEKEIA 498
                 L EG+ Y FRV A N  G   PS ++    D V A D LDL+ L  +         
Sbjct: 13569 SAKDLTEGKEYTFRVSAENENGEGTPSEITVVARDDVVAPD-LDLKGLPDL--------- 13618

Query: 499   IYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQR 558
              Y      + ++  P  G  A  +S       W+    +G+DPL            +  R
Sbjct: 13619 CYLAKENSNFRLKIPIKGKPAPSVS-------WK----KGEDPL-----------ATDTR 13656

Query: 559   VNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRV 618
             V+ +++  +    V+D  +  +  + +   N  G  E    T  I+      +P+ P  +
Sbjct: 13657 VSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEG---TISIKVVGKPGIPTGP--I 13711

Query: 619   LASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTT 676
                  T  ++ ++W  PK +   ++  Y ++   +  N W  C    +    F V  L  
Sbjct: 13712 KFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCA-SAVQKTTFRVTRLHE 13770

Query: 677   GEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKF 736
             G +Y FRV A N  G+ E  + S+ I  +    VP  P    +++    S++L W  PK 
Sbjct: 13771 GMEYTFRVSAENKYGVGEGLK-SEPIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKK 13829

Query: 737   SGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEP 796
             +GGSPI GY+L+ +E +   W   N +P +     V GLTEG  YEF++ A+NLAG+G+P
Sbjct: 13830 TGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKP 13889

Query: 797   SDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDA 856
             S PSE        +    P        +   S+ ++W  P Y G   ++GY V+ R+  +
Sbjct: 13890 SLPSE----PVVALDPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPS 13945

Query: 857   GEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVN-ANGVGKPSDTSEPVLV--EARPGT 913
               W+  N          V+DL +G  Y FR+RA N A  +  PS+++E ++   E    T
Sbjct: 13946 KSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPT 14005

Query: 914   KEISAGVDEQGNIYLGFDCQEMTDAS-------QFTWCKSYEEISDDERFKIETVGDHSK 966
               +   + +   I  G D   +   S       + +W K+ ++I   +  +I +    S 
Sbjct: 14006 IVLDPTIKDGLTIKAG-DTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSM 14064

Query: 967   LYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
             L +K   ++D G Y+++ ++  G     V
Sbjct: 14065 LTIKYATRKDAGEYTITATNPFGTKVEHV 14093



 Score =  184 bits (466), Expect = 7e-46
 Identities = 157/633 (24%), Positives = 259/633 (40%), Gaps = 56/633 (8%)

Query: 283   KFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSF 342
             K G+T +  G+T+ L    ++   L    P++ W +    ++ S  T++      + L+ 
Sbjct: 14013 KDGLTIKA-GDTIVLNAISILGKPL----PKSSWSKAGKDIRPSDITQITSTPTSSMLTI 14067

Query: 343   SHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVT 402
              +  + D G YT+   +  G         V      V   PG P  ++  + + +   +T
Sbjct: 14068 KYATRKDAGEYTITATNPFGTK-------VEHVKVTVLDVPGPPGPVEISNVSAEKATLT 14120

Query: 403   WKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNS 462
             W PP     SP+  Y +++ E     W   ++  ++ C++  T L +G  YIFRV AVN 
Sbjct: 14121 WTPPLEDGGSPIKSYILEKRETSRLLWTVVSE-DIQSCRHVATKLIQGNEYIFRVSAVNH 14179

Query: 463   AGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEI 522
              G   P + S+ V  +D                               PGPP     S +
Sbjct: 14180 YGKGEPVQ-SEPVKMVDRFG---------------------------PPGPPEKPEVSNV 14211

Query: 523   SRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSY 581
             ++N   +SW+ P   G   +  Y +E+    S  W R   +T V   R  V  L EG +Y
Sbjct: 14212 TKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRA-IKTPVSDLRCKVTGLQEGSTY 14270

Query: 582   VFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEE-- 639
              FRV + NR G+  PSE +  +  +D    P  P     +  TK S  + W +P ++   
Sbjct: 14271 EFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGL 14330

Query: 640   DLLGYYVDCCVAGTNLW-EPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQE 698
             ++ GY V+    G   W +      +   +FVV  L T E+Y FR+ A+N  G+ E +  
Sbjct: 14331 EITGYVVEHQKVGDEAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVI 14390

Query: 699   SDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWH 758
              DV  V+  +  P       L         L  ++     G P       K  ++ KN  
Sbjct: 14391 PDVEIVEREM-APDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRA 14449

Query: 759   EVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYD 818
              + ++ S  T+L +         +F +   N AG        +        +  PGP  +
Sbjct: 14450 NIENTESF-TLLIIPECNRYDTGKFVMTIENPAG-------KKSGFVNVRVLDTPGPVLN 14501

Query: 819   LTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQ 878
             L   ++   S+ + W  P+  G S ++ Y V+ RE     + T         Y KV+ L 
Sbjct: 14502 LRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTKCHKCTY-KVTGLS 14560

Query: 879   QGKTYVFRVRAVNANGVGKPSDTSEPVLVEARP 911
             +G  Y FRV A N  G+G+P++T+EPV     P
Sbjct: 14561 EGCEYFFRVMAENEYGIGEPTETTEPVKASEAP 14593



 Score =  184 bits (466), Expect = 7e-46
 Identities = 233/952 (24%), Positives = 374/952 (39%), Gaps = 107/952 (11%)

Query: 382   APGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDR---CEVGTNNWVQCNDAPVK 438
             APG P   +  D  R  V + W  P     S V+GY ++R    EVG   W++CN   V 
Sbjct: 22569 APGRP---EVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVS 22625

Query: 439   ICKYPVTGLFEGRSYIFRVRAVNSAG-ISRPSRVSDAVAALDPLDLRRLQA-VHLEGEKE 496
                + VT L EG +Y FRV A N+AG IS+ S  +  V   D     + +    L G+  
Sbjct: 22626 DNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLV 22685

Query: 497   IAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGK-DPLMYFIEKSVVGSGS 555
                   DL  DA V G P                 EP     K D  +   EK       
Sbjct: 22686 TIRAGSDLVLDAAVGGKP-----------------EPKIIWTKGDKELDLCEK------- 22721

Query: 556   WQRVNAQ-TAVRSPRYAVF-DLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPS 613
                V+ Q T  R+     F D  +   Y   V +A+  G    S +   + +      P 
Sbjct: 22722 ---VSLQYTGKRATAVIKFCDRSDSGKYTLTVKNAS--GTKAVSVMVKVLDS------PG 22770

Query: 614   APGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVV 671
               G++  SR T+    + W  P+ +   ++  Y V+        W     +    + +VV
Sbjct: 22771 PCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLS-YVV 22829

Query: 672   HGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGW 731
               L    +YIFRV+AVN  G      ES+ I  + + T+PS P     +      + + W
Sbjct: 22830 TRLIKNNEYIFRVRAVNKYGPGV-PVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQW 22888

Query: 732   KVPKFSGGSPILGYYLDKREVHHKNWHEVNSS-PSKPTILTVDGLTEGSLYEFKIAAVNL 790
               P+  GG+ I  Y +DKRE     W  VN       T L V  L EG  Y+F++ AVN 
Sbjct: 22889 TKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNA 22948

Query: 791   AGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVD 850
             AG  EPS+ S    C   +   PGP       +    S+ + W  P+Y G + + GY ++
Sbjct: 22949 AGNSEPSEASNFISCREPSYT-PGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLE 23007

Query: 851   FREEDAGEWITVN-QTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDT---SEPVL 906
              +E+D  +W  V+   T  N    V DL+ G+ Y FRV AVN  G+ + S++    EPV 
Sbjct: 23008 MQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVE 23067

Query: 907   VEARPGTKEISAGVDEQGNIYLGFDCQEMTDAS-----QFTWCKSYEEISDDERFKIETV 961
                 P   E++  + +   I  G   + M   S       TW K   +++   R  I+T 
Sbjct: 23068 RIEIPDL-ELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLA--SRAIIDTT 23124

Query: 962   GDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKSE 1021
               +S L +   ++ D G Y++   +  G  S+ VL             ++ +   P  S 
Sbjct: 23125 ESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVL------------VKVYDTPGPCPSV 23172

Query: 1022  LAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRI--KCDKA----TGIIEM 1075
                E+        W             +I+  RE +      +  KC K     +G++E 
Sbjct: 23173 KVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEG 23232

Query: 1076  VMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEY 1135
              M  F +  E  Y +    G+    S  VL+ +     L  A+ +  +  +         
Sbjct: 23233 TMYYFRVLPENIYGI----GEPCETSDAVLVSE---VPLVPAKLEVVDVTKS-----TVT 23280

Query: 1136  LHWD-VTEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNLERGICELLIPKLSKKD 1194
             L W+    +   RL   V    K    +W+K         +  L+  + E  +  L++ +
Sbjct: 23281 LAWEKPLYDGGSRLTGYVLEACKAGTERWMK---------VVTLKPTVLEHTVTSLNEGE 23331

Query: 1195  HGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLKVLCTPEGIRLQCFMK 1254
                ++   ++++G       +      D  L +      S  P K +  P G  ++  + 
Sbjct: 23332 QYLFRIRAQNEKGVSEPRETVTAVTVQD--LRVLPTIDLSTMPQKTIHVPAGRPVELVIP 23389

Query: 1255  YF-TDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEI 1305
                      +W    +K+  SE + +    ++A L I E T +D G+YT E+
Sbjct: 23390 IAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLEL 23441



 Score =  182 bits (462), Expect = 2e-45
 Identities = 157/621 (25%), Positives = 254/621 (40%), Gaps = 75/621 (12%)

Query: 302   LVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRG 361
             LV P   R  P A W+     L+ES+   +      A L+       D G YTL + +  
Sbjct: 23386 LVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVT 23445

Query: 362   GVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDR 421
             G +  +  + + D      G P  P+ +   DA    + ++W+PP     +P+ GY V++
Sbjct: 23446 GTTSETIKVIILDKP----GPPTGPIKIDEIDATS--ITISWEPPELDGGAPLSGYVVEQ 23499

Query: 422   CEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPL 481
              +     W+  +++  +   +  T L EG  Y+FRV A N  GI                
Sbjct: 23500 RDAHRPGWLPVSESVTR-STFKFTRLTEGNEYVFRVAATNRFGIGS-------------- 23544

Query: 482   DLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDP 541
                 LQ+  +E    I           ++PGPP  +   ++SR+ + L+W PP   G   
Sbjct: 23545 ---YLQSEVIECRSSI-----------RIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQ 23590

Query: 542   LM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEIT 600
             +  Y +E+  V +  W RVN +  V   RY    L EG  Y  RV + N  G  +PS  +
Sbjct: 23591 VTGYIVERKEVRADRWVRVN-KVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPS 23649

Query: 601   SPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEP 658
              PI A D    P  P     +  T+TSV + W  P+ E    + GY ++      + W  
Sbjct: 23650 KPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTK 23709

Query: 659   CNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPY--- 715
             CN  P     + +  L  G +Y FRV A NA G  E ++    +KV   L  P +     
Sbjct: 23710 CNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDER 23769

Query: 716   ---GITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTV 772
                GI +       +T+  K   F    PI  +  + +++  +     + + ++  I   
Sbjct: 23770 YQEGIFVRQGGVIRLTIPIKGKPF----PICKWTKEGQDISKRAMIATSETHTELVIKEA 23825

Query: 773   DGLTEGSLYEF--------KIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEV 824
             D    G+ Y+         K   + +  IG P+ P              GP   L + ++
Sbjct: 23826 DRGDSGT-YDLVLENKCGKKAVYIKVRVIGSPNSPE-------------GP---LEYDDI 23868

Query: 825   RDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYV 884
             +  S+ + W+ P   G + + GY ++ RE     W T++        L V  L++   Y 
Sbjct: 23869 QVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRVRGTS-LVVKGLKENVEYH 23927

Query: 885   FRVRAVNANGVGKPSDTSEPV 905
             FRV A N  G+ KP  + EPV
Sbjct: 23928 FRVSAENQFGISKPLKSEEPV 23948



 Score =  182 bits (461), Expect = 3e-45
 Identities = 173/685 (25%), Positives = 271/685 (39%), Gaps = 56/685 (8%)

Query: 238   VSTNAAVVVRRFRGDEEPFRSVGLPIGLPLS----SMIPYTHFDVQFLEKFGVTFRREGE 293
             VS N   V     GD   FR +       +S    S  P T  D     K  +  R  G+
Sbjct: 22624 VSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGD 22683

Query: 294   TVTLKCTMLVTPDLK---RVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDE 350
              VT++    +  D     + +P+  W + D  L   +   + +   +A+       + D 
Sbjct: 22684 LVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDS 22743

Query: 351   GLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTT 410
             G YTL + +  G    S  + V D+       PG    L      ++   + W  P    
Sbjct: 22744 GKYTLTVKNASGTKAVSVMVKVLDS-------PGPCGKLTVSRVTQEKCTLAWSLPQEDG 22796

Query: 411   ESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSR 470
              + +  Y V+R E    NWV   +       Y VT L +   YIFRVRAVN  G      
Sbjct: 22797 GAEITHYIVERRETSRLNWVIV-EGECPTLSYVVTRLIKNNEYIFRVRAVNKYG------ 22849

Query: 471   VSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLS 530
                               V +E E  +A           +P PP         + ++++ 
Sbjct: 22850 ----------------PGVPVESEPIVA------RNSFTIPSPPGIPEEVGTGKEHIIIQ 22887

Query: 531   W-EPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSAN 589
             W +P +  G +   Y ++K    S  W RVN    V   R  V  LMEG  Y FRV + N
Sbjct: 22888 WTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVN 22947

Query: 590   RHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVD 647
               G SEPSE ++ I  ++ +  P  P        TK S+ + W +P ++   D++GY ++
Sbjct: 22948 AAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLE 23007

Query: 648   CCVAGTNLWEPCN-HKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQA 706
                  T+ W   + +  I    F V  L  G++Y FRV AVN  GMSE S+    I+   
Sbjct: 23008 MQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVE 23067

Query: 707   ALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSK 766
              + +P       L            ++     G P       K+ +   +   ++++ S 
Sbjct: 23068 RIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESY 23127

Query: 767   PTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRD 826
              ++L VD +      ++ I A N +G        +           PGP   +   EV  
Sbjct: 23128 -SLLIVDKVNRYDAGKYTIEAENQSG-------KKSATVLVKVYDTPGPCPSVKVKEVSR 23179

Query: 827   TSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFR 886
              S+ + W+ P   G +PV+ Y V+ RE     + TV    +   Y ++S L +G  Y FR
Sbjct: 23180 DSVTITWEIPTIDGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLY-RISGLVEGTMYYFR 23238

Query: 887   VRAVNANGVGKPSDTSEPVLVEARP 911
             V   N  G+G+P +TS+ VLV   P
Sbjct: 23239 VLPENIYGIGEPCETSDAVLVSEVP 23263



 Score =  181 bits (460), Expect = 4e-45
 Identities = 159/669 (23%), Positives = 274/669 (40%), Gaps = 82/669 (12%)

Query: 376   DPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDA 435
             DP+    PG P + +  D  R  V + W  P     S V GY ++  +V  + W +CN  
Sbjct: 23656 DPIAP--PGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTT 23713

Query: 436   PVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLR--RLQAVHLEG 493
             P KI +Y +T L +G  Y FRV A N+ G   P+ V   V   + L+     L   + EG
Sbjct: 23714 PTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEG 23773

Query: 494   EKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGS 553
                I + Q    G  ++  P  G       + + +  W   T  G+D     I K     
Sbjct: 23774 ---IFVRQG---GVIRLTIPIKG-------KPFPICKW---TKEGQD-----ISK----- 23807

Query: 554   GSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHG----------LSEPSEITSPI 603
                 R    T+       + +   G S  + ++  N+ G          +  P+    P+
Sbjct: 23808 ----RAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIGSPNSPEGPL 23863

Query: 604   QAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNH 661
             +  D+ V                SV V W  P  +   D+LGY ++        W   + 
Sbjct: 23864 EYDDIQV---------------RSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDS 23908

Query: 662   KPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGIT-LL 720
             +  G +  VV GL    +Y FRV A N  G+S+  +  + +  +  L  P  P     +L
Sbjct: 23909 RVRGTS-LVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVL 23967

Query: 721   NCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSL 780
             +    S++L W  PK  GGS + GYY++++E     W   N +    T+ TV GL   + 
Sbjct: 23968 DVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAE 24027

Query: 781   YEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSG 840
             Y+F+I A N  G+ E S  SE   C+     +P    +L    +   S+ + W+ P   G
Sbjct: 24028 YQFRIIAQNDVGLSETSPASEPVVCKD-PFDKPSQPGELEILSISKDSVTLQWEKPECDG 24086

Query: 841   SSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSD 900
                + GY+V++R+     W   N+    ++   +  L +   Y FRV A N  G+ +P  
Sbjct: 24087 GKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRR 24146

Query: 901   TSEPVLVEARPG--------TKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISD 952
             T+  +  +   G         K+++  + E   +      + + D     W +  +E+  
Sbjct: 24147 TAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPD---IKWYRFGKELIQ 24203

Query: 953   DERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIK 1012
               ++K+ + G    L +   ++ED G Y+        ++++ V + E   +L+  +    
Sbjct: 24204 SRKYKMSSDGRTHTLTVMTEEQEDEGVYTC-------IATNEVGEVETSSKLLLQATPQF 24256

Query: 1013  NPTIPLKSE 1021
             +P  PLK +
Sbjct: 24257 HPGYPLKEK 24265



 Score =  179 bits (453), Expect = 2e-44
 Identities = 155/603 (25%), Positives = 260/603 (43%), Gaps = 78/603 (12%)

Query: 327  KWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGA---- 382
            +W ++  G          L +  E  + +R V++ G S+ S       +DP++       
Sbjct: 7657 EWVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPS-----EPSDPVLCREKLYP 7711

Query: 383  PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
            P  P  L+  +  ++   + W  P     SP+  Y V++ +V    W Q  D  VK  K 
Sbjct: 7712 PSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGW-QTVDTTVKDTKC 7770

Query: 443  PVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQD 502
             VT L EG  Y+FRV A N+ G S  + + D+V A D                       
Sbjct: 7771 TVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFT-------------------- 7810

Query: 503  DLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNA 561
                    PGPP  +   ++++ +V L WEPP   G  P+  Y IEK       W +   
Sbjct: 7811 -------TPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAG- 7862

Query: 562  QTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLAS 621
            +TA     + V D++EG    F+V + N  G+  PSE T  +  +D T  PS P  +  +
Sbjct: 7863 KTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVT 7922

Query: 622  RNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVH-GLTTGE 678
               +  + + W  P+      ++GY+V+ C  GT  W   N +PI   +F V  G+   +
Sbjct: 7923 DAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDK 7982

Query: 679  QYIFRVKAVNAVGMSENSQESDVIKVQ---AALTVPSHPYGITLLNCDGHSMTLGWKVPK 735
            +Y+ RV+AVNA+G+SE S+ S+ +  +      T+    + I ++  +G  +++   VP 
Sbjct: 7983 EYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHDIIVI--EGEKLSI--PVPF 8038

Query: 736  FSGGSPILGYYLDKREVHH------KNWHEVNSSPSKPTILTVDGLTEGSLYEFKI---- 785
             +   P + ++ D +EV        KN H +++    P  +  D        E K+    
Sbjct: 8039 RAVPVPTVSWHKDGKEVKASDRLTMKNDH-ISAHLEVPKSVRADAGIYTITLENKLGSAT 8097

Query: 786  AAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVS 845
            A++N+  IG P                 GP  D+   ++  +S  + W+ P + G +P+ 
Sbjct: 8098 ASINVKVIGLP-----------------GPCKDIKASDITKSSCKLTWEPPEFDGGTPIL 8140

Query: 846  GYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPV 905
             Y ++ RE     +I V        +  V DL     Y FRV+AVN  G G+  +   PV
Sbjct: 8141 HYVLERREAGRRTYIPVMSGENKLSW-TVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPV 8199

Query: 906  LVE 908
            + +
Sbjct: 8200 IAQ 8202



 Score =  177 bits (450), Expect = 5e-44
 Identities = 166/627 (26%), Positives = 257/627 (40%), Gaps = 66/627 (10%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICK- 441
             PG P   +  D  +  V + W  P     S ++GYFV+ C++  + WV+CN AP +I + 
Sbjct: 12821 PGKP---EVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQE 12877

Query: 442   -YPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIY 500
              Y  TGL E   Y FR  A  +  IS PS  SD V  L         A ++    ++++ 
Sbjct: 12878 EYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTIL---------AENVPPRIDLSVA 12928

Query: 501   QDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVN 560
                L       G    + A+   +    +SW+      KD  +    K   G     + N
Sbjct: 12929 MKSLL--TVKAGTNVCLDATVFGKPMPTVSWK------KDGTLL---KPAEGIKMAMQRN 12977

Query: 561   AQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLA 620
               T        +F +    S  + + + N  G       T  ++  D    P  P  V  
Sbjct: 12978 LCTL------ELFSVNRKDSGDYTITAENSSG---SKSATIKLKVLDK---PGPPASVKI 13025

Query: 621   SRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGE 678
             ++      ++ W+ P  +   ++  Y VD        W   +   +      V  L  G 
Sbjct: 13026 NKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVS-ATVPITSCSVEKLIEGH 13084

Query: 679   QYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGI----TLLNCDGHSMTLGWKVP 734
             +Y FR+ A N  G+ +      V    A    P  P G      + N     MT+ WK P
Sbjct: 13085 EYQFRICAENKYGVGD-----PVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPP 13139

Query: 735   KFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIG 794
                GGSPI GY L+KRE    NW +VN  P     L   GL EG+ YEF++ A+N AG G
Sbjct: 13140 ADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPG 13199

Query: 795   EPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREE 854
             +PSD S+         P   PA+   +   R +S+ + W  P Y G SP+ GY V+ +  
Sbjct: 13200 KPSDASKAAYARDPQYPPGPPAFPKVYDTTR-SSVSLSWGKPAYDGGSPIIGYLVEVKRA 13258

Query: 855   DAGEWITVN--QTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSE-----PVLV 907
             D+  W+  N  Q     R+ +V+ L +   Y FRV AVN  G   PSD  +      +L+
Sbjct: 13259 DSDNWVRCNLPQNLQKTRF-EVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILI 13317

Query: 908   EARPGTKEISAGVDEQGNIYLGFDCQEMTDAS-----QFTWCKSYEEISDDERFKIETVG 962
                P   E+ A + +   +  G   +           + TW K    + D     I++  
Sbjct: 13318 ---PPEGELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTD 13374

Query: 963   DHSKLYLKNPDKEDLGTYSVSVSDTDG 989
               + L  +N +K D G Y +++ ++ G
Sbjct: 13375 FDTFLRCENVNKYDAGKYILTLENSCG 13401



 Score =  176 bits (445), Expect = 2e-43
 Identities = 164/628 (26%), Positives = 264/628 (42%), Gaps = 59/628 (9%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
             PG P   +  +  R+ V + W  P       + GY V++ ++ + +W++ N   V  C +
Sbjct: 13905 PGKP---EVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAF 13961

Query: 443   PVTGLFEGRSYIFRVRAVNSAG-ISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQ 501
              VT L EG  Y FR+RA N+AG IS PS  ++ +   D            E E    +  
Sbjct: 13962 TVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKD------------EYEAPTIVLD 14009

Query: 502   DDLEGDAQVPGPPTGV--HASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRV 559
               ++    +    T V    S + +     SW   +  GKD     I + +  + +   +
Sbjct: 14010 PTIKDGLTIKAGDTIVLNAISILGKPLPKSSW---SKAGKDIRPSDITQ-ITSTPTSSML 14065

Query: 560   NAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTV--VPSAPGR 617
               + A R                     A  + ++  +   + ++   VTV  VP  PG 
Sbjct: 14066 TIKYATRK-------------------DAGEYTITATNPFGTKVEHVKVTVLDVPGPPGP 14106

Query: 618   VLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLT 675
             V  S  +     + W  P  +    +  Y ++       LW   + + I   R V   L 
Sbjct: 14107 VEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVS-EDIQSCRHVATKLI 14165

Query: 676   TGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPK 735
              G +YIFRV AVN  G  E  Q S+ +K+      P  P    + N   ++ T+ WK P 
Sbjct: 14166 QGNEYIFRVSAVNHYGKGEPVQ-SEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPV 14224

Query: 736   FSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGE 795
               GGS I GY++++RE     W     +P       V GL EGS YEF+++A N AGIG 
Sbjct: 14225 DDGGSEITGYHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGP 14284

Query: 796   PSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREED 855
             PS+ S+    +    P PGP  +    +    S  + W  P Y G   ++GY V+ ++  
Sbjct: 14285 PSEASDSVLMKDAAYP-PGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVG 14343

Query: 856   AGEWITVNQTTTANRYLK--VSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGT 913
                WI  + T TA R  +  V DLQ  + Y FR+ A+N  GVG+P+   +  +VE     
Sbjct: 14344 DEAWIK-DTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAP 14402

Query: 914   K-EISAGVDEQGNIYLGFDCQ-----EMTDASQFTWCKSYEEISDDERFKIETVGDHSKL 967
               E+ A +     +  G   +     +   A + TW K  + I+   R  IE     + L
Sbjct: 14403 DFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTK--DNINLKNRANIENTESFTLL 14460

Query: 968   YLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
              +   ++ D G + +++ +  G  S FV
Sbjct: 14461 IIPECNRYDTGKFVMTIENPAGKKSGFV 14488



 Score =  174 bits (442), Expect = 4e-43
 Identities = 154/640 (24%), Positives = 249/640 (38%), Gaps = 84/640 (13%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
             PG P   +    +++ + V W PP       + GYF+++ E  +  WV  N + +   + 
Sbjct: 12024 PGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRM 12083

Query: 443   PVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQD 502
              V  L     Y FRV+A N  GI  PS  S  V A DP++                    
Sbjct: 12084 KVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIE-------------------- 12123

Query: 503   DLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIE-KSVVGSGS----W 556
                     PGPPT     + +++ + L W  P   G  P++ Y +E +  +   S    W
Sbjct: 12124 -------PPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGW 12176

Query: 557   QRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPS--- 613
             +R NA   +    + V  L E + Y FRV + N+ G+  P+E+   I+ +++   P    
Sbjct: 12177 KRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDL 12236

Query: 614   -------------APGRVLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCN 660
                           P R+ A    + +  V W +   +  +    VD       L  P +
Sbjct: 12237 DASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNS 12296

Query: 661   HKPIGYNRFVVHGLTTGEQYIF-RVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITL 719
              +       +      GE+ +F  V+ ++  G   + + SDV K                
Sbjct: 12297 TRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKT--------------- 12341

Query: 720   LNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGS 779
                   S  + W  P+  GGS +  Y ++KRE   K W  V     K T   V  L  G+
Sbjct: 12342 ------SCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVKK-TSFHVTNLVPGN 12394

Query: 780   LYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYS 839
              Y F++ AVN  G G P+D  +        + EP P   L   E+   S  + W  P+  
Sbjct: 12395 EYYFRVTAVNEYGPGVPTDVPKPVLASD-PLSEPDPPRKLEVTEMTKNSATLAWLPPLRD 12453

Query: 840   GSSPVSGYFVDFREED--AGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGK 897
             G + + GY   +REE+  A  W     +   +  L V+ L++GK Y FRV A NA GV  
Sbjct: 12454 GGAKIDGYITSYREEEQPADRW--TEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSL 12511

Query: 898   PSDTSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDA-----SQFTWCKSYEEISD 952
             P +     + EA+         + EQ  I  G   +              W K  +E+  
Sbjct: 12512 PREAEG--VYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVT 12569

Query: 953   DERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSS 992
                  +      S L +K+  ++D G YS++  ++ G  +
Sbjct: 12570 SSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDT 12609



 Score =  173 bits (439), Expect = 1e-42
 Identities = 157/607 (25%), Positives = 254/607 (41%), Gaps = 62/607 (10%)

Query: 312   PRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLF 371
             P  +W + +  +  S    +   +  + L    + + D G Y+L   +  G       + 
Sbjct: 12556 PTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVV 12615

Query: 372   VRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQ 431
             V DA     G P  P D+   D + D   ++W  P     S +  Y V++C+V   +WV 
Sbjct: 12616 VMDAP----GPPQPPFDIS--DIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVT 12669

Query: 432   CNDAPVKI-CKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVH 490
                +  K  C+  V  L  G+ YIFRVRA N  GIS P                      
Sbjct: 12670 ALASVTKTSCR--VGKLIPGQEYIFRVRAENRFGISEP---------------------- 12705

Query: 491   LEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKS 549
             L   K +A +         VP  P     ++++++ + ++W+ P   G  P++ Y IE+ 
Sbjct: 12706 LTSPKMVAQFPFG------VPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERK 12759

Query: 550   VVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVT 609
                S  W + N  T VRS  Y    L+EG  Y FR+ + N+ G S PS+ T  + A+ + 
Sbjct: 12760 ERNSLLWVKAN-DTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTAR-MP 12817

Query: 610   VVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKP--IG 665
             V P  PG+      TK++V + W RPKH+    ++GY+V+ C    + W  CN  P  I 
Sbjct: 12818 VDP--PGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIP 12875

Query: 666   YNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNC--- 722
                +   GL    QY FR  A  AV +S  S+ SD + + A    P     + + +    
Sbjct: 12876 QEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTV 12935

Query: 723   -DGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLY 781
               G ++ L   V  F    P + +  D   +      ++    +  T L +  +      
Sbjct: 12936 KAGTNVCLDATV--FGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCT-LELFSVNRKDSG 12992

Query: 782   EFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGS 841
             ++ I A N +G       S+    +   + +PGP   +   ++     ++ W+ P+  G 
Sbjct: 12993 DYTITAENSSG-------SKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGG 13045

Query: 842   SPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDT 901
             S ++ Y VD RE     W  V+ T        V  L +G  Y FR+ A N  GVG P  T
Sbjct: 13046 SEITNYIVDKRETSRPNWAQVSATVPITS-CSVEKLIEGHEYQFRICAENKYGVGDPVFT 13104

Query: 902   SEPVLVE 908
              EP + +
Sbjct: 13105 -EPAIAK 13110



 Score =  172 bits (437), Expect = 2e-42
 Identities = 163/628 (25%), Positives = 259/628 (41%), Gaps = 61/628 (9%)

Query: 292   GETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQ-ASLSFSHLHKDDE 350
             GET  L+  +   P      P   W +D   L+E+          Q  +L      + D 
Sbjct: 18350 GETFVLEADIRGKPI-----PDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDG 18404

Query: 351   GLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTT 410
             G Y L++ + GG       + V D      G P  P+ +    A + Y+   W PP    
Sbjct: 18405 GQYILKLSNVGGTKSIPITVKVLDRP----GPPEGPLKVTGVTAEKCYL--AWNPPLQDG 18458

Query: 411   ESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSR 470
              + +  Y +++ E    +W Q +   V+   Y VT L  G  YIFRV AVN  GI  P  
Sbjct: 18459 GANISHYIIEKRETSRLSWTQVS-TEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLE 18517

Query: 471   VSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLS 530
              S  V A +P                            + PGPP+    S I+++ +V++
Sbjct: 18518 -SGPVTACNPY---------------------------KPPGPPSTPEVSAITKDSMVVT 18549

Query: 531   WEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSAN 589
             W  P   G   +  Y +EK       W + N +T +   R  V  L EG SY FRV + N
Sbjct: 18550 WARPVDDGGTEIEGYILEKRDKEGVRWTKCNKKT-LTDLRLRVTGLTEGHSYEFRVAAEN 18608

Query: 590   RHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVD 647
               G+ EPSE +   +A D    P  P     +  +++SV + W +P ++    + GY V+
Sbjct: 18609 AAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVE 18668

Query: 648   CCVAGTNLWEPCNHKPIGY--NRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQ 705
                A  + W  C   P G    +F V  L    +Y FR+ A+N+ G+ E +     +  Q
Sbjct: 18669 VKEAAADEWTTCT-PPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQ 18727

Query: 706   AALTVPSHPYGITLLNCD--GHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSS 763
               +  P       L        S TL   V       P + +   +  +  +   EV SS
Sbjct: 18728 ERIEPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSS 18787

Query: 764   PSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCE 823
                 T+L +D +T      + +   N +G       S+        +  P    +LT  E
Sbjct: 18788 ---FTMLVIDNVTRFDSGRYNLTLENNSG-------SKTAFVNVRVLDSPSAPVNLTIRE 18837

Query: 824   VRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTY 883
             V+  S+ + W+ P+  G + ++ Y V+ RE     + T+    T   + ++ +LQ+G +Y
Sbjct: 18838 VKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKTTF-RIENLQEGCSY 18896

Query: 884   VFRVRAVNANGVGKPSDTSEPVLVEARP 911
              FRV A N  G+G P++T+EPV V   P
Sbjct: 18897 YFRVLASNEYGIGLPAETTEPVKVSEPP 18924



 Score =  172 bits (436), Expect = 2e-42
 Identities = 149/603 (24%), Positives = 243/603 (40%), Gaps = 66/603 (10%)

Query: 309   RVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSA 368
             R  P   W R++    +    ++  G     LS  +  ++D G Y L++ +  G    SA
Sbjct: 17679 RPTPEITWSREEGEFTDK--VQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSG--SKSA 17734

Query: 369   FLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNN 428
             F+ V+  D      PG P +L   +  +D   + W+PP     + V  Y +D+ E     
Sbjct: 17735 FVTVKVLD-----TPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKA 17789

Query: 429   WVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQA 488
             +   +    K   + V  L EG  Y FRV A N  G+  P    DAV A +P        
Sbjct: 17790 YANVSSKCSKT-SFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEP-------- 17840

Query: 489   VHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIE 547
                                   P PP  V  +++S+    L WE P   G   ++ Y +E
Sbjct: 17841 ----------------------PSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVE 17878

Query: 548   KSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQD 607
                 G+  W  V       +    V  L  G+ Y FRV + N  G S+P  +  P+ A+D
Sbjct: 17879 MQPKGTEKWSIVAESKVCNA---VVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKD 17935

Query: 608   VTVVPSA-----PGRVLASRNTKTSV-VVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNH 661
             +T+ PS         + A  + K  + V+   RP          +     G  L +    
Sbjct: 17936 LTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPN---------ISWVKDGEPLKQTTRV 17986

Query: 662   KPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYG-ITLL 720
                      V  +  G +  F    V A   +  + E+  + V   L  P  P G +   
Sbjct: 17987 NVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIV---LEKPGPPVGPVRFD 18043

Query: 721   NCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSL 780
                   + + W+ P ++GG  I  Y ++KR+     WH V+++ ++ TI  +  L  G+ 
Sbjct: 18044 EVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTI-KITKLKTGTE 18102

Query: 781   YEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSG 840
             Y+F+I A N  G   P D         +   EPGP        +    +++ W  PV  G
Sbjct: 18103 YQFRIFAENRYGKSAPLDSKA--VIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDG 18160

Query: 841   SSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSD 900
              + + GY ++ +E+++  W+ +N+T   +   K + L +G  Y F+V A N  G+GKPS 
Sbjct: 18161 GTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSK 18220

Query: 901   TSE 903
              SE
Sbjct: 18221 VSE 18223



 Score =  172 bits (435), Expect = 3e-42
 Identities = 170/703 (24%), Positives = 284/703 (40%), Gaps = 123/703 (17%)

Query: 353   YTLRIVSRG--GVSDHSA-FLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTT 409
             Y  R+ +    GV + S   +F R  D L    PG P + +  D +R  V + W  P   
Sbjct: 18600 YEFRVAAENAAGVGEPSEPSVFYRACDALYP--PGPPSNPKVTDTSRSSVSLAWSKPIYD 18657

Query: 410   TESPVMGYFVDRCEVGTNNWVQCNDAP-VKICKYPVTGLFEGRSYIFRVRAVNSAGISRP 468
               +PV GY V+  E   + W  C     ++  ++ VT L E   Y FR+ A+NS G+  P
Sbjct: 18658 GGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEP 18717

Query: 469   SRVSDAVAALDPL---------DLRRLQA----------VHLEGEKEIAIYQDDLEG--- 506
             + +  +V A + +         DLR++            V ++G  E  +  +  EG   
Sbjct: 18718 ATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT 18777

Query: 507   -DAQV--------------------------------------------PGPPTGVHASE 521
               AQ+                                            P  P  +   E
Sbjct: 18778 DRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIRE 18837

Query: 522   ISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKS 580
             + ++ V LSWEPP   G   +  Y +EK      ++  +       +  + + +L EG S
Sbjct: 18838 VKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKTT--FRIENLQEGCS 18895

Query: 581   YVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE-- 638
             Y FRVL++N +G+  P+E T P++   V+  P  PGRV     T+ +  ++W++P+ +  
Sbjct: 18896 YYFRVLASNEYGIGLPAETTEPVK---VSEPPLPPGRVTLVDVTRNTATIKWEKPESDGG 18952

Query: 639   EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQ- 697
               + GY V+    G+  W  C    +      + GLT GE+Y+FRV AVN  G S+  Q 
Sbjct: 18953 SKITGYVVEMQTKGSEKWSTCTQ--VKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQL 19010

Query: 698   ----ESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVH 753
                  +  I+++ ++ +P H + +           L   VP        + +  D + + 
Sbjct: 19011 GVPVIARDIEIKPSVELPFHTFNVKARE------QLKIDVPFKGRPQATVNWRKDGQTL- 19063

Query: 754   HKNWHEVNSSPSKP-TILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPE 812
              K    VN S SK  T L++   ++  +  +++   N AG       S         +  
Sbjct: 19064 -KETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAG-------SITVPITIIVLDR 19115

Query: 813   PGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYL 872
             PGP   +   EV   S+ + W  P Y G   +S Y V+ +E  +  W  V+Q   A   +
Sbjct: 19116 PGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQ-AVARTSI 19174

Query: 873   KVSDLQQGKTYVFRVRAVNANGVGKPSDTSE-----PVLVEARPGTKEI----------- 916
             K+  L  G  Y FRV A N  G    S++S      P      PGT ++           
Sbjct: 19175 KIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVT 19234

Query: 917   -SAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKI 958
                 V++ G+  +G+   E  + S   W K+ + +  D + K+
Sbjct: 19235 WQVPVNDGGSRVIGYHL-EYKERSSILWSKANKILIADTQMKV 19276



 Score =  171 bits (434), Expect = 4e-42
 Identities = 161/542 (29%), Positives = 240/542 (44%), Gaps = 50/542 (9%)

Query: 376  DPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDA 435
            DPL  G P +P  L   +  +  + + WK P +   SP+ GY +++      ++ + N  
Sbjct: 8918 DPL--GPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKR 8975

Query: 436  PVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEK 495
                  + V  L E + Y FRV+AVN  G S PS   + V   D +       + + G+ 
Sbjct: 8976 LCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDT 9035

Query: 496  EIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGS 555
                  + +   A V G P  +   E S+N  V+  E PT    D L   I K  V    
Sbjct: 9036 IKVKAGEPVHIPADVTGLP--MPKIEWSKNETVI--EKPT----DALQ--ITKEEV---- 9081

Query: 556  WQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVV--PS 613
              R  A+T +  P+     + E K   + V ++NR G        S  +   V V   PS
Sbjct: 9082 -SRSEAKTELSIPK----AVREDKG-TYTVTASNRLG--------SVFRNVHVEVYDRPS 9127

Query: 614  APGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNL--WEPCNHKPIGYNRF 669
             P  +  +     S  + WD P      ++  Y +D   A      WE   +  +   R+
Sbjct: 9128 PPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAV-EKRY 9186

Query: 670  VVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTL 729
             +  L    QY FRV+AVN  G+S+   +SD + +Q    +P  P    +L     SM +
Sbjct: 9187 GIWKLIPNGQYEFRVRAVNKYGISDEC-KSDKVVIQDPYRLPGPPGKPKVLARTKGSMLV 9245

Query: 730  GWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSP-----SKPTILTVDGLTEGSLYEFK 784
             W  P  +GGSPI GY+L+KRE     W  V+ +P      K     V  L EG  Y+F+
Sbjct: 9246 SWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFR 9305

Query: 785  IAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPV 844
              A+N AGIG PS+PS+         P PGP       +   +S+ + WK P   G SP+
Sbjct: 9306 AMAINAAGIGPPSEPSDPEVAGDPIFP-PGPPSCPEVKDKTKSSISLGWKPPAKDGGSPI 9364

Query: 845  SGYFVDFREEDAGEWITVNQ----TTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSD 900
             GY V+ +EE   +W  VN+     TT      V +L++ + Y FRV+AVN  G  +PSD
Sbjct: 9365 KGYIVEMQEEGTTDWKRVNEPDKLITTCE--CVVPNLKELRKYRFRVKAVNEAGESEPSD 9422

Query: 901  TS 902
            T+
Sbjct: 9423 TT 9424



 Score =  171 bits (433), Expect = 5e-42
 Identities = 165/648 (25%), Positives = 245/648 (37%), Gaps = 83/648 (12%)

Query: 281   LEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVL--LKESKWTKMFFGEGQA 338
             L+  GV   + G+T+ L+  +   P      P   W +D     L  S   K+      +
Sbjct: 11833 LKLSGVLTVKAGDTIRLEAGVRGKPF-----PEVAWTKDKDATDLTRSPRVKIDTRADSS 11887

Query: 339   SLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDY 398
               S +   + D G Y +   +  G        FV  A   V   PG   +L+  D + D 
Sbjct: 11888 KFSLTKAKRSDGGKYVVTATNTAGS-------FVAYATVNVLDKPGPVRNLKIVDVSSDR 11940

Query: 399   VIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVR 458
               V W PP       +  Y +++CE     W     A V      VT L EG  YIFRVR
Sbjct: 11941 CTVCWDPPEDDGGCEIQNYILEKCETKRMVW-STYSATVLTPGTTVTRLIEGNEYIFRVR 11999

Query: 459   AVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVH 518
             A N  G   P+     +A                            +     PG P    
Sbjct: 12000 AENKIGTGPPTESKPVIA----------------------------KTKYDKPGRPDPPE 12031

Query: 519   ASEISRNYVVLSWEPPT-PRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLME 577
              +++S+  + + W PP    GK    YF+EK    S  W  VN ++A+   R  V +L+ 
Sbjct: 12032 VTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVN-KSAIPERRMKVQNLLP 12090

Query: 578   GKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKH 637
                Y FRV + N  G+ EPS  + P+ A+D    P  P        TK S+ + W +P +
Sbjct: 12091 DHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTKHSITLGWGKPVY 12150

Query: 638   E--EDLLGYYVD-----CCVAGTNLWEPCN-HKPIGYNRFVVHGLTTGEQYIFRVKAVNA 689
             +    ++GY V+        +    W+ CN    +    F V  L   ++Y FRV A N 
Sbjct: 12151 DGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQ 12210

Query: 690   VGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDK 749
             VG+   ++  + IK +  L  P      ++            K+     G PI  + + +
Sbjct: 12211 VGIGRPAELKEAIKPKEILEPPEIDLDASMR-----------KLVIVRAGCPIRLFAIVR 12259

Query: 750   -REVHHKNWHEVN----------SSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSD 798
              R      W +V                   L +   T     ++ +  VN AG      
Sbjct: 12260 GRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAG------ 12313

Query: 799   PSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGE 858
               +        +  PGP  DL   +V  TS  + W  P   G S V+ Y V+ RE D   
Sbjct: 12314 -EKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKT 12372

Query: 859   WITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVL 906
             W TV        +  V++L  G  Y FRV AVN  G G P+D  +PVL
Sbjct: 12373 WSTVTPEVKKTSF-HVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVL 12419



 Score =  171 bits (433), Expect = 5e-42
 Identities = 160/655 (24%), Positives = 271/655 (41%), Gaps = 62/655 (9%)

Query: 364   SDHSAFLFVRDADPL-VTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRC 422
             +++   L  + ADP+ V   P  P  +   D  R+ V ++W  P     S ++ Y V+  
Sbjct: 16739 NEYGIGLPAQTADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQ 16798

Query: 423   EVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLD 482
                +  W +C  A VK  +  +T L +G  Y+FRV AVN  G S P  ++  + A D + 
Sbjct: 16799 AKHSEKWSEC--ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLV- 16855

Query: 483   LRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPL 542
                   +  + +   + Y   +  D ++  P +G       R    ++W           
Sbjct: 16856 ------IEPDVKPAFSSYSVQVGQDLKIEVPISG-------RPKPTITWT---------- 16892

Query: 543   MYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSP 602
                  K  +      R+N   ++     ++ +  +     + +  AN  G     + T+ 
Sbjct: 16893 -----KDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVG-----QKTAS 16942

Query: 603   IQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEE--DLLGYYVDCCVAGTNLWEPCN 660
             I+   +       G V     +  S+ + W+ P +     +  Y V      T +W+  +
Sbjct: 16943 IEIVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVS 17002

Query: 661   HKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLL 720
                +      V  L TG +Y FR+ A N  G S  + ESD I  Q     P  P      
Sbjct: 17003 -ATVARTTLKVTKLKTGTEYQFRIFAENRYGQSF-ALESDPIVAQYPYKEPGPPGTPFAT 17060

Query: 721   NCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSL 780
                  SM + W  P  +GGSP++GY+L+++E +   W +VN +    T      L EG  
Sbjct: 17061 AISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIE 17120

Query: 781   YEFKIAAVNLAGIGEPSDPSEHF----KCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAP 836
             YEF++ A N+ G+G+ S  SE +     C+    PEP          V+   + + W  P
Sbjct: 17121 YEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEP--------IMVKRNEITLQWTKP 17172

Query: 837   VYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANG-V 895
             VY G S ++GY V+ R+   G W+  + T        VS L + + Y FRV A NA G +
Sbjct: 17173 VYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAI 17232

Query: 896   GKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDAS-------QFTWCKSYE 948
              KPSD++ P+  +       IS     +  I +        +A           W +  +
Sbjct: 17233 SKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDK 17292

Query: 949   EISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELER 1003
             EI +  R +I+     + L +K+  + D G Y +  S+  G S SF ++ + L+R
Sbjct: 17293 EIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAG-SKSFPVNVKVLDR 17346



 Score =  170 bits (431), Expect = 8e-42
 Identities = 168/685 (24%), Positives = 281/685 (41%), Gaps = 86/685 (12%)

Query: 305   PDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVS 364
             P + R +P   W +D   LK++    +        L     +KDD G YT+   +  G +
Sbjct: 17962 PVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTA 18021

Query: 365   DHSAFLFVRDADPLVTGAPGAPMD-LQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCE 423
               +  + V +        PG P+  ++  + + D+V+++W+PP  T    +  Y V++ +
Sbjct: 18022 TENLSVIVLEK-------PGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRD 18074

Query: 424   VGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDL 483
               T  W   + A V      +T L  G  Y FR+ A N  G S P               
Sbjct: 18075 TTTTTWHMVS-ATVARTTIKITKLKTGTEYQFRIFAENRYGKSAP--------------- 18118

Query: 484   RRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM 543
                    L+ +  I  Y        + PGPP     + IS++ +++ W  P   G   ++
Sbjct: 18119 -------LDSKAVIVQYP------FKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKII 18165

Query: 544   -YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSP 602
              Y +E+    S  W ++N +T ++  ++    L EG  Y F+V + N  G+ +PS+++  
Sbjct: 18166 GYHLEQKEKNSILWVKLN-KTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSEC 18224

Query: 603   IQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCN 660
               A+D    P  P  ++ +RN   +V ++W +P ++    + GY V+        W   +
Sbjct: 18225 FVARDPCDPPGRPEAIVITRN---NVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKAS 18281

Query: 661   HKPIGYNRFVVHGLTTGEQYIFRVKAVNAVG-MSENSQESDVIKVQAALTVPS----HPY 715
                +    F V GL   ++Y FRV A NA G  SE S  S  I  +  +  P+      Y
Sbjct: 18282 FTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKY 18341

Query: 716   GITLLNCDGHSMTLGWKVPKFSGGSPI--LGYYLDKREVHHKNWH-EVNSSPSKPTILTV 772
                ++   G +  L   +     G PI  + +  D +E+       E+ S+  K T++  
Sbjct: 18342 KDVIVVHAGETFVLEADI----RGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVK 18397

Query: 773   DGL-TEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAY-DLTFCEVRDTSLV 830
             D + T+G  Y  K++ V     G  S P          +  PGP    L    V      
Sbjct: 18398 DCIRTDGGQYILKLSNVG----GTKSIP-----ITVKVLDRPGPPEGPLKVTGVTAEKCY 18448

Query: 831   MLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAV 890
             + W  P+  G + +S Y ++ RE     W  V+    A  Y KV+ L  G  Y+FRV AV
Sbjct: 18449 LAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNY-KVTKLLPGNEYIFRVMAV 18507

Query: 891   NANGVGKPSDTS-----EPVLVEARPGTKEISA------------GVDEQGNIYLGFDCQ 933
             N  G+G+P ++       P      P T E+SA             VD+ G    G+   
Sbjct: 18508 NKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGY-IL 18566

Query: 934   EMTDASQFTWCKSYEEISDDERFKI 958
             E  D     W K  ++   D R ++
Sbjct: 18567 EKRDKEGVRWTKCNKKTLTDLRLRV 18591



 Score =  169 bits (429), Expect = 1e-41
 Identities = 139/511 (27%), Positives = 223/511 (43%), Gaps = 34/511 (6%)

Query: 677   GEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKF 736
             G +YIFRV+AVN  G+ E   ESD +  + A   P  P    +     +SMT+ W  P  
Sbjct: 20661 GNEYIFRVRAVNKYGIGE-PLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIA 20719

Query: 737   SGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEP 796
              GGS I GY+L+KR+     W +V     + T   V GLTE S Y++++ AVN AG G  
Sbjct: 20720 DGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPF 20779

Query: 797   SDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDA 856
             S+PSE +K  A  +  PGP   +   +   +S+ + W  PVY G S V+GY V+ R+ + 
Sbjct: 20780 SEPSEFYKA-ADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEE 20838

Query: 857   GEWITVNQ--TTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTK 914
              EW TV+         Y+ VS+L+ G  Y FRV AVN  G G+P + +EPV  +      
Sbjct: 20839 EEWTTVSTKGEVRTTEYV-VSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAP 20897

Query: 915   EISAGVDEQGNIY--LGFDCQEM-----TDASQFTWCKSYEEISDDERFKIETVGDHSKL 967
             EI   V  + ++    G D Q +           TW K  + +  D R+ IE     S L
Sbjct: 20898 EIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLL 20957

Query: 968   YLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSN-EIKN------------P 1014
              +    + D G Y +++ +  G   S  +  + L+   A    ++K+            P
Sbjct: 20958 TIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPP 21017

Query: 1015  TIPLKSELAYEIFDK--GRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGI 1072
              I   S +   + +K     R W    H     S++ I  D         R+  +   GI
Sbjct: 21018 LIDGGSPIINYVIEKRDATKRTWSVVSHKCSSTSFKLI--DLSEKTPFFFRVLAENEIGI 21075

Query: 1073  IEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHF 1132
              E       ++        I D   K  +   +I    K   +      +  + ++G   
Sbjct: 21076 GEPCETTEPVK-AAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGE 21134

Query: 1133  AEYLHWDVTEECEVRLVCKVANTKKETVFKW 1163
               + H  +++ CE+    +V+  K+++V ++
Sbjct: 21135 QTWSHAGISKTCEI----EVSQLKEQSVLEF 21161



 Score =  169 bits (429), Expect = 1e-41
 Identities = 160/636 (25%), Positives = 264/636 (41%), Gaps = 66/636 (10%)

Query: 302   LVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRG 361
             L  P   + +P   W +D + LKES++ +    E + +LS  +  K+  G YT+      
Sbjct: 21211 LELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTV------ 21264

Query: 362   GVSDHSAFLFVRDADPLVTGAPGAPMD-LQCHDANRDYVIVTWKPPNTTTESPVMGYFVD 420
              + D++          +  G P  P   ++  +   D VI++W  P       +  Y ++
Sbjct: 21265 -ILDNAVCRIAVPITVITLGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIE 21323

Query: 421   RCEVGTNNW-VQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALD 479
             + E    NW + C+       K P   L +   Y FRVRA N  G+S+P   S  VA   
Sbjct: 21324 KRETSQTNWKMVCSSVARTTFKVP--NLVKDAEYQFRVRAENRYGVSQPLVSSIIVA--- 21378

Query: 480   PLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGK 539
                                      +   ++PGPP       ++ + + L+W+ P   G 
Sbjct: 21379 -------------------------KHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGG 21413

Query: 540   DPLMYF-IEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSE 598
               +  F +EK    S  WQ+VN  + +    Y    L+EG  Y FRV + N  GLS PS+
Sbjct: 21414 SEVTGFHVEKKERNSILWQKVNT-SPISGREYRATGLVEGLDYQFRVYAENSAGLSSPSD 21472

Query: 599   ITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLW 656
              +    A      P  P  +  +R T   + ++W+ P  +    ++GY ++    G   W
Sbjct: 21473 PSKFTLAVSPVDPPGTPDYIDVTRET---ITLKWNPPLRDGGSKIVGYSIE-KRQGNERW 21528

Query: 657   EPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVG-MSENSQESDVIKVQAALTVPSHPY 715
               CN   +   ++ V GL+ G++Y FR+ A NAVG +S  SQ S +I  +     P   +
Sbjct: 21529 VRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEF 21588

Query: 716   GITLLNCDGHSMTLG--WKVPKFSGGSPI--LGYYLDKREVHHKNWHEVNSSPSKPTILT 771
             G      DG  +  G   ++     G P+  + ++ D  E+  +   E+       T L 
Sbjct: 21589 GPEYF--DGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGS-TSLF 21645

Query: 772   VDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAY-DLTFCEVRDTSLV 830
             V   T      + + A N +G       S   + +      PG     + F  +    + 
Sbjct: 21646 VRDATRDHRGVYTVEAKNASG-------SAKAEIKVKVQDTPGKVVGPIRFTNITGEKMT 21698

Query: 831   MLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAV 890
             + W AP+  G +P++ Y ++ RE     W  +     A  Y  +  L  G  Y FRV AV
Sbjct: 21699 LWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIK-LINGNEYQFRVSAV 21757

Query: 891   NANGVGKPSDTSEPVLVEARPGTKEISAGVDEQGNI 926
             N  GVG+P D S+PV+ + +  T   + G+ E  NI
Sbjct: 21758 NKFGVGRPLD-SDPVVAQIQ-YTVPDAPGIPEPSNI 21791



 Score =  169 bits (427), Expect = 2e-41
 Identities = 159/618 (25%), Positives = 253/618 (40%), Gaps = 50/618 (8%)

Query: 382   APGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICK 441
             AP  P  L   D  +  V + W  P     S + GY ++    G++ W       VK  +
Sbjct: 14592 APSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITT--VKGLE 14649

Query: 442   YPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQ 501
               V  L EG  Y F+V AVNSAG S P R S  V   +   L  L    +  +  IA   
Sbjct: 14650 CVVRNLTEGEEYTFQVMAVNSAGRSAP-RESRPVIVKEQTMLPELDLRGIYQKLVIAKAG 14708

Query: 502   DDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNA 561
             D+++ +  V G P              ++W+    +G   L              QRVN 
Sbjct: 14709 DNIKVEIPVLGRPKPT-----------VTWK----KGDQILK-----------QTQRVNF 14742

Query: 562   QTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLAS 621
             +T   S    + + +   S  + + + N  G  E  ++ + IQ  D+   P+ P  +   
Sbjct: 14743 ETTATSTILNINECVRSDSGPYPLTARNIVG--EVGDVIT-IQVHDIPGPPTGP--IKFD 14797

Query: 622   RNTKTSVVVQWDRPKHEED--LLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQ 679
               +   V   WD P+++    +  Y V+     +  W       I    +    LTTG +
Sbjct: 14798 EVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTVIR-TTYKATRLTTGLE 14856

Query: 680   YIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGG 739
             Y FRVKA N  G+      + ++       VP  P    +      SMT+ W  P   GG
Sbjct: 14857 YQFRVKAQNRYGVGPGITSACIV-ANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGG 14915

Query: 740   SPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDP 799
             SPILGY+++++E +   W  V+ +     I    GLT+G  YEF++ A N+AG  +PS P
Sbjct: 14916 SPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKP 14975

Query: 800   SEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEW 859
             SE         P PG    L    +   ++ + W  P Y+G   ++ Y V+ R+   G W
Sbjct: 14976 SEPMLALDPIDP-PGKPVPL---NITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRW 15031

Query: 860   ITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANG-VGKPSDTSEPVLVEARPGTKEISA 918
             +  N +        VS L +   Y FRV A NA G +  PS+ S+ +         +I  
Sbjct: 15032 LKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKV 15091

Query: 919   GVDEQGNIYL--GFDCQEMTDAS-----QFTWCKSYEEISDDERFKIETVGDHSKLYLKN 971
              V  +  + L  G   +   D S        W K  +E+    + +I+     + L  K+
Sbjct: 15092 DVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKD 15151

Query: 972   PDKEDLGTYSVSVSDTDG 989
               + D G Y+++ ++  G
Sbjct: 15152 STRRDSGAYTLTATNPGG 15169



 Score =  168 bits (426), Expect = 3e-41
 Identities = 145/581 (24%), Positives = 244/581 (41%), Gaps = 63/581 (10%)

Query: 335  EGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDA 394
            +G++ L      + D GLY +++ +  G++     + V D        PG P++    D 
Sbjct: 8389 KGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDT-------PGPPINFVFEDI 8441

Query: 395  NRDYVIVTWKPPNTTTESPVMGYFVDRCE--VGTNNWVQCNDAPVKICKYPVTGLFEGRS 452
             +  V+  W+PP     S ++ Y +++ +     + W+    + ++ CKY VT L EG+ 
Sbjct: 8442 RKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVT-STLRHCKYSVTKLIEGKE 8500

Query: 453  YIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPG 512
            Y+FRVRA N  G   P  VS  + A DP                         G    P 
Sbjct: 8501 YLFRVRAENRFGPGPPC-VSKPLVAKDPF------------------------GPPDAPD 8535

Query: 513  PPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAV 572
             P      +++ N +++ W  P   G   L Y++EK  V S  W RVN ++ + + +  V
Sbjct: 8536 KPI---VEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVN-KSLLNALKANV 8591

Query: 573  FDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQW 632
              L+EG +YVFRV + N  G  + S  + P  A D  + P  P     +  + T++ ++W
Sbjct: 8592 DGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTAHD-PISPPGPPIPRVTDTSSTTIELEW 8650

Query: 633  DRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAV 690
            + P      +++GY+VD  + GTN W  C  K I   ++ V  +  G  Y  RV AVNA 
Sbjct: 8651 EPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAA 8710

Query: 691  GMSENSQESDVIKVQAALTVPSHPYGITL-LNCDGHSMTLGWK---VPKFSGGSPILGYY 746
            G     +   V      +  P  P  + L ++  G    +  K   +P    G P+    
Sbjct: 8711 GEGPPGETQPV-----TVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKV 8765

Query: 747  LDKREVH-HKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
              K E    K+   +++  +K  ++  D L +     + I A N  G       S+    
Sbjct: 8766 WTKEEGELDKDRVVIDNVGTKSELIIKDALRKDH-GRYVITATNSCG-------SKFAAA 8817

Query: 806  EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQT 865
                   PGP  DL          ++ W  P   G S ++G+ ++ ++     W    +T
Sbjct: 8818 RVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIET 8877

Query: 866  TTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVL 906
              +     ++ L +G+ Y FRV A N  G G P +   P+L
Sbjct: 8878 ERSK--CDITGLLEGQEYKFRVIAKNKFGCGPPVEIG-PIL 8915



 Score =  167 bits (424), Expect = 5e-41
 Identities = 156/610 (25%), Positives = 250/610 (40%), Gaps = 58/610 (9%)

Query: 305   PDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVS 364
             P L R +P   W + D +LK+++            L+ +   + D G Y L   +R  V 
Sbjct: 14716 PVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPL--TARNIVG 14773

Query: 365   DHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEV 424
             +    + ++  D  + G P  P+     + + D+V  +W PP      P+  Y V+  + 
Sbjct: 14774 EVGDVITIQVHD--IPGPPTGPIKFD--EVSSDFVTFSWDPPENDGGVPISNYVVEMRQT 14829

Query: 425   GTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLR 484
              +  WV+     ++   Y  T L  G  Y FRV+A N  G+  P   S  + A  P    
Sbjct: 14830 DSTTWVELATTVIR-TTYKATRLTTGLEYQFRVKAQNRYGVG-PGITSACIVANYPF--- 14884

Query: 485   RLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM- 543
                                     +VPGPP     + ++++ + +SW  P   G  P++ 
Sbjct: 14885 ------------------------KVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILG 14920

Query: 544   YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPI 603
             Y +E+       WQ V ++  V    +    L +G +Y FRV++ N  G S+PS+ + P+
Sbjct: 14921 YHVERKERNGILWQTV-SKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPM 14979

Query: 604   QAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEE--DLLGYYVDCCVAGTNLWEPCNH 661
              A D       PG+ +    T+ +V ++W +P++     +  Y V+        W   N 
Sbjct: 14980 LALDPI---DPPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANF 15036

Query: 662   KPIGYNRFVVHGLTTGEQYIFRVKAVNAVG-MSENSQESDVIKVQAALTVPSHPYGI--- 717
               I  N F V GLT    Y FRV A NA G +S  S+ SD I  +  +  P     +   
Sbjct: 15037 SNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFK 15096

Query: 718   -TLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLT 776
              T++   G +  L   V       P + +  D +E+      E+  +     ++  D  T
Sbjct: 15097 DTVILKAGEAFRLEADVS--GRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDS-T 15153

Query: 777   EGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAP 836
                   + + A N  G  +       F  +    P P P   L   EV     V+ W  P
Sbjct: 15154 RRDSGAYTLTATNPGGFAK-----HIFNVKVLDRPGP-PEGPLAVTEVTSEKCVLSWFPP 15207

Query: 837   VYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVG 896
             +  G + +  Y V  RE     W  V       + LKV+ L +G  Y+FRV AVN  GVG
Sbjct: 15208 LDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTK-LKVTKLLKGNEYIFRVMAVNKYGVG 15266

Query: 897   KPSDTSEPVL 906
             +P + SEPVL
Sbjct: 15267 EPLE-SEPVL 15275



 Score =  167 bits (424), Expect = 5e-41
 Identities = 158/611 (25%), Positives = 256/611 (41%), Gaps = 64/611 (10%)

Query: 309   RVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSA 368
             R +P   W +D + LK++    +       +LS    HKDD G Y + + +  G    S 
Sbjct: 16884 RPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASI 16943

Query: 369   FLFVRDA-DPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTN 427
              +   D  DP     P  P+     D + + + ++W PP  T    +  Y V + +  T 
Sbjct: 16944 EIVTLDKPDP-----PKGPVKFD--DVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTT 16996

Query: 428   NWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQ 487
              W     A V      VT L  G  Y FR+ A N  G                      Q
Sbjct: 16997 VW-DVVSATVARTTLKVTKLKTGTEYQFRIFAENRYG----------------------Q 17033

Query: 488   AVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFI 546
             +  LE +  +A Y        + PGPP    A+ IS++ +V+ W  P   G  P++ Y +
Sbjct: 17034 SFALESDPIVAQYP------YKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHL 17087

Query: 547   EKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQ 606
             E+    S  W +VN +T +   ++   +L EG  Y FRV + N  G+ + S+ +    A+
Sbjct: 17088 ERKERNSILWTKVN-KTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVAR 17146

Query: 607   DVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEED--LLGYYVDCCVAGTNLWEPCNHKPI 664
             D    P  P  ++  RN    + +QW +P ++    + GY V+        W   +   +
Sbjct: 17147 DPCDPPGTPEPIMVKRN---EITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNV 17203

Query: 665   GYNRFVVHGLTTGEQYIFRVKAVNAVG-MSENSQESDVIKVQAALTVP----SHPYGITL 719
                +F V GLT  ++Y FRV A NA G +S+ S  +  I  +  + +P       +  T+
Sbjct: 17204 IETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTI 17263

Query: 720   LNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGL-TEG 778
             +   G +  L  +        P + +    +E+      E+ ++  K  ++  D +  +G
Sbjct: 17264 VVNAGETFRL--EADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDG 17321

Query: 779   SLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAY-DLTFCEVRDTSLVMLWKAPV 837
               Y  +  A N+AG       S+ F      +  PGP    +    V      + W  P+
Sbjct: 17322 GQYILR--ASNVAG-------SKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPPL 17372

Query: 838   YSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGK 897
               G S +S Y V+ RE     W  V      N  LKV+ L +G  YVFR+ AVN  GVG+
Sbjct: 17373 QDGGSDISHYVVEKRETSRLAWTVVASEVVTNS-LKVTKLLEGNEYVFRIMAVNKYGVGE 17431

Query: 898   PSDTSEPVLVE 908
             P + S PVL++
Sbjct: 17432 PLE-SAPVLMK 17441



 Score =  167 bits (423), Expect = 7e-41
 Identities = 161/636 (25%), Positives = 268/636 (42%), Gaps = 74/636 (11%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
             PG P+ L   +  R  V + W  P  T    +  Y V++ ++    W++ N + +   ++
Sbjct: 14988 PGKPVPL---NITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEF 15044

Query: 443   PVTGLFEGRSYIFRVRAVNSAG-ISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQ 501
              V+GL E  +Y FRV A N+AG IS PS  SDA+   D ++  +++ V ++ +  + +  
Sbjct: 15045 TVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIK-VDVKFKDTVILKA 15103

Query: 502   DD---LEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQR 558
              +   LE D     PPT             + W       +      I+   +   S   
Sbjct: 15104 GEAFRLEADVSGRPPPT-------------MEWSKDGKELEGTAKLEIK---IADFSTNL 15147

Query: 559   VNAQTAVR-SPRYAVFDLMEG--KSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAP 615
             VN  +  R S  Y +     G    ++F V   +R G  E                    
Sbjct: 15148 VNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPE-------------------- 15187

Query: 616   GRVLASRNTKTSVVVQWDRPKHEEDL-LGYYV-----DCCVAGTNLWEPCNHKPIGYNRF 669
             G +  +  T    V+ W  P  +    + +Y+        +A TN+        +   + 
Sbjct: 15188 GPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNV-----ASEVQVTKL 15242

Query: 670   VVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTL 729
              V  L  G +YIFRV AVN  G+ E  +   V+ V      P  P    +      SM +
Sbjct: 15243 KVTKLLKGNEYIFRVMAVNKYGVGEPLESEPVLAVNP-YGPPDPPKNPEVTTITKDSMVV 15301

Query: 730   GWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVN 789
              W  P   GGS I+ Y +++R+   + W + N          V GLTEG  YEF+I A N
Sbjct: 15302 CWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAEN 15361

Query: 790   LAGIGEPSDPSEHFK-CEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYF 848
              AGI  PS  S  +K C+  T+ +PGP  +    +   +S+ + W  P+Y G S ++GY 
Sbjct: 15362 AAGISAPSPTSPFYKACD--TVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYM 15419

Query: 849   VDFR--EEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVL 906
             V+    EED  + +T      A  Y  ++ L + + Y  R+ A+N+ G+G+P+       
Sbjct: 15420 VEIALPEEDEWQIVTPPAGLKATSY-TITGLTENQEYKIRIYAMNSEGLGEPALVPGTPK 15478

Query: 907   VEARPGTKEISAGVDEQGNIYLGFDCQ-------EMTDASQFTWCKSYEEISDDERFKIE 959
              E R    EI    D +  + +   C        +   A +  W + + E  D  +  IE
Sbjct: 15479 AEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLD--KASIE 15536

Query: 960   TVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
             +   ++ L + N ++ D G Y ++V ++ G  S+FV
Sbjct: 15537 STSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFV 15572



 Score =  167 bits (422), Expect = 9e-41
 Identities = 157/616 (25%), Positives = 246/616 (39%), Gaps = 58/616 (9%)

Query: 309   RVQPRAEWYR---DDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSD 365
             R  P+  W +   D+V+ K     ++   +  A L   +  +DD G Y+L +V+  G  +
Sbjct: 12261 RPAPKVTWRKVGIDNVVRKG----QVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAG--E 12314

Query: 366   HSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVG 425
              + F+ VR  D      PG   DL+  D  +    V+W PP     S V  Y V++ E  
Sbjct: 12315 KAVFVNVRVLD-----TPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREAD 12369

Query: 426   TNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRR 485
                W       VK   + VT L  G  Y FRV AVN  G   P+ V   V A DPL    
Sbjct: 12370 RKTWSTVTPE-VKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPL---- 12424

Query: 486   LQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYF 545
                                      P PP  +  +E+++N   L+W PP   G   +  +
Sbjct: 12425 -----------------------SEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGY 12461

Query: 546   IEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQA 605
             I           R    + V+     V  L EGK Y FRV + N  G+S P E     +A
Sbjct: 12462 ITSYREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEA 12521

Query: 606   QDVTVVPS--APGRVLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNHKP 663
             ++  + P    P ++      K  +        H         D  V  ++L     HK 
Sbjct: 12522 KEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHL---AVHKA 12578

Query: 664   IGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCD 723
                +  ++  +T  +   + + A N+ G   ++Q+  V+ V  A   P  P+ I+  + D
Sbjct: 12579 DSSSILIIKDVTRKDSGYYSLTAENSSG--TDTQKIKVV-VMDAPGPPQPPFDIS--DID 12633

Query: 724   GHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEF 783
               + +L W +P   GGS I  Y ++K +V   +W    +S +K T   V  L  G  Y F
Sbjct: 12634 ADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTK-TSCRVGKLIPGQEYIF 12692

Query: 784   KIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSP 843
             ++ A N  GI EP    +      +    P    +    +V    + + W  P   G SP
Sbjct: 12693 RVRAENRFGISEPLTSPK--MVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSP 12750

Query: 844   VSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSE 903
             + GY ++ +E ++  W+  N T   +     + L +G  Y FR+ A+N  G   PS  +E
Sbjct: 12751 IIGYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTE 12810

Query: 904   PVLVEA---RPGTKEI 916
              V        PG  E+
Sbjct: 12811 YVTARMPVDPPGKPEV 12826



 Score =  166 bits (420), Expect = 2e-40
 Identities = 155/611 (25%), Positives = 243/611 (39%), Gaps = 63/611 (10%)

Query: 312   PRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLF 371
             P  +W + D  L  +   ++   +   SLS     + D G Y L+  +  G    +  + 
Sbjct: 16201 PTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVK 16260

Query: 372   VRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQ 431
             V D      G P  P+ +    A +    + WKPP     S ++ Y V+R E     W  
Sbjct: 16261 VLDRP----GPPEGPVVISGVTAEK--CTLAWKPPLQDGGSDIINYIVERRETSRLVWTV 16314

Query: 432   CNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHL 491
               DA V+     VT L EG  Y FR+ AVN  G+  P   S+ V A +P           
Sbjct: 16315 V-DANVQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLE-SEPVVAKNPF---------- 16362

Query: 492   EGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWE-PPTPRGKDPLMYFIEKSV 550
                               VP  P     + ++++ +++ WE P +  G + L Y +EK  
Sbjct: 16363 -----------------VVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVLEKRD 16405

Query: 551   VGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTV 610
                  W R + +  +   R  V  L+E   Y FRV + N  GLSEPS  ++  +A D   
Sbjct: 16406 KEGIRWTRCHKRL-IGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACDPIY 16464

Query: 611   VPSAPGRVLASRNTKTSVVVQWDRPKHEE--DLLGYYVDCCVAGTNLWEPCNHKPIGYNR 668
              P  P        T++SV + W +P ++   ++ GY V+ C      W  C   P G N+
Sbjct: 16465 KPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCT-PPTGINK 16523

Query: 669   --FVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHS 726
                 V  L    +Y FR+ A+N  G+ E++     I V+  L  P     + L       
Sbjct: 16524 TNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKI---- 16579

Query: 727   MTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIA 786
                   +   +GGS  L   +  R      W +V+       I+ V      S     + 
Sbjct: 16580 ------INIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDV----TSSFTSLVLD 16629

Query: 787   AVNLAGIG------EPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSG 840
              VN    G      E S  ++        +  P P  +L   E+   S+ + W+ P+  G
Sbjct: 16630 NVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDG 16689

Query: 841   SSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSD 900
              S +  Y V+ RE     +  V      N + K+  LQ+G +Y FRV A N  G+G P+ 
Sbjct: 16690 GSKIKNYIVEKREATRKSYAAVVTNCHKNSW-KIDQLQEGCSYYFRVTAENEYGIGLPAQ 16748

Query: 901   TSEPVLVEARP 911
             T++P+ V   P
Sbjct: 16749 TADPIKVAEVP 16759



 Score =  165 bits (418), Expect = 3e-40
 Identities = 154/563 (27%), Positives = 231/563 (41%), Gaps = 60/563 (10%)

Query: 376   DPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDA 435
             DP+   AP  P   +  D  +    + W PP     S V GY V+  E G   W +  D 
Sbjct: 10045 DPI---APPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDK 10101

Query: 436   PVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEK 495
              V+  K  VTGL EG  Y FRVRAVN AGI  P  V+D +   D L              
Sbjct: 10102 EVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRL-------------- 10147

Query: 496   EIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGS 555
                    DL+ DA V      VHA  + R    +S +PP       + + + +  +    
Sbjct: 10148 ----VSPDLQLDASVRDRIV-VHAGGVIRIIAYVSGKPPPT-----VTWNMNERTLP--- 10194

Query: 556   WQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAP 615
              Q    +T   S    + +       V+ +L+ N  G  + + I       DV  VP   
Sbjct: 10195 -QEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIV------DVLDVPGPV 10247

Query: 616   GRVLASRN-TKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVH 672
             G    + N T  S  + W  P+ +    +  Y ++   +    W P  +     N   V 
Sbjct: 10248 GTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNA-TVQ 10306

Query: 673   GLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWK 732
             GL  G+ Y FR+ A N++GM    + S+ + ++  +TVP  P  + +     +++TL W 
Sbjct: 10307 GLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWN 10366

Query: 733   VPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAG 792
              PK+ GGS I+ Y L+ R +  + +H+V +        TV GL EG  YE++++AVN+ G
Sbjct: 10367 PPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVG 10426

Query: 793   IGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPV----YSGS-SPVSGY 847
              G+PS  ++   C+    P   P   L F   RD   + + +A      YSG   P   +
Sbjct: 10427 QGKPSFCTKPITCKDELAP---PTLHLDF---RDKLTIRVGEAFALTGRYSGKPKPKVSW 10480

Query: 848   FVDFRE--EDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPV 905
             F D  +  ED    I     T A   +K      GK  V     V  N  G      +  
Sbjct: 10481 FKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCV-----VVENSTGSRKGFCQVN 10535

Query: 906   LVEARPGTKEISAGVDEQGNIYL 928
             +V+ RPG        DE    Y+
Sbjct: 10536 VVD-RPGPPVGPVSFDEVTKDYM 10557



 Score =  162 bits (410), Expect = 2e-39
 Identities = 182/806 (22%), Positives = 327/806 (40%), Gaps = 96/806 (11%)

Query: 153   APEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVH 212
             AP I   ++  T     + +L   + G P P ++WY+ G  + Q+    KY++ S+   H
Sbjct: 24160 APGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSR---KYKMSSDGRTH 24216

Query: 213   TLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIP 272
             TL +   + +D   Y+ +ATN  G+V T++ ++++                        P
Sbjct: 24217 TLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQA----------------------TP 24254

Query: 273   YTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMF 332
               H      EK+   +   G T+ L    +  P      P   W+    LL+ S+   + 
Sbjct: 24255 QFHPGYPLKEKY---YGAVGSTLRLHVMYIGRP-----VPAMTWFHGQKLLQNSENITIE 24306

Query: 333   FGEGQASLSFSHLH-KDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQC 391
               E    L   ++  K   G Y +++ +  G  D    + ++D     TG    P+ ++ 
Sbjct: 24307 NTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTG----PIVIEA 24362

Query: 392   HDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGR 451
                N    +++WKPP     S +  Y V++CE       Q   + + +    +  L E  
Sbjct: 24363 LLKNS--AVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENA 24420

Query: 452   SYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVP 511
              Y FRV A N+ GIS P  VS  V    P +                            P
Sbjct: 24421 GYYFRVSAQNTFGISDPLEVSSVVIIKSPFEK---------------------------P 24453

Query: 512   GPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRY 570
             G P     + ++++  V++W+PP   G   +  Y++EK       W  V  +  +R   +
Sbjct: 24454 GAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEE-IRETVF 24512

Query: 571   AVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQ-DVTVVPSAPGRVLASRNTK--TS 627
             +V +L+EG  Y FRV   N  G SE SEI+ PI  + DV +        L + N +  ++
Sbjct: 24513 SVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSN 24572

Query: 628   VVVQWDRPKHEEDLLGYYVDCC-VAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKA 686
               +      H + ++ +Y     +    L         GY++ ++  +T  +  +++V+A
Sbjct: 24573 ATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRA 24632

Query: 687   VNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNC-DGHSMTLGWKVPKFSGGSPILGY 745
              N  G S +   S  ++V A + +P    G+  ++   G  +++  K+P      P++ +
Sbjct: 24633 TNQGG-SVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSI--KIPFSGKPDPVITW 24689

Query: 746   YLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
                +  + +   ++V  + S  +++  +G+       + + A N  GI + +        
Sbjct: 24690 QKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKT-------V 24742

Query: 806   EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQT 865
             E      P P   +   +V   S+ + W  P   G S ++ Y V+     A  W+ V Q 
Sbjct: 24743 ELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQ- 24801

Query: 866   TTANRYLKVSDLQQGKT-YVFRVRAVNANGVGKPSDTSEPVLV-EARPGTKEISAGVDEQ 923
                 RY  ++    GKT Y FRV A N  G+ KPS+ SEP +  E +         VDE 
Sbjct: 24802 ARETRYTVINLF--GKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDET 24859

Query: 924   GNIYLGFDCQEMTDASQFTWCKSYEE 949
               +        MT AS  +  + YE+
Sbjct: 24860 REV-------SMTKASHSSTKELYEK 24878



 Score =  161 bits (408), Expect = 4e-39
 Identities = 155/638 (24%), Positives = 255/638 (39%), Gaps = 72/638 (11%)

Query: 383   PGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKY 442
             PG P +L   D  + +V + W+ P+    SP + Y V+R   G+++W + +   +K   Y
Sbjct: 11729 PGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHY 11788

Query: 443   PVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALD----PLDLRRLQAVHLEGEKEIA 498
              V    E + Y FRV+  N  G S   +  + V   D     LDL+    + ++    I 
Sbjct: 11789 MVDRCVENQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIR 11848

Query: 499   IYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQR 558
             +       +A V G P           +  ++W               +K         R
Sbjct: 11849 L-------EAGVRGKP-----------FPEVAWTK-------------DKDATDLTRSPR 11877

Query: 559   VNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRV 618
             V   T   S ++++          + V + N  G            A     V   PG V
Sbjct: 11878 VKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAG---------SFVAYATVNVLDKPGPV 11928

Query: 619   LASRNTKTSVV------VQWDRPKHEE--DLLGYYVDCCVAGTNLWEPCNHKPIGYNRFV 670
                RN K   V      V WD P+ +   ++  Y ++ C     +W   +   +     V
Sbjct: 11929 ---RNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTV 11985

Query: 671   VHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLG 730
                L  G +YIFRV+A N +G    ++   VI  +     P  P    +       MT+ 
Sbjct: 11986 TR-LIEGNEYIFRVRAENKIGTGPPTESKPVI-AKTKYDKPGRPDPPEVTKVSKEEMTVV 12043

Query: 731   WKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNL 790
             W  P++ GG  I GY+L+K+E H   W  VN S      + V  L     Y+F++ A N 
Sbjct: 12044 WNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENE 12103

Query: 791   AGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVD 850
              GIGEPS PS     +    P PGP  +    +    S+ + W  PVY G +P+ GY V+
Sbjct: 12104 IGIGEPSLPSRPVVAKDPIEP-PGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVE 12162

Query: 851   FREEDAGE-----WITVNQTT-TANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEP 904
              R + A       W   N       +   V+ L + + Y FRV A N  G+G+P++  E 
Sbjct: 12163 MRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEA 12222

Query: 905   VLVE--ARPGTKEISAGVDEQGNIYLG-----FDCQEMTDASQFTWCKSYEEISDDERFK 957
             +  +    P   ++ A + +   +  G     F       A + TW K   + +   + +
Sbjct: 12223 IKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGID-NVVRKGQ 12281

Query: 958   IETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFV 995
             ++ V   + L + N  ++D G YS+++ +  G  + FV
Sbjct: 12282 VDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFV 12319



 Score =  161 bits (407), Expect = 5e-39
 Identities = 157/614 (25%), Positives = 257/614 (41%), Gaps = 62/614 (10%)

Query: 305   PDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVS 364
             P + R  P   W++D+V LK++        E  + L+     ++D G Y +++ +  G +
Sbjct: 15798 PFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEA 15857

Query: 365   DHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEV 424
               +  + V D      G P  P+ +   +   D + ++W PP     S +  Y V++ + 
Sbjct: 15858 IETLNVIVLDKP----GPPTGPVKMD--EVTADSITLSWGPPKYDGGSSINNYIVEKRDT 15911

Query: 425   GTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLR 484
              T  W Q   A V         L  G  Y FR+ A N  G                    
Sbjct: 15912 STTTW-QIVSATVARTTIKACRLKTGCEYQFRIAAENRYG-------------------- 15950

Query: 485   RLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSW-EPPTPRGKDPLM 543
               ++ +L  E  +A Y        +VPGPP     +  SR+ + + W EP +  G   + 
Sbjct: 15951 --KSTYLNSEPTVAQYP------FKVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIG 16002

Query: 544   YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPI 603
             Y +E+    S  W ++N +T +   ++    L EG  Y FRV + N  G+ +PS+++   
Sbjct: 16003 YHLERKERNSILWVKLN-KTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECY 16061

Query: 604   QAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNH 661
              A+D    P  P  ++ +RN   SV +QW +P ++    + GY V+        W   + 
Sbjct: 16062 VARDPCDPPGRPEAIIVTRN---SVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASF 16118

Query: 662   KPIGYNRFVVHGLTTGEQYIFRVKAVNAVGM-SENSQESDVIKVQAALTVP----SHPYG 716
               I    F V GL    +Y FRV A NA G+ SE S+ +  I  +  +  P       Y 
Sbjct: 16119 TNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYK 16178

Query: 717   ITLLNCDGHSMTLGWKVPKFSGGSPI--LGYYLDKREVHHKNWHEVNSSPSKPTILTVDG 774
              T++   G S    +KV     G PI  + +    +E+ +    E+ S+    ++   D 
Sbjct: 16179 DTIVVHAGES----FKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDA 16234

Query: 775   LTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWK 834
             +   S   + + A N+AG     + S     +    P P P   +    V      + WK
Sbjct: 16235 VRVDS-GNYILKAKNVAG-----ERSVTVNVKVLDRPGP-PEGPVVISGVTAEKCTLAWK 16287

Query: 835   APVYSGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANG 894
              P+  G S +  Y V+ RE     W TV          KV+ L +G  Y FR+ AVN  G
Sbjct: 16288 PPLQDGGSDIINYIVERRETSRLVW-TVVDANVQTLSCKVTKLLEGNEYTFRIMAVNKYG 16346

Query: 895   VGKPSDTSEPVLVE 908
             VG+P + SEPV+ +
Sbjct: 16347 VGEPLE-SEPVVAK 16359



 Score =  160 bits (406), Expect = 6e-39
 Identities = 164/646 (25%), Positives = 251/646 (38%), Gaps = 84/646 (13%)

Query: 291  EGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDE 350
            EGE +++       P      P   W++D   +K S    M      A L      + D 
Sbjct: 8028 EGEKLSIPVPFRAVP-----VPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADA 8082

Query: 351  GLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTT 410
            G+YT+ + ++ G +  S        +  V G PG   D++  D  +    +TW+PP    
Sbjct: 8083 GIYTITLENKLGSATASI-------NVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDG 8135

Query: 411  ESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSR 470
             +P++ Y ++R E G   ++       K+  + V  L     Y FRV+AVN  G      
Sbjct: 8136 GTPILHYVLERREAGRRTYIPVMSGENKL-SWTVKDLIPNGEYFFRVKAVNKVGGGEYIE 8194

Query: 471  VSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLS 530
            + + V A DP                            Q P PP  V     +   + ++
Sbjct: 8195 LKNPVIAQDP---------------------------KQPPDPPVDVEVHNPTAEAMTIT 8227

Query: 531  WEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSAN 589
            W+PP   G   +M Y IEK   G   W+R N +  V    Y    L EGK Y FRV + N
Sbjct: 8228 WKPPLYDGGSKIMGYIIEKIAKGEERWKRCN-EHLVPILTYTAKGLEEGKEYQFRVRAEN 8286

Query: 590  RHGLSEPSEITSPIQAQDVTVVPSAPGRVL------------ASRNTKTSVVVQWDR--- 634
              G+SEPS  T P +A D    P    R              AS +      + W +   
Sbjct: 8287 AAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYPTITWIKDEN 8346

Query: 635  ---PKHEEDLLGYYVDCCVAGTNLWEP----------CNHKPIGYNRFVVHGLTTGEQYI 681
               P+  +      V          EP           ++   G ++  V      +  +
Sbjct: 8347 VIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGL 8406

Query: 682  FRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSP 741
            + +K  N  G+++      V      L  P  P      +    S+   W+ P   GGS 
Sbjct: 8407 YMIKVENDHGIAKAPCTVSV------LDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGSE 8460

Query: 742  ILGYYLDKRE--VHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDP 799
            I+ Y L+K++       W  V S+  +    +V  L EG  Y F++ A N  G G P   
Sbjct: 8461 IINYTLEKKDKTKPDSEWIVVTST-LRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVS 8519

Query: 800  SEHFKCEAWTMPEPGPAYDLTFCE-VRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGE 858
                  + +  P+   A D    E V   S+++ W  P  +G SP+ GY+++ RE ++  
Sbjct: 8520 KPLVAKDPFGPPD---APDKPIVEDVTSNSMLVKWNEPKDNG-SPILGYWLEKREVNSTH 8575

Query: 859  WITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEP 904
            W  VN++        V  L +G TYVFRV A NA G GK S  S+P
Sbjct: 8576 WSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDP 8621



 Score =  158 bits (399), Expect = 4e-38
 Identities = 128/444 (28%), Positives = 198/444 (44%), Gaps = 35/444 (7%)

Query: 511  PGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPR 569
            P  P  +   +I+++ V L+WEPP   G  PL  Y +EK  V   +W +V     V    
Sbjct: 7116 PSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV--MDFVTDLE 7173

Query: 570  YAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV 629
            + V DL++GK Y+F+V + N+ G  EP+ +  P+       VP  P  V     T  S+ 
Sbjct: 7174 FTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWRDRTANSIF 7233

Query: 630  VQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAV 687
            + WD PK++    + GY V+ C  G++ W  C  +P+   +  V GL  G+ Y +RVKA+
Sbjct: 7234 LTWDPPKNDGGSRIKGYIVERCPRGSDKWVACG-EPVAETKMEVTGLEEGKWYAYRVKAL 7292

Query: 688  NAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKV--PKFSGGSPILGY 745
            N  G S+ S+ ++ I+       P     + LL   G ++  G K+  P    G P    
Sbjct: 7293 NRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLL--AGLTVKAGTKIELPATVTGKPEPKI 7350

Query: 746  YLDKREVHHKNWHE--VNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHF 803
               K ++  K      + + P K T+  VD         + I AVN+ G           
Sbjct: 7351 TWTKADMILKQDKRITIENVPKKSTVTIVDS-KRSDTGTYIIEAVNVCGRATA------- 7402

Query: 804  KCEAWTMPEPGP--AYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWIT 861
              E   + +PGP  A+D+T  +V + S ++ W  P   G S ++ Y V+ R  D+  W  
Sbjct: 7403 VVEVNVLDKPGPPAAFDIT--DVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHK 7460

Query: 862  VNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISAGVD 921
            ++ T     + K + L   K Y+FRV A N  GVG+P        V+A P T +     D
Sbjct: 7461 LSSTVKDTNF-KATKLIPNKEYIFRVAAENMYGVGEP--------VQASPITAKYQ--FD 7509

Query: 922  EQGNIYLGFDCQEMTDASQFTWCK 945
              G            DA   TWC+
Sbjct: 7510 PPGPPTRLEPSDITKDAVTLTWCE 7533



 Score =  157 bits (397), Expect = 7e-38
 Identities = 168/638 (26%), Positives = 259/638 (40%), Gaps = 70/638 (10%)

Query: 372   VRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQ 431
             V+ A+P     P  P  +   D ++    + W+ P     S V+GY V+    GT  W  
Sbjct: 17835 VKAAEP-----PSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSI 17889

Query: 432   CNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHL 491
               ++  K+C   VTGL  G+ Y FRV+A N  G S P  +   V A D   L    ++ L
Sbjct: 17890 VAES--KVCNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKD---LTIQPSLKL 17944

Query: 492   EGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVV 551
                       +DL+ +  V G P              +SW     +  +PL         
Sbjct: 17945 PFNTYSIQAGEDLKIEIPVIGRPRPN-----------ISWV----KDGEPLK-------- 17981

Query: 552   GSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVF---RVLSANRHGLSEPSEITSPIQAQDV 608
                   RVN +    S    V  + EG    F    V + N  G +  +E  S I    V
Sbjct: 17982 ---QTTRVNVEETATS---TVLHIKEGNKDDFGKYTVTATNSAGTA--TENLSVI----V 18029

Query: 609   TVVPSAP-GRVLASRNTKTSVVVQWDRPKHEE--DLLGYYVDCCVAGTNLWEPCNHKPIG 665
                P  P G V     +   VV+ W+ P +     +  Y V+     T  W   +   + 
Sbjct: 18030 LEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVS-ATVA 18088

Query: 666   YNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGH 725
                  +  L TG +Y FR+ A N  G S       VI VQ     P  P    + +    
Sbjct: 18089 RTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVI-VQYPFKEPGPPGTPFVTSISKD 18147

Query: 726   SMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKI 785
              M + W  P   GG+ I+GY+L+++E +   W ++N +P + T     GL EG  YEFK+
Sbjct: 18148 QMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKV 18207

Query: 786   AAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVS 845
             +A N+ GIG+PS  SE F       P   P   +    +   ++ + WK P Y G S ++
Sbjct: 18208 SAENIVGIGKPSKVSECFVARDPCDPPGRPEAIV----ITRNNVTLKWKKPAYDGGSKIT 18263

Query: 846   GYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANG-VGKPSDTSEP 904
             GY V+ ++   G W+  + T        VS L + + Y FRV A NA G   +PSD+S  
Sbjct: 18264 GYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSG- 18322

Query: 905   VLVEARPGTKEISAGVDEQGNIYLGFDCQEM---------TDASQFTWCKSYEEISDD-E 954
               + AR      +A +D +    +     E                 W K  +E+ +   
Sbjct: 18323 -AITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAA 18381

Query: 955   RFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSS 992
             R +I++    + L +K+  + D G Y + +S+  G  S
Sbjct: 18382 RMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKS 18419



 Score =  151 bits (382), Expect = 4e-36
 Identities = 175/732 (23%), Positives = 295/732 (40%), Gaps = 58/732 (7%)

Query: 511  PGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPR 569
            PGPP      +I +  V+  WEPP   G   ++ Y +EK        + +   + +R  +
Sbjct: 8430 PGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCK 8489

Query: 570  YAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV 629
            Y+V  L+EGK Y+FRV + NR G   P  ++ P+ A+D    P AP + +    T  S++
Sbjct: 8490 YSVTKLIEGKEYLFRVRAENRFGPGPPC-VSKPLVAKDPFGPPDAPDKPIVEDVTSNSML 8548

Query: 630  VQWDRPK-HEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVN 688
            V+W+ PK +   +LGY+++     +  W   N   +   +  V GL  G  Y+FRV A N
Sbjct: 8549 VKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAEN 8608

Query: 689  AVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLD 748
            A G  + S  SD       ++ P  P    + +    ++ L W+ P F+GG  I+GY++D
Sbjct: 8609 AAGPGKFSPPSDPKTAHDPISPPGPPIP-RVTDTSSTTIELEWEPPAFNGGGEIVGYFVD 8667

Query: 749  KREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAW 808
            K+ V    W        K    TV  + EG+ Y+ +++AVN AG G P +       E  
Sbjct: 8668 KQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGETQPVTVAE-- 8725

Query: 809  TMPEPGPAYDLTFCEVRDTSLVMLWK-----APVYSGSSPVSGYFVDFREEDAGEWITVN 863
              P+  PA +L    V+    +M  K     A V     P   +  +  E D    +  N
Sbjct: 8726 --PQEPPAVELD-VSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDN 8782

Query: 864  QTTTANRYLKVSDLQQGKTYV----------FRVRAVNANGVGKPSDTSEPVLVEARPGT 913
              T +   +K +  +    YV          F    V    V  P    +PV+   +   
Sbjct: 8783 VGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCL 8842

Query: 914  KEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPD 973
               S   D+ G+   GF   E  DA   TW +  E     ER K +  G      L+  +
Sbjct: 8843 LNWSDPEDDGGSEITGF-IIERKDAKMHTWRQPIE----TERSKCDITG-----LLEGQE 8892

Query: 974  KEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVR 1033
             +    + V   +  G        P E+  ++A+ + +  PT P    L Y    K  + 
Sbjct: 8893 YK----FRVIAKNKFGCG-----PPVEIGPILAV-DPLGPPTSP--ERLTYTERTKSTIT 8940

Query: 1034 F-WLQAEHLSPDASYRFIINDREVSDSEIHRIK---CDKATGIIEMVMDRFSIENEGTYT 1089
              W +           +II  R     +  R+    C   + ++E + +    E      
Sbjct: 8941 LDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAV 9000

Query: 1090 VQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLV 1149
             +I + +     ++V+  D     ++     R + ++ +     E +H  +  +     +
Sbjct: 9001 NEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKA---GEPVH--IPADVTGLPM 9055

Query: 1150 CKVANTKKETVFKWLKDDVLYETETLPNLERGICELLIPKLSKKDHGEYKATLKDDRGQD 1209
             K+  +K ETV +    D L  T+   +      EL IPK  ++D G Y  T  +  G  
Sbjct: 9056 PKIEWSKNETVIE-KPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSV 9114

Query: 1210 VSILEIAGKVYD 1221
               + +  +VYD
Sbjct: 9115 FRNVHV--EVYD 9124



 Score =  151 bits (382), Expect = 4e-36
 Identities = 151/584 (25%), Positives = 239/584 (40%), Gaps = 82/584 (14%)

Query: 347  KDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPP 406
            + D G Y +   +  G    +A + V D        PG  +DL+    NR   ++ W  P
Sbjct: 8796 RKDHGRYVITATNSCGSKFAAARVEVFDV-------PGPVLDLKPVVTNRKMCLLNWSDP 8848

Query: 407  NTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGIS 466
                 S + G+ ++R +   + W Q  +     C   +TGL EG+ Y FRV A N  G  
Sbjct: 8849 EDDGGSEITGFIIERKDAKMHTWRQPIETERSKC--DITGLLEGQEYKFRVIAKNKFGCG 8906

Query: 467  RPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTG---VHASEIS 523
             P  +   + A+DPL                              GPPT    +  +E +
Sbjct: 8907 PPVEIG-PILAVDPL------------------------------GPPTSPERLTYTERT 8935

Query: 524  RNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYV 582
            ++ + L W+ P   G  P+  Y IEK       ++RVN +    +  + V +L E + Y 
Sbjct: 8936 KSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLC-PTTSFLVENLDEHQMYE 8994

Query: 583  FRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKH-EEDL 641
            FRV + N  G SEPS +   +  QD  V P+   R+    +T   + V+   P H   D+
Sbjct: 8995 FRVKAVNEIGESEPS-LPLNVVIQDDEVPPTIKLRLSVRGDT---IKVKAGEPVHIPADV 9050

Query: 642  LGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGE--------------QYIFRVKAV 687
             G  +       N  E    KP    +     ++  E              +  + V A 
Sbjct: 9051 TGLPMPKIEWSKN--ETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTAS 9108

Query: 688  NAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYL 747
            N +G    +   +V         PS P  + + +    S  L W  P  +GGS I  Y +
Sbjct: 9109 NRLGSVFRNVHVEV------YDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVI 9162

Query: 748  DKREVHHK--NWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
            DKR+   K   W EV ++  +     +  L     YEF++ AVN  GI +     +    
Sbjct: 9163 DKRDASRKKAEWEEVTNTAVEKR-YGIWKLIPNGQYEFRVRAVNKYGISDECKSDKVVIQ 9221

Query: 806  EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQT 865
            + + +P P P         + + LV  W  P+ +G SP++GY+++ REE +  W  V++ 
Sbjct: 9222 DPYRLPGP-PGKPKVLARTKGSMLVS-WTPPLDNGGSPITGYWLEKREEGSPYWSRVSRA 9279

Query: 866  TTANRYLK-----VSDLQQGKTYVFRVRAVNANGVGKPSDTSEP 904
                  LK     V  L +G  Y FR  A+NA G+G PS+ S+P
Sbjct: 9280 PITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDP 9323



 Score =  150 bits (379), Expect = 9e-36
 Identities = 109/444 (24%), Positives = 202/444 (45%), Gaps = 39/444 (8%)

Query: 563  TAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASR 622
            T      + + +  +G    ++++  N+HG +E       I  + + V    PG V    
Sbjct: 6675 TTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGF-----INLKVIDV----PGPVRNLE 6725

Query: 623  NTKT---SVVVQWDRPKHE--EDLLGYYVD-------CCVAGTNLWEPCNHKPIGYNRFV 670
             T+T    V + W+ P  +    ++GY V+         V  T+  E C         F 
Sbjct: 6726 VTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDRAESCE--------FT 6777

Query: 671  VHGLTTGE-QYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTL 729
            V GL  G  +Y+FRV A N VG  E  +  + ++ ++   VP  P  +T+ + +   ++L
Sbjct: 6778 VTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSL 6837

Query: 730  GWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVN 789
             W+ P++ GG+ I  Y ++ R+     W    +  ++    TV  + EG  Y F++ A N
Sbjct: 6838 TWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQN 6897

Query: 790  LAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFV 849
              G+G+PS  +   K  A  +  P P  +LT  +   +S+ + W+ P+  G SP+ GY +
Sbjct: 6898 RIGVGKPSAATPFVKV-ADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYII 6956

Query: 850  DFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEA 909
            +  EE    WI  N         KV+ L++G  Y++RV A N  GV  PS+   P+  + 
Sbjct: 6957 ERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADD 7016

Query: 910  R--PGTKEISAGVDEQGNIYLGFDCQEMTDASQF-----TWCKSYEEISDDERFKIETVG 962
                 T ++SA  D    + +      +  ++ +     TWC   + +   +R K++T+ 
Sbjct: 7017 AFVEPTMDLSAFKDGL-EVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLS 7075

Query: 963  DHSKLYLKNPDKEDLGTYSVSVSD 986
             +++L +   ++ D G Y++ + +
Sbjct: 7076 AYAELVISPSERSDKGIYTLKLEN 7099



 Score =  150 bits (378), Expect = 1e-35
 Identities = 138/520 (26%), Positives = 208/520 (40%), Gaps = 88/520 (16%)

Query: 375   ADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVD--RCEVGTNNWVQC 432
             +DPL    P  P  L+  +  ++   + W PP     + + GY       E   + W + 
Sbjct: 12421 SDPL--SEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEY 12478

Query: 433   NDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAA----LDPLDLRRLQ- 487
             +   VK     VTGL EG+ Y FRV A N+ G+S P        A    L P  L   Q 
Sbjct: 12479 S--VVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQI 12536

Query: 488   -------------------------------------AVHLEGEKEIAIYQDDLEGDA-- 508
                                                  AVH      I I +D    D+  
Sbjct: 12537 TIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGY 12596

Query: 509   ---------------------QVPGPPTG-VHASEISRNYVVLSWEPPTPRGKDPLM-YF 545
                                    PGPP      S+I  +   LSW  P   G   +  Y 
Sbjct: 12597 YSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHIPLEDGGSNITNYI 12656

Query: 546   IEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSP-IQ 604
             +EK  V  G W  V A  +V      V  L+ G+ Y+FRV + NR G+SEP  +TSP + 
Sbjct: 12657 VEKCDVSRGDW--VTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEP--LTSPKMV 12712

Query: 605   AQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHK 662
             AQ    VPS P     ++  K  + V WDRP  +    ++GY ++     + LW   N  
Sbjct: 12713 AQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVKANDT 12772

Query: 663   PIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNC 722
              +    +   GL  G +Y FR+ A+N  G S  S+ ++ +  +  +  P  P    +++ 
Sbjct: 12773 LVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKP---EVIDV 12829

Query: 723   DGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSK--PTILTVDGLTEGSL 780
                +++L W  PK  GGS I+GY+++  ++    W   N++P +      T  GL E + 
Sbjct: 12830 TKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQ 12889

Query: 781   YEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLT 820
             Y+F+  A     I  PS+PS+     A  +P   P  DL+
Sbjct: 12890 YQFRAIARTAVNISPPSEPSDPVTILAENVP---PRIDLS 12926



 Score =  149 bits (376), Expect = 2e-35
 Identities = 199/866 (22%), Positives = 327/866 (37%), Gaps = 118/866 (13%)

Query: 150   ISRAPEIL--VRLRSHTVWER-MSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIE 206
             I  APEI   V LR+  + +    V++    +G P P V W KD   +   A   +Y IE
Sbjct: 20893 ILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDA---RYSIE 20949

Query: 207   SNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLP 266
             +      L I +   +DT  Y     N                             +G P
Sbjct: 20950 NTDSSSLLTIPQVTRNDTGKYILTIENG----------------------------VGEP 20981

Query: 267   LSSMIPYTHFDVQFL-EKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKE 325
              SS +     D     +K  V     G TVTL   +   P +    P   +  +     +
Sbjct: 20982 KSSTVSVKVLDTPAACQKLQVKHVSRG-TVTL---LWDPPLIDGGSPIINYVIEKRDATK 21037

Query: 326   SKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGA 385
               W+ +      +S SF  +   ++  +  R+++   +            +P+      A
Sbjct: 21038 RTWSVV--SHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEP---CETTEPVKAAEVPA 21092

Query: 386   PM-DLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPV 444
             P+ DL   D+ +  VI++W  P+    S +  Y V+R   G   W     +  K C+  V
Sbjct: 21093 PIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGIS--KTCEIEV 21150

Query: 445   TGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDL 504
             + L E     FRV A N  G+S P         + P+ ++ L          I   + DL
Sbjct: 21151 SQLKEQSVLEFRVFAKNEKGLSDP-------VTIGPITVKEL----------IITPEVDL 21193

Query: 505   EGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTA 564
                + +PG    V    I  N   +  E P      P + +++  +              
Sbjct: 21194 ---SDIPGAQVTVR---IGHN---VHLELPYKGKPKPSISWLKDGL-------------P 21231

Query: 565   VRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQ--AQDVTVV----PSAP-GR 617
             ++   +  F   E K  +    +   HG      + + +   A  +TV+    PS P G 
Sbjct: 21232 LKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKGP 21291

Query: 618   VLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNHK----PIGYNRFVVHG 673
             +        SV++ WD P   ED  G  + C           N K     +    F V  
Sbjct: 21292 IRFDEIKADSVILSWDVP---EDNGGGEITCYSIEKRETSQTNWKMVCSSVARTTFKVPN 21348

Query: 674   LTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKV 733
             L    +Y FRV+A N  G+S+    S +I  +    +P  P    + N     M+L W  
Sbjct: 21349 LVKDAEYQFRVRAENRYGVSQ-PLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDA 21407

Query: 734   PKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGI 793
             P + GGS + G++++K+E +   W +VN+SP         GL EG  Y+F++ A N AG+
Sbjct: 21408 PVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGL 21467

Query: 794   GEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFRE 853
               PSDPS+     +   P   P Y     +V   ++ + W  P+  G S + GY ++ R+
Sbjct: 21468 SSPSDPSKFTLAVSPVDPPGTPDY----IDVTRETITLKWNPPLRDGGSKIVGYSIEKRQ 21523

Query: 854   EDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKP----------SDTSE 903
              +   W+  N T  +     V+ L  G  Y FR+ A NA G   P           D + 
Sbjct: 21524 GNE-RWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENV 21582

Query: 904   PVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGD 963
             P +VE   G +     + + G         +     + TW K   EI      +I  V  
Sbjct: 21583 PPIVEF--GPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLG 21640

Query: 964   HSKLYLKNPDKEDLGTYSVSVSDTDG 989
              + L++++  ++  G Y+V   +  G
Sbjct: 21641 STSLFVRDATRDHRGVYTVEAKNASG 21666



 Score =  149 bits (376), Expect = 2e-35
 Identities = 139/518 (26%), Positives = 220/518 (42%), Gaps = 56/518 (10%)

Query: 511   PGPPTG-VHASEISRNYVVLSWEPPTPRG-KDPLMYFIEKSVVGSGSWQRVNAQTAVRSP 568
             P  P G +   +I    V +SW PP   G  D L Y +E+  V   +W  ++++  VR  
Sbjct: 23856 PNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSR--VRGT 23913

Query: 569   RYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQ---DVTVVPSAPGRVLASRNTK 625
                V  L E   Y FRV + N+ G+S+P +   P+  +   +    PS P  VL    TK
Sbjct: 23914 SLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVLDV--TK 23971

Query: 626   TSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFR 683
             +SV + W RPK +    + GYY++     T+ W   N   I    + V GL    +Y FR
Sbjct: 23972 SSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFR 24031

Query: 684   VKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPIL 743
             + A N VG+SE S  S+ +  +     PS P  + +L+    S+TL W+ P+  GG  IL
Sbjct: 24032 IIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEIL 24091

Query: 744   GYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHF 803
             GY+++ R+     W + N    K    T+ GL E + YEF++ A N  G+  P   +   
Sbjct: 24092 GYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSI 24151

Query: 804   KCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVN 863
             K +  +   PG        E++D +  +        G +      +  R     +W    
Sbjct: 24152 KTKLTSGEAPGIRK-----EMKDVTTKL--------GEAAQLSCQIVGRPLPDIKWYRFG 24198

Query: 864   QTTTANRYLKVSDLQQGKTYVFRV-----------RAVNANGVGKPSDTSEPVLVEARP- 911
             +    +R  K+S    G+T+   V             +  N VG+  +TS  +L++A P 
Sbjct: 24199 KELIQSRKYKMS--SDGRTHTLTVMTEEQEDEGVYTCIATNEVGE-VETSSKLLLQATPQ 24255

Query: 912   -----GTKEISAGVD----EQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVG 962
                    KE   G          +Y+G     M      TW    + + + E   IE   
Sbjct: 24256 FHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAM------TWFHGQKLLQNSENITIENTE 24309

Query: 963   DHSKLYLKNPD-KEDLGTYSVSVSDTDGVSSSFVLDPE 999
              ++ L +KN   K   G Y V +S+  G   + +LD E
Sbjct: 24310 HYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDA-ILDVE 24346



 Score =  147 bits (371), Expect = 7e-35
 Identities = 164/689 (23%), Positives = 272/689 (39%), Gaps = 81/689 (11%)

Query: 250   RGDEEPFRSVGLP-----IGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVT 304
             +G  +P R +G+P     I +  S  +P+  F+V+  E+  +    +G            
Sbjct: 19002 KGRSDP-RQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKIDVPFKG------------ 19048

Query: 305   PDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVS 364
                 R Q    W +D   LKE+    +   +   SLS     K+D G Y L + +  G  
Sbjct: 19049 ----RPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSI 19104

Query: 365   DHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEV 424
                  + V D        PG P  ++  + + D + ++W PP       +  Y V++ E 
Sbjct: 19105 TVPITIIVLDR-------PGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKET 19157

Query: 425   GTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLR 484
              +  W   + A V      +  L  G  Y FRV A N  G S  S  S  VA        
Sbjct: 19158 TSTTWHIVSQA-VARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVA-------- 19208

Query: 485   RLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM- 543
                                 E     PGPP        +++ ++++W+ P   G   ++ 
Sbjct: 19209 --------------------EYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIG 19248

Query: 544   YFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPI 603
             Y +E     S  W + N +  +   +  V  L EG  Y +RV + N  G+ + S+   P+
Sbjct: 19249 YHLEYKERSSILWSKAN-KILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPV 19307

Query: 604   QAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNH 661
              A+D       PG+   +  T+ SV ++W +P ++    + GY V+        W  CN+
Sbjct: 19308 PARDPC---DPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNY 19364

Query: 662   KPIGYNRFVVHGLTTGEQYIFRVKAVNAV-GMSENSQESDVIKVQAALTVPSHPYGITLL 720
               I    F V  LT  ++Y FRV A NA   +SE S+ +  I V+  +  P     +   
Sbjct: 19365 TNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFR 19424

Query: 721   NCDGHSMTLGWKVPKFSGGS--PILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEG 778
             +          K+     G   P++ +  D  E+  +   E+ S+ +  T+LTV      
Sbjct: 19425 DVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNH-TLLTVKDCIRR 19483

Query: 779   SLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVY 838
                ++ +   N+AG       S    C+    P P PA  L    +      + W  P  
Sbjct: 19484 DTGQYVLTLKNVAG-----TRSVAVNCKVLDKPGP-PAGPLEINGLTAEKCSLSWGRPQE 19537

Query: 839   SGSSPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKP 898
              G + +  Y V+ RE     W T+ +        KV+ L +G  Y+FRV  VN  GVG+P
Sbjct: 19538 DGGADIDYYIVEKRETSHLAW-TICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEP 19596

Query: 899   SDT-----SEPVLVEARPGTKEISAGVDE 922
              ++      +P  V + P + EI++   E
Sbjct: 19597 LESVAIKALDPFTVPSPPTSLEITSVTKE 19625



 Score =  144 bits (364), Expect = 5e-34
 Identities = 163/681 (23%), Positives = 264/681 (38%), Gaps = 79/681 (11%)

Query: 312   PRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLF 371
             P+    RD V LK +            +++       D G Y +   +  G +     + 
Sbjct: 20134 PKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIV 20193

Query: 372   VRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQ 431
             V D      G P  P+ +   D   + V + W+PP     S V  Y + + E  T  W +
Sbjct: 20194 VLDRP----GPPTGPVVIS--DITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTE 20247

Query: 432   CNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHL 491
              + A V      V  L  G  Y FR++A N  GIS            D +D   +     
Sbjct: 20248 VS-ATVARTMMKVMKLTTGEEYQFRIKAENRFGIS------------DHIDSACVT---- 20290

Query: 492   EGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSV 550
                         ++     PGPP+    + ++R  + + W  P   G   ++ Y +E   
Sbjct: 20291 ------------VKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKD 20338

Query: 551   VGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTV 610
               S  WQ+ N +  +R+  + V  +  G  Y FRV + N  G+ +PS  + P+ A D   
Sbjct: 20339 RNSILWQKAN-KLVIRTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDAC- 20396

Query: 611   VPSAPGRVLASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNR 668
                 P  V  +  +K SV + W +P  +    + GY V+        W   +   +   +
Sbjct: 20397 --EPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQ 20454

Query: 669   FVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPY-GITLLNCDGHSM 727
             F++ GLT   QY FRV A NAVG   N   S+V+     +     P   + L   +    
Sbjct: 20455 FIISGLTQNSQYEFRVFARNAVGSISNP--SEVVGPITCIDSYGGPVIDLPLEYTEVVKY 20512

Query: 728   TLGWKVPKFSGGS----PILGYYLDKREVHHKNWHEVNSSPSKPTILTVDG--LTEGSLY 781
               G  V   +G S    P + +Y D +E+       V ++    +IL  D   L  G  Y
Sbjct: 20513 RAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGC-Y 20571

Query: 782   EFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGS 841
             E K+   N  G       S   + +    P P P   + F  V    + +LW+ P   G 
Sbjct: 20572 ELKLR--NAMG-----SASATIRVQILDKPGP-PGGPIEFKTVTAEKITLLWRPPADDGG 20623

Query: 842   SPVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDT 901
             + ++ Y V+ RE     W  V++       +  + + +G  Y+FRVRAVN  G+G+P ++
Sbjct: 20624 AKITHYIVEKRETSRVVWSMVSEHLE-ECIITTTKIIKGNEYIFRVRAVNKYGIGEPLES 20682

Query: 902   SEPVLVEA-----RPGTKEI------------SAGVDEQGNIYLGFDCQEMTDASQFTWC 944
                V   A      PG  E+            S  + + G+   G+   E  D     W 
Sbjct: 20683 DSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGY-FLEKRDKKSLGWF 20741

Query: 945   KSYEEISDDERFKIETVGDHS 965
             K  +E   D R K+  + ++S
Sbjct: 20742 KVLKETIRDTRQKVTGLTENS 20762



 Score =  141 bits (355), Expect = 5e-33
 Identities = 122/473 (25%), Positives = 210/473 (44%), Gaps = 49/473 (10%)

Query: 511   PGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPR 569
             PGPP  +   E+ ++   L WEPP   G   +  Y I+K      ++  V+++ +  S  
Sbjct: 17744 PGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKTS-- 17801

Query: 570   YAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV 629
             + V +L EG  Y FRV++ N  G+  P E    ++A +    PS PG+V  +  ++TS  
Sbjct: 17802 FKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEP---PSPPGKVTLTDVSQTSAS 17858

Query: 630   VQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAV 687
             + W++P+H+    +LGY V+    GT  W       +     VV GL++G++Y FRVKA 
Sbjct: 17859 LMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVC--NAVVTGLSSGQEYQFRVKAY 17916

Query: 688   NAVGMSEN-----SQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPI 742
             N  G S+         +  + +Q +L +P + Y I      G  + +  ++P      P 
Sbjct: 17917 NEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQA----GEDLKI--EIPVIGRPRPN 17970

Query: 743   LGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEH 802
             + +  D   +       V  + +  T+L +    +    ++ + A N AG       +E+
Sbjct: 17971 ISWVKDGEPLKQTTRVNVEETATS-TVLHIKEGNKDDFGKYTVTATNSAGTA-----TEN 18024

Query: 803   FKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITV 862
                     P P P   + F EV    +V+ W+ P Y+G   +S Y V+ R+     W  V
Sbjct: 18025 LSVIVLEKPGP-PVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMV 18083

Query: 863   NQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVE------ARPGTKEI 916
             +  T A   +K++ L+ G  Y FR+ A N  G   P D S+ V+V+        PGT  +
Sbjct: 18084 S-ATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLD-SKAVIVQYPFKEPGPPGTPFV 18141

Query: 917   SA------------GVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFK 957
             ++             V++ G   +G+   E  + +   W K  +    D +FK
Sbjct: 18142 TSISKDQMLVQWHEPVNDGGTKIIGYHL-EQKEKNSILWVKLNKTPIQDTKFK 18193



 Score =  140 bits (353), Expect = 9e-33
 Identities = 116/421 (27%), Positives = 187/421 (44%), Gaps = 32/421 (7%)

Query: 511   PGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPR 569
             PGP   +  ++I+++ V L W+ P   G   +  Y +EK      S+    A T      
Sbjct: 14496 PGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYS--TATTKCHKCT 14553

Query: 570   YAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV 629
             Y V  L EG  Y FRV++ N +G+ EP+E T P++A +    PS P  +     TK++V 
Sbjct: 14554 YKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASE---APSPPDSLNIMDITKSTVS 14610

Query: 630   VQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAV 687
             + W +PKH+    + GY ++    G++ W   +   +     VV  LT GE+Y F+V AV
Sbjct: 14611 LAWPKPKHDGGSKITGYVIEAQRKGSDQW--THITTVKGLECVVRNLTEGEEYTFQVMAV 14668

Query: 688   NAVGMSENSQESDVIKVQAALTVPSHPYGI---TLLNCDGHSMTLGWKVPKFSGGSPILG 744
             N+ G S   +   VI  +  +       GI    ++   G ++ +  ++P      P + 
Sbjct: 14669 NSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKV--EIPVLGRPKPTVT 14726

Query: 745   YYLDKREVHHKNWHEVN-SSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHF 803
             +   K +   K    VN  + +  TIL ++         + + A N+ G     +  +  
Sbjct: 14727 W--KKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVG-----EVGDVI 14779

Query: 804   KCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVN 863
               +   +P P P   + F EV    +   W  P   G  P+S Y V+ R+ D+  W+ + 
Sbjct: 14780 TIQVHDIPGP-PTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELA 14838

Query: 864   QTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSE------PVLVEARPGTKEIS 917
              T     Y K + L  G  Y FRV+A N  GVG P  TS       P  V   PGT +++
Sbjct: 14839 TTVIRTTY-KATRLTTGLEYQFRVKAQNRYGVG-PGITSACIVANYPFKVPGPPGTPQVT 14896

Query: 918   A 918
             A
Sbjct: 14897 A 14897



 Score =  136 bits (343), Expect = 1e-31
 Identities = 112/417 (26%), Positives = 180/417 (43%), Gaps = 28/417 (6%)

Query: 511   PGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVVGSGSWQRVNAQTAVRSPR 569
             PGPP  +   E+++  V L+W+PP   G   +  Y +EK      ++  V   T      
Sbjct: 15580 PGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTV--ATNCHKTS 15637

Query: 570   YAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVV 629
             + V  L EG SY FRVL+ N +G+  P+E    ++A +    P  PG++     T+ SV 
Sbjct: 15638 WKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASE---RPLPPGKITLMDVTRNSVS 15694

Query: 630   VQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAV 687
             + W++P+H+    +LGY V+    G++ W  C    +      + GL  GE+Y FRV A 
Sbjct: 15695 LSWEKPEHDGGSRILGYIVEMQTKGSDKWATC--ATVKVTEATITGLIQGEEYSFRVSAQ 15752

Query: 688   NAVGMSENSQESDVIKVQAALTVPSHPYGI-TLLNCDGHSMTLGWKVPKFSGGSPILGYY 746
             N  G+S+  Q S  +  +  +  P+      T     G  + +   VP     +P + ++
Sbjct: 15753 NEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKV--DVPFIGRPTPAVTWH 15810

Query: 747   LDKREVHHKNWHEVNS-SPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
              D   V  K    VN+ S    ++LT+       +  + +   N AG     +  E    
Sbjct: 15811 KD--NVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAG-----EAIETLNV 15863

Query: 806   EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQT 865
                  P P P   +   EV   S+ + W  P Y G S ++ Y V+ R+     W  V+  
Sbjct: 15864 IVLDKPGP-PTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVS-A 15921

Query: 866   TTANRYLKVSDLQQGKTYVFRVRAVNANGV-----GKPSDTSEPVLVEARPGTKEIS 917
             T A   +K   L+ G  Y FR+ A N  G       +P+    P  V   PGT  ++
Sbjct: 15922 TVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVT 15978



 Score =  134 bits (337), Expect = 6e-31
 Identities = 174/771 (22%), Positives = 294/771 (38%), Gaps = 127/771 (16%)

Query: 171   VKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT-LEINRADFDDTATYSA 229
             ++L   ++G P P+ +W K+G  I + A      + +    HT L I  AD  D+ TY  
Sbjct: 23782 IRLTIPIKGKPFPICKWTKEGQDISKRA------MIATSETHTELVIKEADRGDSGTYDL 23835

Query: 230   VATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFR 289
             V  N  G+ +    V V                IG P S   P  + D+Q +    V++R
Sbjct: 23836 VLENKCGKKAVYIKVRV----------------IGSPNSPEGPLEYDDIQ-VRSVRVSWR 23878

Query: 290   REGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDD 349
                +         +    +R  P+A WY  D  ++ +            SL    L ++ 
Sbjct: 23879 PPADDGGADILGYILE--RREVPKAAWYTIDSRVRGT------------SLVVKGLKENV 23924

Query: 350   EGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCH-----DANRDYVIVTWK 404
             E  + +   ++ G+S       ++  +P+    P  P +   +     D  +  V ++W 
Sbjct: 23925 EYHFRVSAENQFGISKP-----LKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWS 23979

Query: 405   PPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAG 464
              P     S V GY+++R E  T+ WV+ N   +    Y VTGL     Y FR+ A N  G
Sbjct: 23980 RPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVG 24039

Query: 465   ISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISR 524
             +S  S  S+ V   DP D                            P  P  +    IS+
Sbjct: 24040 LSETSPASEPVVCKDPFD---------------------------KPSQPGELEILSISK 24072

Query: 525   NYVVLSWE-PPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVF 583
             + V L WE P    GK+ L Y++E    G  +W++ N +  ++  ++ +  L+E   Y F
Sbjct: 24073 DSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKE-RIKDKQFTIGGLLEATEYEF 24131

Query: 584   RVLSANRHGLSEPSEITSPIQAQDVTVVPSAPG--RVLASRNTKTSVVVQWD-----RPK 636
             RV + N  GLS P      I+ +       APG  + +    TK     Q       RP 
Sbjct: 24132 RVFAENETGLSRPRRTAMSIKTK--LTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPL 24189

Query: 637   HEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQY---IFRVKAVNAVGMS 693
                D+  Y       G  L +   +K     R     + T EQ    ++   A N VG  
Sbjct: 24190 --PDIKWYRF-----GKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEV 24242

Query: 694   ENSQESDVIKVQAALTVPSHP--------YGITLLNCDGHSMTLGWKVPKFSGGSPILGY 745
             E S      K+    T   HP        YG        H M +G  VP  +       +
Sbjct: 24243 ETSS-----KLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMT-------W 24290

Query: 746   YLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKC 805
             +  ++ + +     + ++     ++  +   +    ++K+   N+ G  +          
Sbjct: 24291 FHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAI-----LDV 24345

Query: 806   EAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFRE-EDAGEWITVNQ 864
             E    P+  P   +    +   S V+ WK P   G S ++ Y V+  E ++  EW  V+ 
Sbjct: 24346 EIQDKPDK-PTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSS 24404

Query: 865   TTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEA---RPG 912
               +     ++ +L +   Y FRV A N  G+  P + S  V++++   +PG
Sbjct: 24405 AISVTT-CRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPG 24454



 Score =  121 bits (304), Expect = 4e-27
 Identities = 113/424 (26%), Positives = 188/424 (44%), Gaps = 38/424 (8%)

Query: 493   GEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLM-YFIEKSVV 551
             G+KE  I    L+     PGPP  V   EIS++   ++WEPP   G  P++ Y ++K   
Sbjct: 13401 GKKEYTIVVKVLD----TPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDA 13456

Query: 552   GSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVV 611
                SW  V  + +  S  + V +L EGKSY FRV + N +G+ +P E    ++A      
Sbjct: 13457 ERKSWSTVTTECSKTS--FRVANLEEGKSYFFRVFAENEYGIGDPGETRDAVKAS----- 13509

Query: 612   PSAPGRVL---ASRNTKTSVVVQWDRPKHE--EDLLGYYVDCCVAGTNLWEPCNHKPIGY 666
                PG V+       +K+S  + W +P  +    ++GY VD  +   N W+    K +  
Sbjct: 13510 -QTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVD-FLTEENKWQRV-MKSLSL 13566

Query: 667   NRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIK---VQAALTVPSHPYGITLLNCD 723
              ++    LT G++Y FRV A N  G    S+ + V +   V   L +   P  +  L  +
Sbjct: 13567 -QYSAKDLTEGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLP-DLCYLAKE 13624

Query: 724   GHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEF 783
               +  L  K+P     +P + +   +  +       V SS    T++  D   +    ++
Sbjct: 13625 NSNFRL--KIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYD-CQKSDAGKY 13681

Query: 784   KIAAVNLAGIGEPSDPSEHFKCEAWTMPEPG-PAYDLTFCEVRDTSLVMLWKAPVYSGSS 842
              I   N+AG  E +            + +PG P   + F EV   ++ + W  P   G S
Sbjct: 13682 TITLKNVAGTKEGT-------ISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGS 13734

Query: 843   PVSGYFVDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTS 902
              ++ Y ++ R+    +W+T         + +V+ L +G  Y FRV A N  GVG+    S
Sbjct: 13735 EITNYILEKRDSVNNKWVTCASAVQKTTF-RVTRLHEGMEYTFRVSAENKYGVGE-GLKS 13792

Query: 903   EPVL 906
             EP++
Sbjct: 13793 EPIV 13796



 Score =  111 bits (278), Expect = 4e-24
 Identities = 93/324 (28%), Positives = 134/324 (41%), Gaps = 41/324 (12%)

Query: 152   RAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRI-ESNYG 210
             +AP     LR+  V  + +  L   V G P P+V+WY+ G  I   A+  KYRI E   G
Sbjct: 24554 QAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEII--ADGLKYRIQEFKGG 24611

Query: 211   VHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSM 270
              H L I     DD   Y   ATN  G VS  A+                 L + +P    
Sbjct: 24612 YHQLIIASVTDDDATVYQVRATNQGGSVSGTAS-----------------LEVEVPAKIH 24654

Query: 271   IPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTK 330
             +P T      LE  G      GE V++K      PD     P   W +   L+  +   +
Sbjct: 24655 LPKT------LEGMGAVHALRGEVVSIKIPFSGKPD-----PVITWQKGQDLIDNNGHYQ 24703

Query: 331   MFFGEGQASLSFSH-LHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDL 389
             +       SL F + + + D G Y +   +R G+   +  L V D        P  P  +
Sbjct: 24704 VIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADV-------PDPPRGV 24756

Query: 390   QCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFE 449
             +  D +RD V +TW  P +   S +  Y V++C      W++   A  +  +Y V  LF 
Sbjct: 24757 KVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQA--RETRYTVINLFG 24814

Query: 450   GRSYIFRVRAVNSAGISRPSRVSD 473
               SY FRV A N  G+S+PS  S+
Sbjct: 24815 KTSYQFRVIAENKFGLSKPSEPSE 24838



 Score = 95.5 bits (236), Expect = 3e-19
 Identities = 99/408 (24%), Positives = 161/408 (39%), Gaps = 25/408 (6%)

Query: 603   IQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEED--LLGYYVDCCVAGTNLWEPCN 660
             ++ QD    P+ P  ++     K S V+ W  P  +    +  Y V+ C A         
Sbjct: 24345 VEIQDKPDKPTGP--IVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLV 24402

Query: 661   HKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLL 720
                I      +  LT    Y FRV A N  G+S+  + S V+ +++    P  P   T+ 
Sbjct: 24403 SSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTIT 24462

Query: 721   NCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSL 780
                  S  + WK P   GG+ I  YYL+KRE     W  V +   + T+ +V  L EG  
Sbjct: 24463 AVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLE 24522

Query: 781   YEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAY--DLTFCEVRDTSLVMLWKAPVY 838
             YEF++   NL G  E S+ SE    ++  +P   P +  +L    VR  S   L    V 
Sbjct: 24523 YEFRVKCENLGGESEWSEISEPITPKS-DVPIQAPHFKEELRNLNVRYQSNATL-VCKVT 24580

Query: 839   SGSSPVSGYFVDFREEDA-GEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANG--- 894
                 P+  ++   +E  A G    + +       L ++ +      V++VRA N  G   
Sbjct: 24581 GHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVS 24640

Query: 895   ------VGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYE 948
                   V  P+    P  +E   G   + A   E  +I + F  +        TW K  +
Sbjct: 24641 GTASLEVEVPAKIHLPKTLE---GMGAVHALRGEVVSIKIPFSGK---PDPVITWQKGQD 24694

Query: 949   EISDDERFKIETVGDHSKLYLKN-PDKEDLGTYSVSVSDTDGVSSSFV 995
              I ++  +++      + L   N  +++D G Y V   +  G+    V
Sbjct: 24695 LIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTV 24742



 Score = 77.8 bits (190), Expect = 7e-14
 Identities = 113/534 (21%), Positives = 206/534 (38%), Gaps = 93/534 (17%)

Query: 930  FDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
            F+C+         W K+  EI   E+FKI   G   +L + N   ED   Y+  V   D 
Sbjct: 2855 FECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTF-VCGNDQ 2913

Query: 990  VSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRF 1049
            VS++  + P  +  ++   N  +  TI  +  + YE                    SY++
Sbjct: 2914 VSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYE------------------GISYKW 2955

Query: 1050 IINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDA 1109
            + N  E+  ++  +++  K T  + +    F    + T+      GKA S ++L +    
Sbjct: 2956 LKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVA----GKATSTATLYV---- 3007

Query: 1110 FKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDV- 1168
                    E +  EF +    H  +     V E+      C+V+  + +   +W+KDD  
Sbjct: 3008 --------EARHIEFRK----HIKDI---KVLEKKRAMFECEVS--EPDITVQWMKDDQE 3050

Query: 1169 LYETETLP-NLERGICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAM 1227
            L  T+ +    E+ +  LLIP     D G+Y        G +VS  ++  +  D  I ++
Sbjct: 3051 LQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVA----GGNVSTAKLFVEGRDVRIRSI 3106

Query: 1228 SRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSS--EHMRIGGSEEM 1285
             +        ++V+   E  R     +   D++  +W     +I+    E  +      +
Sbjct: 3107 KK-------EVQVI---EKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRI 3156

Query: 1286 AWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGR 1345
              + I E  + D G+YTF    G++    +L ++     +   E Q              
Sbjct: 3157 HRMFISETRQSDAGEYTFVA--GRNRSSVTLYVNAPEPPQVLQELQP------------- 3201

Query: 1346 LIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVK-VEQAKYVSMT 1404
                    VT+  GK       + G P P++ W+K +Q   LS  F  K +   +  ++ 
Sbjct: 3202 --------VTVQSGKPARFCAVISGRPQPKISWYKEEQ--LLSTGFKCKFLHDGQEYTLL 3251

Query: 1405 IKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAKPKLIPA 1458
            +     ED+  Y+   KN YG      ++SV     ++P++  P Q  P   PA
Sbjct: 3252 LIEAFPEDAAVYTCEAKNDYGVATTSASLSV-----EVPEVVSPDQEMPVYPPA 3300



 Score = 72.4 bits (176), Expect = 3e-12
 Identities = 113/531 (21%), Positives = 199/531 (37%), Gaps = 76/531 (14%)

Query: 930  FDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
            F+C+         W K  +E+   +R KI+      +L + +    D G Y+V       
Sbjct: 3031 FECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVS 3090

Query: 990  VSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASY-- 1047
             +  FV   +   R+ ++  E+             ++ +K R     +      DA +  
Sbjct: 3091 TAKLFVEGRDV--RIRSIKKEV-------------QVIEKQRAVVEFEVNEDDVDAHWYK 3135

Query: 1048 -----RFIINDRE--VSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQ 1100
                  F + +R   V +  IHR           M +      + G YT        +++
Sbjct: 3136 DGIEINFQVQERHKYVVERRIHR-----------MFISETRQSDAGEYTFVA----GRNR 3180

Query: 1101 SSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETV 1160
            SS+ L  +A                  + P   + L     +  +    C V + + +  
Sbjct: 3181 SSVTLYVNA-----------------PEPPQVLQELQPVTVQSGKPARFCAVISGRPQPK 3223

Query: 1161 FKWLKDDVLYETETLPNLERGICE--LLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGK 1218
              W K++ L  T           E  LL+ +   +D   Y    K+D G   +   ++ +
Sbjct: 3224 ISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVE 3283

Query: 1219 VYDDMILAMSRVCGKSA--SPLKVLCTPEG--IRLQCFMKYFTDEMKVNWCHKDAKISSS 1274
            V + +           A  +PL+   T EG   R QC  +    ++KV+W  KD KI  S
Sbjct: 3284 VPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQC--RVSGTDLKVSWYSKDKKIKPS 3341

Query: 1275 EHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFD--GKDNHQRSLDLSG-QAFDEAFAEFQ 1331
               R+   E+   L+I E   +D+G YTF   +  G+ +   +L L G   F+E  +  Q
Sbjct: 3342 RFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEGFSKFEENTSNSQ 3401

Query: 1332 QFKAAAFAEKNRGRLIGGLPDVV------TIMEGKTLNLTCTVFGNPDPEVIWFKNDQDI 1385
               + + + K     +G  P  +       +  G+T+     V G P PE+ WF N Q I
Sbjct: 3402 WHVSLSVSFKKEP--LGQKPSFIQPLSSLRVHNGETVRFHARVSGIPKPEIQWFHNQQLI 3459

Query: 1386 QLSEHFSVKVEQAKYVS-MTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
              ++      E++  ++ M I    SE +G+YS    N  G      T++V
Sbjct: 3460 LPTKDVVFHFEESTGMALMLIVDAYSEHAGQYSCKAANSAGEATCAATLTV 3510



 Score = 65.9 bits (159), Expect = 3e-10
 Identities = 67/248 (27%), Positives = 102/248 (41%), Gaps = 30/248 (12%)

Query: 30    DEYASKKRASTQASSQKSLSQRSSSQRASSQTSLGGTICRVCAKRVSTQEDEEQENRSRY 89
             +EY   K A  ++SS  S   R     + +   L   +  +   R    E+ E +   R 
Sbjct: 25877 EEYEISKHAQRESSSSASRLLRRRRSLSPTYIELMRPVSELIRSRPQPAEEYEDDTERRS 25936

Query: 90    QSLVAAYGEAKRQRFLSELAHLEEDVHLARSQARDKLDKYAIQQMMEDKLAWERHTFEER 149
              +      E  R R  S ++    +  L+R +   + D ++  + M+  L  ++ T E +
Sbjct: 25937 PT-----PERTRPRSPSPVS---SERSLSRFERSARFDIFSRYESMKAALKTQK-TSERK 25987

Query: 150   ----------ISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAE 199
                       +  AP I +R+RSH V    + +    VQ  PT  V+WY +G    +  E
Sbjct: 25988 YEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNG---VELQE 26044

Query: 200   PGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVV--------RRFRG 251
               K    +  GV TLEI     DD+ TY AV TN  G+ S  A + V           R 
Sbjct: 26045 SSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRR 26104

Query: 252   DEEPFRSV 259
             DEE  RSV
Sbjct: 26105 DEEVPRSV 26112



 Score = 65.9 bits (159), Expect = 3e-10
 Identities = 50/166 (30%), Positives = 76/166 (45%), Gaps = 22/166 (13%)

Query: 1262  VNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTF--EIFDGKDNHQRSLDLS 1319
             V W     ++++SE  R G S     L I + + +D+G  T   +  +G    Q  L LS
Sbjct: 26696 VKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLS 26755

Query: 1320  GQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWF 1379
              +  D          A AF  + R +          I EG+ +  TC + G P PE+ WF
Sbjct: 26756 KELSD----------APAFISQPRSQ---------NINEGQNVLFTCEISGEPSPEIEWF 26796

Query: 1380  KNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYG 1425
             KN+  I +S + S+   +  Y S+ I+  +  DSGKY+I  KN  G
Sbjct: 26797 KNNLPISISSNVSISRSRNVY-SLEIRNASVSDSGKYTIKAKNFRG 26841



 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 61/247 (24%), Positives = 97/247 (39%), Gaps = 22/247 (8%)

Query: 154  PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
            P  + +L++  + E   +++     G P P + W K+  +I     P K RIE   G   
Sbjct: 1510 PMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYP-KIRIEGTKGEAA 1568

Query: 214  LEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPY 273
            L+I+     D+A Y+A A N  G+ +T   V V     + EP R + +P G   +  I  
Sbjct: 1569 LKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAA 1628

Query: 274  THFDVQFLE------KFGVTFRREGETVTLKCTMLVTPDLKRVQPR-------------- 313
               +   L       + G  + +E +        L +  LKR  P               
Sbjct: 1629 PELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTM 1688

Query: 314  -AEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFV 372
              EW  D   L+ +   +M    G  SL +   +  D G+ T R  ++ G    SA L V
Sbjct: 1689 VVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIV 1748

Query: 373  RDADPLV 379
            +D   LV
Sbjct: 1749 KDEKSLV 1755



 Score = 62.0 bits (149), Expect = 4e-09
 Identities = 42/125 (33%), Positives = 59/125 (47%), Gaps = 5/125 (4%)

Query: 123   RDKLDKYAIQQMMEDKLAWERHTFEERI-SRAPEILVRLRSHTVWERMSVKLCFTVQGFP 181
             R+  D Y  + M + K    R T   R+  R PE  + L + T +   +V+   T+   P
Sbjct: 25290 REVYDYYCRRTMKKIK----RRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHP 25345

Query: 182   TPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTN 241
              P V WYK G  I       KY  ES+ G++ L IN    DD A Y+ VA N +G+ S  
Sbjct: 25346 EPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCK 25405

Query: 242   AAVVV 246
             A + V
Sbjct: 25406 AKLTV 25410



 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 73/333 (21%), Positives = 124/333 (37%), Gaps = 48/333 (14%)

Query: 76    STQEDEEQENRSRYQSLVA--AYGEAKRQRFLS-ELAHLEEDVHLARSQARDKLDKYAIQ 132
             ++Q  +E+  RS +  L    AY  +  ++    E +    +V    ++ R+ L  Y   
Sbjct: 26100 ASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHS 26159

Query: 133   QMMEDK-LAWERHTFEERISR-------APEILVRLRSHTVWERMSVKLCFTVQGFPTPV 184
                E K  A E  + EE+ +        A  IL + RS TV+E  S +      G P P 
Sbjct: 26160 ASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPT 26219

Query: 185   VQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAV 244
             V W + G ++  +A   ++++ +     T EI+     D   YS V  N+ G+      +
Sbjct: 26220 VTWLRKGQVLSTSA---RHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTL 26276

Query: 245   VVRRFRGDEEPFRS----------------------VGLPIGLPLSSMIP---------- 272
              +++ R  E+   S                      V  P      ++ P          
Sbjct: 26277 TIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEK 26336

Query: 273   YTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMF 332
               H  V    K     + E      K T +V   + R +    WY+D   LKE+   +  
Sbjct: 26337 VQHLPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAK-EVTWYKDGKKLKENGHFQFH 26395

Query: 333   FG-EGQASLSFSHLHKDDEGLYTLRIVSRGGVS 364
             +  +G   L  ++L + D+G Y   I   GG S
Sbjct: 26396 YSADGTYELKINNLTESDQGEYVCEISGEGGTS 26428



 Score = 61.2 bits (147), Expect = 7e-09
 Identities = 32/84 (38%), Positives = 47/84 (55%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             D+VTI  G  L L   V G P+P++IW K D+++ L E  S++    K  +  IK     
Sbjct: 22683 DLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQY-TGKRATAVIKFCDRS 22741

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             DSGKY++ +KN  G + + V V V
Sbjct: 22742 DSGKYTLTVKNASGTKAVSVMVKV 22765



 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 24/201 (11%)

Query: 154  PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
            P++L  L+  TV      + C  + G P P + WYK+  L+       K +   +   +T
Sbjct: 3193 PQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGF---KCKFLHDGQEYT 3249

Query: 214  LEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPY 273
            L +  A  +D A Y+  A N +G  +T+A++             SV +P  +     +P 
Sbjct: 3250 LLLIEAFPEDAAVYTCEAKNDYGVATTSASL-------------SVEVPEVVSPDQEMPV 3296

Query: 274  THFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFF 333
              +    +     T   EG+    +C +  T DLK       WY  D  +K S++ +M  
Sbjct: 3297 --YPPAIITPLQDTVTSEGQPARFQCRVSGT-DLK-----VSWYSKDKKIKPSRFFRMTQ 3348

Query: 334  GEGQASLSFSHLHKDDEGLYT 354
             E    L  +  + +DEG YT
Sbjct: 3349 FEDTYQLEIAEAYPEDEGTYT 3369



 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 73/337 (21%), Positives = 124/337 (36%), Gaps = 49/337 (14%)

Query: 1129  GPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKW------LKDDVLYETETLPNLERGI 1182
             GP   + +H    E   V+ VCK+ N  + T   W      L++   YE       E G+
Sbjct: 25196 GPVSGQIMHAVGEEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEI----TYEDGV 25251

Query: 1183  CELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGK----VYDDMILAMSRVCGKSASPL 1238
               L +  ++K D G Y+  + +D G+D S  E+  K    VYD       +   +    +
Sbjct: 25252 AILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTM 25311

Query: 1239  KVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWL---QICEPTE 1295
             ++L  P    L  + K           +    +     + +     + W    Q  +P +
Sbjct: 25312 RLLERPPEFTLPLYNK---------TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGD 25362

Query: 1296  KDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKN-RGRLIGGLPDVV 1354
              DK KYTFE     D     L ++    D+  AE+       + E + + +L   L    
Sbjct: 25363 NDK-KYTFE----SDKGLYQLTINSVTTDDD-AEYTVVARNKYGEDSCKAKLTVTLHPPP 25416

Query: 1355  T----------------IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQA 1398
             T                  EG+++     V G P P + W K+ Q + L  +  +  E  
Sbjct: 25417 TDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGL 25476

Query: 1399  KYVSMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
              Y ++ I+    ED+G Y +   N  G       + V
Sbjct: 25477 DYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 25513



 Score = 58.9 bits (141), Expect = 3e-08
 Identities = 104/506 (20%), Positives = 199/506 (39%), Gaps = 98/506 (19%)

Query: 930  FDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
            F+C+  T+ ++  W ++ E I D  ++ I        L +++   +D   Y+VS+++  G
Sbjct: 6287 FNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRG 6346

Query: 990  VS----SSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDA 1045
             +    ++ +++ E+L  +            PLK     E  +K  V FW +   L+   
Sbjct: 6347 ENVKSAANLIVEEEDLRIVE-----------PLKD---IETMEKKSVTFWCKVNRLN--V 6390

Query: 1046 SYRFIINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVL 1105
            + ++  N  EV        + DK   ++ +    F   +EG Y V    G+ KS + L++
Sbjct: 6391 TLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFP--DEGEYIVTA--GQDKSVAELLI 6446

Query: 1106 IGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKW-- 1163
            I         EA  +  E L  Q           VTE  +    C+++  K     KW  
Sbjct: 6447 I---------EAPTEFVEHLEDQ----------TVTEFDDAVFSCQLSREKANV--KWYR 6485

Query: 1164 ----LKDDVLYETETLPNLERGICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKV 1219
                +K+   Y+ E   ++ R    L+I      D  EY   ++D + +       A   
Sbjct: 6486 NGREIKEGKKYKFEKDGSIHR----LIIKDCRLDDECEYACGVEDRKSR-------ARLF 6534

Query: 1220 YDDMILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRI 1279
             +++ + + R       P  +L  P G  +    +   D+++V W   +  +   +  ++
Sbjct: 6535 VEEIPVEIIR------PPQDILEAP-GADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQM 6587

Query: 1280 GGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFA 1339
                ++  LQIC+   +D+G+Y F   D                 EA A+ +   A    
Sbjct: 6588 MSEGKIHRLQICDIKPRDQGEYRFIAKD----------------KEARAKLELAAAPKIK 6631

Query: 1340 EKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAK 1399
              ++  ++    DV     GK L +       P  E  WFK ++ +  ++      EQ  
Sbjct: 6632 TADQDLVV----DV-----GKPLTMVVPYDAYPKAEAEWFKENEPLS-TKTIDTTAEQTS 6681

Query: 1400 YVSMTIKGVTSEDSGKYSINIKNKYG 1425
            +  +  K     D G+Y I ++NK+G
Sbjct: 6682 FRILEAK---KGDKGRYKIVLQNKHG 6704



 Score = 58.5 bits (140), Expect = 4e-08
 Identities = 36/101 (35%), Positives = 61/101 (60%), Gaps = 6/101 (5%)

Query: 154 PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
           P  + RL+S TV +   V+L   V G PTPVV++Y+DG+ I  + +   ++I     +++
Sbjct: 104 PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLD---FQISQEGDLYS 160

Query: 214 LEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEE 254
           L I  A  +D+ TYS  ATN+ G+ ++ A ++V   +G+EE
Sbjct: 161 LLIAEAYPEDSGTYSVNATNSVGRATSTAELLV---QGEEE 198



 Score = 58.2 bits (139), Expect = 6e-08
 Identities = 33/106 (31%), Positives = 49/106 (46%), Gaps = 3/106 (2%)

Query: 148   ERISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIES 207
             E IS  P I+  L+  TV      K      G P P   W KDG  I Q    GKY++  
Sbjct: 26474 EPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQG---GKYKLSE 26530

Query: 208   NYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDE 253
             + G   LEI++ D  D+  Y+    N+ G VS++  + ++  +  E
Sbjct: 26531 DKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTE 26576



 Score = 57.0 bits (136), Expect = 1e-07
 Identities = 109/586 (18%), Positives = 215/586 (36%), Gaps = 97/586 (16%)

Query: 873  KVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEAR--------PGTKEISAGVDEQG 924
            KV    +GK +   +R V     G+   T++     A           TK +     E+G
Sbjct: 5868 KVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEG 5927

Query: 925  NIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSV 984
               +  +C+   + ++  W K+  EI   ++++I   G   KL + +   ED+ TY+   
Sbjct: 5928 ATAV-LECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDA 5986

Query: 985  SDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPD 1044
             D    S +  + P  +E L  L++               ++ +K   RF  + E    +
Sbjct: 5987 KDFK-TSCNLNVVPPHVEFLRPLTD--------------LQVREKEMARF--ECELSREN 6029

Query: 1045 ASYRFIINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLV 1104
            A  ++  +  E+   + + I    A  I  +V+++  +++E  Y+ ++   +        
Sbjct: 6030 AKVKWFKDGAEIKKGKKYDIISKGAVRI--LVINKCLLDDEAEYSCEVRTART------- 6080

Query: 1105 LIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWL 1164
                   TVLEE     K              + +V+E   ++LVC+V+    E +  W 
Sbjct: 6081 ---SGMLTVLEEEAVFTKNL-----------ANIEVSETDTIKLVCEVSKPGAEVI--WY 6124

Query: 1165 K-DDVLYETETLPNLERGICELL-IPKLSKKDHGEYKATLKDDRGQ-DVSILEIAGKVYD 1221
            K D+ + ET     L  G   +L I     +D G Y   L   R    V + E+A +   
Sbjct: 6125 KGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFI- 6183

Query: 1222 DMILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGG 1281
                            L++L   EG + +       +   V W   D  + S +   +  
Sbjct: 6184 -----------SKPQNLEIL---EGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIA 6229

Query: 1282 SEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEK 1341
              +   L + + T +D G Y   +   +                         AA     
Sbjct: 6230 DGKKRVLVVKDATLQDMGTYVVMVGAAR------------------------AAAHLTVI 6265

Query: 1342 NRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYV 1401
             + R++  L D   + E + +   C V      +  WF+N++ I  S  + +  +   Y 
Sbjct: 6266 EKLRIVVPLKD-TRVKEQQEVVFNCEV-NTEGAKAKWFRNEEAIFDSSKYIILQKDLVY- 6322

Query: 1402 SMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAP 1447
            ++ I+    +D   Y++++ N + GE +    ++    E +  + P
Sbjct: 6323 TLRIRDAHLDDQANYNVSLTN-HRGENVKSAANLIVEEEDLRIVEP 6367



 Score = 56.2 bits (134), Expect = 2e-07
 Identities = 98/501 (19%), Positives = 188/501 (37%), Gaps = 63/501 (12%)

Query: 948   EEISD----DERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELER 1003
             EEIS      E  K+       KL LK    + L +  V  S    +  S V   EE+ +
Sbjct: 26598 EEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIV--HEEITK 26655

Query: 1004  LMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHR 1063
                 S E++     +K+       ++G+ R  L+A +++     ++++N  E+++SE +R
Sbjct: 26656 TSQASEEVRTHA-EIKAFSTQMSINEGQ-RLVLKA-NIAGATDVKWVLNGVELTNSEEYR 26712

Query: 1064  IKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKE 1123
                  +   + +       E   T   +  +G  K Q  L L                KE
Sbjct: 26713 YGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTL---------------SKE 26757

Query: 1124  FLRKQGPHF-AEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNLERG- 1181
                   P F ++    ++ E   V   C+++      + +W K+++     +  ++ R  
Sbjct: 26758 L--SDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEI-EWFKNNLPISISSNVSISRSR 26814

Query: 1182  -ICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLKV 1240
              +  L I   S  D G+Y    K+ RGQ  +   +       M+L +     +      V
Sbjct: 26815 NVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASL-------MVLPLVEEPSREV----V 26863

Query: 1241  LCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGK 1300
             L T     LQ    + +  ++++   ++A  SS          EM +  +   +      
Sbjct: 26864 LRTSGDTSLQG--SFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSM-- 26919

Query: 1301  YTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRG-----RLIGGLPDVVT 1355
                         +  +++S  +F    +   Q +++       G       I  LP  ++
Sbjct: 26920 -----------QESFVEMSSSSF-MGISNMTQLESSTSKMLKAGIRGIPPKIEALPSDIS 26967

Query: 1356  IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQA-KYVSMTIKGVTSEDSG 1414
             I EGK L + C   G P PEV W    + I   E     +E      ++ I  V  +D G
Sbjct: 26968 IDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGG 27027

Query: 1415  KYSINIKNKYGGEKIDVTVSV 1435
              Y++++ N++G +   V + +
Sbjct: 27028 LYTLSLGNEFGSDSATVNIHI 27048



 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 40/202 (19%), Positives = 91/202 (45%), Gaps = 11/202 (5%)

Query: 1247  IRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIF 1306
             ++  C ++ +    +V W     ++ +SE   I   + +A L + + T+ D G Y  ++ 
Sbjct: 25213 VKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVV 25272

Query: 1307  DGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEK-NRGRLIGGLPDVV------TIMEG 1359
             +         +L  +   E +  + +        + +  RL+   P+        T   G
Sbjct: 25273 NDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVG 25332

Query: 1360  KTLNLTCTVFGNPDPEVIWFKNDQDIQLSEH---FSVKVEQAKYVSMTIKGVTSEDSGKY 1416
             + +    T+  +P+P V W+K+ Q I+  ++   ++ + ++  Y  +TI  VT++D  +Y
Sbjct: 25333 ENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLY-QLTINSVTTDDDAEY 25391

Query: 1417  SINIKNKYGGEKIDVTVSVYKH 1438
             ++  +NKYG +     ++V  H
Sbjct: 25392 TVVARNKYGEDSCKAKLTVTLH 25413



 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 69/264 (26%), Positives = 108/264 (40%), Gaps = 19/264 (7%)

Query: 12    RHRHFDQSYRNIQTRYLLDEYASKKRASTQASSQKSLS-QRSSSQRASSQTSLGGTICRV 70
             R      S    Q +  L E ASK   S +     + S ++S      ++TS      R 
Sbjct: 26606 RSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRT 26665

Query: 71    CA--KRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHLEE--------DVHLARS 120
              A  K  STQ    +  R   ++ +A   + K      EL + EE        D  L   
Sbjct: 26666 HAEIKAFSTQMSINEGQRLVLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIK 26725

Query: 121   QA--RDKLDKYAIQQMMEDKLAWERH-TFEERISRAPEILVRLRSHTVWERMSVKLCFTV 177
             QA  RD+     I +  E  +  +   T  + +S AP  + + RS  + E  +V     +
Sbjct: 26726 QASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEI 26785

Query: 178   QGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQ 237
              G P+P ++W+K+   I  ++      I  +  V++LEI  A   D+  Y+  A N  GQ
Sbjct: 26786 SGEPSPEIEWFKNNLPISISS---NVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQ 26842

Query: 238   VSTNAAVVVRRFRGDEEPFRSVGL 261
              S  A+++V      EEP R V L
Sbjct: 26843 CSATASLMVLPL--VEEPSREVVL 26864



 Score = 55.1 bits (131), Expect = 5e-07
 Identities = 30/86 (34%), Positives = 46/86 (53%), Gaps = 3/86 (3%)

Query: 1350  LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVT 1409
             +P+ +TI  GK L +   V+G P P   W K + ++  S H +V    +  + + IK VT
Sbjct: 12532 MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSI-LIIKDVT 12590

Query: 1410  SEDSGKYSINIKNKYG--GEKIDVTV 1433
              +DSG YS+  +N  G   +KI V V
Sbjct: 12591 RKDSGYYSLTAENSSGTDTQKIKVVV 12616



 Score = 54.7 bits (130), Expect = 6e-07
 Identities = 61/243 (25%), Positives = 101/243 (41%), Gaps = 29/243 (11%)

Query: 154  PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
            P ++  L++ TV E  SV L   + G+P+P V WY++   I  + +   ++I    G+  
Sbjct: 897  PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSID---FQITFQSGIAR 953

Query: 214  LEINRADFDDTATYSAVATNAHGQVSTNAAVVVR--------------RFRGDEEPFRS- 258
            L I  A  +D+  ++  A N  G VST+  + V+              +F  +E+ F   
Sbjct: 954  LMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVES 1013

Query: 259  ---VGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAE 315
               V     L      P       F+ K  V    EG +V   C +   P     +P   
Sbjct: 1014 RDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNP-----KPHVY 1068

Query: 316  WYRDDVLLKESKWTKMFFGE--GQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVR 373
            W +  V L      K+ + +  G+  L  S    DD G YT+ + ++ G +  SA L + 
Sbjct: 1069 WKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL-LE 1127

Query: 374  DAD 376
            +AD
Sbjct: 1128 EAD 1130



 Score = 52.4 bits (124), Expect = 3e-06
 Identities = 26/80 (32%), Positives = 47/80 (58%), Gaps = 2/80 (2%)

Query: 1346 LIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTI 1405
            L+ GL +V T++EG+++ L C + G P P V W++ D  I+ S  F +   Q+    + I
Sbjct: 899  LVSGLKNV-TVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITF-QSGIARLMI 956

Query: 1406 KGVTSEDSGKYSINIKNKYG 1425
            +   +EDSG+++ +  N+ G
Sbjct: 957  REAFAEDSGRFTCSAVNEAG 976



 Score = 52.0 bits (123), Expect = 4e-06
 Identities = 51/223 (22%), Positives = 91/223 (40%), Gaps = 31/223 (13%)

Query: 151 SRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYG 210
           ++AP     L+S  V E  +      + GFP P V W++DG +I  +  PG  +I  + G
Sbjct: 3   TQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPG-VQISFSDG 61

Query: 211 VHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSM 270
              L I      ++  YS  ATN  GQ ++ A ++V   + +  P               
Sbjct: 62  RAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLV---KAETAP--------------- 103

Query: 271 IPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTK 330
                    F+++      R+G  V L+  +   P      P  ++YRD   ++ S   +
Sbjct: 104 -------PNFVQRLQSMTVRQGSQVRLQVRVTGIP-----TPVVKFYRDGAEIQSSLDFQ 151

Query: 331 MFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVR 373
           +       SL  +  + +D G Y++   +  G +  +A L V+
Sbjct: 152 ISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 52.0 bits (123), Expect = 4e-06
 Identities = 48/207 (23%), Positives = 83/207 (40%), Gaps = 27/207 (13%)

Query: 1245 EGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFE 1304
            E + L+C +  +     V W  +D +I SS   +I     +A L I E   +D G++T  
Sbjct: 912  ESVTLECHISGYPSPT-VTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCS 970

Query: 1305 IFDGKDNHQRSLDLSGQAFDE-----------------AFAEFQQ--FKAAAFAEKNRGR 1345
              +       S  L+ Q  +E                  F E +       +  E+  G 
Sbjct: 971  AVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGP 1030

Query: 1346 LIGGLPDVVT------IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKV-EQA 1398
                 P  +T      ++EG ++   C V GNP P V W K+   +     + V   +Q 
Sbjct: 1031 GEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQT 1090

Query: 1399 KYVSMTIKGVTSEDSGKYSINIKNKYG 1425
                + I    ++D+G+Y+I ++NK+G
Sbjct: 1091 GECKLVISMTFADDAGEYTIVVRNKHG 1117



 Score = 50.8 bits (120), Expect = 9e-06
 Identities = 113/619 (18%), Positives = 230/619 (37%), Gaps = 109/619 (17%)

Query: 872  LKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARP---GTKEISAGVDEQGNIYL 928
            L + D+    +    V+A+N  G    + +   +LV+A+     T+E+   V ++ +   
Sbjct: 2090 LVIRDVTAEDSASIMVKAINIAG---ETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMA 2146

Query: 929  GFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTD 988
             F+C+      +  W K   E+ + +++++ +      L +   D  D   YS  + + +
Sbjct: 2147 TFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDE 2206

Query: 989  GVSSS-----------FVLDPEELERLMALSNEIK-------------NPTIPLKSELAY 1024
             V ++           FV + +++E   + S E++             +  + LKS   Y
Sbjct: 2207 NVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKY 2266

Query: 1025 EIFDK-GRVRFWLQAEHLSPDASYRFIIN----------------------DREVSDSEI 1061
             I  + GR    ++         Y F+I+                      D++V + +I
Sbjct: 2267 TITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDI 2326

Query: 1062 HRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQR 1121
             +++   +   +E V  +   E + +  V I   K   QS ++LI D  K       F  
Sbjct: 2327 VQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDK---QSHMLLIEDMTKEDAGNYSFTI 2383

Query: 1122 KEFLRKQGPHFAEYL--------HWDVTEECEVRLVCKVANTKKETVFKWLKDDVLYETE 1173
                       + Y           +V E  +  L CKV+     +V  +L D+ +   +
Sbjct: 2384 PALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDD 2443

Query: 1174 TLPNLERGICE-LLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCG 1232
             +  + +G  + L+I +    D G YK               I G+V  +  L++ ++  
Sbjct: 2444 RVQAIVKGTKQRLVINRTHASDEGPYKL--------------IVGRVETNCNLSVEKI-- 2487

Query: 1233 KSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICE 1292
            K    L+ L   E   +   ++     + V W  KD +I  S   +I    ++  L +  
Sbjct: 2488 KIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLN 2547

Query: 1293 PTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPD 1352
              + D+GKYTF  + G++     L ++G A  +   +                       
Sbjct: 2548 MMKDDEGKYTF--YAGENMTSGKLTVAGGAISKPLTD----------------------- 2582

Query: 1353 VVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSED 1412
              T+ E +     C V  NPD +  W ++ + + L+ +   + +  K   + I     +D
Sbjct: 2583 -QTVAESQEAVFECEV-ANPDSKGEWLRDGKHLPLTNNIRSESDGHKR-RLIIAATKLDD 2639

Query: 1413 SGKYSINIKNKYGGEKIDV 1431
             G+Y+  +       K+ V
Sbjct: 2640 IGEYTYKVATSKTSAKLKV 2658



 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 28/107 (26%), Positives = 52/107 (48%), Gaps = 6/107 (5%)

Query: 1351  PDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTS 1410
             P  +T+ EG++   +C   G P P V W +  Q +  S    V   + K  +  I  V +
Sbjct: 26195 PRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYK-STFEISSVQA 26253

Query: 1411  EDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMA---PPQQAKPK 1454
              D G YS+ ++N  G ++ + T+++ K   ++ + A   PP+   P+
Sbjct: 26254 SDEGNYSVVVENSEGKQEAEFTLTIQK--ARVTEKAVTSPPRVKSPE 26298



 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 64/265 (24%), Positives = 99/265 (37%), Gaps = 48/265 (18%)

Query: 147  EERISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIE 206
            +E + + P  +  L S  V    +V+    V G P P +QW+ +  LI    +   +  E
Sbjct: 3412 KEPLGQKPSFIQPLSSLRVHNGETVRFHARVSGIPKPEIQWFHNQQLILPTKDV-VFHFE 3470

Query: 207  SNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRR------------------ 248
             + G+  + I  A  +    YS  A N+ G+ +  A + V                    
Sbjct: 3471 ESTGMALMLIVDAYSEHAGQYSCKAANSAGEATCAATLTVTPKAPESILHERIEQEIEME 3530

Query: 249  --------FRGDEEPFRSVGLPIG-----LPLSSMIPY--THFDVQFLEKFGVTFRRE-- 291
                       +EE   S  L +      L L S  P   T FD +  E  G  F +E  
Sbjct: 3531 MKEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYPTKFDSE-KEGTGPIFIKEVS 3589

Query: 292  ------GETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHL 345
                  G+  TL  T++  P     +P+ +W+ + VLL  S   K  F     SL     
Sbjct: 3590 NADISMGDVATLSVTVIGIP-----KPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFT 3644

Query: 346  HKDDEGLYTLRIVSRGGVSDHSAFL 370
              +DEG YT    +  G +  SA+L
Sbjct: 3645 KLEDEGEYTCMASNDYGKTICSAYL 3669



 Score = 48.9 bits (115), Expect = 4e-05
 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 2/75 (2%)

Query: 1351 PDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTS 1410
            P+ V ++EG+T    C V G P P+V W+ N Q I+ S+ F V+ +   Y  + I    S
Sbjct: 1801 PEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHY--LDIVDCKS 1858

Query: 1411 EDSGKYSINIKNKYG 1425
             D+G+  +  +N  G
Sbjct: 1859 YDTGEVKVTAENPEG 1873



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 55/207 (26%), Positives = 88/207 (42%), Gaps = 26/207 (12%)

Query: 1261 KVNWCHKDAKISSSE--HMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDL 1318
            +V+W      IS+S    ++I  S+  A L I   T+ + G+Y+ +  +G          
Sbjct: 36   EVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNG---------- 85

Query: 1319 SGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIW 1378
            SGQA   A       +    AE      +  L  + T+ +G  + L   V G P P V +
Sbjct: 86   SGQATSTA-------ELLVKAETAPPNFVQRLQSM-TVRQGSQVRLQVRVTGIPTPVVKF 137

Query: 1379 FKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKH 1438
            +++  +IQ S  F +  E   Y S+ I     EDSG YS+N  N  G  +   T  +   
Sbjct: 138  YRDGAEIQSSLDFQISQEGDLY-SLLIAEAYPEDSGTYSVNATNSVG--RATSTAELLVQ 194

Query: 1439 GEKIPDMAPPQQAKPKLIPASASAAGQ 1465
            GE   +  P ++ K  +  A  S + Q
Sbjct: 195  GE---EEVPAKKTKTIVSTAQISESRQ 218



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 53/227 (23%), Positives = 89/227 (39%), Gaps = 13/227 (5%)

Query: 154  PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKY-RIESNYGVH 212
            P I+  L+     E    +    V G    V  + KD  +     +P ++ R+      +
Sbjct: 3299 PAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKI-----KPSRFFRMTQFEDTY 3353

Query: 213  TLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIP 272
             LEI  A  +D  TY+ VA+NA GQVS+ A + +  F   EE   +    + L +S    
Sbjct: 3354 QLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEGFSKFEENTSNSQWHVSLSVSFKKE 3413

Query: 273  YTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMF 332
                   F++         GETV     +   P     +P  +W+ +  L+  +K     
Sbjct: 3414 PLGQKPSFIQPLSSLRVHNGETVRFHARVSGIP-----KPEIQWFHNQQLILPTKDVVFH 3468

Query: 333  FGE--GQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADP 377
            F E  G A +     + +  G Y+ +  +  G +  +A L V    P
Sbjct: 3469 FEESTGMALMLIVDAYSEHAGQYSCKAANSAGEATCAATLTVTPKAP 3515



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 124/606 (20%), Positives = 230/606 (37%), Gaps = 106/606 (17%)

Query: 832  LWKAPVYSGSSPVSGYFVDFREEDA-GEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAV 890
            L+   V+ G +  + + ++  E D  G+W    Q  TA+   ++  ++ GK ++  +   
Sbjct: 5385 LYGVEVFVGET--AHFEIELSEPDVHGQWKLKGQPLTASPDCEI--IEDGKKHILILHNC 5440

Query: 891  NANGVGKPSDTSEPVLVEARPGTKEIS-------AGVDEQGNIYLGFDCQEMTDASQFTW 943
                 G+ S  +      A    KE+        + V         F+C+   +   F W
Sbjct: 5441 QLGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRW 5500

Query: 944  CKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELER 1003
             K  +EI+ D+RF++   G    + +K+   ED   Y     D    S   +++   L+ 
Sbjct: 5501 LKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKH-TSGKLIIEGIRLKF 5559

Query: 1004 LMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHR 1063
            L            PLK   A E   K    F ++  H   +   ++  ND+ +  +    
Sbjct: 5560 L-----------TPLKDVTAKE---KESAVFTVELSH--DNIRVKWFKNDQRLHTTRSVS 5603

Query: 1064 IKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKE 1123
            ++ +  T  I       SI++     V+          ++ +  +A  TVLE        
Sbjct: 5604 MQDEGKTHSI--TFKDLSIDDTSQIRVE----------AMGMSSEAKLTVLE-------- 5643

Query: 1124 FLRKQGPHFAEYLH-WDVTEECEVRLVCKVANTKKETVFKWLKD--DVLYETETLPNLER 1180
                  P+F   L  +   E+ EV L C++  +K +   KW KD  ++      +   + 
Sbjct: 5644 ----GDPYFTGKLQDYTGVEKDEVILQCEI--SKADAPVKWFKDGKEIKPSKNAVIKADG 5697

Query: 1181 GICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKV-YDDMILAMSRVCGKSASPLK 1239
                L++ K  K D G+Y      D G D    + +GK+  +D  + + R       PL 
Sbjct: 5698 KKRMLILKKALKSDIGQYTC----DCGTD----KTSGKLDIEDREIKLVR-------PLH 5742

Query: 1240 VLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKG 1299
             +   E    +   +   D++  NW  K                  A LQ  +   K++G
Sbjct: 5743 SVEVMETETARFETEISEDDIHANWKLKGE----------------ALLQTPDCEIKEEG 5786

Query: 1300 KYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAE-KNRGRLIGGLPDV--VTI 1356
            K    +      H   LD +G        +FQ     + A  + + R+IG L  +  VT+
Sbjct: 5787 KIHSLVL-----HNCRLDQTGG------VDFQAANVKSSAHLRVKPRVIGLLRPLKDVTV 5835

Query: 1357 MEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKY 1416
              G+T    C +    D  V W+   + ++ S+   V   + K  ++T++ V  ED+G+ 
Sbjct: 5836 TAGETATFDCEL-SYEDIPVEWYLKGKKLEPSDKV-VPRSEGKVHTLTLRDVKLEDAGEV 5893

Query: 1417 SINIKN 1422
             +  K+
Sbjct: 5894 QLTAKD 5899



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             D +TI  G+   LT    G P P+V WFK++ D+   +   +K   A      IK   S 
Sbjct: 10454 DKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRS- 10512

Query: 1412  DSGKYSINIKNKYGGEK 1428
             DSGKY + ++N  G  K
Sbjct: 10513 DSGKYCVVVENSTGSRK 10529



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             D + +  G++  +   ++G P P + W K DQ++  +    +K       S+++K     
Sbjct: 16179 DTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFA-TSLSVKDAVRV 16237

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             DSG Y +  KN  G   + V V V
Sbjct: 16238 DSGNYILKAKNVAGERSVTVNVKV 16261



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 39/145 (26%), Positives = 65/145 (44%), Gaps = 15/145 (10%)

Query: 1293  PTEKDKGKYTFEIFDGKDNHQRSLDLSGQA-FDEAFAEFQQFKAAAFAEKNRGRLIGGLP 1351
             P  K   KY+F +         ++++ G + + E+ AE +  +     +     L   L 
Sbjct: 23033 PDLKMGQKYSFRV--------AAVNVKGMSEYSESIAEIEPVERIEIPDLE---LADDLK 23081

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
               VTI  G +L L  +V G P P + W K  Q I L+    +   ++ Y  + +  V   
Sbjct: 23082 KTVTIRAGASLRLMVSVSGRPPPVITWSK--QGIDLASRAIIDTTES-YSLLIVDKVNRY 23138

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSVY 1436
             D+GKY+I  +N+ G +   V V VY
Sbjct: 23139 DAGKYTIEAENQSGKKSATVLVKVY 23163



 Score = 48.1 bits (113), Expect = 6e-05
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 7/105 (6%)

Query: 1354 VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAK-YVSMTIKGVTSED 1412
            V I EG  L +     GNP+P+++W KN   I   ++  +++E  K   ++ I    S+D
Sbjct: 1519 VNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQD 1578

Query: 1413 SGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAKPKLIP 1457
            S  Y+    NK G +     V+V        + A P+  +  +IP
Sbjct: 1579 SAWYTATAINKAGRDTTRCKVNVE------VEFAEPEPERKLIIP 1617



 Score = 48.1 bits (113), Expect = 6e-05
 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 3/86 (3%)

Query: 1350  LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVT 1409
             L  ++ I  G +L L   + G P PEV W K D +I+ +    V    + + S+ +  V 
Sbjct: 16576 LRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVT---SSFTSLVLDNVN 16632

Query: 1410  SEDSGKYSINIKNKYGGEKIDVTVSV 1435
               DSGKY++ ++N  G +   VTV V
Sbjct: 16633 RYDSGKYTLTLENSSGTKSAFVTVRV 16658



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 91/436 (20%), Positives = 177/436 (40%), Gaps = 67/436 (15%)

Query: 999  EELERLMALSNEIKNPTI-PLKSEL-----AYEIFDKGRVRFWLQAEHLSPDASYRFIIN 1052
            EE ++ +A   +I  PT  P K EL     A +IF+    R   Q      DA +R  + 
Sbjct: 2001 EEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFE----RIQSQTVGQGSDAHFRVRVV 2056

Query: 1053 DREVSDSEIHR--IKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAF 1110
             +   + E ++  +K +++  I       +    +    + I D  A+  +S+++     
Sbjct: 2057 GKPDPECEWYKNGVKIERSDRIY------WYWPEDNVCELVIRDVTAEDSASIMV----- 2105

Query: 1111 KTVLEEAEFQRKEFLRKQGPH---FAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDD 1167
            K +    E     FL  Q      F + L   V +E +     +   ++     KW KD 
Sbjct: 2106 KAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDG 2165

Query: 1168 V-LYETETLP-NLERGICELLIPKLSKKDHGEYKATLKDDRG-QDVSILEIAGKVYDDMI 1224
            + ++E +    + +R +  L I  +   D  +Y   L +D   +  + L + G V + + 
Sbjct: 2166 MEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFV- 2224

Query: 1225 LAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEE 1284
                    K    ++V  +  G  L+C +    + ++  W H D ++ S+    I     
Sbjct: 2225 --------KELQDIEVPESYSG-ELECIVS--PENIEGKWYHNDVELKSNGKYTITSRRG 2273

Query: 1285 MAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRG 1344
               L + + T++D+G+Y+F + DGK    +                 + K    A     
Sbjct: 2274 RQNLTVKDVTKEDQGEYSF-VIDGKKTTCK----------------LKMKPRPIA----- 2311

Query: 1345 RLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMT 1404
             ++ GL D   + EG  + L   V      E +W K+ Q++Q S+   + +++  ++ + 
Sbjct: 2312 -ILQGLSD-QKVCEGDIVQLEVKV-SLESVEGVWMKDGQEVQPSDRVHIVIDKQSHM-LL 2367

Query: 1405 IKGVTSEDSGKYSINI 1420
            I+ +T ED+G YS  I
Sbjct: 2368 IEDMTKEDAGNYSFTI 2383



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 116/553 (20%), Positives = 198/553 (35%), Gaps = 103/553 (18%)

Query: 930  FDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYS--VSVSDT 987
            F+C      +  TW K    I +  + +    G   KL++ +    D G Y+  + + + 
Sbjct: 4766 FECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNK 4825

Query: 988  DGVSSSFVLDPEELERLMALSNE----IKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSP 1043
            +  S++ ++  E   R +    E    +K   + L  EL     +K R   W +   +  
Sbjct: 4826 EKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSCEL-----NKERDVVWRKDGKIVV 4880

Query: 1044 DASYRFI-----------INDREVSDS--------EIHRIKCDKATGIIEMVMDRFSIEN 1084
            +   R +           IND + +D+          + ++C     ++E++ D      
Sbjct: 4881 EKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWL---- 4936

Query: 1085 EGTYTVQIHDGKAKSQSSLVLIGDAFKTVLE----------EAEFQRKEFLRKQGPHF-- 1132
                   I D   K + + +   D  K               AE   K  + + G H   
Sbjct: 4937 ----VKPIRDQHVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYL 4992

Query: 1133 --AEYLHWDVTE---ECE-VRLVCKVANTKKET-VFKWLKDDVLYETET----------- 1174
                 +  D+ E   E E  R   K+   ++E  + K ++D  +YE E+           
Sbjct: 4993 KIKNAMPEDIAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEAD 5052

Query: 1175 LPNLERGICELLIPKLS---KKDHGEYKATL-KDDRGQDVSILEIAGKVYDDMILAMSRV 1230
            +P   +   ELL P  +   K + G+   TL K    Q   +L  A       IL +  +
Sbjct: 5053 IPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEI 5112

Query: 1231 CGKSASPLKVLCTPEG--IRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWL 1288
                A PLK +  PE    R +C +   T E  V W      I SS+   I    +   L
Sbjct: 5113 ELDFAVPLKDVTVPERRQARFECVL---TREANVIWSKGPDIIKSSDKFDIIADGKKHIL 5169

Query: 1289 QICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIG 1348
             I +    D+G YT E+                       E ++  A  F    R + + 
Sbjct: 5170 VINDSQFDDEGVYTAEV-----------------------EGKKTSARLFVTGIRLKFMS 5206

Query: 1349 GLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGV 1408
             L D  T+ EG+T    C +  +    V+WFKND  +  S    +  E  K   + +K V
Sbjct: 5207 PLEDQ-TVKEGETATFVCEL-SHEKMHVVWFKNDAKLHTSRTVLISSE-GKTHKLEMKEV 5263

Query: 1409 TSEDSGKYSINIK 1421
            T +D  +    +K
Sbjct: 5264 TLDDISQIKAQVK 5276



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             DV+T+  G+T+ +   V G P+P++ W K  + +   +   + ++    V + IK     
Sbjct: 11544 DVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDL-IQDLPRVELQIKEAVRA 11602

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             D GKY I+ KN  G  +    V+V
Sbjct: 11603 DHGKYIISAKNSSGHAQGSAIVNV 11626



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 48/209 (22%), Positives = 81/209 (38%), Gaps = 22/209 (10%)

Query: 1238  LKVLCTPEGIRLQCFMKYFTDEMK-VNWCHKDAKISSSEHMRIGGSEEMAW-LQICEPTE 1295
             LK   + E  +L C ++      K V W     K+  + H +   S +  + L+I   TE
Sbjct: 26352 LKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTE 26411

Query: 1296  KDKGKYTFEIFDGKDNHQRSLDLSGQAF----------DEAFAEFQQFKAAAFAEKNRGR 1345
              D+G+Y  EI       + +L   GQAF           E     Q+   +    K   +
Sbjct: 26412 SDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPK 26471

Query: 1346  L---IGGLPDVVTIMEGKTLN------LTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVE 1396
                 I   P +VT ++  T++            G P P  IW K+ + I     + +  +
Sbjct: 26472 APEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSED 26531

Query: 1397  QAKYVSMTIKGVTSEDSGKYSINIKNKYG 1425
             +  +  + I    + DSG Y+  +KN  G
Sbjct: 26532 KGGFF-LEIHKTDTSDSGLYTCTVKNSAG 26559



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 5/91 (5%)

Query: 1345  RLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMT 1404
             +LI GL     +  G T+     + G P P   W  +  +I+  EH++V+ +    V +T
Sbjct: 11143 KLIEGL----VVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSV-LT 11197

Query: 1405  IKGVTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
             IK     D+G+Y I + N  G + + V ++V
Sbjct: 11198 IKNCLRRDTGEYQITVSNAAGSKTVAVHLTV 11228



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 24/79 (30%), Positives = 39/79 (49%)

Query: 1357 MEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKY 1416
            +EG+T      V G P PE  WF + Q I       V +++    S+ I   T  DSG++
Sbjct: 1423 LEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEW 1482

Query: 1417 SINIKNKYGGEKIDVTVSV 1435
            ++  +N+ G   I V ++V
Sbjct: 1483 TVVAQNRAGRSSISVILTV 1501



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 47/177 (26%), Positives = 74/177 (41%), Gaps = 37/177 (20%)

Query: 181  PTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVST 240
            P   V+WYKDG    +  E  KYR+ S+  VH L I   D  D   YS V       V T
Sbjct: 2155 PFVKVKWYKDGM---EVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDE-NVKT 2210

Query: 241  NAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCT 300
             A ++V                      +++ +    V+ L+   V     GE   L+C 
Sbjct: 2211 TAKLIVE--------------------GAVVEF----VKELQDIEVPESYSGE---LEC- 2242

Query: 301  MLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRI 357
             +V+P+        +WY +DV LK +    +    G+ +L+   + K+D+G Y+  I
Sbjct: 2243 -IVSPE----NIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVI 2294



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 48/202 (23%), Positives = 87/202 (43%), Gaps = 25/202 (12%)

Query: 1257 TDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEP-TEKDKGKYTFEIFDGKDNHQRS 1315
            T+  +VNW  ++  + S E  +    +    L I +  TE  +G+Y  E          +
Sbjct: 4392 TNAKEVNWYFENKLVPSDEKFKCLQDQNTYTLVIDKVNTEDHQGEYVCE----------A 4441

Query: 1316 LDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPE 1375
            L+ SG+    A  +    K AA   K +        + + +  G     TC +   P+  
Sbjct: 4442 LNDSGKTATSA--KLTVVKRAAPVIKRK-------IEPLEVALGHLAKFTCEIQSAPNVR 4492

Query: 1376 VIWFKNDQDIQLSEHFSVKVEQAKYV-SMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVS 1434
              WFK  ++I  S+  S++   +KY+ S+ I      D G+Y+    N+YG      T++
Sbjct: 4493 FQWFKAGREIYESDKCSIR--SSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLT 4550

Query: 1435 VYKHG--EKIPDMAPPQQAKPK 1454
            V   G  +K+  + P ++ +PK
Sbjct: 4551 VTVPGGEKKVRKLLPERKPEPK 4572



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 1350  LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVT 1409
             L  VV +    TL L  T+ G P+PEV W K +    L++   ++V  + +  + I  VT
Sbjct: 18741 LRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEG--ILTDRAQIEV-TSSFTMLVIDNVT 18797

Query: 1410  SEDSGKYSINIKNKYGGEKIDVTVSV 1435
               DSG+Y++ ++N  G +   V V V
Sbjct: 18798 RFDSGRYNLTLENNSGSKTAFVNVRV 18823



 Score = 45.4 bits (106), Expect = 4e-04
 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 3/80 (3%)

Query: 1356  IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGK 1415
             I  G TL L+  + G P P+V W K D+D        V    +K   + I+    ED G 
Sbjct: 10858 IKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGSK---LEIRNAAHEDGGI 10914

Query: 1416  YSINIKNKYGGEKIDVTVSV 1435
             YS+ ++N  G + + V V V
Sbjct: 10915 YSLTVENPAGSKTVSVKVLV 10934



 Score = 45.1 bits (105), Expect = 5e-04
 Identities = 91/479 (18%), Positives = 176/479 (36%), Gaps = 75/479 (15%)

Query: 943  WCKSYEEISDDERFKIETVGDH-SKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEEL 1001
            W K+  +I   +R       D+  +L +++   ED  +  V   +  G +SS      + 
Sbjct: 2065 WYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQA 2124

Query: 1002 ERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEI 1061
            ++L+  + E+++     K  +A             + E   P    ++  +  EV + + 
Sbjct: 2125 KQLITFTQELQDVVAKEKDTMAT-----------FECETSEPFVKVKWYKDGMEVHEGDK 2173

Query: 1062 HRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQR 1121
            +R+  D+    + ++    S + E    V + D   K+ + L++ G   + V E  + + 
Sbjct: 2174 YRMHSDRKVHFLSILTIDTS-DAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIE- 2231

Query: 1122 KEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNL--E 1179
                              V E     L C V+    E   KW  +DV  ++     +   
Sbjct: 2232 ------------------VPESYSGELECIVSPENIEG--KWYHNDVELKSNGKYTITSR 2271

Query: 1180 RGICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLK 1239
            RG   L +  ++K+D GEY   + D +     +      +     L+  +VC        
Sbjct: 2272 RGRQNLTVKDVTKEDQGEYSFVI-DGKKTTCKLKMKPRPIAILQGLSDQKVC-------- 2322

Query: 1240 VLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKG 1299
                 EG  +Q  +K   + ++  W     ++  S+ + I   ++   L I + T++D G
Sbjct: 2323 -----EGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAG 2377

Query: 1300 KYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEG 1359
             Y+F I         +L LS       ++                 +I  L D V ++EG
Sbjct: 2378 NYSFTI--------PALGLSTSGRVSVYSV---------------DVITPLKD-VNVIEG 2413

Query: 1360 KTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSI 1418
                L C V       V W+ ND+ I+  +     V+  K   + I    + D G Y +
Sbjct: 2414 TKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQ-RLVINRTHASDEGPYKL 2471



 Score = 45.1 bits (105), Expect = 5e-04
 Identities = 21/84 (25%), Positives = 42/84 (50%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             DV+ +  G+T  L   + G P P+V+W K+ ++++ +          +  ++ +K     
Sbjct: 18343 DVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRT 18402

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             D G+Y + + N  G + I +TV V
Sbjct: 18403 DGGQYILKLSNVGGTKSIPITVKV 18426



 Score = 44.7 bits (104), Expect = 7e-04
 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 1354 VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAK-YVSMTIKGVTSED 1412
            V ++EG T      + G P PEV WF++ Q I  S    V++  +     +TI  VT  +
Sbjct: 15   VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKAN 74

Query: 1413 SGKYSINIKNKYG 1425
            SG+YS+   N  G
Sbjct: 75   SGRYSLKATNGSG 87



 Score = 44.7 bits (104), Expect = 7e-04
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             D + I  G++L +   V G P P V WFK+  +I+   +  +  +     S+ ++  T +
Sbjct: 21594 DGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEI-TDVLGSTSLFVRDATRD 21652

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
               G Y++  KN  G  K ++ V V
Sbjct: 21653 HRGVYTVEAKNASGSAKAEIKVKV 21676



 Score = 44.3 bits (103), Expect = 9e-04
 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             D + +  G+T  L   V G P P + W + D++I+ S    +K    K + + +K     
Sbjct: 17261 DTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKAL-LIVKDAIRI 17319

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             D G+Y +   N  G +   V V V
Sbjct: 17320 DGGQYILRASNVAGSKSFPVNVKV 17343



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 29/92 (31%), Positives = 39/92 (42%), Gaps = 2/92 (2%)

Query: 167   ERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTAT 226
             E  SV     V G P P ++W KDG  +  +  P    I      + L I     +DT  
Sbjct: 25436 EGQSVCFEIRVSGIPPPTLKWEKDGQPL--SLGPNIEIIHEGLDYYALHIRDTLPEDTGY 25493

Query: 227   YSAVATNAHGQVSTNAAVVVRRFRGDEEPFRS 258
             Y   ATN  G  S  A + V R R  ++ F+S
Sbjct: 25494 YRVTATNTAGSTSCQAHLQVERLRYKKQEFKS 25525



 Score = 43.5 bits (101), Expect = 0.001
 Identities = 60/266 (22%), Positives = 105/266 (39%), Gaps = 54/266 (20%)

Query: 179  GFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQV 238
            G PT VV+W  DG  +  A    + R+ + +G  +L+   A   D+   +  ATN +G  
Sbjct: 1684 GDPTMVVEWLHDGKPLEAA---NRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTD 1740

Query: 239  STNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKF----------GVTF 288
             T+A ++V+    DE+          L   S +P     +Q +E+           GVT 
Sbjct: 1741 HTSATLIVK----DEK---------SLVEESQLPEGRKGLQRIEELERMAHEGALTGVTT 1787

Query: 289  RR------------------EGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTK 330
             +                  EGET   +C +   P     QP+  WY +  L+++SK  +
Sbjct: 1788 DQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYP-----QPKVNWYLNGQLIRKSKRFR 1842

Query: 331  MFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVR---DADPLVTGAPGAPM 387
            + + +G   L        D G   +   +  GV +H   L ++   D   ++  AP    
Sbjct: 1843 VRY-DGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRP 1901

Query: 388  DLQCHDANR-DYVIVTWKPPNTTTES 412
            +   H+  +  + +     P  TTE+
Sbjct: 1902 EFHVHEPGKLQFEVQKVDRPVDTTET 1927



 Score = 43.5 bits (101), Expect = 0.001
 Identities = 38/141 (26%), Positives = 61/141 (43%), Gaps = 8/141 (5%)

Query: 107  ELAHLEEDVHLARSQARDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVW 166
            EL H  +++     +A  +  K  I     DK+             AP+I  R++S TV 
Sbjct: 1991 ELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSM------EAPKIFERIQSQTVG 2044

Query: 167  ERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTAT 226
            +         V G P P  +WYK+G  I ++     Y  E N  V  L I     +D+A+
Sbjct: 2045 QGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDN--VCELVIRDVTAEDSAS 2102

Query: 227  YSAVATNAHGQVSTNAAVVVR 247
                A N  G+ S++A ++V+
Sbjct: 2103 IMVKAINIAGETSSHAFLLVQ 2123



 Score = 43.5 bits (101), Expect = 0.001
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 1356  IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGK 1415
             +  G +  +T    G P P V+W K D D++   +      +    S+TI+     DSGK
Sbjct: 19826 VKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRT---SLTIENANRNDSGK 19882

Query: 1416  YSINIKNKYGGEKIDVTVSV 1435
             Y++ I+N      + + V V
Sbjct: 19883 YTLTIQNVLSAASLTLVVKV 19902



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 33/94 (35%), Positives = 46/94 (48%), Gaps = 8/94 (8%)

Query: 291  EGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKM-FFGEGQASLSFSHLHKDD 349
            EG  VT  C M   P      P+  WY+D   +K  +  +M F  +G+ASL    +  +D
Sbjct: 1258 EGMGVTFHCKMSGYP-----LPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPED 1312

Query: 350  EGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAP 383
            EG+YT    +  G +  S  L+V  A PL  GAP
Sbjct: 1313 EGIYTAFASNIKGNAICSGKLYVEPAAPL--GAP 1344



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 8/115 (6%)

Query: 145  TFEERISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYR 204
            T +++  + P+I++      V E  + +    V G+P P V WY +G LI ++    ++R
Sbjct: 1786 TTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSK---RFR 1842

Query: 205  IESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSV 259
            +  + G+H L+I      DT      A N  G +     + +++     E FRSV
Sbjct: 1843 VRYD-GIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQ----REDFRSV 1892



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 80/376 (21%), Positives = 138/376 (36%), Gaps = 82/376 (21%)

Query: 905  VLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDH 964
            VL E    TK + A ++      +   C+     ++  W K  EEI +  R++I T G  
Sbjct: 6086 VLEEEAVFTKNL-ANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRK 6144

Query: 965  SKLYLKNPDKEDLGTYSVSV--SDTDG------VSSSFVLDPEELERLMALSNE----IK 1012
              L ++N   ED G Y+  +  S TDG      +++ F+  P+ LE L     E    I 
Sbjct: 6145 RILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAEFVCSIS 6204

Query: 1013 NPTIP---------LKSELAYEIFDKGRVRFWL--------------------QAEHLSP 1043
              + P         L+S   Y++   G+ R  +                     A HL+ 
Sbjct: 6205 KESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTV 6264

Query: 1044 DASYRFII--NDREVSDSEIHRIKCDKATGII--------EMVMDR---FSIENEGTYTV 1090
                R ++   D  V + +     C+  T           E + D      ++ +  YT+
Sbjct: 6265 IEKLRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTL 6324

Query: 1091 QIHDGKAKSQSSLVL---------IGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVT 1141
            +I D     Q++  +         +  A   ++EE + +  E L+            +  
Sbjct: 6325 RIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLK----------DIETM 6374

Query: 1142 EECEVRLVCKVANTKKETVFKWLK--DDVLYETETLPNLERGICELLIPKLSKKDHGEYK 1199
            E+  V   CKV   +     KW K  ++V ++      +++    L I      D GEY 
Sbjct: 6375 EKKSVTFWCKV--NRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYI 6432

Query: 1200 ATLKDDRGQDVSILEI 1215
             T     GQD S+ E+
Sbjct: 6433 VT----AGQDKSVAEL 6444



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 20/80 (25%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 1356  IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGK 1415
             +  G ++ L     G P P  +W K D ++ L            + ++T++     D+GK
Sbjct: 21997 VRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTT---DSFSTLTVENCNRNDAGK 22053

Query: 1416  YSINIKNKYGGEKIDVTVSV 1435
             Y++ ++N  G + I  TV V
Sbjct: 22054 YTLTVENNSGSKSITFTVKV 22073



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 27/87 (31%), Positives = 39/87 (44%), Gaps = 1/87 (1%)

Query: 1350  LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVE-QAKYVSMTIKGV 1408
             L  V+T+  G T+ L   V G P PEV W K+     L+    VK++ +A     ++   
Sbjct: 11835 LSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKA 11894

Query: 1409  TSEDSGKYSINIKNKYGGEKIDVTVSV 1435
                D GKY +   N  G      TV+V
Sbjct: 11895 KRSDGGKYVVTATNTAGSFVAYATVNV 11921



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 1350  LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVT 1409
             +  ++T+  G  + L  TVFG P P V W K+   ++ +E   + + Q    ++ +  V 
Sbjct: 12929 MKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAM-QRNLCTLELFSVN 12987

Query: 1410  SEDSGKYSINIKNKYGGEKIDVTVSV 1435
              +DSG Y+I  +N  G +   + + V
Sbjct: 12988 RKDSGDYTITAENSSGSKSATIKLKV 13013



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 6/99 (6%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
             V  + G+ +++     G PDP + W K    I  + H+ V V ++    +   GV  +D+
Sbjct: 24665 VHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDA 24724

Query: 1414  GKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAK 1452
             G Y +  KN++G ++  V + V      +PD  PP+  K
Sbjct: 24725 GFYVVCAKNRFGIDQKTVELDV----ADVPD--PPRGVK 24757



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             DV+ +  G+ L +   + G P P + W K+  +I+      + +    +  +T+K     
Sbjct: 19425 DVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEI-ISTDNHTLLTVKDCIRR 19483

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             D+G+Y + +KN  G   + V   V
Sbjct: 19484 DTGQYVLTLKNVAGTRSVAVNCKV 19507



 Score = 42.0 bits (97), Expect = 0.004
 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 10/98 (10%)

Query: 1354 VTIMEGKTLNLTCTVFGNPDPEVIWFKN----DQDIQLSEHFSVKVEQAKYVSMTIKGVT 1409
            + IM GKTL +   V G P P  +W K     D+D  + ++   K E      + IK   
Sbjct: 8742 IQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSE------LIIKDAL 8795

Query: 1410 SEDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAP 1447
             +D G+Y I   N  G +     V V+     + D+ P
Sbjct: 8796 RKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKP 8833



 Score = 42.0 bits (97), Expect = 0.004
 Identities = 27/87 (31%), Positives = 46/87 (52%), Gaps = 2/87 (2%)

Query: 1350  LPDVVTIMEGKTLNLTC-TVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGV 1408
             + D +TI  G T+ L   ++ G P P+  W K  +DI+ S+   +       + +TIK  
Sbjct: 14012 IKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSM-LTIKYA 14070

Query: 1409  TSEDSGKYSINIKNKYGGEKIDVTVSV 1435
             T +D+G+Y+I   N +G +   V V+V
Sbjct: 14071 TRKDAGEYTITATNPFGTKVEHVKVTV 14097



 Score = 42.0 bits (97), Expect = 0.004
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
             + +  G+ + L   + G P P   WF     ++ SE  +V+    K   +TI+  T  D+
Sbjct: 23376 IHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETH-TKVAKLTIRETTIRDT 23434

Query: 1414  GKYSINIKNKYG 1425
             G+Y++ +KN  G
Sbjct: 23435 GEYTLELKNVTG 23446



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 2/88 (2%)

Query: 1349  GLPDVVTIM-EGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKG 1407
             GLPD+  +  E     L   + G P P V W K +  +      SV+   A   ++ +  
Sbjct: 13614 GLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVE-SSAVNTTLIVYD 13672

Query: 1408  VTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
                 D+GKY+I +KN  G ++  +++ V
Sbjct: 13673 CQKSDAGKYTITLKNVAGTKEGTISIKV 13700



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 32/105 (30%), Positives = 47/105 (44%), Gaps = 9/105 (8%)

Query: 1350  LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVT 1409
             L  VVTI    TL L   + G P PEV W ++    +  +  S++   + Y  + +  V 
Sbjct: 15494 LRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHG--ESLDKASIE-STSSYTLLIVGNVN 15550

Query: 1410  SEDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAKPK 1454
               DSGKY + ++N  G +   V V V      +    PPQ  K K
Sbjct: 15551 RFDSGKYILTVENSSGSKSAFVNVRV------LDTPGPPQDLKVK 15589



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 21/84 (25%), Positives = 40/84 (47%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             +VV    G ++ L   + G P P + W+K+D+++Q +    V+       S+ IK     
Sbjct: 20508 EVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVE-NTTDLASILIKDADRL 20566

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             +SG Y + ++N  G     + V +
Sbjct: 20567 NSGCYELKLRNAMGSASATIRVQI 20590



 Score = 41.2 bits (95), Expect = 0.007
 Identities = 22/90 (24%), Positives = 43/90 (47%), Gaps = 1/90 (1%)

Query: 1346  LIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTI 1405
             L G    ++T   G    +   + G P P+V W   +  ++ ++  S+   + +  ++T+
Sbjct: 22277 LTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDR-TTLTV 22335

Query: 1406  KGVTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
             K     DSG+Y + ++N  G +   VTV V
Sbjct: 22336 KDSMRGDSGRYFLTLENTAGVKTFSVTVVV 22365



 Score = 40.8 bits (94), Expect = 0.010
 Identities = 37/149 (24%), Positives = 63/149 (42%), Gaps = 2/149 (1%)

Query: 1287 WLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRL 1346
            W+   EP  + K + T  + +GK    R   L+ Q   +     ++ +A    E     L
Sbjct: 7262 WVACGEPVAETKMEVT-GLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFL 7320

Query: 1347 IGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIK 1406
               L   +T+  G  + L  TV G P+P++ W K D  ++  +  +++    K  ++TI 
Sbjct: 7321 DVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIE-NVPKKSTVTIV 7379

Query: 1407 GVTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
                 D+G Y I   N  G     V V+V
Sbjct: 7380 DSKRSDTGTYIIEAVNVCGRATAVVEVNV 7408



 Score = 40.4 bits (93), Expect = 0.013
 Identities = 68/297 (22%), Positives = 116/297 (39%), Gaps = 49/297 (16%)

Query: 1150 CKVANTKKETVFKWLKDDVL----YETETLPNLERGICELLIPKLSKKDHGEYKATLKDD 1205
            C+V    K  V+ W K  V     Y  +   N + G C+L+I      D GEY   +++ 
Sbjct: 1057 CQVGGNPKPHVY-WKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNK 1115

Query: 1206 RGQ---DVSILEIAG-----KVYDDMILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFT 1257
             G+     S+LE A      K   +M L  ++V      P KV  T  G     + K + 
Sbjct: 1116 HGETSASASLLEEADYELLMKSQQEM-LYQTQVTAFVQEP-KVGETAPGFVYSEYEKEYE 1173

Query: 1258 DEMKV--NWCHKDAKISSS----EHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDN 1311
             E  +      KD  +  +    +   I   EE    ++ +  E    K T E    +D 
Sbjct: 1174 KEQALIRKKMAKDTVVVRTYVEDQEFHISSFEE----RLIKEIEYRIIKTTLEELLEEDG 1229

Query: 1312 HQR-SLDLS-GQAFDEAF-AEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTV 1368
             ++ ++D+S  +A +  F +  + ++                     I+EG  +   C +
Sbjct: 1230 EEKMAVDISESEAVESGFDSRIKNYR---------------------ILEGMGVTFHCKM 1268

Query: 1369 FGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYG 1425
             G P P++ W+K+ + I+  E + +   Q    S+ I  V  ED G Y+    N  G
Sbjct: 1269 SGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKG 1325



 Score = 40.4 bits (93), Expect = 0.013
 Identities = 29/109 (26%), Positives = 49/109 (44%), Gaps = 11/109 (10%)

Query: 159  RLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIE-SNYGVHTLEIN 217
            R++++ + E M V     + G+P P + WYKDG  I       +Y+++    G  +L I 
Sbjct: 1250 RIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGE---RYQMDFLQDGRASLRIP 1306

Query: 218  RADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLP 266
                +D   Y+A A+N  G    +  + V       EP   +G P  +P
Sbjct: 1307 VVLPEDEGIYTAFASNIKGNAICSGKLYV-------EPAAPLGAPTYIP 1348



 Score = 40.4 bits (93), Expect = 0.013
 Identities = 21/71 (29%), Positives = 32/71 (45%)

Query: 1355 TIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSG 1414
            T+ +G   +    V G PDPE  W+KN   I+ S+       +     + I+ VT+EDS 
Sbjct: 2042 TVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSA 2101

Query: 1415 KYSINIKNKYG 1425
               +   N  G
Sbjct: 2102 SIMVKAINIAG 2112



 Score = 40.4 bits (93), Expect = 0.013
 Identities = 31/121 (25%), Positives = 55/121 (45%), Gaps = 18/121 (14%)

Query: 1332  QFKAAAFAEKNRG--RLIG--------------GLP-DVVTIMEGKTLNLTCTVFGNPDP 1374
             QF+  A+ EK +   R++G               LP +  +I  G+ L +   V G P P
Sbjct: 17910 QFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRP 17969

Query: 1375  EVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVS 1434
              + W K+ + ++ +   +V+ E A    + IK    +D GKY++   N  G    +++V 
Sbjct: 17970 NISWVKDGEPLKQTTRVNVE-ETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVI 18028

Query: 1435  V 1435
             V
Sbjct: 18029 V 18029



 Score = 40.0 bits (92), Expect = 0.017
 Identities = 21/82 (25%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 1354 VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
            + ++EG+ L++       P P V W K+ ++++ S+  ++K +         K V + D+
Sbjct: 8024 IIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRA-DA 8082

Query: 1414 GKYSINIKNKYGGEKIDVTVSV 1435
            G Y+I ++NK G     + V V
Sbjct: 8083 GIYTITLENKLGSATASINVKV 8104



 Score = 40.0 bits (92), Expect = 0.017
 Identities = 22/93 (23%), Positives = 43/93 (46%), Gaps = 3/93 (3%)

Query: 1344  GRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKY-VS 1402
             G L   L   + +  G T+ L   V G P P++ W K   ++ L +   + ++   +   
Sbjct: 13321 GELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSK--PNVNLRDRIGLDIKSTDFDTF 13378

Query: 1403  MTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSV 1435
             +  + V   D+GKY + ++N  G ++  + V V
Sbjct: 13379 LRCENVNKYDAGKYILTLENSCGKKEYTIVVKV 13411



 Score = 40.0 bits (92), Expect = 0.017
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 1359  GKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSI 1418
             G+ + +     G P P V W K+++++     +S++   +  + +TI  VT  D+GKY +
Sbjct: 20914 GEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSL-LTIPQVTRNDTGKYIL 20972

Query: 1419  NIKNKYGGEKIDVTVSV 1435
              I+N  G  K   TVSV
Sbjct: 20973 TIENGVGEPK-SSTVSV 20988



 Score = 39.7 bits (91), Expect = 0.022
 Identities = 47/191 (24%), Positives = 75/191 (39%), Gaps = 27/191 (14%)

Query: 1263  NWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQA 1322
             +W    A +  S  ++ GGS+   ++       K++GK  +E   GKD   R   L    
Sbjct: 10059 DWTKSSADLEWSPPLKDGGSKVTGYIV----EYKEEGKEEWE--KGKDKEVRGTKLVVTG 10112

Query: 1323  FDE-AFAEFQ--QFKAAAFAEKN--------RGRLIG-------GLPDVVTIMEGKTLNL 1364
               E AF +F+      A   E          + RL+         + D + +  G  + +
Sbjct: 10113 LKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRI 10172

Query: 1365  TCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKY 1424
                V G P P V W  N++   L +  +++   A   SM IK       G YS+  KN+ 
Sbjct: 10173 IAYVSGKPPPTVTWNMNER--TLPQEATIET-TAISSSMVIKNCQRSHQGVYSLLAKNEA 10229

Query: 1425  GGEKIDVTVSV 1435
             G  K  + V V
Sbjct: 10230 GERKKTIIVDV 10240



 Score = 39.3 bits (90), Expect = 0.028
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 3/82 (3%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
             + + +G  + LT  + G P P   W K  QDI  S+   +   +  +  + IK     DS
Sbjct: 23774 IFVRQGGVIRLTIPIKGKPFPICKWTKEGQDI--SKRAMIATSET-HTELVIKEADRGDS 23830

Query: 1414  GKYSINIKNKYGGEKIDVTVSV 1435
             G Y + ++NK G + + + V V
Sbjct: 23831 GTYDLVLENKCGKKAVYIKVRV 23852



 Score = 39.3 bits (90), Expect = 0.028
 Identities = 60/321 (18%), Positives = 118/321 (36%), Gaps = 50/321 (15%)

Query: 68    CRVCAKRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHLEEDVHLARSQARDKL- 126
             C++  K +  ++ E Q+  ++  S +    +A  Q  +S+ A   E++ ++ +++++KL 
Sbjct: 26565 CKLTIKAI--KDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLA 26622

Query: 127   -----DKYAIQQMMEDKLAW--ERHTFEERISRAPEILVRLRSHTVWERMSV-------- 171
                   K  I + ++   A   E+    E I++  +    +R+H   +  S         
Sbjct: 26623 LKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQ 26682

Query: 172   KLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVA 231
             +L           V+W  +G  +  + E   YR   +    TL I +A   D    + ++
Sbjct: 26683 RLVLKANIAGATDVKWVLNGVELTNSEE---YRYGVSGSDQTLTIKQASHRDEGILTCIS 26739

Query: 232   TNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRRE 291
                 G V     + + +   D   F      I  P S  I                   E
Sbjct: 26740 KTKEGIVKCQYDLTLSKELSDAPAF------ISQPRSQNI------------------NE 26775

Query: 292   GETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEG 351
             G+ V   C +   P      P  EW+++++ +  S    +       SL   +    D G
Sbjct: 26776 GQNVLFTCEISGEPS-----PEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSG 26830

Query: 352   LYTLRIVSRGGVSDHSAFLFV 372
              YT++  +  G    +A L V
Sbjct: 26831 KYTIKAKNFRGQCSATASLMV 26851



 Score = 38.9 bits (89), Expect = 0.037
 Identities = 26/104 (25%), Positives = 44/104 (42%), Gaps = 15/104 (14%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAK---YVSMTIKGVTS 1410
             + +  G +  +     G P PE+ W + + +      F+ KV+  K   Y  ++I     
Sbjct: 17662 IVVRAGGSARIHIPFKGRPTPEITWSREEGE------FTDKVQIEKGVNYTQLSIDNCDR 17715

Query: 1411  EDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAKPK 1454
              D+GKY + ++N  G +   VTV V      +    PPQ    K
Sbjct: 17716 NDAGKYILKLENSSGSKSAFVTVKV------LDTPGPPQNLAVK 17753



 Score = 38.5 bits (88), Expect = 0.048
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
             VT+  G  ++L     G P P + W K+   ++ SE       + K ++++IK    E  
Sbjct: 21201 VTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENK-ITLSIKNAKKEHG 21259

Query: 1414  GKYSINIKNKYGGEKIDVTV 1433
             GKY++ + N      + +TV
Sbjct: 21260 GKYTVILDNAVCRIAVPITV 21279



 Score = 38.5 bits (88), Expect = 0.048
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 1359  GKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE-DSGKYS 1417
             G TL L     G P P + WF   + +Q SE+ +++     Y  + +K V  +  +GKY 
Sbjct: 24271 GSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIE-NTEHYTHLVMKNVQRKTHAGKYK 24329

Query: 1418  INIKNKYG 1425
             + + N +G
Sbjct: 24330 VQLSNVFG 24337



 Score = 38.1 bits (87), Expect = 0.063
 Identities = 25/75 (33%), Positives = 34/75 (45%), Gaps = 3/75 (4%)

Query: 172  KLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVA 231
            K    +Q  P    QW+K G  I    E  K  I S+  + +LEI R    D   Y+  A
Sbjct: 4480 KFTCEIQSAPNVRFQWFKAGREIY---ESDKCSIRSSKYISSLEILRTQVVDCGEYTCKA 4536

Query: 232  TNAHGQVSTNAAVVV 246
            +N +G VS  A + V
Sbjct: 4537 SNEYGSVSCTATLTV 4551



 Score = 38.1 bits (87), Expect = 0.063
 Identities = 22/90 (24%), Positives = 42/90 (46%), Gaps = 5/90 (5%)

Query: 1352 DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQL-SEHFSVKVEQAK----YVSMTIK 1406
            D + +  G+ +++   V G P P++ W KN+  I+  ++   +  E+         ++I 
Sbjct: 9034 DTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIP 9093

Query: 1407 GVTSEDSGKYSINIKNKYGGEKIDVTVSVY 1436
                ED G Y++   N+ G    +V V VY
Sbjct: 9094 KAVREDKGTYTVTASNRLGSVFRNVHVEVY 9123



 Score = 38.1 bits (87), Expect = 0.063
 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 1/84 (1%)

Query: 1352  DVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSE 1411
             D V +  G+   L   V G P P + W K+ ++++ +    +K+      ++  K  T  
Sbjct: 15097 DTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFS-TNLVNKDSTRR 15155

Query: 1412  DSGKYSINIKNKYGGEKIDVTVSV 1435
             DSG Y++   N  G  K    V V
Sbjct: 15156 DSGAYTLTATNPGGFAKHIFNVKV 15179



 Score = 38.1 bits (87), Expect = 0.063
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 3/72 (4%)

Query: 1355  TIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVS-MTIKGVTSEDS 1413
             T++ G+ L +     G P P V W K+  ++ L +   V  E  +  S +TIK    ED 
Sbjct: 15786 TVLAGEDLKVDVPFIGRPTPAVTWHKD--NVPLKQTTRVNAESTENNSLLTIKDACREDV 15843

Query: 1414  GKYSINIKNKYG 1425
             G Y + + N  G
Sbjct: 15844 GHYVVKLTNSAG 15855



 Score = 37.0 bits (84), Expect = 0.14
 Identities = 26/93 (27%), Positives = 42/93 (45%), Gaps = 2/93 (2%)

Query: 1353  VVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSED 1412
             +V +  G  + L   V G P P+V W K   D  + +     V+   +  + I   T +D
Sbjct: 12243 LVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAF--LVIPNSTRDD 12300

Query: 1413  SGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDM 1445
             SGKYS+ + N  G + + V V V      + D+
Sbjct: 12301 SGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDL 12333



 Score = 37.0 bits (84), Expect = 0.14
 Identities = 16/79 (20%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 1355  TIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSG 1414
             ++  G+ L +   + G P P + W K+   ++ +   +V  +     +++IK    +D G
Sbjct: 16868 SVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINV-TDSLDLTTLSIKETHKDDGG 16926

Query: 1415  KYSINIKNKYGGEKIDVTV 1433
             +Y I + N  G +   + +
Sbjct: 16927 QYGITVANVVGQKTASIEI 16945



 Score = 37.0 bits (84), Expect = 0.14
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 907   VEARPGTKEISAGVDEQGNIYLGFDC--QEMTDASQFTWCKSYEEISDDERFKIETVGDH 964
             +E  P + +I   V E+G  ++ + C  +    ++Q TW     ++ + E+++I      
Sbjct: 25193 IEIGPVSGQIMHAVGEEGG-HVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGV 25251

Query: 965   SKLYLKNPDKEDLGTYSVSVSDTDGVSSSF 994
             + LY+K+  K D GTY   V +  G  SS+
Sbjct: 25252 AILYVKDITKLDDGTYRCKVVNDYGEDSSY 25281



 Score = 36.6 bits (83), Expect = 0.18
 Identities = 110/564 (19%), Positives = 213/564 (37%), Gaps = 96/564 (17%)

Query: 879  QGKTYVFRVRAVNANGVGKP-------SDTSEPVLVEARP--GTKEISAGVDEQGNIYLG 929
            +GKT+   ++ V  + + +        S T++  ++EA P    K       E+  I L 
Sbjct: 5252 EGKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITL- 5310

Query: 930  FDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
              C+   D     W K  EEI    ++ I+  G    L +K  D +D G Y V    TD 
Sbjct: 5311 -KCEVSKDVP-VKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEY-VCDCGTDK 5367

Query: 990  VSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRF 1049
              ++  ++     RL+ +   +    + +     +EI            E   PD   ++
Sbjct: 5368 TKANVTVEA----RLIKVEKPLYGVEVFVGETAHFEI------------ELSEPDVHGQW 5411

Query: 1050 IINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDA 1109
             +  + ++ S    I  D    I+  ++    +   G  + Q  + K+ +   +  +   
Sbjct: 5412 KLKGQPLTASPDCEIIEDGKKHIL--ILHNCQLGMTGEVSFQAANAKSAANLKVKELPLI 5469

Query: 1110 FKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDVL 1169
            F T L + +                     V E+ E +  C+V+   K   F+WLK    
Sbjct: 5470 FITPLSDVK---------------------VFEKDEAKFECEVSREPK--TFRWLKG--- 5503

Query: 1170 YETETLPNLERGICELLIPKLSKKDHGEYKATLKDDRGQDVS--ILEIAGKVYDDMILAM 1227
              T+ +   +R   EL+      KD  ++   +K    +D +  + E   K +    L +
Sbjct: 5504 --TQEITGDDR--FELI------KDGTKHSMVIKSAAFEDEAKYMFEAEDK-HTSGKLII 5552

Query: 1228 SRVCGKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAW 1287
              +  K  +PLK +   E       ++   D ++V W   D ++ ++  + +        
Sbjct: 5553 EGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSM-------- 5604

Query: 1288 LQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLI 1347
                    +D+GK     F  KD    S+D + Q   EA     + K      +      
Sbjct: 5605 --------QDEGKTHSITF--KD---LSIDDTSQIRVEAMGMSSEAKLTVL--EGDPYFT 5649

Query: 1348 GGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKG 1407
            G L D   + + + + L C +    D  V WFK+ ++I+ S++  +K +  K + + +K 
Sbjct: 5650 GKLQDYTGVEKDEVI-LQCEI-SKADAPVKWFKDGKEIKPSKNAVIKADGKKRM-LILKK 5706

Query: 1408 VTSEDSGKYSINIKNKYGGEKIDV 1431
                D G+Y+ +        K+D+
Sbjct: 5707 ALKSDIGQYTCDCGTDKTSGKLDI 5730



 Score = 36.6 bits (83), Expect = 0.18
 Identities = 42/144 (29%), Positives = 64/144 (44%), Gaps = 24/144 (16%)

Query: 186  QWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVV 245
            +W+++   I  ++   KY I     V+TL I  A  DD A Y+   TN  G+   +AA +
Sbjct: 6299 KWFRNEEAIFDSS---KYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANL 6355

Query: 246  VRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTF--RREGETVTLKCTM-- 301
            +     +EE  R V      PL         D++ +EK  VTF  +     VTLK T   
Sbjct: 6356 I----VEEEDLRIVE-----PLK--------DIETMEKKSVTFWCKVNRLNVTLKWTKNG 6398

Query: 302  LVTPDLKRVQPRAEWYRDDVLLKE 325
               P   RV  R + Y+  + +K+
Sbjct: 6399 EEVPFDNRVSYRVDKYKHMLTIKD 6422



 Score = 36.6 bits (83), Expect = 0.18
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 1370  GNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYV-SMTIKGVTSEDSGKYSINIKNKYGGEK 1428
             G P   V W K+ Q   L E   V V  +K V S++IK  + ED G Y + + N  G   
Sbjct: 19048 GRPQATVNWRKDGQT--LKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSIT 19105

Query: 1429  IDVTVSV 1435
             + +T+ V
Sbjct: 19106 VPITIIV 19112



 Score = 36.6 bits (83), Expect = 0.18
 Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 1364  LTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAK--YVSMTIKGVTSEDSGKYSINIK 1421
             L C V G+P P V W++  ++I +++    ++++ K  Y  + I  VT +D+  Y +   
Sbjct: 24575 LVCKVTGHPKPIVKWYRQGKEI-IADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRAT 24633

Query: 1422  NKYG 1425
             N+ G
Sbjct: 24634 NQGG 24637



 Score = 36.2 bits (82), Expect = 0.24
 Identities = 20/84 (23%), Positives = 36/84 (42%), Gaps = 1/84 (1%)

Query: 1353  VVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSED 1412
             +V    G  + +   V G P P V W K DQ ++ ++  + +      + + I      D
Sbjct: 14702 LVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTI-LNINECVRSD 14760

Query: 1413  SGKYSINIKNKYGGEKIDVTVSVY 1436
             SG Y +  +N  G     +T+ V+
Sbjct: 14761 SGPYPLTARNIVGEVGDVITIQVH 14784



 Score = 36.2 bits (82), Expect = 0.24
 Identities = 17/72 (23%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 1354  VTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDS 1413
             VT   G+   L+C + G P P++ W++  +++  S  + +  +   + ++T+     ED 
Sbjct: 24170 VTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTH-TLTVMTEEQEDE 24228

Query: 1414  GKYSINIKNKYG 1425
             G Y+    N+ G
Sbjct: 24229 GVYTCIATNEVG 24240



 Score = 35.4 bits (80), Expect = 0.41
 Identities = 28/97 (28%), Positives = 41/97 (42%), Gaps = 9/97 (9%)

Query: 153  APEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVH 212
            AP  + +     + E  SV     V G P P V W K G  +        YR + +Y   
Sbjct: 1035 APYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTG-----YRYKVSYNKQ 1089

Query: 213  T----LEINRADFDDTATYSAVATNAHGQVSTNAAVV 245
            T    L I+    DD   Y+ V  N HG+ S +A+++
Sbjct: 1090 TGECKLVISMTFADDAGEYTIVVRNKHGETSASASLL 1126



 Score = 35.4 bits (80), Expect = 0.41
 Identities = 46/222 (20%), Positives = 81/222 (36%), Gaps = 34/222 (15%)

Query: 145  TFEERISRA--PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGK 202
            T E ++ R   P  +++  S    E  + +    V G P P   W+ DG  I       K
Sbjct: 1400 TDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVN-DYTHK 1458

Query: 203  YRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLP 262
              I+ + G  +L I  A   D+  ++ VA N  G+ S +  + V       +P       
Sbjct: 1459 VVIKED-GTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKP------- 1510

Query: 263  IGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVL 322
                             F+EK      +EG  + +K      P+     P   W ++  +
Sbjct: 1511 ----------------MFVEKLKNVNIKEGSRLEMKVRATGNPN-----PDIVWLKNSDI 1549

Query: 323  LKESKWTKMFF--GEGQASLSFSHLHKDDEGLYTLRIVSRGG 362
            +   K+ K+     +G+A+L        D   YT   +++ G
Sbjct: 1550 IVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAG 1591



 Score = 35.0 bits (79), Expect = 0.53
 Identities = 55/234 (23%), Positives = 82/234 (35%), Gaps = 50/234 (21%)

Query: 185  VQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAV 244
            V+W+KDG+ I +     KY I S   V  L IN+   DD A YS     A          
Sbjct: 6032 VKWFKDGAEIKKGK---KYDIISKGAVRILVINKCLLDDEAEYSCEVRTAR--------- 6079

Query: 245  VVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVT 304
                                   S M+     +  F +        E +T+ L C +   
Sbjct: 6080 ----------------------TSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEV--- 6114

Query: 305  PDLKRVQPRAE--WYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTLRIVSR-- 360
                  +P AE  WY+ D  + E+   ++     +  L   + H +D G Y  R+ S   
Sbjct: 6115 -----SKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRT 6169

Query: 361  -GGVSDHS-AFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTES 412
             G V  H  A  F+     L     G   +  C   +++   V WK  + T ES
Sbjct: 6170 DGKVKVHELAAEFISKPQNLEI-LEGEKAEFVC-SISKESFPVQWKRDDKTLES 6221



 Score = 34.7 bits (78), Expect = 0.69
 Identities = 23/85 (27%), Positives = 35/85 (41%), Gaps = 1/85 (1%)

Query: 1356 IMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGK 1415
            I  G    L+ TV G P P++ WF N   +  S  +    +   + S+ I     ED G+
Sbjct: 3593 ISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDH-SLIILFTKLEDEGE 3651

Query: 1416 YSINIKNKYGGEKIDVTVSVYKHGE 1440
            Y+    N YG       + +   GE
Sbjct: 3652 YTCMASNDYGKTICSAYLKINSKGE 3676



 Score = 34.7 bits (78), Expect = 0.69
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 4/73 (5%)

Query: 175  FTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESN-YGVHTLEINRADFDDTATYSAVATN 233
            +TV G P P V W+K+   +C +     Y I  N  G  T  +N    +D+  Y   A N
Sbjct: 3721 YTVVGEPAPTVTWFKENKQLCTSV---YYTIIHNPNGSGTFIVNDPQREDSGLYICKAEN 3777

Query: 234  AHGQVSTNAAVVV 246
              G+ +  A ++V
Sbjct: 3778 MLGESTCAAELLV 3790



 Score = 34.3 bits (77), Expect = 0.91
 Identities = 54/257 (21%), Positives = 107/257 (41%), Gaps = 32/257 (12%)

Query: 930  FDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDG 989
            F C+      + +W    ++I     F++    D  +L +     ED GTY+   S+  G
Sbjct: 3318 FQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVG 3377

Query: 990  -VSSSFVLDPEELERL----------MALSNEIKNPTIPLKSEL-----AYEIFDKGRVR 1033
             VSS+  L  E   +           ++LS   K   +  K        +  + +   VR
Sbjct: 3378 QVSSTANLSLEGFSKFEENTSNSQWHVSLSVSFKKEPLGQKPSFIQPLSSLRVHNGETVR 3437

Query: 1034 FWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGI-IEMVMDRFSIENEGTYTVQI 1092
            F  +   + P    ++  N + +  ++      +++TG+ + +++D +S E+ G Y+ + 
Sbjct: 3438 FHARVSGI-PKPEIQWFHNQQLILPTKDVVFHFEESTGMALMLIVDAYS-EHAGQYSCKA 3495

Query: 1093 HD--GKAKSQSSLVLIGDAFKTVL-----EEAEFQRKEF------LRKQGPHFAEYLHWD 1139
             +  G+A   ++L +   A +++L     +E E + KEF        ++G H AE     
Sbjct: 3496 ANSAGEATCAATLTVTPKAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSK 3555

Query: 1140 VTEECEVRLVCKVANTK 1156
            + E  E+     V  TK
Sbjct: 3556 INETLELLSESPVYPTK 3572



 Score = 33.9 bits (76), Expect = 1.2
 Identities = 17/59 (28%), Positives = 27/59 (45%)

Query: 1367 TVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYG 1425
            TV G P P V WFK ++ +  S ++++        +  +     EDSG Y    +N  G
Sbjct: 3722 TVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLG 3780



 Score = 33.9 bits (76), Expect = 1.2
 Identities = 19/78 (24%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 1345 RLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMT 1404
            R +  L + VT+++G+ L L+C +  N + +V+W K+ + +       V        ++T
Sbjct: 4841 RFVKTLEEEVTVVKGQPLYLSCEL--NKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALT 4898

Query: 1405 IKGVTSEDSGKYSINIKN 1422
            I      D+G Y++ ++N
Sbjct: 4899 INDADDTDAGTYTVTVEN 4916



 Score = 33.1 bits (74), Expect = 2.0
 Identities = 25/93 (26%), Positives = 36/93 (38%), Gaps = 3/93 (3%)

Query: 154   PEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHT 213
             P   +   + TV     +K+     G PTP V W+KD   + Q         E+N     
Sbjct: 15776 PAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENN---SL 15832

Query: 214   LEINRADFDDTATYSAVATNAHGQVSTNAAVVV 246
             L I  A  +D   Y    TN+ G+      V+V
Sbjct: 15833 LTIKDACREDVGHYVVKLTNSAGEAIETLNVIV 15865



 Score = 32.0 bits (71), Expect = 4.5
 Identities = 24/108 (22%), Positives = 42/108 (38%), Gaps = 28/108 (25%)

Query: 1356 IMEGKTLNLTCTVFGNPDPEVIWFKNDQ--------------------DIQLSEHFSVKV 1395
            +  G  + L  ++ G+P P + W K++                     ++Q  E F + +
Sbjct: 8319 VKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPL 8378

Query: 1396 EQAKYVSMTIKGVTS--------EDSGKYSINIKNKYGGEKIDVTVSV 1435
             Q   +  + KG +          D G Y I ++N +G  K   TVSV
Sbjct: 8379 TQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSV 8426



 Score = 32.0 bits (71), Expect = 4.5
 Identities = 24/105 (22%), Positives = 44/105 (41%), Gaps = 10/105 (9%)

Query: 1350 LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFK-------NDQDIQLSEHFSVKVEQAKYVS 1402
            L + + + EG  +N+   + G P P + WFK       N + +    H + K+      +
Sbjct: 9750 LKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVN-KLVVDDTCT 9808

Query: 1403 MTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAP 1447
            + I      D+G Y+I