Guide to the Human Genome
Home | Table of Contents | Search text | Search genes | Search sequences | Purchase | FAQ | Blog | Help

Search of human proteins with 140560919

BLASTP 2.2.11 [Jun-05-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|140560919 myomesin 1 isoform a [Homo sapiens]
         (1685 letters)

Database: hs.faa 
           37,866 sequences; 18,247,518 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|140560919 myomesin 1 isoform a [Homo sapiens]                     3393   0.0  
gi|140560917 myomesin 1 isoform b [Homo sapiens]                     1723   0.0  
gi|156104903 myomesin 2 [Homo sapiens]                                862   0.0  
gi|155969693 myomesin family, member 3 [Homo sapiens]                 746   0.0  
gi|110349719 titin isoform N2-A [Homo sapiens]                        257   8e-68
gi|110349717 titin isoform novex-2 [Homo sapiens]                     257   8e-68
gi|110349713 titin isoform novex-1 [Homo sapiens]                     257   8e-68
gi|110349715 titin isoform N2-B [Homo sapiens]                        257   8e-68
gi|253970427 immunoglobulin superfamily, member 22 [Homo sapiens]     170   9e-42
gi|148839296 immunoglobulin-like and fibronectin type III domain...   132   4e-30
gi|46049110 myosin binding protein C, slow type isoform 4 [Homo ...   117   7e-26
gi|46049125 myosin binding protein C, slow type isoform 2 [Homo ...   117   7e-26
gi|45976288 myosin binding protein C, slow type isoform 1 [Homo ...   117   7e-26
gi|148596957 myosin binding protein C, cardiac [Homo sapiens]         115   3e-25
gi|109633039 protein tyrosine phosphatase, receptor type, F isof...   114   6e-25
gi|18860892 protein tyrosine phosphatase, receptor type, D isofo...   114   1e-24
gi|119220552 sidekick 1 [Homo sapiens]                                114   1e-24
gi|109633041 protein tyrosine phosphatase, receptor type, F isof...   113   1e-24
gi|222352127 sidekick 2 [Homo sapiens]                                110   1e-23
gi|104487297 protein tyrosine phosphatase, receptor type, sigma ...   110   1e-23
gi|133908641 myosin binding protein C, fast type [Homo sapiens]       110   1e-23
gi|18860890 protein tyrosine phosphatase, receptor type, D isofo...   110   2e-23
gi|4506309 protein tyrosine phosphatase, receptor type, D isofor...   108   4e-23
gi|104487006 protein tyrosine phosphatase, receptor type, sigma ...   105   5e-22
gi|157311649 neogenin homolog 1 [Homo sapiens]                        105   5e-22
gi|46049119 myosin binding protein C, slow type isoform 3 [Homo ...   105   5e-22
gi|110431348 deleted in colorectal carcinoma [Homo sapiens]            96   3e-19
gi|193083163 roundabout, axon guidance receptor, homolog 2 isofo...    96   4e-19
gi|61888896 roundabout, axon guidance receptor, homolog 2 isofor...    96   4e-19
gi|205360934 fibronectin type III domain containing 3B [Homo sap...    95   5e-19

>gi|140560919 myomesin 1 isoform a [Homo sapiens]
          Length = 1685

 Score = 3393 bits (8798), Expect = 0.0
 Identities = 1685/1685 (100%), Positives = 1685/1685 (100%)

Query: 1    MSLPFYQRCHQHYDLSYRNKDVRSTVSHYQREKKRSAVYTQGSTAYSSRSSAAHRRESEA 60
            MSLPFYQRCHQHYDLSYRNKDVRSTVSHYQREKKRSAVYTQGSTAYSSRSSAAHRRESEA
Sbjct: 1    MSLPFYQRCHQHYDLSYRNKDVRSTVSHYQREKKRSAVYTQGSTAYSSRSSAAHRRESEA 60

Query: 61   FRRASASSSQQQASQHALSSEVSRKAASAYDYGSSHGLTDSSLLLDDYSSKLSPKPKRAK 120
            FRRASASSSQQQASQHALSSEVSRKAASAYDYGSSHGLTDSSLLLDDYSSKLSPKPKRAK
Sbjct: 61   FRRASASSSQQQASQHALSSEVSRKAASAYDYGSSHGLTDSSLLLDDYSSKLSPKPKRAK 120

Query: 121  HSLLSGEEKENLPSDYMVPIFSGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITT 180
            HSLLSGEEKENLPSDYMVPIFSGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITT
Sbjct: 121  HSLLSGEEKENLPSDYMVPIFSGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITT 180

Query: 181  SKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKS 240
            SKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKS
Sbjct: 181  SKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKS 240

Query: 241  RKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSI 300
            RKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSI
Sbjct: 241  RKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSI 300

Query: 301  AGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGE 360
            AGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGE
Sbjct: 301  AGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGE 360

Query: 361  LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGE 420
            LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGE
Sbjct: 361  LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGE 420

Query: 421  TMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLY 480
            TMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLY
Sbjct: 421  TMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLY 480

Query: 481  TIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSP 540
            TIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSP
Sbjct: 481  TIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSP 540

Query: 541  ILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSE 600
            ILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSE
Sbjct: 541  ILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSE 600

Query: 601  PVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKP 660
            PVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKP
Sbjct: 601  PVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKP 660

Query: 661  PGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGV 720
            PGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGV
Sbjct: 661  PGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGV 720

Query: 721  GEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGS 780
            GEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGS
Sbjct: 721  GEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGS 780

Query: 781  GKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVS 840
            GKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVS
Sbjct: 781  GKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVS 840

Query: 841  PDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVS 900
            PDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVS
Sbjct: 841  PDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVS 900

Query: 901  ETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKI 960
            ETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKI
Sbjct: 901  ETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKI 960

Query: 961  GGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLG 1020
            GGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLG
Sbjct: 961  GGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLG 1020

Query: 1021 APSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEA 1080
            APSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEA
Sbjct: 1021 APSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEA 1080

Query: 1081 KAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPG 1140
            KAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPG
Sbjct: 1081 KAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPG 1140

Query: 1141 TKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDL 1200
            TKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDL
Sbjct: 1141 TKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDL 1200

Query: 1201 GMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQV 1260
            GMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQV
Sbjct: 1201 GMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQV 1260

Query: 1261 RFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQL 1320
            RFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQL
Sbjct: 1261 RFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQL 1320

Query: 1321 QDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKV 1380
            QDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKV
Sbjct: 1321 QDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKV 1380

Query: 1381 ANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSR 1440
            ANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSR
Sbjct: 1381 ANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSR 1440

Query: 1441 LKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIR 1500
            LKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIR
Sbjct: 1441 LKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIR 1500

Query: 1501 YSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQR 1560
            YSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQR
Sbjct: 1501 YSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQR 1560

Query: 1561 LKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCN 1620
            LKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCN
Sbjct: 1561 LKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCN 1620

Query: 1621 LKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALESLKG 1680
            LKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALESLKG
Sbjct: 1621 LKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALESLKG 1680

Query: 1681 GKKAK 1685
            GKKAK
Sbjct: 1681 GKKAK 1685


>gi|140560917 myomesin 1 isoform b [Homo sapiens]
          Length = 1589

 Score = 1723 bits (4462), Expect = 0.0
 Identities = 885/1039 (85%), Positives = 918/1039 (88%), Gaps = 24/1039 (2%)

Query: 1    MSLPFYQRCHQHYDLSYRNKDVRSTVSHYQREKKRSAVYTQGSTAYSSRSSAAHRRESEA 60
            MSLPFYQRCHQHYDLSYRNKDVRSTVSHYQREKKRSAVYTQGSTAYSSRSSAAHRRESEA
Sbjct: 1    MSLPFYQRCHQHYDLSYRNKDVRSTVSHYQREKKRSAVYTQGSTAYSSRSSAAHRRESEA 60

Query: 61   FRRASASSSQQQASQHALSSEVSRKAASAYDYGSSHGLTDSSLLLDDYSSKLSPKPKRAK 120
            FRRASASSSQQQASQHALSSEVSRKAASAYDYGSSHGLTDSSLLLDDYSSKLSPKPKRAK
Sbjct: 61   FRRASASSSQQQASQHALSSEVSRKAASAYDYGSSHGLTDSSLLLDDYSSKLSPKPKRAK 120

Query: 121  HSLLSGEEKENLPSDYMVPIFSGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITT 180
            HSLLSGEEKENLPSDYMVPIFSGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITT
Sbjct: 121  HSLLSGEEKENLPSDYMVPIFSGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITT 180

Query: 181  SKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKS 240
            SKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKS
Sbjct: 181  SKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKS 240

Query: 241  RKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSI 300
            RKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSI
Sbjct: 241  RKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSI 300

Query: 301  AGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGE 360
            AGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGE
Sbjct: 301  AGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGE 360

Query: 361  LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGE 420
            LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGE
Sbjct: 361  LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGE 420

Query: 421  TMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLY 480
            TMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLY
Sbjct: 421  TMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLY 480

Query: 481  TIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSP 540
            TIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSP
Sbjct: 481  TIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSP 540

Query: 541  ILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSE 600
            ILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSE
Sbjct: 541  ILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSE 600

Query: 601  PVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKP 660
            PVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKP
Sbjct: 601  PVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKP 660

Query: 661  PGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGV 720
            PGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGV
Sbjct: 661  PGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGV 720

Query: 721  GEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGS 780
            GEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGS
Sbjct: 721  GEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGS 780

Query: 781  GKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVS 840
            GKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAI     
Sbjct: 781  GKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSP 840

Query: 841  PDVCPALS-------------DEPGGLTASRGRVHEASPPTFQKDALLG--SKPNKPSLP 885
            P     L              D+ GG   +   V+        ++ + G   K  + ++ 
Sbjct: 841  PCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVN-------YREVIDGVPGKWREANVK 893

Query: 886  SSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLK-KKTDRAPPSPPCDITCLE 944
            + S+   +    K +   Q ++            + S+  K ++   A P PP  + C E
Sbjct: 894  AVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSE 953

Query: 945  SFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKEN 1004
              +DS+VL WK P   G   +TGY+V+ +E       +WR  N  A+     K+  LKE 
Sbjct: 954  VRKDSLVLQWKPPVHSGRTPVTGYFVDLKEA-KAKEDQWRGLNEAAIKNVYLKVRGLKEG 1012

Query: 1005 MVYQFQVAAMNMAGLGAPS 1023
            + Y F+V A+N AG+G PS
Sbjct: 1013 VSYVFRVRAINQAGVGKPS 1031



 Score = 1638 bits (4241), Expect = 0.0
 Identities = 853/1106 (77%), Positives = 905/1106 (81%), Gaps = 50/1106 (4%)

Query: 621  WTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAG 679
            ++  + V + +      P  P D+   EA + Y+++SWK P   G   I+ YF++KCE G
Sbjct: 493  YSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVG 552

Query: 680  TENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDI- 738
            T++W + N + PVK  RF +  L EG+SY FRVR  N  G+G PS  +E     D  +  
Sbjct: 553  TDSWSQCN-DTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKA 611

Query: 739  -----PKAPGK-------------IIPSRNTDTSV--------VVSWEE-SKDAKELVGY 771
                 P AP               I+P   TD SV        V+SW+   +   E + Y
Sbjct: 612  RLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMY 671

Query: 772  YIEASVAGSGKWEPCNNN-PVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIE 830
            ++E   AG+  W+  N   PVK  RF    L  G+SY FRVR  N+AG+ E S+ +E   
Sbjct: 672  FVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTV 731

Query: 831  VKAAIGGGVSPD-VCPALSDEPGGLTASR---------GRVHEASPPTFQKDALLGSKPN 880
            V   +    +P  + P+ + +   + +           G   EAS     K     + P 
Sbjct: 732  VGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPV 791

Query: 881  KPS-LPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCD 939
            K S         GQ+ + +V       L+   Q         S+ ++ K   APPSPPCD
Sbjct: 792  KGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQD--------SEAIEVKAAIAPPSPPCD 843

Query: 940  ITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKIS 999
            ITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKIS
Sbjct: 844  ITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKIS 903

Query: 1000 NLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQW 1059
            NLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQW
Sbjct: 904  NLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQW 963

Query: 1060 KPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAIN 1119
            KPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAIN
Sbjct: 964  KPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAIN 1023

Query: 1120 QAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTE 1179
            QAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTE
Sbjct: 1024 QAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTE 1083

Query: 1180 DSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEH 1239
            DSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEH
Sbjct: 1084 DSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEH 1143

Query: 1240 KFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTG 1299
            KFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTG
Sbjct: 1144 KFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTG 1203

Query: 1300 IIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPH 1359
            IIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPH
Sbjct: 1204 IIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPH 1263

Query: 1360 FVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFS 1419
            FVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFS
Sbjct: 1264 FVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFS 1323

Query: 1420 KKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYS 1479
            KKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYS
Sbjct: 1324 KKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYS 1383

Query: 1480 FVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTG 1539
            FVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTG
Sbjct: 1384 FVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTG 1443

Query: 1540 HQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGD 1599
            HQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGD
Sbjct: 1444 HQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGD 1503

Query: 1600 PPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDF 1659
            PPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDF
Sbjct: 1504 PPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDF 1563

Query: 1660 TVSVFIPEEEARMAALESLKGGKKAK 1685
            TVSVFIPEEEARMAALESLKGGKKAK
Sbjct: 1564 TVSVFIPEEEARMAALESLKGGKKAK 1589



 Score = 87.0 bits (214), Expect = 1e-16
 Identities = 40/97 (41%), Positives = 57/97 (58%), Gaps = 2/97 (2%)

Query: 510  PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFID--KCEVGTDSWSQCNDTPVKFA 567
            P  P  +KC E  KD +++ WK P   G +P+ GYF+D  + +   D W   N+  +K  
Sbjct: 943  PGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNV 1002

Query: 568  RFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAA 604
               V GL EG SY+FRVRA+N+ G+G PS ++ PV A
Sbjct: 1003 YLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA 1039



 Score = 31.2 bits (69), Expect = 8.9
 Identities = 22/83 (26%), Positives = 36/83 (43%), Gaps = 2/83 (2%)

Query: 1583 TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFT--INGVSTAD 1640
            T+ E + + L C++ G P P V+W KN+  +    +        R    T  ING    D
Sbjct: 287  TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346

Query: 1641 SGKYGLVVKNKYGSETSDFTVSV 1663
            + +Y     N  G  ++  +V V
Sbjct: 347  TAQYRASAMNVKGELSAYASVVV 369



 Score = 31.2 bits (69), Expect = 8.9
 Identities = 22/83 (26%), Positives = 36/83 (43%), Gaps = 2/83 (2%)

Query: 287  TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
            T+ E + + L C++ G P P V+W KN+  +    +        R    T  ING    D
Sbjct: 1487 TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFT--INGVSTAD 1544

Query: 347  TAQYRASAMNVKGELSAYASVVV 369
            + +Y     N  G  ++  +V V
Sbjct: 1545 SGKYGLVVKNKYGSETSDFTVSV 1567


>gi|156104903 myomesin 2 [Homo sapiens]
          Length = 1465

 Score =  862 bits (2228), Expect = 0.0
 Identities = 469/1084 (43%), Positives = 652/1084 (60%), Gaps = 61/1084 (5%)

Query: 625  IIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENW 683
            + V + +P     PG P DL   +A R YV+++WKPP       +M YFV++CE GT NW
Sbjct: 370  LFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNW 429

Query: 684  QRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD------ 737
             + N + PVK  ++ +  L EG+SY FRVR  NSAG+  PS  ++     D LD      
Sbjct: 430  VQCN-DAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQA 488

Query: 738  ---------------------IPKAPGKIIPSRNTDTSVVVSWEE-SKDAKELVGYYIEA 775
                                 +P  P  +  S  +   VV+SWE  +   K+ + Y+IE 
Sbjct: 489  VHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEK 548

Query: 776  SVAGSGKWEPCN-NNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAA 834
            SV GSG W+  N    V+  R+    L+ G+SY+FRV + N  GLSE S+ +  I+ +  
Sbjct: 549  SVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQ-- 606

Query: 835  IGGGVSPDVCPALSDEPGGLTASRGR----VHEASPPTFQKDALLGSKPNKPSL------ 884
                   DV   +   PG + ASR      V +   P  ++D LLG   +          
Sbjct: 607  -------DVT-VVPSAPGRVLASRNTKTSVVVQWDRPKHEED-LLGYYVDCCVAGTNLWE 657

Query: 885  PSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSK----SDPLKKKTDRAPPSPPCDI 940
            P + + +G         T  E+     +     G S+    SD +K +     PS P  I
Sbjct: 658  PCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGI 717

Query: 941  TCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISN 1000
            T L     SM LGWK P   GG+ I GYY++ REV       W E N          +  
Sbjct: 718  TLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHK---NWHEVNSSPSKPTILTVDG 774

Query: 1001 LKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWK 1060
            L E  +Y+F++AA+N+AG+G PS  SE FKCE WT+  PGP + L   EVR  SLV+ WK
Sbjct: 775  LTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWK 834

Query: 1061 PPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQ 1120
             PV+SG +PV+GYFVD +E  A E  W  +N+    N YLKV  L++G +YVFRVRA+N 
Sbjct: 835  APVYSGSSPVSGYFVDFREEDAGE--WITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNA 892

Query: 1121 AGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTED 1180
             GVGKPSD + PV+ E RPGTKE+   VD+ G I L F+C +MT  S+F+W K Y    D
Sbjct: 893  NGVGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISD 952

Query: 1181 SPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHK 1240
              R ++E+ G+ +K+  K+   +DLG YS  V+DTDG++SS+++D EEL+RL+ALS+E K
Sbjct: 953  DERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIK 1012

Query: 1241 FPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGI 1300
             PT+P+KSELA EI +KG+VRFW+QAE LS +A   +I N++E+ +   +++  D+ TGI
Sbjct: 1013 NPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGI 1072

Query: 1301 IEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHF 1360
            IEM M++   E+EGTYT Q+ DGKA + S++VL+GD FK + +EAEFQR+E++RKQGPHF
Sbjct: 1073 IEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHF 1132

Query: 1361 VEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSK 1420
             EYL W+VT EC V L CKVAN KKET   W KD+     +   + + GIC LLI + SK
Sbjct: 1133 AEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNLERGICELLIPKLSK 1192

Query: 1421 KDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSF 1480
            KD G Y+  LKDDRG+D S L++  + + ++++ + +    SA+ LK+  T EGI+L  F
Sbjct: 1193 KDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLKVLCTPEGIRLQCF 1252

Query: 1481 VTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGH 1540
            + Y+ +++KVNW H  + I  S+ ++ G + E  WLQI EPT  DKGKY  E+FDGK  H
Sbjct: 1253 MKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNH 1312

Query: 1541 QKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDP 1600
            Q+++DLSGQA+DEA+AEFQ+ K AA AEKNR R++GGLPDVVTI EGK LNLTC V+G+P
Sbjct: 1313 QRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNP 1372

Query: 1601 PPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFT 1660
             PEV W KN++ +   +H ++K E  +    TI GV++ DSGKY + +KNKYG E  D T
Sbjct: 1373 DPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYGGEKIDVT 1432

Query: 1661 VSVF 1664
            VSV+
Sbjct: 1433 VSVY 1436



 Score =  667 bits (1720), Expect = 0.0
 Identities = 465/1502 (30%), Positives = 750/1502 (49%), Gaps = 131/1502 (8%)

Query: 138  VPIFSGRQKHVSGITDTEEER--IKEAAAYIAQRNLLASEEGITT-SKQSTASKQTT--- 191
            VP +  R +H        + R  + E A+        +S++ ++  S    AS QT+   
Sbjct: 6    VPFYQKRHRHFDQSYRNIQTRYLLDEYASKKRASTQASSQKSLSQRSSSQRASSQTSLGG 65

Query: 192  ---------ASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRK 242
                      S Q    +++ +  QS  +    A RQ  +S+ A     +E+    +S+ 
Sbjct: 66   TICRVCAKRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHL---EEDVHLARSQA 122

Query: 243  VVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAG 302
               R+K ++ ++++ +E+   +     E+ +  APE +++ RSHTVWE+ +VKL  ++ G
Sbjct: 123  ---RDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVWERMSVKLCFTVQG 179

Query: 303  WPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELS 362
            +P P V WYK+   I   A PGKY IES YG+HTLEIN  DF+DTA Y A A N  G++S
Sbjct: 180  FPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVS 239

Query: 363  AYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETM 422
              A+VVV+R++G+ +  R       +PLS  + PY   + F++ F +KF V+F REGET+
Sbjct: 240  TNAAVVVRRFRGDEEPFRSVGLPIGLPLS-SMIPY---THFDVQFLEKFGVTFRREGETV 295

Query: 423  SLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTI 482
            +L C +++TP++K  QP  +WYR+ V L  SKW +  +   +A+L+FSHL+K+DEGLYT+
Sbjct: 296  TLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTL 355

Query: 483  RVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPIL 542
            R+        +SA++FVRDAD  + GAP AP+D++C +AN+DY+I++WK P     SP++
Sbjct: 356  RIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVM 415

Query: 543  GYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPV 602
            GYF+D+CEVGT++W QCND PVK  ++PVTGL EGRSYIFRVRAVN  GI  PSRVS+ V
Sbjct: 416  GYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAV 475

Query: 603  AALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPG 662
            AALDP +  RL++          I  ++   +  VPGPPT +  +E +R+YVVLSW+PP 
Sbjct: 476  AALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPT 535

Query: 663  QRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGE 722
             RG + +MYF+EK   G+ +WQRVN +  V+SPR+A+FDL EGKSY FRV  +N  G+ E
Sbjct: 536  PRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSE 595

Query: 723  PSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGK 782
            PSE T      D   +P APG+++ SRNT TSVVV W+  K  ++L+GYY++  VAG+  
Sbjct: 596  PSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNL 655

Query: 783  WEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPD 842
            WEPCN+ P+  +RF  HGL TG+ YIFRV+AVNA G+SE SQ+S+ I+V+AA+       
Sbjct: 656  WEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAAL------- 708

Query: 843  VCPALSDEPGGLTASRGRVHEAS-----PPTFQKDALLG-----------------SKPN 880
                +   P G+T      H  +     P       +LG                 S P+
Sbjct: 709  ---TVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPS 765

Query: 881  KPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAP-PSPPCD 939
            KP++ +     G TE S      + ++         +    S+  K +    P P P  D
Sbjct: 766  KPTILTVD---GLTEGS----LYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYD 818

Query: 940  ITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKIS 999
            +T  E    S+V+ WK P   G + ++GY+V++RE      G+W   N    +    K+S
Sbjct: 819  LTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFRE---EDAGEWITVNQTTTANRYLKVS 875

Query: 1000 NLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQW 1059
            +L++   Y F+V A+N  G+G PS  SE    E    A PG    +      + ++ L +
Sbjct: 876  DLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVE----ARPG-TKEISAGVDEQGNIYLGF 930

Query: 1060 KPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVR--- 1116
                 +  +  T  +    E  + +++++         +YLK    ++  +Y   V    
Sbjct: 931  DCQEMTDASQFT--WCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTD 988

Query: 1117 AINQAGVGKPSD------LAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFS 1170
             ++ + V  P +      L+  +   T P   E+   + D G +    + + ++P + + 
Sbjct: 989  GVSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYR 1048

Query: 1171 W--SKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLI---- 1224
            +  +   VS  +  R++ +      +M      +++ G Y+  + D    + S L+    
Sbjct: 1049 FIINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGD 1108

Query: 1225 ------DEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYI 1278
                  +E E +R   L  +           L  ++ E+ +VR   +      N K   +
Sbjct: 1109 AFKTVLEEAEFQRKEFLRKQGPH----FAEYLHWDVTEECEVRLVCKV----ANTKKETV 1160

Query: 1279 FN--EKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGD 1336
            F   + ++    +   +++R  GI E+ + KL  +D G Y   L+D +  + S + + G 
Sbjct: 1161 FKWLKDDVLYETETLPNLER--GICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGK 1218

Query: 1337 VFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDER 1396
            V+  +           + +        L    T E  + L+C +     E  + W   + 
Sbjct: 1219 VYDDMILA--------MSRVCGKSASPLKVLCTPE-GIRLQCFMKYFTDEMKVNWCHKDA 1269

Query: 1397 EISVDE--KHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMME 1454
            +IS  E  +    + +  L I E ++KD G Y   + D +   +  L L  +AF E   E
Sbjct: 1270 KISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAE 1329

Query: 1455 VCKKIALSATDLK----------IQSTAEGIQLYSFVTYYVE-DLKVNWSHNGSAIRYSD 1503
              +  A +  +            + +  EG  L    T +   D +V W  N   I+ S+
Sbjct: 1330 FQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSE 1389

Query: 1504 RVKTGV-TGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLK 1562
                 V   + + + I   T  D GKY + + +   G +  V +S   + E   +    +
Sbjct: 1390 HFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQ 1449

Query: 1563 QA 1564
            QA
Sbjct: 1450 QA 1451



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 18/87 (20%)

Query: 1  MSLPFYQRCHQHYDLSYRNKDVRSTVSHYQREKKRSAVYTQGSTAYSSRSSAAHRRESEA 60
          +++PFYQ+ H+H+D SYRN   R  +  Y  +K+        ST  SS+ S + R     
Sbjct: 4  VTVPFYQKRHRHFDQSYRNIQTRYLLDEYASKKR-------ASTQASSQKSLSQR----- 51

Query: 61 FRRASASSSQQQASQHALSSEVSRKAA 87
                SSSQ+ +SQ +L   + R  A
Sbjct: 52 ------SSSQRASSQTSLGGTICRVCA 72


>gi|155969693 myomesin family, member 3 [Homo sapiens]
          Length = 1437

 Score =  746 bits (1925), Expect = 0.0
 Identities = 427/1094 (39%), Positives = 620/1094 (56%), Gaps = 68/1094 (6%)

Query: 625  IIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQ-RGHEGIMYFVEKCEAGTENW 683
            ++V + E      PG P ++   +  R  ++L+W PP   RG+    Y +E+C+  +  W
Sbjct: 360  VLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEW 419

Query: 684  QRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK-------- 735
               + E P  + R  +  L EG+SY FRVR  +  G   PS+A+E+ V+GD         
Sbjct: 420  IACH-EAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTE 478

Query: 736  -------------------LDIPKAPGKIIPSRNTDTSVVVSWEE-SKDAKELVGYYIEA 775
                               + IP  P  +  S   +  VV++WEE S   +  + Y +E 
Sbjct: 479  IPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEK 538

Query: 776  SVAGSGKWEPCNN-NPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAA 834
            SV GSG WE  ++ +PV+  RF    L   +SY+FRVRA+N  GLS+ S+ SE I ++  
Sbjct: 539  SVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGP 598

Query: 835  IGGGVSPDVCPALSDEPGGLTAS---------------RGRVHEASPPTFQKDALLGSKP 879
                  P    A  D    ++ +                 +V  +   T     + G++ 
Sbjct: 599  PATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRF 658

Query: 880  NKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCD 939
              P L +  +   +  V  VSE               +  + ++P++ K   A PS P  
Sbjct: 659  TVPGLRTGKEY--EFCVRSVSEA-----------GVGESSAATEPIRVKQALATPSAPYG 705

Query: 940  ITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKIS 999
               L   ++ MV+GWK P + GG +I GY+++     D     W   N + +     K+S
Sbjct: 706  FALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQH---DSEELDWHAVNQQPIPTRVCKVS 762

Query: 1000 NLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQW 1059
            +L E   Y+F+  A N AG+G  SA S  F+C+EWT+  PGPP+ ++ SEVR  SLVLQW
Sbjct: 763  DLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQW 822

Query: 1060 KPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAIN 1119
            +PP++ G  PVTGY V  +E  +  +QW+ +    I   +L+V  L+ G SYVF+V+A+N
Sbjct: 823  EPPLYMGAGPVTGYHVSFQEEGS--EQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMN 880

Query: 1120 QAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTE 1179
             AG+G+PS    PV+ E +PG  E+ V VD++G I L FE  +    SEF WSKDY    
Sbjct: 881  SAGLGQPSMPTDPVLLEDKPGAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPL 940

Query: 1180 DSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTD-GIASSYLIDEEELKRLLALSHE 1238
            D  R+++E K NK+K+  K+ G++DLG YS  VTD D  I++S+ + EEEL++L  LSHE
Sbjct: 941  DPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHE 1000

Query: 1239 HKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNT 1298
             + P + + S   ++ILE+G+VR W++ EKLS  A+++ IFN KEIF  P  K++ DR  
Sbjct: 1001 IRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREK 1060

Query: 1299 GIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGP 1358
            G++E+ ++ L +ED+G+YT QLQDGKA N  T+ LV D F KL ++A+ +R++W RKQGP
Sbjct: 1061 GLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGP 1120

Query: 1359 HFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEF 1418
            +F   L W+VT +C V L CKV N KKET   W+    E+  D ++D + G   L I E 
Sbjct: 1121 YFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMP-DGQYDPETGTGLLCIEEL 1179

Query: 1419 SKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLY 1478
            SKKD GIY  ++ DDRG+D + L L  +A   +  E+ +  ALSAT LKIQ T EGI+++
Sbjct: 1180 SKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIF 1239

Query: 1479 SFVTYY-VEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGK 1537
            S V YY VE +K  W H    +   DR++TG T ++IWL I +P  +DKGKY +E+  GK
Sbjct: 1240 SKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGK 1299

Query: 1538 TGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVW 1597
               Q + DLSGQA+++A AE QRLK  AI EKNRA+V+ GLPDV TI E K L LTC V 
Sbjct: 1300 EVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVS 1359

Query: 1598 GDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETS 1657
            GDP PE+SWLKN++ +   D   ++   G     TI  V++ DSG+YG+ VKNKYGSET 
Sbjct: 1360 GDPTPEISWLKNDQPVTFLDRYRMEVR-GTEVTITIEKVNSEDSGRYGVFVKNKYGSETG 1418

Query: 1658 DFTVSVFIPEEEAR 1671
              T+SVF   +E +
Sbjct: 1419 QVTISVFKHGDEPK 1432



 Score =  455 bits (1171), Expect = e-127
 Identities = 383/1444 (26%), Positives = 665/1444 (46%), Gaps = 138/1444 (9%)

Query: 175  EEGITTSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQ---SVVSKQATSALQ 231
            EE   + +  ++ ++ T        + S A     A+   TAS +       ++ TSA++
Sbjct: 34   EERQHSLRMGSSVRRRTFRSSEEEHEFSAADYALAAALALTASSELSWEAQLRRQTSAVE 93

Query: 232  QEETSEKK---------------SRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHA 276
             EE  +K+                   ++R++ +  +LR+  EE      +L E      
Sbjct: 94   LEERGQKRVGFGNDWERTEIAFLQTHRLLRQRRDWKTLRRRTEEKVQEAKELRELCYGRG 153

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHA-NPGKYIIESRYGMH 335
            P F I  RSH VWE   V L C++   P P+VTWYKN   I+      GKY I + YG+ 
Sbjct: 154  PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLL 213

Query: 336  TLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGE---FDETRFHAGASTMPLSF 392
            +LEI  C  ED+A Y     N  G+ S++A V+V+ Y G+   FD   F         +F
Sbjct: 214  SLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRS------TF 267

Query: 393  GVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSP 452
            G +         + F       F RE E  SL C  + + ++   +  IQW+R+G  L  
Sbjct: 268  GPS---------VEFTSVLKPVFAREKEPFSLSC--LFSEDVLDAE-SIQWFRDGSLLRS 315

Query: 453  SKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAA 512
            S+  + L++  +A+L  S   KEDEGLY +RV       + S YV VRDA+AE  GAP +
Sbjct: 316  SRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGS 375

Query: 513  PLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVT 572
            PL+V+CL+ N+D +I++W  P+   G+PI  Y I++C+  +  W  C++ P    R P+ 
Sbjct: 376  PLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQ 435

Query: 573  GLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEP 632
            GL+EG+SY FRVRA++++G   PS+ SE V   D  + AR K+        +I ++ +  
Sbjct: 436  GLVEGQSYRFRVRAISRVGSSVPSKASELVVMGD-HDAARRKTEIPFDLGNKITISTDAF 494

Query: 633  SEGI-VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELP 691
             + + +P PPT++  +E   +YVVL+W+ P  R    + Y +EK   G+  W+ +++E P
Sbjct: 495  EDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESP 554

Query: 692  VKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATE-VTVVGDKLDIPKAPGKIIPSRN 750
            V+SPRFA+ DL + KSY FRVR  N  G+ +PSE +E + + G    +P  P ++   R+
Sbjct: 555  VRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLP-PPAQVQAFRD 613

Query: 751  TDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFR 810
            T TSV ++W+  KD  EL+GYYI +   G+ +W+  NN P++G+RFT  GL TG+ Y F 
Sbjct: 614  TQTSVSLTWDPVKD-PELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFC 672

Query: 811  VRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLT--------ASRGRVH 862
            VR+V+ AG+ E S  +E I VK A+    +P     L+     +            G++ 
Sbjct: 673  VRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKIL 732

Query: 863  EASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAA-----PQ 917
                     + L     N+  +P        T V KVS+  +        +AA      +
Sbjct: 733  GYFLDQHDSEELDWHAVNQQPIP--------TRVCKVSDLHEGHFYEFRARAANWAGVGE 784

Query: 918  GKSKSDPLKKKTDRAP-PSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVI 976
              + S   + K    P P PP D+   E    S+VL W+ P  +G   +TGY+V+++E  
Sbjct: 785  LSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQE-- 842

Query: 977  DGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTI 1036
            +G   +W+      +S    ++S+L+    Y FQV AMN AGLG PS  ++    E+   
Sbjct: 843  EG-SEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED--- 898

Query: 1037 AVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAI- 1095
              PG  H ++     +  + L ++ P      P +  F   K+ K   D  R   E  + 
Sbjct: 899  -KPG-AHEIEVGVDEEGFIYLAFEAP----EAPDSSEFQWSKDYKGPLDPQRVKIEDKVN 952

Query: 1096 -KNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEV---------- 1144
               V LK  GL++  +Y   V   ++  +     L    + + +  + E+          
Sbjct: 953  KSKVILKEPGLEDLGTYSVIVTDADE-DISASHTLTEEELEKLKKLSHEIRNPVIKLISG 1011

Query: 1145 -VVNVDDDGVISLNFECDKMTPKSEFS--WSKDYVSTEDSPRLEVESKGNKTKMTFKDLG 1201
              +++ + G + L  E +K++P +E    ++   + +  + ++  + +    ++  ++L 
Sbjct: 1012 WNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLS 1071

Query: 1202 MDDLGIYSCDVTD--TDGIASSYLIDEE---ELKRLLALSHEHKFPTVP-VKSELAVEIL 1255
             +D G Y+  + D       +  L+D++    L++  A   + K    P  +  L  ++ 
Sbjct: 1072 EEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVT 1131

Query: 1256 EKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGT 1315
            E  QV+   +        +  + F   E+ +G       D  TG   + +E+L  +D+G 
Sbjct: 1132 EDCQVQLTCKVTNTKKETRFQWFFQRAEMPDG-----QYDPETGTGLLCIEELSKKDKGI 1186

Query: 1316 YTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGE-CNV 1374
            Y   + D +  + + + L GD    +  E        + + G      L  + T E   +
Sbjct: 1187 YRAMVSDDRGEDDTILDLTGDALDAIFTE--------LGRIGALSATPLKIQGTEEGIRI 1238

Query: 1375 LLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDR 1434
              K K  N+ +     W+  ++ +   ++      +  + +     KD+   +  L+   
Sbjct: 1239 FSKVKYYNV-EYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAA 1297

Query: 1435 GKDKSRLK--LVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDL---- 1488
            GK+  +L   L  +AF++ M E  +   L+  +   ++ A+ ++    V   +ED     
Sbjct: 1298 GKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIE---KNRAKVVRGLPDVATIMEDKTLCL 1354

Query: 1489 ----------KVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKY---VMELFD 1535
                      +++W  N   + + DR +  V G ++ + I +    D G+Y   V   + 
Sbjct: 1355 TCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYG 1414

Query: 1536 GKTG 1539
             +TG
Sbjct: 1415 SETG 1418



 Score = 40.8 bits (94), Expect = 0.011
 Identities = 25/98 (25%), Positives = 45/98 (45%), Gaps = 3/98 (3%)

Query: 283  PRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGC 342
            P   T+ E + + L C ++G P P ++W KN  P+       +Y +E R    T+ I   
Sbjct: 1341 PDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTF---LDRYRMEVRGTEVTITIEKV 1397

Query: 343  DFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETR 380
            + ED+ +Y     N  G  +   ++ V ++  E  E +
Sbjct: 1398 NSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435



 Score = 35.8 bits (81), Expect = 0.36
 Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 13/82 (15%)

Query: 1584 IQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGR--------TAYFTING 1635
            + E   + LTC V   PPP+V+W KN+  +         F AG+             I  
Sbjct: 165  VWEHTTVLLTCTVQASPPPQVTWYKNDTRIDP-----RLFRAGKYRITNNYGLLSLEIRR 219

Query: 1636 VSTADSGKYGLVVKNKYGSETS 1657
             +  DS  Y + VKN +G  +S
Sbjct: 220  CAIEDSATYTVRVKNAHGQASS 241


>gi|110349719 titin isoform N2-A [Homo sapiens]
          Length = 33423

 Score =  257 bits (656), Expect = 8e-68
 Identities = 233/902 (25%), Positives = 381/902 (42%), Gaps = 102/902 (11%)

Query: 405   IHFDDKF-DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGE 463
             +  D KF DV   + GE + +   +   P      P I W ++G+ +      + + +  
Sbjct: 25789 VMMDVKFRDVIVVKAGEVLKINADIAGRP-----LPVISWAKDGIEIEERARTEIISTDN 25843

Query: 464   RATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANK 523
                LT     + D G Y + ++        +    V D      G PA PL++  L A K
Sbjct: 25844 HTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKP----GPPAGPLEINGLTAEK 25899

Query: 524   DYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFR 583
                 +SW +P  DGG+ I  Y ++K E    +W+ C +  ++     VT L++G  YIFR
Sbjct: 25900 --CSLSWGRPQEDGGADIDYYIVEKRETSHLAWTIC-EGELQMTSCKVTKLLKGNEYIFR 25956

Query: 584   VRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTD 643
             V  VNK G+G P   S  + ALDP                             VP PPT 
Sbjct: 25957 VTGVNKYGVGEPLE-SVAIKALDPFT---------------------------VPSPPTS 25988

Query: 644   LSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDL 702
             L +T  T+  + L W +P    G E   Y +E+ E  +  W RVN + PV   R     L
Sbjct: 25989 LEITSVTKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKK-PVYDLRVKSTGL 26047

Query: 703   AEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES 762
              EG  Y +RV   N+AG+  PSE + +    D + +P  P K     +  T++ ++W + 
Sbjct: 26048 REGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKP 26107

Query: 763   --KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLS 820
                    + GY +E   +    W+    + ++G+ +T  GL TG  Y+FRV++VN  G S
Sbjct: 26108 LFDGGAPITGYTVEYKKSDDTDWKTSIQS-LRGTEYTISGLTTGAEYVFRVKSVNKVGAS 26166

Query: 821   EYSQDSE---AIEVKAAIGGGVSPDVCPALSDEPGG----LTASRGR----VHEASPPT- 868
             + S  S+   A E +      +  ++   L  + G         RGR    V  + P T 
Sbjct: 26167 DPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTD 26226

Query: 869   FQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKK 928
              +  A + +  ++ SL  + +N  + +  K + T+Q  L+           +    + K 
Sbjct: 26227 LRTRAYVDTTDSRTSL--TIENANRNDSGKYTLTIQNVLS----------AASLTLVVKV 26274

Query: 929   TDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANV 988
              D   P PP +IT  +  ++S VL W  P+  GGA +  Y++  RE       K   +  
Sbjct: 26275 LD--TPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKRE----ASKKAWVSVT 26328

Query: 989   KAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCS 1048
                +  +YK++NL+E  +Y F+V+  N  G+G P+   E  K  E     P PP  L  +
Sbjct: 26329 NNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVKITE----KPSPPEKLGVT 26384

Query: 1049  EVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEG 1108
              + KDS+ L W  P H G + +  Y V+  E   K   W  +  A  K+ +  V GL+E 
Sbjct: 26385 SISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQK--NW--VKCAVAKSTHHVVSGLREN 26440

Query: 1109  VSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISL----NFECD--- 1161
               Y FRV A NQAG+  P +L  PV+ + +    E+ +       + +    N + D   
Sbjct: 26441 SEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPI 26500

Query: 1162  KMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1221
                P  + + S+D V  + + R   E       +  K+    D G Y     ++ G   +
Sbjct: 26501 SGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKA 26560

Query: 1222  YLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNE 1281
             ++        ++ L      P  P    +  +I E+     W   +   G+   NYI  +
Sbjct: 26561 FI-------NIVVLDR----PGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLK 26609

Query: 1282  KE 1283
             +E
Sbjct: 26610 RE 26611



 Score =  248 bits (632), Expect = 5e-65
 Identities = 214/828 (25%), Positives = 356/828 (42%), Gaps = 107/828 (12%)

Query: 429   VITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGE 488
             ++ P   + + E +W++   PLS +K + T  + E+ +       K D+G Y I ++   
Sbjct: 13019 MVVPYDAYPKAEAEWFKENEPLS-TKTIDT--TAEQTSFRILEAKKGDKGRYKIVLQ--N 13073

Query: 489   YYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDK 548
              + +   ++ ++  D      P    +++  E     + ++W++P  DGGS I+GY +++
Sbjct: 13074 KHGKAEGFINLKVIDV-----PGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVER 13128

Query: 549   CEVGTDSWSQCNDTPVKFARFPVTGLIEGR-SYIFRVRAVNKMGIGFPSRVSEPVAALDP 607
              ++   +W    D   +   F VTGL +G   Y+FRV A N++G G P     PV     
Sbjct: 13129 RDIKRKTWVLATDR-AESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPV----- 13182

Query: 608   AEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHE 667
                                   E  S+  VPGPP ++++T+  R  V L+W+PP   G  
Sbjct: 13183 ----------------------EARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGA 13220

Query: 668   GIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEA 726
              I  Y +E  +  +  W    T +  +     + D+ EG+ Y FRVR  N  GVG+PS A
Sbjct: 13221 EITNYVIELRDKTSIRWDTAMT-VRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAA 13279

Query: 727   TEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES-KD-AKELVGYYIEASVAGSGKWE 784
             T    V D ++ P  P  +  S  T +SV + WE   KD    ++GY IE    G   W 
Sbjct: 13280 TPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWI 13339

Query: 785   PCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVC 844
              CN   V    +   GL  G  Y++RV A N AG+S+ S+                    
Sbjct: 13340 RCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEIL------------------ 13381

Query: 845   PALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVS-----KV 899
                    G LTA    V      +  KD L    PN  ++   S    +   +     KV
Sbjct: 13382 -------GPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKV 13434

Query: 900   SET----------VQEELTPPPQKAAPQG------KSKSDPLKKKTD---RAPPSPPCDI 940
              ET             EL   P + + +G      +++   +  + D    A PS P ++
Sbjct: 13435 LETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKEL 13494

Query: 941   TCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISN 1000
                +  +DS+ L W+ PD  GG+ +TGY V  REV       W +  +  V++  + + +
Sbjct: 13495 KFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKT---WTKV-MDFVTDLEFTVPD 13550

Query: 1001  LKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWK 1060
             L +   Y F+V A N  G G P+ V E          VP PP ++K  +   +S+ L W 
Sbjct: 13551 LVQGKEYLFKVCARNKCGPGEPAYVDEPVNMST-PATVPDPPENVKWRDRTANSIFLTWD 13609

Query: 1061  PPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQ 1120
             PP + G + + GY V+        D+W    E  +    ++V GL+EG  Y +RV+A+N+
Sbjct: 13610 PPKNDGGSRIKGYIVE--RCPRGSDKWVACGE-PVAETKMEVTGLEEGKWYAYRVKALNR 13666

Query: 1121  AGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISL----NFECDKMT---PKSEFSWSK 1173
              G  KPS     + A       E+ ++V     +++      E        P+ + +W+K
Sbjct: 13667 QGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTK 13726

Query: 1174  DYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1221
               +  +   R+ +E+   K+ +T  D    D G Y  +  +  G A++
Sbjct: 13727 ADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATA 13774



 Score =  247 bits (631), Expect = 6e-65
 Identities = 233/877 (26%), Positives = 353/877 (40%), Gaps = 116/877 (13%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P + W ++G  L P++ ++        TL    +N++D G YTI        +  +  + 
Sbjct: 19325 PTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLK 19384

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V D        P  P  VK  +   D  ++SW+ P  DGGS I  Y +DK E    +W+Q
Sbjct: 19385 VLDK-------PGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQ 19437

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
              + T V      V  LIEG  Y FR+ A NK G+G P   +EP  A +P +         
Sbjct: 19438 VSAT-VPITSCSVEKLIEGHEYQFRICAENKYGVGDPV-FTEPAIAKNPYDP-------- 19487

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                                PG      ++  T+ ++ +SWKPP   G   I  Y +EK E
Sbjct: 19488 -------------------PGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRE 19528

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
                 NW +VN + P+         L EG  Y FRV   N AG G+PS+A++     D   
Sbjct: 19529 TQAVNWTKVNRK-PIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQY 19587

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCN-NNPVKGS 794
              P  P        T +SV +SW +        ++GY +E   A S  W  CN    ++ +
Sbjct: 19588 PPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKT 19647

Query: 795   RFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAI---GGGVSPDVCPALSDEP 851
             RF   GL+    Y FRV AVN  G S+ S   +    K  +    G +  D+   L    
Sbjct: 19648 RFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRA 19707

Query: 852   GGLTASRGRVHEASPPTFQKDALLGSKPN-----KPSLPSSS---------QNLGQTEVS 897
             G        V    PP      +  SKPN     +  L   S         +N+ + +  
Sbjct: 19708 GVTMRLYVPVKGRPPP-----KITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAG 19762

Query: 898   KVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQP 957
             K   T++             GK +   + K  D   P PP ++T  E  +DS  + W+ P
Sbjct: 19763 KYILTLENSC----------GKKEYTIVVKVLD--TPGPPVNVTVKEISKDSAYVTWEPP 19810

Query: 958   DKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMA 1017
                GG+ I  Y V  R   D     W     +  S+ +++++NL+E   Y F+V A N  
Sbjct: 19811 IIDGGSPIINYVVQKR---DAERKSWSTVTTEC-SKTSFRVANLEEGKSYFFRVFAENEY 19866

Query: 1018  GLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDL 1077
             G+G P    +  K  +     PGP   LK   V K S  + WK P   G + + GY VD 
Sbjct: 19867 GIGDPGETRDAVKASQ----TPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDF 19922

Query: 1078  KEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAET 1137
                  +E++W+ + ++   ++    + L EG  Y FRV A N+ G G PS++   VVA  
Sbjct: 19923 ---LTEENKWQRVMKSL--SLQYSAKDLTEGKEYTFRVSAENENGEGTPSEIT--VVAR- 19974

Query: 1138  RPGTKEVVVNVDDDGVISL--------NFECD---KMTPKSEFSWSKDYVSTEDSPRLEV 1186
                   V  ++D  G+  L        NF      K  P    SW K         R+ V
Sbjct: 19975 ---DDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSV 20031

Query: 1187  ESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPV 1246
             ES    T +   D    D G Y+  + +  G     +         + +  +   PT P+
Sbjct: 20032 ESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTI--------SIKVVGKPGIPTGPI 20083

Query: 1247  KSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1283
             K +   E+  +     W   +   G+   NYI  +++
Sbjct: 20084 KFD---EVTAEAMTLKWAPPKDDGGSEITNYILEKRD 20117



 Score =  247 bits (630), Expect = 8e-65
 Identities = 216/807 (26%), Positives = 347/807 (42%), Gaps = 78/807 (9%)

Query: 438   QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
             +P+I W +  + L   K +      +++T+T     + D G Y I         + +A V
Sbjct: 13719 EPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAV--NVCGRATAVV 13776

Query: 498   FVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
              V   D      P  P      +   +  +++W  P  DGGS I  Y +++    ++ W 
Sbjct: 13777 EVNVLDK-----PGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWH 13831

Query: 558   QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAA---LDPAEKARLK 614
             + + T VK   F  T LI  + YIFRV A N  G+G P + S P+ A    DP       
Sbjct: 13832 KLSST-VKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQAS-PITAKYQFDP------- 13882

Query: 615   SRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFV 673
                                    PGPPT L  ++ T+  V L+W  P   G   I  Y+V
Sbjct: 13883 -----------------------PGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWV 13919

Query: 674   EKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVG 733
             E+ +  T+ W R N ++PVK   + +  L   K Y FRV   N AG G+PS++TE  ++ 
Sbjct: 13920 ERLDPDTDKWVRCN-KMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIK 13978

Query: 734   DKLDIPKAPGKIIPSRNTDTSVVVSW--EESKDAKELVGYYIEASVAGSGKWEPCNNNPV 791
             D +D P  PGK        TSV ++W   E     ++  Y IE    G+ +W       V
Sbjct: 13979 DPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEG-V 14037

Query: 792   KGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEP 851
               ++    GL+ GQ Y FRVRAVN AG SE S+ S+ +  +  +     P     ++   
Sbjct: 14038 PTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVIN--- 14094

Query: 852   GGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETV---QEELT 908
               +T +   +    P       +      K  +         T V     TV    E   
Sbjct: 14095 --ITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSL 14152

Query: 909   PPPQKAAPQGKSKS------DPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGG 962
                + AA     +S      D +  K     P PP  +  ++  +  + L W+ P   GG
Sbjct: 14153 YVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGG 14212

Query: 963   AEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAP 1022
               I  Y +  +E +     +W +A   A  +  ++++++ E    QFQV A N AG+G P
Sbjct: 14213 RPIQRYVIEKKERLG---TRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHP 14269

Query: 1023  SAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKA 1082
             S  +E    E+ T + P PP  L  ++  +  + + WKPP  +G +P+ GY V++     
Sbjct: 14270 SEPTEILSIEDPT-SPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEM--CPV 14326

Query: 1083  KEDQWRGLNEAAIKNVYLKV-RGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA---ETR 1138
               ++W  +N   IK++  KV  G+     YV RVRA+N  GV +PS+++  VVA   + +
Sbjct: 14327 GTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCK 14386

Query: 1139  P----GTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTK 1194
             P     T +++V   +   I + F   +  P    SW KD    + S RL +++      
Sbjct: 14387 PTIDLETHDIIVIEGEKLSIPVPF---RAVPVPTVSWHKDGKEVKASDRLTMKNDHISAH 14443

Query: 1195  MTFKDLGMDDLGIYSCDVTDTDGIASS 1221
             +        D GIY+  + +  G A++
Sbjct: 14444 LEVPKSVRADAGIYTITLENKLGSATA 14470



 Score =  244 bits (623), Expect = 5e-64
 Identities = 210/715 (29%), Positives = 320/715 (44%), Gaps = 77/715 (10%)

Query: 432   PEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHL---NKEDEGLYTIRVR--M 486
             P I   +P I W ++G PL  +  V      E AT T  H+   NK+D G YT+      
Sbjct: 24334 PVIGRPRPNISWVKDGEPLKQTTRVNV---EETATSTVLHIKEGNKDDFGKYTVTATNSA 24390

Query: 487   GEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFI 546
             G   E  S  V       E  G P  P  V+  E + D+++ISW+ PA  GG  I  Y +
Sbjct: 24391 GTATENLSVIVL------EKPGPPVGP--VRFDEVSADFVVISWEPPAYTGGCQISNYIV 24442

Query: 547   DKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALD 606
             +K +  T +W   + T  +     +T L  G  Y FR+ A N+ G               
Sbjct: 24443 EKRDTTTTTWHMVSATVAR-TTIKITKLKTGTEYQFRIFAENRYG--------------- 24486

Query: 607   PAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGH 666
                        SAP   + ++ +    E   PGPP    VT  ++  +++ W  P   G 
Sbjct: 24487 ----------KSAPLDSKAVIVQYPFKE---PGPPGTPFVTSISKDQMLVQWHEPVNDGG 24533

Query: 667   EGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSE 725
               I+ Y +E+ E  +  W ++N + P++  +F    L EG  Y F+V   N  G+G+PS+
Sbjct: 24534 TKIIGYHLEQKEKNSILWVKLN-KTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSK 24592

Query: 726   ATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKW 783
              +E  V  D  D P  P  I+ +RN   +V + W++       ++ GY +E      G+W
Sbjct: 24593 VSECFVARDPCDPPGRPEAIVITRN---NVTLKWKKPAYDGGSKITGYIVEKKDLPDGRW 24649

Query: 784   EPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAI---GGGV 839
                +   V  + FT  GLV  Q Y FRV A NAAG  SE S  S AI  +  I      +
Sbjct: 24650 MKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASL 24709

Query: 840   SP---DVCPALSDEPGGLTAS-RGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTE 895
              P   DV    + E   L A  RG+        + KD   G +  + +     ++  Q  
Sbjct: 24710 DPKYKDVIVVHAGETFVLEADIRGK--PIPDVVWSKD---GKELEETAARMEIKSTIQKT 24764

Query: 896   VSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKT-DR-APPSPPCDITCLESFRDSMVLG 953
                V + ++ +      K +  G +KS P+  K  DR  PP  P  +T + +  +   L 
Sbjct: 24765 TLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTA--EKCYLA 24822

Query: 954   WKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAA 1013
             W  P + GGA I+ Y +  RE        W + + + V    YK++ L     Y F+V A
Sbjct: 24823 WNPPLQDGGANISHYIIEKRET---SRLSWTQVSTE-VQALNYKVTKLLPGNEYIFRVMA 24878

Query: 1014  MNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGY 1073
             +N  G+G P        C  +    PGPP + + S + KDS+V+ W  PV  G T + GY
Sbjct: 24879 VNKYGIGEPLESGPVTACNPY--KPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGY 24936

Query: 1074  FVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSD 1128
              ++ ++ +    +W   N+  + ++ L+V GL EG SY FRV A N AGVG+PS+
Sbjct: 24937 ILEKRDKEGV--RWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSE 24989



 Score =  240 bits (612), Expect = 1e-62
 Identities = 232/891 (26%), Positives = 374/891 (41%), Gaps = 101/891 (11%)

Query: 417   REGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKED 476
             R G  + L   V   PE     P+I W +    L   + V   ++G+RAT      ++ D
Sbjct: 29060 RAGSDLVLDAAVGGKPE-----PKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSD 29114

Query: 477   EGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVD 536
              G YT+ V+     +  S  V V D+       P   L V  +   K    ++W  P  D
Sbjct: 29115 SGKYTLTVKNASGTKAVSVMVKVLDSPG-----PCGKLTVSRVTQEK--CTLAWSLPQED 29167

Query: 537   GGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPS 596
             GG+ I  Y +++ E    +W          + + VT LI+   YIFRVRAVNK G G P 
Sbjct: 29168 GGAEITHYIVERRETSRLNWVIVEGECPTLS-YVVTRLIKNNEYIFRVRAVNKYGPGVPV 29226

Query: 597   RVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVL 656
               SEP+ A +                              +P PP         + ++++
Sbjct: 29227 E-SEPIVARNSFT---------------------------IPSPPGIPEEVGTGKEHIII 29258

Query: 657   SW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCS 715
              W KP    G+E   Y V+K E  +  W RVN +  V   R  +  L EG  Y FRV   
Sbjct: 29259 QWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAV 29318

Query: 716   NSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYI 773
             N+AG  EPSEA+      +    P  P        T  S+ ++W +       ++VGY +
Sbjct: 29319 NAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVL 29378

Query: 774   EASVAGSGKWEPCNNN-PVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVK 832
             E     + +W   + N  ++ + FT   L  GQ Y FRV AVN  G+SEYS+    IE  
Sbjct: 29379 EMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPV 29438

Query: 833   AAI---GGGVSPDVCPALSDEPGGLTASRGRVHEASPP--TFQKDAL-LGSKPNKPSLPS 886
               I      ++ D+   ++   G        V    PP  T+ K  + L S+    ++  
Sbjct: 29439 ERIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASR----AIID 29494

Query: 887   SSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESF 946
             ++++     V KV+     + T   +  +  GK  +  L K  D   P P   +   E  
Sbjct: 29495 TTESYSLLIVDKVNRYDAGKYTIEAENQS--GKKSATVLVKVYDTPGPCP--SVKVKEVS 29550

Query: 947   RDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMV 1006
             RDS+ + W+ P   GGA +  Y V  RE        ++    K  S+  Y+IS L E  +
Sbjct: 29551 RDSVTITWEIPTIDGGAPVNNYIVEKRE---AAMRAFKTVTTKC-SKTLYRISGLVEGTM 29606

Query: 1007  YQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSG 1066
             Y F+V   N+ G+G P   S+     E    VP  P  L+  +V K ++ L W+ P++ G
Sbjct: 29607 YYFRVLPENIYGIGEPCETSDAVLVSE----VPLVPAKLEVVDVTKSTVTLAWEKPLYDG 29662

Query: 1067  RTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLK--VRGLKEGVSYVFRVRAINQAGVG 1124
              + +TGY   L+  KA  ++W  +    +K   L+  V  L EG  Y+FR+RA N+ GV 
Sbjct: 29663 GSRLTGYV--LEACKAGTERW--MKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVS 29718

Query: 1125  KPSDLAGPVVAE-----------TRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSK 1173
             +P +    V  +           T P   +  ++V     + L        P +  SW  
Sbjct: 29719 EPRETVTAVTVQDLRVLPTIDLSTMP---QKTIHVPAGRPVELVIPIAGRPPPAA-SWFF 29774

Query: 1174  DYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLL 1233
                   +S R+ VE+     K+T ++  + D G Y+ ++ +  G  S       E  +++
Sbjct: 29775 AGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTS-------ETIKVI 29827

Query: 1234  ALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVN-YIFNEKE 1283
              L      PT P+K    ++ ++   +    +  +L G A ++ Y+  +++
Sbjct: 29828 ILDKPGP-PTGPIK----IDEIDATSITISWEPPELDGGAPLSGYVVEQRD 29873



 Score =  239 bits (609), Expect = 2e-62
 Identities = 243/973 (24%), Positives = 389/973 (39%), Gaps = 133/973 (13%)

Query: 339   INGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYG 398
             + G    DT +YR SA+N+ G+            K E      H                
Sbjct: 16778 VKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLH---------------- 16821

Query: 399   YASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQT 458
                   + F DK  +   R GE  +L  R    P+     P++ W+++   +        
Sbjct: 16822 ------LDFRDKLTI---RVGEAFALTGRYSGKPK-----PKVSWFKDEADVLEDDRTHI 16867

Query: 459   LWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKC 518
               +     L      + D G Y + V       +    V V D      G P  P+    
Sbjct: 16868 KTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRP----GPPVGPVSFD- 16922

Query: 519   LEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGR 578
              E  KDY++ISWK P  DGGS I  Y I+K EVG D W        K     V+ L+EG+
Sbjct: 16923 -EVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAK-TTCKVSKLLEGK 16980

Query: 579   SYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVP 638
              YIFR+ A N  GI      S+P+ +     K R +                      VP
Sbjct: 16981 DYIFRIHAENLYGI------SDPLVSDSMKAKDRFR----------------------VP 17012

Query: 639   GPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFA 698
               P    VTE T+   +++W  P   G     Y +EK E  ++ W RV  +      +F 
Sbjct: 17013 DAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKRETMSKRWARVTKDPIHPYTKFR 17072

Query: 699   LFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVS 758
             + DL EG  Y FRV   N  G+G+PS  ++     D +  P  P        T  SV ++
Sbjct: 17073 VPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLT 17132

Query: 759   WEESK--DAKELVGYYIEASVAGSGKWEPCNNNP--VKGSRFTCHGLVTGQSYIFRVRAV 814
             W+  +     +++GY +E    G  +W   N+ P     +++   GL  GQ+Y FRV AV
Sbjct: 17133 WQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVLAV 17192

Query: 815   NAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGR-VHEASPPTFQKDA 873
             NAAG S+ +   E + VK  +     P++          L A+  R  H     T +  A
Sbjct: 17193 NAAGESDPAHVPEPVLVKDRL---EPPELI---------LDANMAREQHIKVGDTLRLSA 17240

Query: 874   LLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSD---------- 923
             ++   P  P +    ++      +++      ++TP   K   +  +  D          
Sbjct: 17241 IIKGVP-FPKVTWKKEDRDAPTKARI------DVTPVGSKLEIRNAAHEDGGIYSLTVEN 17293

Query: 924   PLKKKTDRA------PPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVID 977
             P   KT          P PP D+   E  +DS  L WK+P   GG+ IT Y V  R+V  
Sbjct: 17294 PAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDV-- 17351

Query: 978   GVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIA 1037
                 +W   +  +  ++++   +L E   Y F+VAA N  G G      +  K  +  + 
Sbjct: 17352 -ASAQWSPLSATS-KKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALD-PLH 17408

Query: 1038  VPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKN 1097
              PGPP  L   +V K  + L W  P   G +P+TGY V+ +E   ++  W  +    + N
Sbjct: 17409 PPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQD--W--IKFKTVTN 17464

Query: 1098  VYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETR--PGTKEVVVNVDDDGVI- 1154
             +   V GL++G +Y FRV+A N  G+G P D   P+  + +  P + E+ V + +  V+ 
Sbjct: 17465 LECVVTGLQQGKTYRFRVKAENIVGLGLP-DTTIPIECQEKLVPPSVELDVKLIEGLVVK 17523

Query: 1155  ---SLNFEC-DKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSC 1210
                ++ F    +  P     W+ D    +      VE+    + +T K+    D G Y  
Sbjct: 17524 AGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQI 17583

Query: 1211  DVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLS 1270
              V++  G         + +   L +      PT P+     +++  +     W   +   
Sbjct: 17584 TVSNAAG--------SKTVAVHLTVLDVPGPPTGPIN---ILDVTPEHMTISWQPPKDDG 17632

Query: 1271  GNAKVNYIFNEKE 1283
             G+  +NYI  +++
Sbjct: 17633 GSPVINYIVEKQD 17645



 Score =  238 bits (606), Expect = 5e-62
 Identities = 256/1027 (24%), Positives = 414/1027 (40%), Gaps = 150/1027 (14%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYR 351
             +N+K+   + G P+P VTW K      +     +   E+      L IN C   D+  Y 
Sbjct: 21081 DNIKVEIPVLGRPKPTVTWKKGD---QILKQTQRVNFETTATSTILNINECVRSDSGPYP 21137

Query: 352   ASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKF 411
              +A N+ GE+    ++ V    G            T P+ F      +            
Sbjct: 21138 LTARNIVGEVGDVITIQVHDIPGP----------PTGPIKFDEVSSDF------------ 21175

Query: 412   DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSH 471
              V+F  +      G        I ++  E++          + WV+   +  R T   + 
Sbjct: 21176 -VTFSWDPPENDGGV------PISNYVVEMR------QTDSTTWVELATTVIRTTYKATR 21222

Query: 472   LNKEDEGLYTIRVRMGEYY---EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIII 528
             L    E  Y  RV+    Y      ++   V +   ++ G P  P   +     KD + I
Sbjct: 21223 LTTGLE--YQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTP---QVTAVTKDSMTI 21277

Query: 529   SWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVN 588
             SW +P  DGGSPILGY +++ E     W   +   V    F  +GL +G +Y FRV A N
Sbjct: 21278 SWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAEN 21337

Query: 589   KMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTE 648
               G   PS+ SEP+ ALDP +                            PG P  L++T 
Sbjct: 21338 MAGKSKPSKPSEPMLALDPIDP---------------------------PGKPVPLNITR 21370

Query: 649   ATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKS 707
              T   V L W KP    G +   Y VEK +     W + N    +++  F +  L E  +
Sbjct: 21371 HT---VTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILEN-EFTVSGLTEDAA 21426

Query: 708   YCFRVRCSNSAG-VGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAK 766
             Y FRV   N+AG +  PSE ++     D ++ PK              V V ++++   K
Sbjct: 21427 YEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKI------------KVDVKFKDTVILK 21474

Query: 767   ELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDS 826
                 + +EA V  SG+  P       G        +  +   F    VN        +DS
Sbjct: 21475 AGEAFRLEADV--SGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNK---DSTRRDS 21529

Query: 827   EAIEVKAAIGGGVSPDVC-------PALSDEPGGLT--ASRGRVHEASPPTFQKDALLG- 876
              A  + A   GG +  +        P   + P  +T   S   V    PP     A +  
Sbjct: 21530 GAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDH 21589

Query: 877   --------SKPNKPSLPSSSQ--NLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLK 926
                     S+    ++ S  Q   L  T++ K +E +   +     K       +S+P+ 
Sbjct: 21590 YIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAV--NKYGVGEPLESEPVL 21647

Query: 927   KKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREA 986
                   PP PP +       +DSMV+ W  PD  GG+EI  Y V  R   D    +W + 
Sbjct: 21648 AVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERR---DKAGQRWIKC 21704

Query: 987   NVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFK-CEEWTIAVPGPPHSL 1045
             N K +++  YK+S L E   Y+F++ A N AG+ APS  S  +K C+  T+  PGPP + 
Sbjct: 21705 NKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACD--TVFKPGPPGNP 21762

Query: 1046  KCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN-EAAIKNVYLKVRG 1104
             +  +  + S+ + W  P++ G + +TGY V++  A  +ED+W+ +   A +K     + G
Sbjct: 21763 RVLDTSRSSISIAWNKPIYDGGSEITGYMVEI--ALPEEDEWQIVTPPAGLKATSYTITG 21820

Query: 1105  LKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECD--- 1161
             L E   Y  R+ A+N  G+G+P+ + G   AE R    E+ ++ D   V+++   C    
Sbjct: 21821 LTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRL 21880

Query: 1162  ----KMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
                 K  P  E  W++D+  + D  +  +ES  + T +   ++   D G Y   V ++ G
Sbjct: 21881 FVPIKGRPAPEVKWARDHGESLD--KASIESTSSYTLLIVGNVNRFDSGKYILTVENSSG 21938

Query: 1218  IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKV-N 1276
               S+++             +     T     +L V+ + K  V        L G +K+ N
Sbjct: 21939 SKSAFV-------------NVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKN 21985

Query: 1277  YIFNEKE 1283
             YI  ++E
Sbjct: 21986 YIVEKRE 21992



 Score =  236 bits (602), Expect = 1e-61
 Identities = 213/769 (27%), Positives = 319/769 (41%), Gaps = 97/769 (12%)

Query: 398   GYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPE-----------IQWYRN 446
             G   +F +   +   VS  RE E +      ++ P+I    PE           I+ +  
Sbjct: 18866 GKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKI--LMPEQITIKAGKKLRIEAHVY 18923

Query: 447   GVPLSPSKWVQTLWSGERATLTFSHL----------------NKEDEGLYTIRVRMGEYY 490
             G P    KW +    GE   +T SHL                 ++D G Y++        
Sbjct: 18924 GKPHPTCKWKK----GEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGT 18979

Query: 491   EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCE 550
             +     V V DA     G P  P D+  ++A  D   +SW  P  DGGS I  Y ++KC+
Sbjct: 18980 DTQKIKVVVMDAP----GPPQPPFDISDIDA--DACSLSWHIPLEDGGSNITNYIVEKCD 19033

Query: 551   VGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEK 610
             V    W     +  K +   V  LI G+ YIFRVRA N+ GI  P    + VA       
Sbjct: 19034 VSRGDWVTALASVTKTS-CRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMVAQFPFG-- 19090

Query: 611   ARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM 670
                                       VP  P +  VT+  +  + ++W  P   G   I+
Sbjct: 19091 --------------------------VPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPII 19124

Query: 671   -YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEV 729
              Y +E+ E  +  W + N  L V+S  +    L EG  Y FR+   N AG   PS+ TE 
Sbjct: 19125 GYLIERKERNSLLWVKANDTL-VRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEY 19183

Query: 730   TVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNN 789
                   +D P  P  I  +++T  S++ +  +     +++GY++EA      KW  CN  
Sbjct: 19184 VTARMPVDPPGKPEVIDVTKST-VSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTA 19242

Query: 790   P--VKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSP--DVCP 845
             P  +    +T  GL     Y FR  A  A  +S  S+ S+ + + A     V P  D+  
Sbjct: 19243 PHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAE---NVPPRIDLSV 19299

Query: 846   ALSD----EPGGLTASRGRVHEASPPT--FQKDALLGSKPNKPSLPSSSQNLGQTEVSKV 899
             A+      + G        V     PT  ++KD  L  KP +    +  +NL   E+  V
Sbjct: 19300 AMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTL-LKPAEGIKMAMQRNLCTLELFSV 19358

Query: 900   SETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDK 959
             +     + T   + ++    SKS  +K K     P PP  +   + + D  +L W+ P +
Sbjct: 19359 NRKDSGDYTITAENSSG---SKSATIKLKV-LDKPGPPASVKINKMYSDRAMLSWEPPLE 19414

Query: 960   IGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 1019
              GG+EIT Y V+ RE        W + +   V   +  +  L E   YQF++ A N  G+
Sbjct: 19415 DGGSEITNYIVDKRETSRP---NWAQVSA-TVPITSCSVEKLIEGHEYQFRICAENKYGV 19470

Query: 1020  GAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE 1079
             G P           +    PG       S + KD + + WKPP   G +P+TGY ++ +E
Sbjct: 19471 GDPVFTEPAIAKNPYD--PPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRE 19528

Query: 1080  AKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSD 1128
              +A    W  +N   I    LK  GL+EG  Y FRV AIN+AG GKPSD
Sbjct: 19529 TQAVN--WTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSD 19575



 Score =  235 bits (600), Expect = 2e-61
 Identities = 248/1071 (23%), Positives = 420/1071 (39%), Gaps = 153/1071 (14%)

Query: 294   VKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRAS 353
             V+L   IAG P P  +W+     +       +  +E+   +  L I      DT +Y   
Sbjct: 29756 VELVIPIAGRPPPAASWFFAGSKLR---ESERVTVETHTKVAKLTIRETTIRDTGEYTLE 29812

Query: 354   AMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDV 413
               NV G  S    V++    G                     P G     EI   D   +
Sbjct: 29813 LKNVTGTTSETIKVIILDKPGP--------------------PTGPIKIDEI---DATSI 29849

Query: 414   SFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLN 473
             +   E   +  G      P   +   +   +R G       W+    S  R+T  F+ L 
Sbjct: 29850 TISWEPPELDGGA-----PLSGYVVEQRDAHRPG-------WLPVSESVTRSTFKFTRLT 29897

Query: 474   KEDEGLYTI----RVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIIS 529
             + +E ++ +    R  +G Y +       V +  + I   P  P  ++  + ++D + ++
Sbjct: 29898 EGNEYVFRVAATNRFGIGSYLQSE-----VIECRSSIR-IPGPPETLQIFDVSRDGMTLT 29951

Query: 530   WKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNK 589
             W  P  DGGS + GY +++ EV  D W + N  PV   R+  TGL EG  Y  RV A+N 
Sbjct: 29952 WYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINA 30011

Query: 590   MGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEA 649
              G G PSR S+P+ A+DP           AP                 PG P +  VT+ 
Sbjct: 30012 RGSGKPSRPSKPIVAMDPI----------AP-----------------PGKPQNPRVTDT 30044

Query: 650   TRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSY 708
             TR+ V L+W  P   G   +  Y +E  +     W + NT  P K   + L  L +G  Y
Sbjct: 30045 TRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTT-PTKIREYTLTHLPQGAEY 30103

Query: 709   CFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKEL 768
              FRV   N+ G GEP+E      V + L+ P            D  +   ++E    ++ 
Sbjct: 30104 RFRVLACNAGGPGEPAEVPGTVKVTEMLEYP------------DYELDERYQEGIFVRQ- 30150

Query: 769   VGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLV-TGQSYIFRVRAVNAAGLS------- 820
              G  I  ++   GK  P      +G   +   ++ T +++   V      G S       
Sbjct: 30151 -GGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTELVIKEADRGDSGTYDLVL 30209

Query: 821   EYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPN 880
             E     +A+ +K  + G  +    P   D+   +     RV    P       +LG    
Sbjct: 30210 ENKCGKKAVYIKVRVIGSPNSPEGPLEYDD---IQVRSVRVSWRPPADDGGADILGYILE 30266

Query: 881   KPSLPSSSQNLGQTEVSKVSETVQE---------ELTPPPQKAAPQGKSKSDPLKKKTDR 931
             +  +P ++     + V   S  V+           ++   Q    +     +P+  KT  
Sbjct: 30267 RREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPL 30326

Query: 932   APPSPPCDIT-CLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKA 990
              PP PP +    L+  + S+ L W +P   GG+ +TGYY+  +E       KW   N   
Sbjct: 30327 NPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKET---STDKWVRHNKTQ 30383

Query: 991   VSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEV 1050
             ++   Y ++ L  +  YQF++ A N  GL   S  SE   C++     P  P  L+   +
Sbjct: 30384 ITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKD-PFDKPSQPGELEILSI 30442

Query: 1051  RKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVS 1110
              KDS+ LQW+ P   G   + GY+V+ ++  + +  W+  N+  IK+    + GL E   
Sbjct: 30443 SKDSVTLQWEKPECDGGKEILGYWVEYRQ--SGDSAWKKSNKERIKDKQFTIGGLLEATE 30500

Query: 1111  YVFRVRAINQAGVGKPSDLAGPV----VAETRPGTKEVVVNVDDDGVISLNFECDKM-TP 1165
             Y FRV A N+ G+ +P   A  +     +   PG ++ + +V      +    C  +  P
Sbjct: 30501 YEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRP 30560

Query: 1166  KSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLID 1225
               +  W +       S + ++ S G    +T      +D G+Y+C       IA++ + +
Sbjct: 30561 LPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTC-------IATNEVGE 30613

Query: 1226  EEELKRLLALSHEHKFPTVPVK--------SELAVEILEKGQ---VRFWMQAEKLSGNAK 1274
              E   +LL  +     P  P+K        S L + ++  G+      W   +KL  N++
Sbjct: 30614 VETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSE 30673

Query: 1275  VNYIFNEKEI-----------FEGPKYKMHIDRNTGIIEMFME-KLQDEDE 1313
                I N +                 KYK+ +    G ++  ++ ++QD+ +
Sbjct: 30674 NITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPD 30724



 Score =  234 bits (597), Expect = 5e-61
 Identities = 319/1304 (24%), Positives = 521/1304 (39%), Gaps = 194/1304 (14%)

Query: 273   LLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRY 332
             L+  P F +   + TV   E++K+     G P P VTW+K+ VP+       +   ES  
Sbjct: 22144 LVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLK---QTTRVNAESTE 22200

Query: 333   GMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKG------EFDETRFHAGAS 386
                 L I     ED   Y     N  GE     +V+V    G      + DE      A 
Sbjct: 22201 NNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVT----AD 22256

Query: 387   TMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRN 446
             ++ LS+G   Y   S    +  +K D S                                
Sbjct: 22257 SITLSWGPPKYDGGSSINNYIVEKRDTS-------------------------------- 22284

Query: 447   GVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAE- 505
                   + W     +  R T+    L    E  Y  R+     Y + S Y+      A+ 
Sbjct: 22285 -----TTTWQIVSATVARTTIKACRLKTGCE--YQFRIAAENRYGK-STYLNSEPTVAQY 22336

Query: 506   ---IEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDT 562
                + G P  P+      +++D + + W +P  DGGS ++GY +++ E  +  W + N T
Sbjct: 22337 PFKVPGPPGTPVVTL---SSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKT 22393

Query: 563   PVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWT 622
             P+   +F  TGL EG  Y FRV A N +GIG PS+VSE   A DP +             
Sbjct: 22394 PIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDP------------ 22441

Query: 623   GQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTE 681
                            PG P  + VT   R+ V L WK P   G   I  Y VEK E    
Sbjct: 22442 ---------------PGRPEAIIVT---RNSVTLQWKKPTYDGGSKITGYIVEKKELPEG 22483

Query: 682   NWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGV-GEPSEATEVTVVGDKLDIPK 740
              W + +    + +  F +  L E   Y FRV   N+AGV  EPSE+T      D++D P+
Sbjct: 22484 RWMKASFTNIIDT-HFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPR 22542

Query: 741   APGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNN--PVKGSRF-- 796
                  +  +  DT VV + E  K   ++ G  I       G  E  N     +K + F  
Sbjct: 22543 IS---MDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFAT 22599

Query: 797   --TCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGL 854
               +    V   S  + ++A N AG     + S  + VK     G  P   P +     G+
Sbjct: 22600 SLSVKDAVRVDSGNYILKAKNVAG-----ERSVTVNVKVLDRPG--PPEGPVVIS---GV 22649

Query: 855   TASRGRVHEASPPTFQKDA------LLGSKPNKPSLPSSSQNLGQTEVSKVSETVQ-EEL 907
             TA +  +  A  P  Q         ++  +     + +      QT   KV++ ++  E 
Sbjct: 22650 TAEKCTL--AWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEY 22707

Query: 908   TPPPQKAAPQGKSK---SDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAE 964
             T         G  +   S+P+  K     P  P         +DSM++ W++P   GG+E
Sbjct: 22708 TFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSE 22767

Query: 965   ITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSA 1024
             I GY +  R+  +G+  +W   + + + E   +++ L EN  Y+F+V+A N AGL  PS 
Sbjct: 22768 ILGYVLEKRDK-EGI--RWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSP 22824

Query: 1025  VSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKE 1084
              S   K  +  I  PGPP++ K  ++ + S+ L W  P++ G   + GY V+  +    E
Sbjct: 22825 PSAYQKACD-PIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGE 22883

Query: 1085  DQWRGLNE-AAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKE 1143
               W        I    ++V  L E   Y FR+ AIN+AGVG+ +D+ GP++ E +    +
Sbjct: 22884 --WTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPD 22941

Query: 1144  V--------VVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKM 1195
             +        ++N+   G + L F   K  P  E  W K      D+  ++V S  + T +
Sbjct: 22942 IDLDLELRKIINIRAGGSLRL-FVPIKGRPTPEVKWGKVDGEIRDAAIIDVTS--SFTSL 22998

Query: 1196  TFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEIL 1255
                ++   D G Y+  + ++ G  S+++       R+L        P+ PV   L V  +
Sbjct: 22999 VLDNVNRYDSGKYTLTLENSSGTKSAFV-----TVRVL------DTPSPPV--NLKVTEI 23045

Query: 1256  EKGQVRFWMQAEKLSGNAKV-NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEG 1314
              K  V    +   L G +K+ NYI  ++E     K    +  N       +++LQ   EG
Sbjct: 23046 TKDSVSITWEPPLLDGGSKIKNYIVEKREATR--KSYAAVVTNCHKNSWKIDQLQ---EG 23100

Query: 1315  -TYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECN 1373
              +Y F++    A N   + L       + K AE           P     ++ +     +
Sbjct: 23101 CSYYFRV---TAENEYGIGLPAQTADPI-KVAEV----------PQPPGKITVDDVTRNS 23146

Query: 1374  VLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTL--LITEFSKKDAGIYEVILK 1431
             V L          + I+ Y  E +    EK      + +L  +IT  ++ +  ++ V+  
Sbjct: 23147 VSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVITNLTQGEEYLFRVVAV 23206

Query: 1432  DDRGKDKSRLKLVDEAFKELMMEVCKKIALSA------TDLKIQSTAEGIQLYSFVTYYV 1485
             +++G+   R   V    K+L++E   K A S+       DLKI+    G    +      
Sbjct: 23207 NEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPT------ 23260

Query: 1486  EDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKY 1529
                 + W+ +G  ++ + R+    + +   L I E   +D G+Y
Sbjct: 23261 ----ITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQY 23300



 Score =  233 bits (595), Expect = 9e-61
 Identities = 261/1020 (25%), Positives = 403/1020 (39%), Gaps = 115/1020 (11%)

Query: 237   EKKSRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKL 296
             E+K R  ++  K  +  +  T  + +     +  +  ++A   +   ++    E    + 
Sbjct: 23460 ERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARD 23519

Query: 297   HCSIAGWPEPRVTWYKNQVPIN----VHANPGK---YIIESRYGMHTLEINGCDFEDTAQ 349
              C   G PEP +   +N++ +     V+        YI+E R           D  D   
Sbjct: 23520 PCDPPGTPEP-IMVKRNEITLQWTKPVYDGGSMITGYIVEKR-----------DLPDGRW 23567

Query: 350   YRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFE---IH 406
              +AS  NV  E     S + +  + EF     +A  +    S    P       E   I 
Sbjct: 23568 MKASFTNVI-ETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRIS 23626

Query: 407   FDDKF-DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERA 465
              D KF D      GET  L   V   P      P I+W R    +  S   +   +  +A
Sbjct: 23627 MDPKFRDTIVVNAGETFRLEADVHGKP-----LPTIEWLRGDKEIEESARCEIKNTDFKA 23681

Query: 466   TLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDY 525
              L      + D G Y +R       + +   V V D      G P  P+ V  + + K  
Sbjct: 23682 LLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRP----GPPEGPVQVTGVTSEK-- 23735

Query: 526   IIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVR 585
               ++W  P  DGGS I  Y ++K E    +W+      V  +   VT L+EG  Y+FR+ 
Sbjct: 23736 CSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNS-LKVTKLLEGNEYVFRIM 23794

Query: 586   AVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLS 645
             AVNK G+G P   S PV   +P                            ++PGPP  L 
Sbjct: 23795 AVNKYGVGEPLE-SAPVLMKNPF---------------------------VLPGPPKSLE 23826

Query: 646   VTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAE 704
             VT   +  + + W +P    G E I Y VEK +     W + N    +   R  +  L E
Sbjct: 23827 VTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRR-ITDLRLRVTGLTE 23885

Query: 705   GKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES-- 762
                Y FRV   N+AGVGEPS AT      D +  P  P        T  S+ ++W +   
Sbjct: 23886 DHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIY 23945

Query: 763   KDAKELVGYYIEASVAGSGKWEPCN-NNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSE 821
                 E++GY +E   A   +W+       ++ +RF    L   Q Y  RV A+N  GL E
Sbjct: 23946 DGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGE 24005

Query: 822   YSQDSEAIEVKAAIGGGVSPD---VCPAL---SDEPGGLTASRG---RVH---EASP-PT 868
                         ++ G V P+     P L   S+   G+    G   R+H   +  P P 
Sbjct: 24006 ----------ATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPE 24055

Query: 869   FQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKK 928
                    G   +K  +    + +  T++S +    + +      K      SKS  +  K
Sbjct: 24056 ITWSREEGEFTDKVQI---EKGVNYTQLS-IDNCDRNDAGKYILKLENSSGSKSAFVTVK 24111

Query: 929   TDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANV 988
                  P PP ++   E  +DS  L W+ P   GGA++  Y ++ RE       +   ANV
Sbjct: 24112 V-LDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRE-----STRKAYANV 24165

Query: 989   KA-VSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKC 1047
              +  S+ ++K+ NL E  +Y F+V A N  G+G P    +  K  E     P PP  +  
Sbjct: 24166 SSKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAE----PPSPPGKVTL 24221

Query: 1048  SEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKE 1107
             ++V + S  L W+ P H G + V GY V+++      ++W  + E+ + N    V GL  
Sbjct: 24222 TDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGT--EKWSIVAESKVCNAV--VTGLSS 24277

Query: 1108  GVSYVFRVRAINQAGVGKPSDLAGPVVAE---TRPGTKEVVVNVDDDGVISLNFECDKM- 1163
             G  Y FRV+A N+ G   P  L  PV+A+    +P  K             L  E   + 
Sbjct: 24278 GQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIG 24337

Query: 1164  TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1223
              P+   SW KD    + + R+ VE     T +  K+   DD G Y+   T++ G A+  L
Sbjct: 24338 RPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENL 24397



 Score =  233 bits (594), Expect = 1e-60
 Identities = 253/971 (26%), Positives = 389/971 (40%), Gaps = 143/971 (14%)

Query: 290   EKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQ 349
             E  N +L   I G P P V+W K + P+   A   +  +ES     TL +  C   D  +
Sbjct: 19996 ENSNFRLKIPIKGKPAPSVSWKKGEDPL---ATDTRVSVESSAVNTTLIVYDCQKSDAGK 20052

Query: 350   YRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFG-VTPYGYASRFEIHFD 408
             Y  +  NV G      S+ V              G  T P+ F  VT      ++    D
Sbjct: 20053 YTITLKNVAGTKEGTISIKVVG----------KPGIPTGPIKFDEVTAEAMTLKWAPPKD 20102

Query: 409   DKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLT 468
             D      G E           IT  I   +  +           +KWV    + ++ T  
Sbjct: 20103 DG-----GSE-----------ITNYILEKRDSVN----------NKWVTCASAVQKTTFR 20136

Query: 469   FSHLNKEDEGLYTIRVRMGEYY---EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDY 525
              + L++  E  YT RV     Y   E   +   V     ++  AP  P     ++   D 
Sbjct: 20137 VTRLHEGME--YTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPP---NIVDVRHDS 20191

Query: 526   IIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVR 585
             + ++W  P   GGSPI GY ++  E  +  W + N TP++   F VTGL EG  Y FRV 
Sbjct: 20192 VSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVM 20251

Query: 586   AVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLS 645
             A+N  G+G PS  SEPV ALDP +                              PP    
Sbjct: 20252 AINLAGVGKPSLPSEPVVALDPID------------------------------PPGKPE 20281

Query: 646   VTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAE 704
             V   TR+ V L W +P    GH+   Y VEK +  +++W + N  + V    F + DL E
Sbjct: 20282 VINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKAN-HVNVPECAFTVTDLVE 20340

Query: 705   GKSYCFRVRCSNSAG-VGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESK 763
             G  Y FR+R  N+AG +  PSE+TE  +  D+ +   AP  ++     D   +    ++ 
Sbjct: 20341 GGKYEFRIRAKNTAGAISAPSESTETIICKDEYE---APTIVLDPTIKDGLTI----KAG 20393

Query: 764   DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYS 823
             D   L    I         W     + ++ S  T     T  S +  ++        EY+
Sbjct: 20394 DTIVLNAISILGKPLPKSSWSKAGKD-IRPSDIT-QITSTPTSSMLTIKYATRKDAGEYT 20451

Query: 824   QDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPS 883
                  I      G  V   V   + D PG      G V E S  + +K  L  + P +  
Sbjct: 20452 -----ITATNPFGTKVE-HVKVTVLDVPG----PPGPV-EISNVSAEKATLTWTPPLEDG 20500

Query: 884   -LPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQ-----------------GKSK---S 922
               P  S  L + E S++  TV  E     +  A +                 GK +   S
Sbjct: 20501 GSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQS 20560

Query: 923   DPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGK 982
             +P+K      PP PP         +++  + WK+P   GG+EITGY+V  RE       +
Sbjct: 20561 EPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSL---R 20617

Query: 983   WREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPP 1042
             W  A    VS+   K++ L+E   Y+F+V+A N AG+G PS  S+    ++     PGPP
Sbjct: 20618 WVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKD-AAYPPGPP 20676

Query: 1043  HSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQW-RGLNEAAIKNVYLK 1101
              +   ++  K S  L W  P + G   +TGY V+    K  ++ W +     A++     
Sbjct: 20677 SNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVE--HQKVGDEAWIKDTTGTALRITQFV 20734

Query: 1102  VRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPG---------TKEVVVNVDDDG 1152
             V  L+    Y FR+ AIN AGVG+P+ +    + E              + +VV     G
Sbjct: 20735 VPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRA---G 20791

Query: 1153  VISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDV 1212
             +    F   K  P  E +W+KD ++ ++  R  +E+  + T +   +    D G +   +
Sbjct: 20792 LSIRIFVPIKGRPAPEVTWTKDNINLKN--RANIENTESFTLLIIPECNRYDTGKFVMTI 20849

Query: 1213  TDTDGIASSYL 1223
              +  G  S ++
Sbjct: 20850 ENPAGKKSGFV 20860



 Score =  233 bits (593), Expect = 2e-60
 Identities = 236/910 (25%), Positives = 381/910 (41%), Gaps = 117/910 (12%)

Query: 404   EIHFDDKF-DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSG 462
             +I  D KF D    + GE   L   V   P      P ++W ++G  L  +  ++   + 
Sbjct: 21460 KIKVDVKFKDTVILKAGEAFRLEADVSGRPP-----PTMEWSKDGKELEGTAKLEIKIAD 21514

Query: 463   ERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEAN 522
                 L      + D G YT+       + ++   V V D      G P  PL V   E  
Sbjct: 21515 FSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRP----GPPEGPLAVT--EVT 21568

Query: 523   KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIF 582
              +  ++SW  P  DGG+ I  Y + K E    +W+    + V+  +  VT L++G  YIF
Sbjct: 21569 SEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVA-SEVQVTKLKVTKLLKGNEYIF 21627

Query: 583   RVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPT 642
             RV AVNK G+G P   SEPV A++P                              P PP 
Sbjct: 21628 RVMAVNKYGVGEPLE-SEPVLAVNPYGP---------------------------PDPPK 21659

Query: 643   DLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFD 701
             +  VT  T+  +V+ W  P    G E I Y VE+ +   + W + N +  +   R+ +  
Sbjct: 21660 NPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKT-LTDLRYKVSG 21718

Query: 702   LAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEE 761
             L EG  Y FR+   N+AG+  PS  +      D +  P  PG       + +S+ ++W +
Sbjct: 21719 LTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNK 21778

Query: 762   S--KDAKELVGYYIEASVAGSGKWEPCNNNP-VKGSRFTCHGLVTGQSYIFRVRAVNAAG 818
                    E+ GY +E ++    +W+       +K + +T  GL   Q Y  R+ A+N+ G
Sbjct: 21779 PIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEG 21838

Query: 819   LSE--------YSQDS---EAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPP 867
             L E         ++D      IE+ A +   V+   C  L          +GR   A   
Sbjct: 21839 LGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRL----FVPIKGR--PAPEV 21892

Query: 868   TFQKDALLGSKPNKPSLPSSSQ-------NLGQTEVSKVSETVQEELTPPPQKAAPQGKS 920
              + +D   G   +K S+ S+S        N+ + +  K   TV+               S
Sbjct: 21893 KWARDH--GESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENS-----------SGS 21939

Query: 921   KSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVP 980
             KS  +  +     P PP D+   E  + S+ L W  P   GG++I  Y V  RE      
Sbjct: 21940 KSAFVNVRV-LDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTR--- 21995

Query: 981   GKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPG 1040
              K          + ++K+  L+E   Y F+V A N  G+G P+  +E  K  E     P 
Sbjct: 21996 -KAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASER----PL 22050

Query: 1041  PPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYL 1100
             PP  +   +V ++S+ L W+ P H G + + GY V+++   +  D+W     A +K    
Sbjct: 22051 PPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGS--DKWATC--ATVKVTEA 22106

Query: 1101  KVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETR--PGTKEVVVNV-----DDDGV 1153
              + GL +G  Y FRV A N+ G+  P  L+ PV+A+    P   +++ N       +D  
Sbjct: 22107 TITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLK 22166

Query: 1154  ISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVT 1213
             + + F   + TP    +W KD V  + + R+  ES  N + +T KD   +D+G Y   +T
Sbjct: 22167 VDVPF-IGRPTPA--VTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLT 22223

Query: 1214  DTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNA 1273
             ++ G A        E   ++ L      PT PVK +   E+        W   +   G++
Sbjct: 22224 NSAGEAI-------ETLNVIVLDKPGP-PTGPVKMD---EVTADSITLSWGPPKYDGGSS 22272

Query: 1274  KVNYIFNEKE 1283
               NYI  +++
Sbjct: 22273 INNYIVEKRD 22282



 Score =  232 bits (592), Expect = 2e-60
 Identities = 212/734 (28%), Positives = 309/734 (42%), Gaps = 93/734 (12%)

Query: 439   PEIQWYRNGVPLS-PSKWVQTLW-----SGERATLTFSHLNKEDEGLYTIRV--RMGEYY 490
             P+I+W +N   +  P+  +Q        S  +  L+     +ED+G YT+    R+G  +
Sbjct: 15428 PKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVF 15487

Query: 491   EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCE 550
                      R+   E+   P+ P ++   +   +   ++W  P  +GGS I  Y IDK +
Sbjct: 15488 ---------RNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRD 15538

Query: 551   VGTD--SWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPA 608
                    W +  +T V+  R+ +  LI    Y FRVRAVNK GI    + S+ V   DP 
Sbjct: 15539 ASRKKAEWEEVTNTAVE-KRYGIWKLIPNGQYEFRVRAVNKYGISDECK-SDKVVIQDPY 15596

Query: 609   EKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEG 668
                                         +PGPP    V   T+  +++SW PP   G   
Sbjct: 15597 R---------------------------LPGPPGKPKVLARTKGSMLVSWTPPLDNGGSP 15629

Query: 669   IM-YFVEKCEAGTENWQRVN----TELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEP 723
             I  Y++EK E G+  W RV+    T++ +K   F +  L EG  Y FR    N+AG+G P
Sbjct: 15630 ITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPP 15689

Query: 724   SEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE-ESKD-AKELVGYYIEASVAGSG 781
             SE ++  V GD +  P  P        T +S+ + W+  +KD    + GY +E    G+ 
Sbjct: 15690 SEPSDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTT 15749

Query: 782   KWEPCNNNPVKGSRFTCHGLVTG----QSYIFRVRAVNAAGLSEYSQDSEAI-------E 830
              W+   N P K    TC  +V      + Y FRV+AVN AG SE S  +  I       E
Sbjct: 15750 DWKRV-NEPDK-LITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEE 15807

Query: 831   VKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQN 890
              +  I  G    +      +       +GR    S   F   A    K     +P  +Q 
Sbjct: 15808 PEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQ- 15866

Query: 891   LGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAP---------PSPPCDIT 941
             L   E S V       +  P  K +  GK       K   +           P PP D+ 
Sbjct: 15867 LETAENSSV-------IIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLK 15919

Query: 942   CLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNL 1001
               +  R S  L WK PD  GG  I GY +  R  IDG    W + N    S   + + +L
Sbjct: 15920 VSDITRGSCRLSWKMPDDDGGDRIKGYVIEKR-TIDG--KAWTKVNPDCGS-TTFVVPDL 15975

Query: 1002  KENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKP 1061
                  Y F+V A N  G+G P    +     +  I  P PP  LK   + K+++ L WKP
Sbjct: 15976 LSEQQYFFRVRAENRFGIGPPVETIQRTTARD-PIYPPDPPIKLKIGLITKNTVHLSWKP 16034

Query: 1062  PVHSGRTPVTGYFVDL---KEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAI 1118
             P + G +PVT Y V+         K++ WR  N+  ++ +   V  L EG  Y FRV+A+
Sbjct: 16035 PKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAV 16094

Query: 1119  NQAGVGKPSDLAGP 1132
             N AGV KPS   GP
Sbjct: 16095 NAAGVSKPSATVGP 16108



 Score =  228 bits (582), Expect = 3e-59
 Identities = 213/797 (26%), Positives = 332/797 (41%), Gaps = 96/797 (12%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVR--MGEYYEQYSAY 496
             P+  W + G  + PS   Q   +   + LT  +  ++D G YTI      G   E     
Sbjct: 20409 PKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVT 20468

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
             V       ++ G P  P+++  + A K    ++W  P  DGGSPI  Y ++K E     W
Sbjct: 20469 VL------DVPGPPG-PVEISNVSAEK--ATLTWTPPLEDGGSPIKSYILEKRETSRLLW 20519

Query: 557   SQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSR 616
             +  ++  ++  R   T LI+G  YIFRV AVN  G G P + SEPV  +D       +  
Sbjct: 20520 TVVSED-IQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQ-SEPVKMVD-------RFG 20570

Query: 617   PSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEK 675
             P                    PGPP    V+  T++   +SWK P   G   I  Y VE+
Sbjct: 20571 P--------------------PGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVER 20610

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
              E  +  W R   + PV   R  +  L EG +Y FRV   N AG+G PSEA++  ++ D 
Sbjct: 20611 REKKSLRWVRA-IKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDA 20669

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEESK--DAKELVGYYIEASVAGSGKW-EPCNNNPVK 792
                P  P     +  T  S  ++W +       E+ GY +E    G   W +      ++
Sbjct: 20670 AYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALR 20729

Query: 793   GSRFTCHGLVTGQSYIFRVRAVNAAGLSEYS--QDSEAIEVKAAIGGGVSPDVCPALSDE 850
              ++F    L T + Y FR+ A+N AG+ E +   D E +E + A    +  ++   L   
Sbjct: 20730 ITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVR 20789

Query: 851   PGG----LTASRGRVHEASPPTFQKDAL-LGSKPNKPSLPSSS----QNLGQTEVSKVSE 901
              G         +GR   A   T+ KD + L ++ N  +  S +        + +  K   
Sbjct: 20790 AGLSIRIFVPIKGR--PAPEVTWTKDNINLKNRANIENTESFTLLIIPECNRYDTGKFVM 20847

Query: 902   TVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIG 961
             T++           P GK       +  D   P P  ++   +  +DS+ L W  P   G
Sbjct: 20848 TIEN----------PAGKKSGFVNVRVLDT--PGPVLNLRPTDITKDSVTLHWDLPLIDG 20895

Query: 962   GAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGA 1021
             G+ IT Y V  RE        +  A  K   +  YK++ L E   Y F+V A N  G+G 
Sbjct: 20896 GSRITNYIVEKREA---TRKSYSTATTKC-HKCTYKVTGLSEGCEYFFRVMAENEYGIGE 20951

Query: 1022  PSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAK 1081
             P+  +E  K  E     P PP SL   ++ K ++ L W  P H G + +TGY ++ +  +
Sbjct: 20952 PTETTEPVKASE----APSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQ--R 21005

Query: 1082  AKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGT 1141
                DQW  +    +K +   VR L EG  Y F+V A+N AG   P + + PV+ + +   
Sbjct: 21006 KGSDQWTHI--TTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRE-SRPVIVKEQTML 21062

Query: 1142  KE----------VVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGN 1191
              E          V+    D+  + +        PK   +W K     + + R+  E+   
Sbjct: 21063 PELDLRGIYQKLVIAKAGDNIKVEIPV---LGRPKPTVTWKKGDQILKQTQRVNFETTAT 21119

Query: 1192  KTKMTFKDLGMDDLGIY 1208
              T +   +    D G Y
Sbjct: 21120 STILNINECVRSDSGPY 21136



 Score =  227 bits (579), Expect = 6e-59
 Identities = 229/893 (25%), Positives = 362/893 (40%), Gaps = 102/893 (11%)

Query: 425   GCRVVITPEIKHFQ-PEIQWYR-------NGVPLSPSKWVQTLWSGERATLTFSHLNKED 476
             G  V I  +IK    P + W++       N  P+     V  L   +  TL      + D
Sbjct: 16131 GTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSD 16190

Query: 477   EGLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPA 534
              GLYTI     +G   ++    V  R       G P  P+  + + A  D + +SW  P 
Sbjct: 16191 TGLYTITAVNNLGTASKEMRLNVLGRP------GPPVGPIKFESVSA--DQMTLSWFPPK 16242

Query: 535   VDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGF 594
              DGGS I  Y I+K E    +W   +  P K   + +  L+EG  Y+FR+ A NK GIG 
Sbjct: 16243 DDGGSKITNYVIEKREANRKTWVHVSSEP-KECTYTIPKLLEGHEYVFRIMAQNKYGIGE 16301

Query: 595   PSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYV 654
             P         LD           S P T + + +        VPG P   +V+  TR+ +
Sbjct: 16302 P---------LD-----------SEPETARNLFS--------VPGAPDKPTVSSVTRNSM 16333

Query: 655   VLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPR----FALFDLAEGKSYC 709
              ++W+ P   G   +  Y++E  +  ++ W+RVN + P+K+      + +  L EG  Y 
Sbjct: 16334 TVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRD-PIKAMTLGVSYKVTGLIEGSDYQ 16392

Query: 710   FRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES-KDA-KE 767
             FRV   N+AGVG  S  ++     D +  P  P   +    T +S  + W    KD   +
Sbjct: 16393 FRVYAINAAGVGPASLPSDPATARDPIAPPGPPFPKVTDW-TKSSADLEWSPPLKDGGSK 16451

Query: 768   LVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSE 827
             + GY +E    G  +WE   +  V+G++    GL  G  Y FRVRAVN AG+ E  + ++
Sbjct: 16452 VTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTD 16511

Query: 828   AIEVKAAIGGGVSPD------VCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNK 881
              IE+K  +   VSPD      V   +    GG+      V    PPT   +    + P +
Sbjct: 16512 VIEMKDRL---VSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQE 16568

Query: 882   PSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDIT 941
              ++ +++  +  + V K  +   + +     K     + K+  +       P   P    
Sbjct: 16569 ATIETTA--ISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTP--FL 16624

Query: 942   CLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNL 1001
                   +S  L W  P+  GG+ IT Y +  RE        W         + A  +  L
Sbjct: 16625 AHNLTNESCKLTWFSPEDDGGSPITNYVIEKRE---SDRRAWTPVTYTVTRQNA-TVQGL 16680

Query: 1002  KENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKP 1061
              +   Y F++AA N  G+G     SE     E  I VP  P  L+  EV K+++ L W P
Sbjct: 16681 IQGKAYFFRIAAENSIGMGPFVETSEALVIRE-PITVPERPEDLEVKEVTKNTVTLTWNP 16739

Query: 1062  PVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQA 1121
             P + G + +  Y ++       E   +  N+  +   Y  V+GLKEG +Y +RV A+N  
Sbjct: 16740 PKYDGGSEIINYVLE-SRLIGTEKFHKVTNDNLLSRKY-TVKGLKEGDTYEYRVSAVNIV 16797

Query: 1122  GVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMT------PKSEFSWSKDY 1175
             G GKPS    P+  +       + ++  D   I +  E   +T      PK + SW KD 
Sbjct: 16798 GQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIRVG-EAFALTGRYSGKPKPKVSWFKDE 16856

Query: 1176  VSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSY----LIDEEELKR 1231
                 +  R  +++      +        D G Y   V ++ G    +    ++D      
Sbjct: 16857 ADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDR----- 16911

Query: 1232  LLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEI 1284
                       P  PV      E+ +   V  W       G+   NYI  +KE+
Sbjct: 16912 ----------PGPPVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEV 16954



 Score =  225 bits (574), Expect = 2e-58
 Identities = 218/877 (24%), Positives = 354/877 (40%), Gaps = 106/877 (12%)

Query: 367   VVVKRYKGEFDETRFHAGASTM-----PLSFGVTPYGYASRFEIHFDDKFDVSFGREGET 421
             V+ +   G F E     GA T      P    + P  Y     +H  + F V     G+ 
Sbjct: 22513 VIARNAAGVFSEPSESTGAITARDEVDPPRISMDPK-YKDTIVVHAGESFKVDADIYGKP 22571

Query: 422   MSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYT 481
             +                P IQW +    LS +  ++   +    +L+     + D G Y 
Sbjct: 22572 I----------------PTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYI 22615

Query: 482   IRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPI 541
             ++ +        +  V V D      G P  P+ +  + A K    ++WK P  DGGS I
Sbjct: 22616 LKAKNVAGERSVTVNVKVLDRP----GPPEGPVVISGVTAEK--CTLAWKPPLQDGGSDI 22669

Query: 542   LGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEP 601
             + Y +++ E     W+   D  V+     VT L+EG  Y FR+ AVNK G+G P   SEP
Sbjct: 22670 INYIVERRETSRLVWTVV-DANVQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLE-SEP 22727

Query: 602   VAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPP 661
             V A +P                            +VP  P    VT  T+  +++ W+ P
Sbjct: 22728 VVAKNPF---------------------------VVPDAPKAPEVTTVTKDSMIVVWERP 22760

Query: 662   GQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGV 720
                G   I+ Y +EK +     W R +  L +   R  +  L E   Y FRV   N+AG+
Sbjct: 22761 ASDGGSEILGYVLEKRDKEGIRWTRCHKRL-IGELRLRVTGLIENHDYEFRVSAENAAGL 22819

Query: 721   GEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVA 778
              EPS  +      D +  P  P        T +SV +SW +       E+ GY +E    
Sbjct: 22820 SEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDV 22879

Query: 779   GSGKWEPCNN-NPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGG 837
               G+W  C     +  +      L+    Y FR+ A+N AG+ E++     I V+  +  
Sbjct: 22880 SVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEA 22939

Query: 838   ---GVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQ----- 889
                 +  ++   ++   GG       +     P  +   + G   +   +  +S      
Sbjct: 22940 PDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTSLV 22999

Query: 890   --NLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFR 947
               N+ + +  K + T++             G   +    +  D   PSPP ++   E  +
Sbjct: 23000 LDNVNRYDSGKYTLTLENS----------SGTKSAFVTVRVLDT--PSPPVNLKVTEITK 23047

Query: 948   DSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVY 1007
             DS+ + W+ P   GG++I  Y V  RE       K   A V    + ++KI  L+E   Y
Sbjct: 23048 DSVSITWEPPLLDGGSKIKNYIVEKREATR----KSYAAVVTNCHKNSWKIDQLQEGCSY 23103

Query: 1008  QFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGR 1067
              F+V A N  G+G P+  ++  K  E    VP PP  +   +V ++S+ L W  P H G 
Sbjct: 23104 YFRVTAENEYGIGLPAQTADPIKVAE----VPQPPGKITVDDVTRNSVSLSWTKPEHDGG 23159

Query: 1068  TPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPS 1127
             + +  Y V++ +AK  E +W     A +K++   +  L +G  Y+FRV A+N+ G   P 
Sbjct: 23160 SKIIQYIVEM-QAKHSE-KWSEC--ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPR 23215

Query: 1128  DLAGPVVA-------ETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTED 1180
              LA P+VA       + +P      V V  D  I +        PK   +W+KD +  + 
Sbjct: 23216 SLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISG---RPKPTITWTKDGLPLKQ 23272

Query: 1181  SPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
             + R+ V    + T ++ K+   DD G Y   V +  G
Sbjct: 23273 TTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVG 23309



 Score =  224 bits (572), Expect = 4e-58
 Identities = 288/1312 (21%), Positives = 517/1312 (39%), Gaps = 206/1312 (15%)

Query: 276   APEFIIKP------RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIE 329
             A + +I+P       S++V   +++K+   I+G P+P +TW K+ +P+       +  + 
Sbjct: 23223 AKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLK---QTTRINVT 23279

Query: 330   SRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRY----KG--EFDETRFHA 383
                 + TL I     +D  QY  +  NV G+ +A   +V        KG  +FD+     
Sbjct: 23280 DSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDV---- 23335

Query: 384   GASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQW 443
              A ++ LS+    Y    +   +   K D +                             
Sbjct: 23336 SAESITLSWNPPLYTGGCQITNYIVQKRDTT----------------------------- 23366

Query: 444   YRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV---FVR 500
                      + W     +  R TL  + L    E  Y  R+     Y Q  A      V 
Sbjct: 23367 --------TTVWDVVSATVARTTLKVTKLKTGTE--YQFRIFAENRYGQSFALESDPIVA 23416

Query: 501   DADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCN 560
                 +  G P  P        +KD ++I W +P  +GGSP++GY +++ E  +  W++ N
Sbjct: 23417 QYPYKEPGPPGTPF---ATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVN 23473

Query: 561   DTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAP 620
              T +   +F    L EG  Y FRV A N +G+G  S+ SE   A DP +           
Sbjct: 23474 KTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDP---------- 23523

Query: 621   WTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAG 679
                              PG P  + V    R+ + L W  P   G   I  Y VEK +  
Sbjct: 23524 -----------------PGTPEPIMVK---RNEITLQWTKPVYDGGSMITGYIVEKRDLP 23563

Query: 680   TENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAG-VGEPSEATEVTVVGDKLDI 738
                W + +    +++ +F +  L E + Y FRV   N+AG + +PS++T      D++++
Sbjct: 23564 DGRWMKASFTNVIET-QFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVEL 23622

Query: 739   PKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEAS--VAGSGKWEPCNNNPVKGSRF 796
             P+     +  +  DT VV + E  +   ++ G  +     + G  + E      +K + F
Sbjct: 23623 PRIS---MDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDF 23679

Query: 797   TCHGLVT------GQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGG-----GVSPDVC- 844
                 +V       G  YI  +RA N AG   +  + + ++      G     GV+ + C 
Sbjct: 23680 KALLIVKDAIRIDGGQYI--LRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCS 23737

Query: 845   ----PALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVS 900
                 P L D  GG   S   V +          ++ S+    SL  +    G   V ++ 
Sbjct: 23738 LTWSPPLQD--GGSDISHYVVEKRETSRLAW-TVVASEVVTNSLKVTKLLEGNEYVFRIM 23794

Query: 901   ETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKI 960
                +  +  P + A         P+  K     P PP  +      +DSM + W +PD  
Sbjct: 23795 AVNKYGVGEPLESA---------PVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSD 23845

Query: 961   GGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLG 1020
             GG+EI GY V  R+   G+  +W + N + +++   +++ L E+  Y+F+V+A N AG+G
Sbjct: 23846 GGSEIIGYIVEKRD-RSGI--RWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVG 23902

Query: 1021  APSAVSECFK-CEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE 1079
              PS  +  +K C+   +  PGPP +    +  K+S+ L W  P++ G + + GY V++  
Sbjct: 23903 EPSPATVYYKACD--PVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEI-- 23958

Query: 1080  AKAKEDQWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETR 1138
              KA E++W+ +  +  ++    ++  L E   Y  RV A+N+ G+G+ + + G V  E +
Sbjct: 23959 CKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDK 24018

Query: 1139  PGTKE----------VVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVES 1188
                 E          +VV       I + F   K  P  E +WS++    E + ++++E 
Sbjct: 24019 LEAPELDLDSELRKGIVVRAGGSARIHIPF---KGRPTPEITWSRE--EGEFTDKVQIEK 24073

Query: 1189  KGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKS 1248
               N T+++  +   +D G Y   + ++ G  S+++  +                T     
Sbjct: 24074 GVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVK-------------VLDTPGPPQ 24120

Query: 1249  ELAVEILEKGQVRFWMQAEKLSGNAKV-NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEK 1307
              LAV+ + K       +   + G AKV NY+ +++E     K   ++          +E 
Sbjct: 24121 NLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRE--STRKAYANVSSKCSKTSFKVEN 24178

Query: 1308  LQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWE 1367
             L   +   Y F++           V   D  K  +               P     ++  
Sbjct: 24179 L--TEGAIYYFRVMAENEFGVGVPVETVDAVKAAEP--------------PSPPGKVTLT 24222

Query: 1368  VTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDF--KDGICTLLITEFSKKDAGI 1425
                + +  L  +       + ++ Y  E +    EK     +  +C  ++T  S      
Sbjct: 24223 DVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVTGLSSGQEYQ 24282

Query: 1426  YEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIAL------SATDLKIQSTAEGIQLYS 1479
             + V   +++GK   R+  V    K+L ++   K+        +  DLKI+    G    +
Sbjct: 24283 FRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPN 24342

Query: 1480  FVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVM 1531
                       ++W  +G  ++ + RV    T     L I E   +D GKY +
Sbjct: 24343 ----------ISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTV 24384



 Score =  219 bits (558), Expect = 2e-56
 Identities = 202/716 (28%), Positives = 292/716 (40%), Gaps = 101/716 (14%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTP-VKFAR 568
             P  P + + L+ ++  I I+W +P  DGGS I GY ++      D W        +K   
Sbjct: 21756 PGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATS 21815

Query: 569   FPVTGLIEGRSYIFRVRAVNKMGIGFPS----------RVSEPVAALD------------ 606
             + +TGL E + Y  R+ A+N  G+G P+          R+  P   LD            
Sbjct: 21816 YTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRAC 21875

Query: 607   ------------PA-------------EKARLKSRPSAPW----------TGQIIVTEEE 631
                         PA             +KA ++S  S             +G+ I+T E 
Sbjct: 21876 CTLRLFVPIKGRPAPEVKWARDHGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVEN 21935

Query: 632   PSEGI----------VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGT 680
              S              PGPP DL V E T++ V L+W PP   G   I  Y VEK E+  
Sbjct: 21936 SSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTR 21995

Query: 681   ENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPK 740
             + +  V T     S  + +  L EG SY FRV   N  G+G P+E  E     ++   P 
Sbjct: 21996 KAYSTVATNCHKTS--WKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASER---PL 22050

Query: 741   APGKIIPSRNTDTSVVVSWE--ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTC 798
              PGKI     T  SV +SWE  E      ++GY +E    GS KW  C    VK +  T 
Sbjct: 22051 PPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATCAT--VKVTEATI 22108

Query: 799   HGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASR 858
              GL+ G+ Y FRV A N  G+S+  Q S  +  K  +       + PA        T   
Sbjct: 22109 TGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLV-------IPPAFKLLFNTFTVLA 22161

Query: 859   GRVHEASPPTFQK--DALLGSKPNKPSLPSSSQNLGQTE---VSKVSETVQEELTPPPQK 913
             G   +   P   +   A+   K N P   ++  N   TE   +  + +  +E++     K
Sbjct: 22162 GEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVK 22221

Query: 914   AAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYR 973
                      + L       P  P   +   E   DS+ L W  P   GG+ I  Y V  R
Sbjct: 22222 LTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKR 22281

Query: 974   EVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEE 1033
                D     W+  +   V+    K   LK    YQF++AA N    G  + ++      +
Sbjct: 22282 ---DTSTTTWQIVSA-TVARTTIKACRLKTGCEYQFRIAAENR--YGKSTYLNSEPTVAQ 22335

Query: 1034  WTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEA 1093
             +   VPGPP +   +   +DS+ +QW  P+  G + V GY ++ KE  +    W  LN+ 
Sbjct: 22336 YPFKVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNS--ILWVKLNKT 22393

Query: 1094  AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAE---TRPGTKEVVV 1146
              I     K  GL+EGV Y FRV A N  G+GKPS ++   VA      PG  E ++
Sbjct: 22394 PIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAII 22449



 Score =  219 bits (557), Expect = 2e-56
 Identities = 204/808 (25%), Positives = 322/808 (39%), Gaps = 89/808 (11%)

Query: 439   PEIQWYRN--GVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAY 496
             PE+ W ++     L+ S  V+     + +  + +   + D G Y +           +A 
Sbjct: 18231 PEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATN-------TAG 18283

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
              FV  A   +   P    ++K ++ + D   + W  P  DGG  I  Y ++KCE     W
Sbjct: 18284 SFVAYATVNVLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVW 18343

Query: 557   SQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSR 616
             S  + T V      VT LIEG  YIFRVRA NK+G G P+  S+PV A    +K      
Sbjct: 18344 STYSAT-VLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTE-SKPVIAKTKYDK------ 18395

Query: 617   PSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEK 675
                                  PG P    VT+ ++  + + W PP   G + I  YF+EK
Sbjct: 18396 ---------------------PGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEK 18434

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
              E  +  W  VN +  +   R  + +L     Y FRV+  N  G+GEPS  +   V  D 
Sbjct: 18435 KEKHSTRWVPVN-KSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDP 18493

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIE-----ASVAGSGKWEPCN- 787
             ++ P  P        T  S+ + W +        ++GY +E     A  +    W+ CN 
Sbjct: 18494 IEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNA 18553

Query: 788   NNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPAL 847
                +    FT   L   Q Y FRV A N  G+   ++  EAI+ K  +     P++    
Sbjct: 18554 AAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEIL---EPPEI---- 18606

Query: 848   SDEPGGLTASRGR--VHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSET--- 902
                   L AS  +  +  A  P      L      +P+   + + +G   V +  +    
Sbjct: 18607 -----DLDASMRKLVIVRAGCPI----RLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLV 18657

Query: 903   -VQEELTPPPQKAAPQGKSKSDPLKKKTDRA---------PPSPPCDITCLESFRDSMVL 952
                  L  P       GK     +    ++A          P P  D+   +  + S  +
Sbjct: 18658 DTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHV 18717

Query: 953   GWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVA 1012
              W  P+  GG+++T Y V  RE       K        V + ++ ++NL     Y F+V 
Sbjct: 18718 SWAPPENDGGSQVTHYIVEKRE----ADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVT 18773

Query: 1013  AMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTG 1072
             A+N  G G P+ V +     +  ++ P PP  L+ +E+ K+S  L W PP+  G   + G
Sbjct: 18774 AVNEYGPGVPTDVPKPVLASD-PLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDG 18832

Query: 1073  YFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGP 1132
             Y    +E +   D+W     + +K++ L V GLKEG  Y FRV A N  GV  P +  G 
Sbjct: 18833 YITSYREEEQPADRW--TEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGV 18890

Query: 1133  VVAETRPGTKEVVV--NVDDDGVISLNFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESK 1189
               A+ +    ++++   +       L  E      P     W K       S  L V   
Sbjct: 18891 YEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKA 18950

Query: 1190  GNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
              + + +  KD+   D G YS    ++ G
Sbjct: 18951 DSSSILIIKDVTRKDSGYYSLTAENSSG 18978



 Score =  216 bits (551), Expect = 1e-55
 Identities = 206/784 (26%), Positives = 323/784 (41%), Gaps = 104/784 (13%)

Query: 475   EDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPA 534
             ED G+Y++ V      +  S  V V D        P  P D++  E  KD   ++WK+P 
Sbjct: 17282 EDGGIYSLTVENPAGSKTVSVKVLVLDK-------PGPPRDLEVSEIRKDSCYLTWKEPL 17334

Query: 535   VDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGF 594
              DGGS I  Y +++ +V +  WS  + T  K + F    L EG  Y+FRV A N+ G G 
Sbjct: 17335 DDGGSVITNYVVERRDVASAQWSPLSATSKKKSHF-AKHLNEGNQYLFRVAAENQYGRGP 17393

Query: 595   PSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYV 654
                  +P+ ALDP                              PGPP DL   +  ++ V
Sbjct: 17394 FVETPKPIKALDPLHP---------------------------PGPPKDLHHVDVDKTEV 17426

Query: 655   VLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVR 713
              L W  P + G   I  Y VE  E GT++W +  T   V +    +  L +GK+Y FRV+
Sbjct: 17427 SLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKT---VTNLECVVTGLQQGKTYRFRVK 17483

Query: 714   CSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYI 773
               N  G+G P   T + +   +  +P       PS   D  ++                I
Sbjct: 17484 AENIVGLGLPD--TTIPIECQEKLVP-------PSVELDVKLIEGLVVKAGTTVRFPAII 17534

Query: 774   EASVAGSGKWEPCNNNPVKGSRFT--------------CHGLVTGQSYIFRVRAVNAAGL 819
                   + KW    +       +T              C    TG+   +++   NAAG 
Sbjct: 17535 RGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGE---YQITVSNAAGS 17591

Query: 820   SEYSQDSEAIEVKAAIGGGVSP-DVCP---ALSDEP----GGLTASRGRVHEASPPTFQK 871
                +     ++V     G ++  DV P    +S +P    GG       V +      +K
Sbjct: 17592 KTVAVHLTVLDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDT---RK 17648

Query: 872   DA--LLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKT 929
             D   ++ S  +K  L       G   V +V    +  + PP           S P   K 
Sbjct: 17649 DTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENKIGVGPPLD---------STPTVAKH 17699

Query: 930   DRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVK 989
               +PPSPP      +   ++  + W  P   GG+ ITGYY+  RE    V GKW   N  
Sbjct: 17700 KFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERRE----VTGKWVRVNKT 17755

Query: 990   AVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFK-CEEWTIAVPGPPHSLKCS 1048
              +++  ++++ L E   Y+F+V A N+AGL  PS  S+  K C    I  PGPP + K  
Sbjct: 17756 PIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACR--PIKPPGPPINPKLK 17813

Query: 1049  EVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN-EAAIKNVYLKVRGLKE 1107
             +  +++  L W  P+  G +P+ GY V+ +  K    QW  +N +  I+    +V GL E
Sbjct: 17814 DKSRETADLVWTKPLSDGGSPILGYVVECQ--KPGTAQWNRINKDELIRQCAFRVPGLIE 17871

Query: 1108  GVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLN-------FEC 1160
             G  Y FR++A N  G G+P +LA  V+A+      EV ++V    VI++           
Sbjct: 17872 GNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILAR 17931

Query: 1161  DKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIAS 1220
              K  P+ + +W+K+        R+++     + ++  K+    D G Y     ++ G A 
Sbjct: 17932 VKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQ 17991

Query: 1221  SYLI 1224
                I
Sbjct: 17992 GSAI 17995



 Score =  216 bits (550), Expect = 1e-55
 Identities = 215/827 (25%), Positives = 330/827 (39%), Gaps = 99/827 (11%)

Query: 417   REGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKED 476
             R G TM L   V   P      P+I W +  V L     +    +     L   ++NK D
Sbjct: 19706 RAGVTMRLYVPVKGRPP-----PKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYD 19760

Query: 477   EGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVD 536
              G Y + +      ++Y+  V V D        P  P++V   E +KD   ++W+ P +D
Sbjct: 19761 AGKYILTLENSCGKKEYTIVVKVLDT-------PGPPVNVTVKEISKDSAYVTWEPPIID 19813

Query: 537   GGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPS 596
             GGSPI+ Y + K +    SWS    T      F V  L EG+SY FRV A N+ GIG P 
Sbjct: 19814 GGSPIINYVVQKRDAERKSWSTVT-TECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPG 19872

Query: 597   RVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVL 656
                + V A                                 PGP  DL V   ++S   +
Sbjct: 19873 ETRDAVKASQ------------------------------TPGPVVDLKVRSVSKSSCSI 19902

Query: 657   SWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSN 716
              WK P   G   I+ +V         WQRV   L   S +++  DL EGK Y FRV   N
Sbjct: 19903 GWKKPHSDGGSRIIGYVVDFLTEENKWQRVMKSL---SLQYSAKDLTEGKEYTFRVSAEN 19959

Query: 717   SAGVGEPSEATEVT---VVGDKLDIPKAPGKIIPSRNTDT-----------SVVVSWEES 762
               G G PSE T V    VV   LD+   P     ++               +  VSW++ 
Sbjct: 19960 ENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKG 20019

Query: 763   KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEY 822
             +D        +      S +    N   +    + C     G+   + +   N AG  E 
Sbjct: 20020 EDP-------LATDTRVSVESSAVNTTLIV---YDCQKSDAGK---YTITLKNVAGTKE- 20065

Query: 823   SQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKP 882
                + +I+V    G    P     ++ E   L  +  +    S  T        S  NK 
Sbjct: 20066 --GTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKW 20123

Query: 883   SLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKS-KSDPLKKKTDRAPPSPPCDIT 941
                +S+       V+++ E ++       +     G+  KS+P+  +     P  P    
Sbjct: 20124 VTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPN 20183

Query: 942   CLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNL 1001
              ++   DS+ L W  P K GG+ ITGY++ ++E    +   W+ AN   +    +K++ L
Sbjct: 20184 IVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLL---WKRANKTPIRMRDFKVTGL 20240

Query: 1002  KENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKP 1061
              E + Y+F+V A+N+AG+G PS  SE     +  I  PG P  +    + ++S+ L W  
Sbjct: 20241 TEGLEYEFRVMAINLAGVGKPSLPSEPVVALD-PIDPPGKPEVI---NITRNSVTLIWTE 20296

Query: 1062  PVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQA 1121
             P + G   +TGY V+ ++  +K   W   N   +      V  L EG  Y FR+RA N A
Sbjct: 20297 PKYDGGHKLTGYIVEKRDLPSK--SWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTA 20354

Query: 1122  G-VGKPSDLAGPVVAETR---------PGTKE-VVVNVDDDGVISLNFECDKMTPKSEFS 1170
             G +  PS+    ++ +           P  K+ + +   D  V++      K  PKS  S
Sbjct: 20355 GAISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKS--S 20412

Query: 1171  WSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
             WSK       S   ++ S    + +T K     D G Y+   T+  G
Sbjct: 20413 WSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFG 20459



 Score =  216 bits (550), Expect = 1e-55
 Identities = 203/835 (24%), Positives = 345/835 (41%), Gaps = 98/835 (11%)

Query: 411   FDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFS 470
             FD    + GE++ +   V   P      P + W+++GV +     ++        +L   
Sbjct: 27965 FDGLIIKSGESLRIKALVQGRPV-----PRVTWFKDGVEIEKRMNMEITDVLGSTSLFVR 28019

Query: 471   HLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISW 530
                ++  G+YT+  +      +    V V+D   ++ G       ++      + + + W
Sbjct: 28020 DATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGP------IRFTNITGEKMTLWW 28073

Query: 531   KQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKM 590
               P  DG +PI  Y I+K E    +W+   D   +   +    LI G  Y FRV AVNK 
Sbjct: 28074 DAPLNDGCAPITHYIIEKRETSRLAWALIEDK-CEAQSYTAIKLINGNEYQFRVSAVNKF 28132

Query: 591   GIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEAT 650
             G+G P   S+PV A                   QI  T        VP  P     +  T
Sbjct: 28133 GVGRPLD-SDPVVA-------------------QIQYT--------VPDAPGIPEPSNIT 28164

Query: 651   RSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYC 709
              + + L+W +P    G E   Y +E+ E  +  W +V ++ P+   RF +  L EG  Y 
Sbjct: 28165 GNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYE 28224

Query: 710   FRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKE 767
             F V   N+AGVG  S  + +    + ++ P  P  +  +  + T+V + W +       E
Sbjct: 28225 FHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGME 28284

Query: 768   LVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSE 827
             ++GY IE   A  G W   N      +R+T   L  G+ Y FRV A+N AG  +  + + 
Sbjct: 28285 IIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTG 28344

Query: 828   AIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRV-----HEASP-PT---FQKDALLGSK 878
              I+   A+    +P++    + +   +  +   +     ++  P PT    + D+ L  +
Sbjct: 28345 TIK---AVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLR 28401

Query: 879   PNKPSLPSSS----QNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPP 934
              +  +  S S    +N  + +  K + TV+               SKS     K     P
Sbjct: 28402 ADIHTTDSFSTLTVENCNRNDAGKYTLTVEN-----------NSGSKSITFTVKV-LDTP 28449

Query: 935   SPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEE 994
              PP  IT  +  R S  L W  P   GGA I  Y V  RE        W+  + K  + +
Sbjct: 28450 GPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKRE---ASRRSWQVISEKC-TRQ 28505

Query: 995   AYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDS 1054
              +K+++L E + Y F+V+A+N  G+G P  + E     E     P PP  L   +  K S
Sbjct: 28506 IFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATE----QPAPPRRLDVVDTSKSS 28561

Query: 1055  LVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFR 1114
              VL W  P H G + +TGY +++++  +  D W  +     K +   V  L E   Y FR
Sbjct: 28562 AVLAWLKPDHDGGSRITGYLLEMRQKGS--DFW--VEAGHTKQLTFTVERLVEKTEYEFR 28617

Query: 1115  VRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMT---------- 1164
             V+A N AG  +P +    V+ +      ++    D  G+ +    C   +          
Sbjct: 28618 VKAKNDAGYSEPREAFSSVIIK----EPQIEPTADLTGITNQLITCKAGSPFTIDVPISG 28673

Query: 1165  -PKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGI 1218
              P  + +W  + +  +++ R+ + +  ++T +T KD    D G Y   + +T G+
Sbjct: 28674 RPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGV 28728



 Score =  209 bits (533), Expect = 1e-53
 Identities = 206/802 (25%), Positives = 328/802 (40%), Gaps = 99/802 (12%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVR--MGEYYEQYSAY 496
             P I+WY++   L  +  V    + + A++     ++ + G Y +++R  MG      SA 
Sbjct: 26902 PTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMG------SAS 26955

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
               +R    +  G P  P++ K + A K  I + W+ PA DGG+ I  Y ++K E     W
Sbjct: 26956 ATIRVQILDKPGPPGGPIEFKTVTAEK--ITLLWRPPADDGGAKITHYIVEKRETSRVVW 27013

Query: 557   SQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSR 616
             S  ++  ++      T +I+G  YIFRVRAVNK GIG P      VA             
Sbjct: 27014 SMVSE-HLEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVA------------- 27059

Query: 617   PSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEK 675
                             +  + PGPP    VT+ T++ + + W  P   G   I  YF+EK
Sbjct: 27060 ---------------KNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEK 27104

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
              +  +  W +V  E  ++  R  +  L E   Y +RV   N+AG G  SE +E     D 
Sbjct: 27105 RDKKSLGWFKVLKE-TIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADP 27163

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCN-NNPVK 792
             +D P  P KI  + +T +S+ + W +        + GY +E       +W   +    V+
Sbjct: 27164 IDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVR 27223

Query: 793   GSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPG 852
              + +    L  G +Y FRV AVN AG  E  + +E ++ K  +    +P++   ++    
Sbjct: 27224 TTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDIL---EAPEIDLDVALRTS 27280

Query: 853   GLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQ 912
              +  +   V    P         G  P   +     +NLG      +  T    L   PQ
Sbjct: 27281 VIAKAGEDVQVLIP-------FKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQ 27333

Query: 913   KAAPQ------------GKSKSDPLKKKTDRAPPSPPCD-ITCLESFRDSMVLGWKQPDK 959
                              G+ KS  +  K    P +  C  +      R ++ L W  P  
Sbjct: 27334 VTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAA--CQKLQVKHVSRGTVTLLWDPPLI 27391

Query: 960   IGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 1019
              GG+ I  Y +  R   D     W   + K  S  ++K+ +L E   + F+V A N  G+
Sbjct: 27392 DGGSPIINYVIEKR---DATKRTWSVVSHKC-SSTSFKLIDLSEKTPFFFRVLAENEIGI 27447

Query: 1020  GAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE 1079
             G P   +E  K  E    VP P   L   +  K S++L W  P   G + +T Y V   E
Sbjct: 27448 GEPCETTEPVKAAE----VPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVV---E 27500

Query: 1080  AKAKEDQ-WRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETR 1138
              K K +Q W   +    K   ++V  LKE     FRV A N+ G+  P  + GP+  +  
Sbjct: 27501 RKGKGEQTWS--HAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTI-GPITVKEL 27557

Query: 1139  -----------PGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVE 1187
                        PG  +V V +  +  + L +   K  PK   SW KD +  ++S  +   
Sbjct: 27558 IITPEVDLSDIPGA-QVTVRIGHNVHLELPY---KGKPKPSISWLKDGLPLKESEFVRFS 27613

Query: 1188  SKGNKTKMTFKDLGMDDLGIYS 1209
                NK  ++ K+   +  G Y+
Sbjct: 27614 KTENKITLSIKNAKKEHGGKYT 27635



 Score =  206 bits (525), Expect = 1e-52
 Identities = 199/815 (24%), Positives = 338/815 (41%), Gaps = 110/815 (13%)

Query: 438   QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
             +PE++W +    L+    ++   +     L   ++ + D G Y + +      +  +A+V
Sbjct: 25136 EPEVKWEKAEGILTDRAQIEV--TSSFTMLVIDNVTRFDSGRYNLTLENNSGSK--TAFV 25191

Query: 498   FVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
              VR  D+     P+AP+++   E  KD + +SW+ P +DGG+ I  Y ++K E    +++
Sbjct: 25192 NVRVLDS-----PSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYA 25246

Query: 558   QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRP 617
                +   K   F +  L EG SY FRV A N+ GIG P+  +EPV   +P          
Sbjct: 25247 TITNNCTK-TTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEP---------- 25295

Query: 618   SAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKC 676
                                 P PP  +++ + TR+   + W+ P   G   I  Y VE  
Sbjct: 25296 --------------------PLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQ 25335

Query: 677   EAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKL 736
               G+E W   +T   VK+    +  L  G+ Y FRV   N  G  +P +   V V+   +
Sbjct: 25336 TKGSEKW---STCTQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLG-VPVIARDI 25391

Query: 737   DIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRF 796
             +I   P   +P     T  V + E+ K     +    +     +  W        + +R 
Sbjct: 25392 EIK--PSVELPFH---TFNVKAREQLK-----IDVPFKGRPQATVNWRKDGQTLKETTRV 25441

Query: 797   TCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTA 856
                   T  S   +  +    G  E    + A        G ++  +   + D PG    
Sbjct: 25442 NVSSSKTVTSLSIKEASKEDVGTYELCVSNSA--------GSITVPITIIVLDRPG--PP 25491

Query: 857   SRGRVHEAS---------PPTFQKDALLGSKPNKPSLPSS------SQNLGQTEVSKVSE 901
                R+ E S         PP +     + +   +    +S      SQ + +T +  V  
Sbjct: 25492 GPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSIKIVRL 25551

Query: 902   TVQEELTPPPQKAAPQGKS---KSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPD 958
             T   E           GKS   +S  +  +   +PP PP     + + + +M++ W+ P 
Sbjct: 25552 TTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPV 25611

Query: 959   KIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAG 1018
               GG+ + GY++ Y+E    +   W +AN   +++   K+S L E ++Y+++V A N+AG
Sbjct: 25612 NDGGSRVIGYHLEYKERSSIL---WSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAG 25668

Query: 1019  LGAPSAVSECFKCEEWTIAVPG-----PPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGY 1073
             +G         KC +    VP      PP   + + + + S+ L+W  P + G   +TGY
Sbjct: 25669 IG---------KCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGY 25719

Query: 1074  FVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQA-GVGKPSDLAGP 1132
              V+ +E    + +W   N   I+  Y +V  L E   Y FRV A N A  V +PS+  GP
Sbjct: 25720 IVERRELP--DGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGP 25777

Query: 1133  VVAETRPGTKEVVVNVDDDGVISLNF-ECDKMT------PKSEFSWSKDYVSTEDSPRLE 1185
             ++ +       V+++V    VI +   E  K+       P    SW+KD +  E+  R E
Sbjct: 25778 IIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTE 25837

Query: 1186  VESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIAS 1220
             + S  N T +T KD    D G Y   + +  G  S
Sbjct: 25838 IISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRS 25872



 Score =  206 bits (523), Expect = 2e-52
 Identities = 199/804 (24%), Positives = 355/804 (44%), Gaps = 75/804 (9%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P  +W  +G  +   +          + LT  +  + D G Y I V      +  + ++ 
Sbjct: 17540 PTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLT 17599

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V D    + G P  P+++  L+   +++ ISW+ P  DGGSP++ Y ++K +   D+W  
Sbjct: 17600 VLD----VPGPPTGPINI--LDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGV 17653

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
              +    K  +  +  L +G  Y+FRVRA NK+G+G P   +  V        A+ K  P 
Sbjct: 17654 VSSGSSK-TKLKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPTV--------AKHKFSPP 17704

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
             +P                 PG P    VT+ T +   +SW  P   G   I  Y++E+ E
Sbjct: 17705 SP-----------------PGKPV---VTDITENAATVSWTLPKSDGGSPITGYYMERRE 17744

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
               T  W RVN + P+   +F +  L EG +Y FRV   N AG+ +PS +++       + 
Sbjct: 17745 V-TGKWVRVN-KTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIK 17802

Query: 738   IPKAP-GKIIPSRNTDTSVVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNP-VKG 793
              P  P    +  ++ +T+ +V W +  S     ++GY +E    G+ +W   N +  ++ 
Sbjct: 17803 PPGPPINPKLKDKSRETADLV-WTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQ 17861

Query: 794   SRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAI-GGGVSPDVC--PALSDE 850
               F   GL+ G  Y FR++A N  G  E  + +E++  K  +    V  DV     ++  
Sbjct: 17862 CAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVR 17921

Query: 851   PGGLTASRGRVHEASPP--TFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELT 908
              G       RV     P  T+ K+  +  +  +  L    Q+L + E+ ++ E V+ +  
Sbjct: 17922 VGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDL---IQDLPRVEL-QIKEAVRADHG 17977

Query: 909   PPPQKAA-PQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITG 967
                  A    G ++   +    DR  P P  ++      +++  + W+ P   GG+EIT 
Sbjct: 17978 KYIISAKNSSGHAQGSAIVNVLDR--PGPCQNLKVTNVTKENCTISWENPLDNGGSEITN 18035

Query: 968   YYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSE 1027
             + V YR+     P +   + V +   +    +NL  N  Y F+V A N  G+G P+  ++
Sbjct: 18036 FIVEYRK-----PNQKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVG-PTIETK 18089

Query: 1028  CFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQW 1087
                     I  PG P +L  ++  K  + L+W+ P + G +P   Y V+ +  K  +D W
Sbjct: 18090 TPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVE-RRLKGSDD-W 18147

Query: 1088  RGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVN 1147
               +++ +IK  +  V    E   Y FRV+  N+ G    SD         +   ++ V++
Sbjct: 18148 ERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGG---ESDWVKTEEVVVKEDLQKPVLD 18204

Query: 1148  VDDDGVI------SLNFECD-KMTPKSEFSWSKDYVSTE--DSPRLEVESKGNKTKMTFK 1198
             +   GV+      ++  E   +  P  E +W+KD  +T+   SPR++++++ + +K +  
Sbjct: 18205 LKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLT 18264

Query: 1199  DLGMDDLGIYSCDVTDTDGIASSY 1222
                  D G Y    T+T G   +Y
Sbjct: 18265 KAKRSDGGKYVVTATNTAGSFVAY 18288



 Score =  204 bits (519), Expect = 6e-52
 Identities = 197/777 (25%), Positives = 323/777 (41%), Gaps = 98/777 (12%)

Query: 474   KEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQP 533
             + D GLY I+V       +    V V D        P  P++    +  K  ++  W+ P
Sbjct: 14773 RPDHGLYMIKVENDHGIAKAPCTVSVLDT-------PGPPINFVFEDIRKTSVLCKWEPP 14825

Query: 534   AVDGGSPILGYFIDKCE-VGTDS-WSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMG 591
               DGGS I+ Y ++K +    DS W     T ++  ++ VT LIEG+ Y+FRVRA N+ G
Sbjct: 14826 LDDGGSEIINYTLEKKDKTKPDSEWIVVTST-LRHCKYSVTKLIEGKEYLFRVRAENRFG 14884

Query: 592   IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATR 651
              G P  VS+P+ A DP                              P  P    V + T 
Sbjct: 14885 PG-PPCVSKPLVAKDPFGP---------------------------PDAPDKPIVEDVTS 14916

Query: 652   SYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFR 711
             + +++ W  P   G   + Y++EK E  + +W RVN  L + + +  +  L EG +Y FR
Sbjct: 14917 NSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSL-LNALKANVDGLLEGLTYVFR 14975

Query: 712   VRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTS---VVVSWEES--KDAK 766
             V   N+AG G+ S  ++     D +  P  P   IP R TDTS   + + WE        
Sbjct: 14976 VCAENAAGPGKFSPPSDPKTAHDPISPPGPP---IP-RVTDTSSTTIELEWEPPAFNGGG 15031

Query: 767   ELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDS 826
             E+VGY+++  + G+ +W  C    +K  ++T   +  G  Y  RV AVNAAG     +  
Sbjct: 15032 EIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGETQ 15091

Query: 827   EAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPS 886
                  +      V  DV        GG+    G+       T +  A++  +P    + +
Sbjct: 15092 PVTVAEPQEPPAVELDV-----SVKGGIQIMAGK-------TLRIPAVVTGRPVPTKVWT 15139

Query: 887   SSQ-----------NLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPS 935
               +           N+G      + + ++++       A     SK    + +     P 
Sbjct: 15140 KEEGELDKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDV-PG 15198

Query: 936   PPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEA 995
             P  D+  + + R   +L W  P+  GG+EITG+ +  +   D     WR+     +  E 
Sbjct: 15199 PVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERK---DAKMHTWRQ----PIETER 15251

Query: 996   YK--ISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKD 1053
              K  I+ L E   Y+F+V A N  G G P  +      +   +  P  P  L  +E  K 
Sbjct: 15252 SKCDITGLLEGQEYKFRVIAKNKFGCGPPVEIGPILAVD--PLGPPTSPERLTYTERTKS 15309

Query: 1054  SLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVF 1113
             ++ L WK P  +G +P+ GY ++ K    K D +  +N+         V  L E   Y F
Sbjct: 15310 TITLDWKEPRSNGGSPIQGYIIE-KRRHDKPD-FERVNKRLCPTTSFLVENLDEHQMYEF 15367

Query: 1114  RVRAINQAGVGKPSDLAGPVVAETR-PGTKEVVVNVDDDGV-----ISLNFECDKM-TPK 1166
             RV+A+N+ G  +PS     V+ +   P T ++ ++V  D +       ++   D    P 
Sbjct: 15368 RVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPM 15427

Query: 1167  SEFSWSKDYVSTE------DSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
              +  WSK+    E         + EV     KT+++      +D G Y+   ++  G
Sbjct: 15428 PKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLG 15484



 Score =  202 bits (515), Expect = 2e-51
 Identities = 243/1051 (23%), Positives = 411/1051 (39%), Gaps = 156/1051 (14%)

Query: 274   LHAPEFIIKP-RSHTVWEK--ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIES 330
             L  PE  +K   SHTV+ +   N+K+   I+G P P+VT  ++ VP+         I   
Sbjct: 26471 LEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAE 26530

Query: 331   RYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPL 390
                  T+ +      D  +Y  +A N  G   A+ ++VV              G  T P+
Sbjct: 26531 NL---TINLKESVTADAGRYEITAANSSGTTKAFINIVVLD----------RPGPPTGPV 26577

Query: 391   SFG-VTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVP 449
                 +T      ++E     K+D            G +V     +K              
Sbjct: 26578 VISDITEESVTLKWE---PPKYDG-----------GSQVTNYILLKR------------E 26611

Query: 450   LSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRV--RMGEYYEQYSAYVFVRDADAEIE 507
              S + W +   +  R  +    L   +E  + I+   R G      SA V V+       
Sbjct: 26612 TSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVK-LPYTTP 26670

Query: 508   GAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFA 567
             G P+ P         ++ I + W +P  +GGS ++GY ++  +  +  W + N   ++  
Sbjct: 26671 GPPSTPW---VTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTT 26727

Query: 568   RFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIV 627
              F VT +  G  Y FRV A N  G+G PS  SEPV A+D  E                  
Sbjct: 26728 HFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACE------------------ 26769

Query: 628   TEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRV 686
                         PP ++ +T+ +++ V LSW+ P   G   I  Y VE+ +     W + 
Sbjct: 26770 ------------PPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKA 26817

Query: 687   NTELPVKSPRFALFDLAEGKSYCFRVRCSNSAG-VGEPSEATEVTVVGDKLDIPKAPGKI 745
             +    V   +F +  L +   Y FRV   N+ G +  PSE     VVG    I    G +
Sbjct: 26818 SFT-NVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSE-----VVGPITCIDSYGGPV 26871

Query: 746   IPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQ 805
             I      T VV         K   G  ++     SGK  P             + LV  +
Sbjct: 26872 IDLPLEYTEVV---------KYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVE 26922

Query: 806   SYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEAS 865
             +    + ++        +     ++++ A+G   S  +   + D+PG      G   E  
Sbjct: 26923 NTT-DLASILIKDADRLNSGCYELKLRNAMGSA-SATIRVQILDKPG----PPGGPIEFK 26976

Query: 866   PPTFQKDALLGSKPNKPSLPS------SSQNLGQTEVSKVSETVQEELTPPPQ------- 912
               T +K  LL   P               +   +   S VSE ++E +    +       
Sbjct: 26977 TVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECIITTTKIIKGNEY 27036

Query: 913   --------KAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAE 964
                     K       +SD +  K     P PP      +  ++SM + W +P   GG++
Sbjct: 27037 IFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSD 27096

Query: 965   ITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSA 1024
             I+GY++  R   D     W +   + + +   K++ L EN  YQ++V A+N AG G  S 
Sbjct: 27097 ISGYFLEKR---DKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSE 27153

Query: 1025  VSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKE 1084
              SE +K  +  I  PGPP  ++ ++  K S+ L W  PV+ G + VTGY V++++   +E
Sbjct: 27154 PSEFYKAAD-PIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQ--GEE 27210

Query: 1085  DQWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKE 1143
             ++W  ++ +  ++     V  LK GV+Y FRV A+N AG G+P ++  PV A+      E
Sbjct: 27211 EEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPE 27270

Query: 1144  ----------VVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKT 1193
                       V+    +D  + + F   K  P    +W KD  +     R  +E+  + +
Sbjct: 27271 IDLDVALRTSVIAKAGEDVQVLIPF---KGRPPPTVTWRKDEKNLGSDARYSIENTDSSS 27327

Query: 1194  KMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVE 1253
              +T   +  +D G Y   + +  G   S  +  + L             T     +L V+
Sbjct: 27328 LLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVL------------DTPAACQKLQVK 27375

Query: 1254  ILEKGQVRFWMQAEKLSGNAK-VNYIFNEKE 1283
              + +G V        + G +  +NY+  +++
Sbjct: 27376 HVSRGTVTLLWDPPLIDGGSPIINYVIEKRD 27406



 Score =  202 bits (513), Expect = 3e-51
 Identities = 201/738 (27%), Positives = 302/738 (40%), Gaps = 66/738 (8%)

Query: 438   QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
             +P I W ++G+PL  S++V+   +  + TL+  +  KE  G YT+ +            V
Sbjct: 27592 KPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITV 27651

Query: 498   FVRDADAEIEGAPAAPLD-VKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
                       G P+ P   ++  E   D +I+SW  P  +GG  I  Y I+K E    +W
Sbjct: 27652 ITL-------GPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNW 27704

Query: 557   SQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSR 616
                  +  +   F V  L++   Y FRVRA N+ G+                        
Sbjct: 27705 KMVCSSVAR-TTFKVPNLVKDAEYQFRVRAENRYGV------------------------ 27739

Query: 617   PSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYF-VEK 675
              S P    IIV + +     +PGPP    +   T   + L+W  P   G   +  F VEK
Sbjct: 27740 -SQPLVSSIIVAKHQFR---IPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEK 27795

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
              E  +  WQ+VNT  P+    +    L EG  Y FRV   NSAG+  PS+ ++ T+    
Sbjct: 27796 KERNSILWQKVNTS-PISGREYRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSP 27854

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKG 793
             +D P  P  I  +R T   + + W         ++VGY IE    G+ +W  CN   V  
Sbjct: 27855 VDPPGTPDYIDVTRET---ITLKWNPPLRDGGSKIVGYSIEKR-QGNERWVRCNFTDVSE 27910

Query: 794   SRFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIGGGV---SPDVCPALSD 849
              ++T  GL  G  Y FR+ A NA G +S  SQ S  I  +      +    P+    L  
Sbjct: 27911 CQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLII 27970

Query: 850   EPGGLTASRGRVHEASPP--TFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEEL 907
             + G     +  V     P  T+ KD   G +  K      +  LG T +     T     
Sbjct: 27971 KSGESLRIKALVQGRPVPRVTWFKD---GVEIEKRMNMEITDVLGSTSLFVRDATRDHRG 28027

Query: 908   TPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITG 967
                 +     G +K++ +K K    P      I       + M L W  P   G A IT 
Sbjct: 28028 VYTVEAKNASGSAKAE-IKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITH 28086

Query: 968   YYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSE 1027
             Y +  RE    +     E   +A S  A K+ N  E   YQF+V+A+N  G+G P     
Sbjct: 28087 YIIEKRET-SRLAWALIEDKCEAQSYTAIKLINGNE---YQFRVSAVNKFGVGRPLDSDP 28142

Query: 1028  CFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQW 1087
                  ++T  VP  P   + S +  +S+ L W  P   G + +  Y ++ +E K+   +W
Sbjct: 28143 VVAQIQYT--VPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKKS--TRW 28198

Query: 1088  -RGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAE--TRPGTKEV 1144
              + +++  I     KV GL EG  Y F V A N AGVG  S ++  +       P     
Sbjct: 28199 VKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPT 28258

Query: 1145  VVNVDDDGVISLNFECDK 1162
             VV V D    +++ E  K
Sbjct: 28259 VVKVTDTSKTTVSLEWSK 28276



 Score =  201 bits (510), Expect = 6e-51
 Identities = 194/718 (27%), Positives = 295/718 (41%), Gaps = 94/718 (13%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P++ W    + L  +  V    + +R TLT     + D G Y + +      + +S  V 
Sbjct: 28677 PKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVV 28736

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V      + G    P++V  + A     ++SW +P   GG+ I  Y ++K E GT +W  
Sbjct: 28737 VIGRPGPVTG----PIEVSSVSAES--CVLSWGEPKDGGGTEITNYIVEKRESGTTAWQL 28790

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
              N + VK  +  VT L +   Y FRV + N+ G+  P   S P+ A  P           
Sbjct: 28791 VNSS-VKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE-SAPIIAEHPF---------- 28838

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                              + P  PT   V   + + + + W+ P   G   I+ Y+VEK E
Sbjct: 28839 -----------------VPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKE 28881

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
               T  W + N ++P     + +  L EG  Y FR    N+AGV + SEA+   +  + +D
Sbjct: 28882 RNTILWVKEN-KVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVD 28940

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIE---ASVAGSGKWEPCNNNPVKGS 794
              P  P     +R+T  S++ S        ++VGY IE    S  G G+W  CN   V  +
Sbjct: 28941 APGRPEVTDVTRST-VSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDN 28999

Query: 795   RFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGG 853
              FT   L  G +Y FRV A NAAG +S+ S+ +  +  +         +  P  ++    
Sbjct: 29000 FFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCR--------DEYAPPKAELDAR 29051

Query: 854   LTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQK 913
             L      +   S      DA +G KP     P      G  E+  + E V  + T     
Sbjct: 29052 LHGDLVTIRAGSDLVL--DAAVGGKPE----PKIIWTKGDKELD-LCEKVSLQYTGKRAT 29104

Query: 914   AAPQGKSKSDPLK------------------KKTDRAPPSPPCDITCLESFRDSMVLGWK 955
             A  +   +SD  K                  K  D   P P   +T     ++   L W 
Sbjct: 29105 AVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLD--SPGPCGKLTVSRVTQEKCTLAWS 29162

Query: 956   QPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEE----AYKISNLKENMVYQFQV 1011
              P + GGAEIT Y V  RE            N   V  E    +Y ++ L +N  Y F+V
Sbjct: 29163 LPQEDGGAEITHYIVERRET--------SRLNWVIVEGECPTLSYVVTRLIKNNEYIFRV 29214

Query: 1012  AAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVT 1071
              A+N  G G P           +TI  P PP   +     K+ +++QW  P   G   ++
Sbjct: 29215 RAVNKYGPGVPVESEPIVARNSFTI--PSPPGIPEEVGTGKEHIIIQWTKPESDGGNEIS 29272

Query: 1072  GYFVDLKEAKAKEDQWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSD 1128
              Y VD +E K+   +W  +N +  + +  LKV  L EG  Y FRV A+N AG  +PS+
Sbjct: 29273 NYLVDKREKKSL--RWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSE 29328



 Score =  191 bits (486), Expect = 4e-48
 Identities = 191/741 (25%), Positives = 302/741 (40%), Gaps = 88/741 (11%)

Query: 412   DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSH 471
             DV   R G+T+ +  RV   PE     P+I W + G  L   K V  +    R  L    
Sbjct: 17916 DVITVRVGQTIRILARVKGRPE-----PDITWTKEGKVLVREKRVDLIQDLPRVELQIKE 17970

Query: 472   LNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWK 531
               + D G Y I  +    + Q SA V V D        P    ++K     K+   ISW+
Sbjct: 17971 AVRADHGKYIISAKNSSGHAQGSAIVNVLDR-------PGPCQNLKVTNVTKENCTISWE 18023

Query: 532   QPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMG 591
              P  +GGS I  + ++  +     WS       K  R     L+    Y FRV A NK+G
Sbjct: 18024 NPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTK--RLIKANLLANNEYYFRVCAENKVG 18081

Query: 592   IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATR 651
             +G       P+ A++P ++                           PG P +L + +  +
Sbjct: 18082 VGPTIETKTPILAINPIDR---------------------------PGEPENLHIADKGK 18114

Query: 652   SYVVLSWKPPG-QRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCF 710
             ++V L W+ P    G   + Y VE+   G+++W+RV+ +  +K   + +    E + Y F
Sbjct: 18115 TFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVH-KGSIKETHYMVDRCVENQIYEF 18173

Query: 711   RVRCSNSAGVGEPSEATEVTVVGD----KLDIPKAPGKIIPSRNT---DTSV------VV 757
             RV+  N  G  +  +  EV V  D     LD+  +    + + +T   +  V       V
Sbjct: 18174 RVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEV 18233

Query: 758   SWEESKDAKELV---GYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAV 814
             +W + KDA +L       I+   A S K+         G ++      T  S++     V
Sbjct: 18234 AWTKDKDATDLTRSPRVKIDTR-ADSSKFSLTKAKRSDGGKYVVTATNTAGSFV-AYATV 18291

Query: 815   NAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEP--GGLTASRGRVHEASPPTFQKD 872
             N        ++ + ++        VS D C    D P   G    +  + E         
Sbjct: 18292 NVLDKPGPVRNLKIVD--------VSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVW 18343

Query: 873   ALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRA 932
             +   +    P    +    G   + +V    +    PP +      K+K D    K  R 
Sbjct: 18344 STYSATVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYD----KPGR- 18398

Query: 933   PPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVS 992
              P PP ++T +   ++ M + W  P+  GG  ITGY++  +E       +W   N  A+ 
Sbjct: 18399 -PDPP-EVTKVS--KEEMTVVWNPPEYDGGKSITGYFLEKKEKHS---TRWVPVNKSAIP 18451

Query: 993   EEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRK 1052
             E   K+ NL  +  YQF+V A N  G+G PS  S     ++  I  PGPP + +  +  K
Sbjct: 18452 ERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKD-PIEPPGPPTNFRVVDTTK 18510

Query: 1053  DSLVLQWKPPVHSGRTPVTGYFVDL--KEAKAKEDQ-WRGLNEAA-IKNVYLKVRGLKEG 1108
              S+ L W  PV+ G  P+ GY V++  K A A  D+ W+  N AA +      V  L E 
Sbjct: 18511 HSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDEN 18570

Query: 1109  VSYVFRVRAINQAGVGKPSDL 1129
               Y FRV A NQ G+G+P++L
Sbjct: 18571 QEYEFRVCAQNQVGIGRPAEL 18591



 Score =  191 bits (484), Expect = 7e-48
 Identities = 185/740 (25%), Positives = 303/740 (40%), Gaps = 88/740 (11%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P+ P +V  L+  K  + +SW +P  DGGS + GY+I++ E  TD W + N T +    +
Sbjct: 30332 PSNPPEV--LDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMY 30389

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              VTGL+    Y FR+ A N +G+   S  SEPV   DP +K                   
Sbjct: 30390 TVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDK------------------- 30430

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNT 688
                     P  P +L +   ++  V L W KP    G E + Y+VE  ++G   W++ N 
Sbjct: 30431 --------PSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNK 30482

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPS 748
             E  +K  +F +  L E   Y FRV   N  G+  P        +  KL   +APG     
Sbjct: 30483 ER-IKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTA--MSIKTKLTSGEAPGIRKEM 30539

Query: 749   RNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYI 808
             ++  T +    E ++ + ++VG  +        KW       ++  ++       G+++ 
Sbjct: 30540 KDVTTKL---GEAAQLSCQIVGRPLPDI-----KWYRFGKELIQSRKYKMSS--DGRTHT 30589

Query: 809   FRVRAVNAAGLSEYS----QDSEAIEVKAAIGGGVSPDVCPA--LSDEPGGLTASRGRVH 862
               V          Y+     +   +E  + +    +P   P   L ++  G   S  R+H
Sbjct: 30590 LTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLH 30649

Query: 863   EA--SPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKS 920
                   P        G K     L  +S+N+        +  V + +    Q+    GK 
Sbjct: 30650 VMYIGRPVPAMTWFHGQK-----LLQNSENITIENTEHYTHLVMKNV----QRKTHAGKY 30700

Query: 921   KSDP----------LKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYV 970
             K             L  +    P  P   I      ++S V+ WK P   GG+ IT Y V
Sbjct: 30701 KVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVV 30760

Query: 971   NYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFK 1030
                E  +G   +W+  +  A+S    +I NL EN  Y F+V+A N  G+  P  VS    
Sbjct: 30761 EKCEAKEGA--EWQLVS-SAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVI 30817

Query: 1031  CEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGL 1090
              +      PG P     + V KDS V+ WKPP   G   +  Y+++ +E   K+++W  +
Sbjct: 30818 IKS-PFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKRE--KKQNKWISV 30874

Query: 1091  NEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAET-----RPGTKEVV 1145
                 I+     V+ L EG+ Y FRV+  N  G  + S+++ P+  ++      P  KE +
Sbjct: 30875 TTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEEL 30934

Query: 1146  VNVDDDGVISLNFECDKMT--PKSEFSW---SKDYVSTEDSPRLEVESKGNKTKMTFKDL 1200
              N++     +    C K+T  PK    W    K+ ++     R++ E KG   ++    +
Sbjct: 30935 RNLNVRYQSNATLVC-KVTGHPKPIVKWYRQGKEIIADGLKYRIQ-EFKGGYHQLIIASV 30992

Query: 1201  GMDDLGIYSCDVTDTDGIAS 1220
               DD  +Y    T+  G  S
Sbjct: 30993 TDDDATVYQVRATNQGGSVS 31012



 Score =  189 bits (481), Expect = 1e-47
 Identities = 201/817 (24%), Positives = 331/817 (40%), Gaps = 114/817 (13%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             PEI W R     +    VQ         L+  + ++ D G Y +++      +  SA+V 
Sbjct: 24054 PEITWSREEGEFTDK--VQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSK--SAFVT 24109

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V+  D      P  P ++   E  KD   + W+ P +DGG+ +  Y IDK E    +++ 
Sbjct: 24110 VKVLDT-----PGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYAN 24164

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
              +    K + F V  L EG  Y FRV A N+ G+G P    + V A +P           
Sbjct: 24165 VSSKCSKTS-FKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEP----------- 24212

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                                P PP  +++T+ +++   L W+ P   G   ++ Y VE   
Sbjct: 24213 -------------------PSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQP 24253

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
              GTE W  V      K     +  L+ G+ Y FRV+  N  G  +P     V V+   L 
Sbjct: 24254 KGTEKWSIVAES---KVCNAVVTGLSSGQEYQFRVKAYNEKGKSDP-RVLGVPVIAKDLT 24309

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGK----WEPCNNNPVKG 793
             I   P   +P          S +  +D K      IE  V G  +    W   +  P+K 
Sbjct: 24310 IQ--PSLKLPFNT------YSIQAGEDLK------IEIPVIGRPRPNISWVK-DGEPLKQ 24354

Query: 794   SRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGG 853
             +    +   T  S +  ++  N     +Y+       V A    G + +    +  E  G
Sbjct: 24355 TT-RVNVEETATSTVLHIKEGNKDDFGKYT-------VTATNSAGTATENLSVIVLEKPG 24406

Query: 854   LTASRGRVHEAS---------PPTFQKDALLGSK-PNKPSLPSSSQNLGQTEVSKVSETV 903
                   R  E S         PP +     + +    K    +++ ++    V++ +  +
Sbjct: 24407 PPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKI 24466

Query: 904   QEELTPPPQKA---APQGKSKSDPLKKKT-----DRAPPSPPCDITCLESFRDSMVLGWK 955
              +  T    +    A     KS PL  K          P PP         +D M++ W 
Sbjct: 24467 TKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQWH 24526

Query: 956   QPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMN 1015
             +P   GG +I GY++  +E    +   W + N   + +  +K + L E + Y+F+V+A N
Sbjct: 24527 EPVNDGGTKIIGYHLEQKEKNSIL---WVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAEN 24583

Query: 1016  MAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFV 1075
             + G+G PS VSECF   +     PG P ++    + ++++ L+WK P + G + +TGY V
Sbjct: 24584 IVGIGKPSKVSECFVARD-PCDPPGRPEAI---VITRNNVTLKWKKPAYDGGSKITGYIV 24639

Query: 1076  DLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG-VGKPSDLAGPVV 1134
             + K+    + +W   +   +      V GL E   Y FRV A N AG   +PSD +G + 
Sbjct: 24640 EKKD--LPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAIT 24697

Query: 1135  AETR---------PGTKEV-VVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTED-SPR 1183
             A            P  K+V VV+  +  V+  +    +  P  +  WSKD    E+ + R
Sbjct: 24698 ARDEIDAPNASLDPKYKDVIVVHAGETFVLEADI---RGKPIPDVVWSKDGKELEETAAR 24754

Query: 1184  LEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIAS 1220
             +E++S   KT +  KD    D G Y   +++  G  S
Sbjct: 24755 MEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKS 24791



 Score =  188 bits (477), Expect = 4e-47
 Identities = 155/528 (29%), Positives = 237/528 (44%), Gaps = 49/528 (9%)

Query: 638   PGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPR 696
             P PP +L VTE T+  V ++W+PP   G   I  Y VEK EA  +++  V T     S  
Sbjct: 23034 PSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNS-- 23091

Query: 697   FALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVV 756
             + +  L EG SY FRV   N  G+G P++  +   V +   +P+ PGKI     T  SV 
Sbjct: 23092 WKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAE---VPQPPGKITVDDVTRNSVS 23148

Query: 757   VSWE--ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAV 814
             +SW   E     +++ Y +E     S KW  C    VK  +     L  G+ Y+FRV AV
Sbjct: 23149 LSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECAR--VKSLQAVITNLTQGEEYLFRVVAV 23206

Query: 815   NAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDAL 874
             N  G S+    +  I  K  +   + PDV PA S      +   G+  +   P       
Sbjct: 23207 NEKGRSDPRSLAVPIVAKDLV---IEPDVKPAFSS----YSVQVGQDLKIEVP------- 23252

Query: 875   LGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKS-------------K 921
             +  +P KP++  +   L   + ++++ T   +LT    K   +                K
Sbjct: 23253 ISGRP-KPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQK 23311

Query: 922   SDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPG 981
             +  ++  T   P  P   +   +   +S+ L W  P   GG +IT Y V  R+    V  
Sbjct: 23312 TASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTV-- 23369

Query: 982   KWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGP 1041
              W   +   V+    K++ LK    YQF++ A N    G   A+       ++    PGP
Sbjct: 23370 -WDVVSA-TVARTTLKVTKLKTGTEYQFRIFAENR--YGQSFALESDPIVAQYPYKEPGP 23425

Query: 1042  PHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLK 1101
             P +   + + KDS+V+QW  PV++G +PV GY ++ KE  +    W  +N+  I +   K
Sbjct: 23426 PGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNS--ILWTKVNKTIIHDTQFK 23483

Query: 1102  VRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAE---TRPGTKEVVV 1146
              + L+EG+ Y FRV A N  GVGK S  +   VA      PGT E ++
Sbjct: 23484 AQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEPIM 23531



 Score =  179 bits (455), Expect = 2e-44
 Identities = 211/823 (25%), Positives = 315/823 (38%), Gaps = 119/823 (14%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRV--RMGEYYEQYSAY 496
             P++ W + G+     K    L     A L   +  ++D G Y++ +    GE     + +
Sbjct: 18636 PKVTWRKVGIDNVVRKGQVDLVD-TMAFLVIPNSTRDDSGKYSLTLVNPAGEK----AVF 18690

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
             V VR  D      P    D+K  +  K    +SW  P  DGGS +  Y ++K E    +W
Sbjct: 18691 VNVRVLDT-----PGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTW 18745

Query: 557   SQCNDTP-VKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKS 615
             S    TP VK   F VT L+ G  Y FRV AVN+ G G P+ V +PV A DP  +     
Sbjct: 18746 STV--TPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPLSE----- 18798

Query: 616   RPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEK 675
                                   P PP  L VTE T++   L+W PP + G   I  ++  
Sbjct: 18799 ----------------------PDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITS 18836

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
                  +   R      VK     +  L EGK Y FRV   N+ GV  P EA  V    ++
Sbjct: 18837 YREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQ 18896

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSG----KWEPCNNNPV 791
             L  PK    ++P + T           K  K+L    IEA V G      KW+   +  V
Sbjct: 18897 LLPPKI---LMPEQIT----------IKAGKKL---RIEAHVYGKPHPTCKWKKGEDEVV 18940

Query: 792   KGSRFTCHGLVTGQSYIFRVRAVNAAGL----SEYSQDSEAIEVKAAIGGGVSPDVCPA- 846
               S    H   +    I +      +G     +E S  ++  ++K  +     P   P  
Sbjct: 18941 TSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFD 19000

Query: 847   LSD--------------EPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLG 892
             +SD              E GG   +   V +           L S   K S        G
Sbjct: 19001 ISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASV-TKTSCRVGKLIPG 19059

Query: 893   QTEVSKVSET----VQEELTPPPQKAA-PQGKSKSDPLKKKTDRAPPSPPCDITCLESFR 947
             Q  + +V       + E LT P   A  P G               PS P +    +  +
Sbjct: 19060 QEYIFRVRAENRFGISEPLTSPKMVAQFPFGV--------------PSEPKNARVTKVNK 19105

Query: 948   DSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVY 1007
             D + + W +PD  GG+ I GY +  +E    +   W +AN   V    Y  + L E + Y
Sbjct: 19106 DCIFVAWDRPDSDGGSPIIGYLIERKERNSLL---WVKANDTLVRSTEYPCAGLVEGLEY 19162

Query: 1008  QFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGR 1067
              F++ A+N AG   PS  +E +      +  PG P  +   +V K ++ L W  P H G 
Sbjct: 19163 SFRIYALNKAGSSPPSKPTE-YVTARMPVDPPGKPEVI---DVTKSTVSLIWARPKHDGG 19218

Query: 1068  TPVTGYFVDLKEAKAKEDQWRGLNEAA--IKNVYLKVRGLKEGVSYVFRVRAINQAGVGK 1125
             + + GYFV+    K   D+W   N A   I        GL+E   Y FR  A     +  
Sbjct: 19219 SKIIGYFVEA--CKLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISP 19276

Query: 1126  PSDLAGPV--VAETRPGTKEVVVNVDDDGVISLNFE-CDKMT----PKSEFSWSKDYVST 1178
             PS+ + PV  +AE  P   ++ V +     +      C   T    P    SW KD    
Sbjct: 19277 PSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLL 19336

Query: 1179  EDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1221
             + +  +++  + N   +    +   D G Y+    ++ G  S+
Sbjct: 19337 KPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSA 19379



 Score =  177 bits (450), Expect = 6e-44
 Identities = 186/778 (23%), Positives = 306/778 (39%), Gaps = 86/778 (11%)

Query: 465   ATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKD 524
             +TLT  + N+ D G YT+ V      +  +  V V D        P  P+  K  +  + 
Sbjct: 28411 STLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPG-----PPGPITFK--DVTRG 28463

Query: 525   YIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRV 584
                + W  P +DGG+ I  Y ++K E    SW   ++   +   F V  L EG  Y FRV
Sbjct: 28464 SATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISEKCTRQI-FKVNDLAEGVPYYFRV 28522

Query: 585   RAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDL 644
              AVN+ G+G P  + EP+ A                       TE+       P PP  L
Sbjct: 28523 SAVNEYGVGEPYEMPEPIVA-----------------------TEQ-------PAPPRRL 28552

Query: 645   SVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLA 703
              V + ++S  VL+W  P   G   I  Y +E  + G++ W         K   F +  L 
Sbjct: 28553 DVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGH---TKQLTFTVERLV 28609

Query: 704   EGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK-----LDIPKAPGKIIPSRNTDTSVVVS 758
             E   Y FRV+  N AG  EP EA    ++ +       D+     ++I  +      +  
Sbjct: 28610 EKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDV 28669

Query: 759   WEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAG 818
                 + A ++     E  +  + +           +  T    + G S  + +   N AG
Sbjct: 28670 PISGRPAPKVTWKLEEMRLKETDRVSITTTKD--RTTLTVKDSMRGDSGRYFLTLENTAG 28727

Query: 819   LSEYSQDSEAIEVKAAIGG-----GVSPDVCPALSDEP--GGLTASRGRVHEASPPTFQK 871
             +  +S     I     + G      VS + C     EP  GG T     + E        
Sbjct: 28728 VKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGGGTEITNYIVEKRE----- 28782

Query: 872   DALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKS-KSDPLKKKTD 930
                  S      L +SS    Q +V+ +++ ++       +      K  +S P+  +  
Sbjct: 28783 -----SGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESAPIIAEHP 28837

Query: 931   RAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKA 990
               PPS P          ++M + W++P   GG++I GY+V  +E    +   W + N   
Sbjct: 28838 FVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTIL---WVKENKVP 28894

Query: 991   VSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEV 1050
               E  YK++ L E + YQF+  A+N AG+   S  S     +   +  PG P   + ++V
Sbjct: 28895 CLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQN-PVDAPGRP---EVTDV 28950

Query: 1051  RKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKED-QWRGLNEAAIKNVYLKVRGLKEGV 1109
              + ++ L W  P + G + V GY ++ K      D +W   N   + + +  V  L EG 
Sbjct: 28951 TRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGD 29010

Query: 1110  SYVFRVRAINQAGV-GKPSDLAGPVVA--ETRPGTKEVVVNVDDDGVISLNFECDKM--- 1163
             +Y FRV A N AGV  K S+  GPV    E  P   E+   +  D ++++    D +   
Sbjct: 29011 TYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGD-LVTIRAGSDLVLDA 29069

Query: 1164  ----TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
                  P+ +  W+K     +   ++ ++  G +     K     D G Y+  V +  G
Sbjct: 29070 AVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASG 29127



 Score =  167 bits (422), Expect = 1e-40
 Identities = 156/528 (29%), Positives = 237/528 (44%), Gaps = 54/528 (10%)

Query: 637   VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFV-EKCEAGTENWQRVNTELPVKSP 695
             VPGP  DL      R   +L+W  P   G   I  F+ E+ +A    W++     P+++ 
Sbjct: 15196 VPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQ-----PIETE 15250

Query: 696   RFA--LFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDT 753
             R    +  L EG+ Y FRV   N  G G P E   +  V D L  P +P ++  +  T +
Sbjct: 15251 RSKCDITGLLEGQEYKFRVIAKNKFGCGPPVEIGPILAV-DPLGPPTSPERLTYTERTKS 15309

Query: 754   SVVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRV 811
             ++ + W+E  S     + GY IE        +E  N      + F    L   Q Y FRV
Sbjct: 15310 TITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRV 15369

Query: 812   RAVNAAGLSEYS-------QDSEA---IEVKAAIGGGVSPDVCPALSDEPGGLTASRGRV 861
             +AVN  G SE S       QD E    I+++ ++ G    D     + EP  + A    V
Sbjct: 15370 KAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRG----DTIKVKAGEPVHIPAD---V 15422

Query: 862   HEASPPTFQ--KDALLGSKPNKP---SLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAP 916
                  P  +  K+  +  KP      +    S++  +TE+S      +++ T     +  
Sbjct: 15423 TGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNR 15482

Query: 917   QGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVI 976
              G    +   +  DR  PSPP ++   +   +S  L W  P   GG+EIT Y ++ R+  
Sbjct: 15483 LGSVFRNVHVEVYDR--PSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDA- 15539

Query: 977   DGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTI 1036
                  +W E    AV E+ Y I  L  N  Y+F+V A+N  G+       EC K ++  I
Sbjct: 15540 SRKKAEWEEVTNTAV-EKRYGIWKLIPNGQYEFRVRAVNKYGIS-----DEC-KSDKVVI 15592

Query: 1037  A----VPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNE 1092
                  +PGPP   K     K S+++ W PP+ +G +P+TGY+++ +E  +    W  ++ 
Sbjct: 15593 QDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSP--YWSRVSR 15650

Query: 1093  AAIKNVYLK-----VRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA 1135
             A I  V LK     V  L EGV Y FR  AIN AG+G PS+ + P VA
Sbjct: 15651 APITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVA 15698



 Score =  157 bits (397), Expect = 8e-38
 Identities = 201/762 (26%), Positives = 300/762 (39%), Gaps = 125/762 (16%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESR-YGM------HTLEINGCDF 344
             E  +L C I G P P + WY+           GK +I+SR Y M      HTL +   + 
Sbjct: 30548 EAAQLSCQIVGRPLPDIKWYRF----------GKELIQSRKYKMSSDGRTHTLTVMTEEQ 30597

Query: 345   EDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFE 404
             ED   Y   A N  GE+   + ++++         +FH G    PL              
Sbjct: 30598 EDEGVYTCIATNEVGEVETSSKLLLQA------TPQFHPG---YPLK------------- 30635

Query: 405   IHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGER 464
                 +K+   +G  G T+ L    +  P      P + W+     L  S+ + T+ + E 
Sbjct: 30636 ----EKY---YGAVGSTLRLHVMYIGRPV-----PAMTWFHGQKLLQNSENI-TIENTEH 30682

Query: 465   AT-LTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDA--DAEIEGAPAAPLDVKCLEA 521
              T L   ++ +        +   G+Y  Q S      DA  D EI+  P  P     +EA
Sbjct: 30683 YTHLVMKNVQR--------KTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEA 30734

Query: 522   N-KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSY 580
               K+  +ISWK PA DGGS I  Y ++KCE    +  Q   + +      +  L E   Y
Sbjct: 30735 LLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGY 30794

Query: 581   IFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGP 640
              FRV A N  GI  P  VS  V    P EK                           PG 
Sbjct: 30795 YFRVSAQNTFGISDPLEVSSVVIIKSPFEK---------------------------PGA 30827

Query: 641   PTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFAL 699
             P   ++T  T+   V++WKPP   G   I  Y++EK E     W  V TE  ++   F++
Sbjct: 30828 PGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTE-EIRETVFSV 30886

Query: 700   FDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIP-KAPGKIIPSRNTD----TS 754
              +L EG  Y FRV+C N  G  E SE +E   +  K D+P +AP      RN +    ++
Sbjct: 30887 KNLIEGLEYEFRVKCENLGGESEWSEISE--PITPKSDVPIQAPHFKEELRNLNVRYQSN 30944

Query: 755   VVVSWEESKDAKELVGYYIEAS--VAGSGKWEPCNNNPVKGS--RFTCHGLVTGQSYIFR 810
               +  + +   K +V +Y +    +A   K+        KG   +     +    + +++
Sbjct: 30945 ATLVCKVTGHPKPIVKWYRQGKEIIADGLKY---RIQEFKGGYHQLIIASVTDDDATVYQ 31001

Query: 811   VRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQ 870
             VRA N  G S     S  +EV A I         P   +  G + A RG V     P   
Sbjct: 31002 VRATNQGG-SVSGTASLEVEVPAKIH-------LPKTLEGMGAVHALRGEVVSIKIPFSG 31053

Query: 871   K-DALLGSKPNKPSLPSSSQN---LGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLK 926
             K D ++  +  +  + ++      + ++  S V     E           + +   D   
Sbjct: 31054 KPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKT 31113

Query: 927   KKTDRAP-PSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWRE 985
              + D A  P PP  +   +  RDS+ L W +P   GG++IT Y V   E       +W  
Sbjct: 31114 VELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIV---EKCATTAERW-- 31168

Query: 986   ANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSE 1027
               V    E  Y + NL     YQF+V A N  GL  PS  SE
Sbjct: 31169 LRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSE 31210



 Score =  153 bits (387), Expect = 1e-36
 Identities = 143/539 (26%), Positives = 230/539 (42%), Gaps = 61/539 (11%)

Query: 637   VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFV-EKCEAGTENWQRVNTELPVKSP 695
             +PGP  D+  ++ T+S   L+W+PP   G   I+++V E+ EAG        T +PV S 
Sbjct: 14479 LPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRR------TYIPVMSG 14532

Query: 696   R----FALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNT 751
                  + + DL     Y FRV+  N  G GE  E     +  D    P  P  +     T
Sbjct: 14533 ENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPT 14592

Query: 752   DTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIF 809
               ++ ++W+        +++GY IE    G  +W+ CN + V    +T  GL  G+ Y F
Sbjct: 14593 AEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQF 14652

Query: 810   RVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVC--PALSDEPGGLTASRGRVHEASPP 867
             RVRA NAAG+SE    S A     A+    +P V    +L  + G   A    +  +  P
Sbjct: 14653 RVRAENAAGISE---PSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYP 14709

Query: 868   TFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEE---LTPPPQKAAPQGKSKSDP 924
             T     +   K     +P   +      V +    VQEE   + P  Q+ +     K + 
Sbjct: 14710 T-----ITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGES 14764

Query: 925   ----------------LKKKTDRAPPSPPCDITCLES--------FRD----SMVLGWKQ 956
                             +K + D      PC ++ L++        F D    S++  W+ 
Sbjct: 14765 QLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFVFEDIRKTSVLCKWEP 14824

Query: 957   PDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNM 1016
             P   GG+EI  Y +  ++     P          +    Y ++ L E   Y F+V A N 
Sbjct: 14825 PLDDGGSEIINYTLEKKDKTK--PDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENR 14882

Query: 1017  AGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVD 1076
              G G P  VS+    ++     P  P      +V  +S++++W  P  +G +P+ GY+++
Sbjct: 14883 FGPG-PPCVSKPLVAKD-PFGPPDAPDKPIVEDVTSNSMLVKWNEPKDNG-SPILGYWLE 14939

Query: 1077  LKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA 1135
              +E  +    W  +N++ +  +   V GL EG++YVFRV A N AG GK S  + P  A
Sbjct: 14940 KREVNS--THWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTA 14996



 Score =  153 bits (386), Expect = 2e-36
 Identities = 113/372 (30%), Positives = 180/372 (48%), Gaps = 30/372 (8%)

Query: 921   KSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVP 980
             +S P+       PP PP         +DSMV+ W +P   GG EI GY +  R+  +GV 
Sbjct: 24889 ESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDK-EGV- 24946

Query: 981   GKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPG 1040
              +W + N K +++   +++ L E   Y+F+VAA N AG+G PS  S  ++  +  +  PG
Sbjct: 24947 -RWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACD-ALYPPG 25004

Query: 1041  PPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN-EAAIKNVY 1099
             PP + K ++  + S+ L W  P++ G  PV GY V++KEA A  D+W        ++   
Sbjct: 25005 PPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAA--DEWTTCTPPTGLQGKQ 25062

Query: 1100  LKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLN-- 1157
               V  LKE   Y FR+ AIN  GVG+P+ L G VVA+ R    E+ ++ D   V+ L   
Sbjct: 25063 FTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRAS 25122

Query: 1158  -----FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDV 1212
                  F   K  P+ E  W K      D  ++EV S  + T +   ++   D G Y+  +
Sbjct: 25123 ATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTS--SFTMLVIDNVTRFDSGRYNLTL 25180

Query: 1213  TDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGN 1272
              +  G  ++++       R+L        P+ PV   L +  ++K  V    +   + G 
Sbjct: 25181 ENNSGSKTAFV-----NVRVL------DSPSAPV--NLTIREVKKDSVTLSWEPPLIDGG 25227

Query: 1273  AKV-NYIFNEKE 1283
             AK+ NYI  ++E
Sbjct: 25228 AKITNYIVEKRE 25239



 Score =  152 bits (385), Expect = 2e-36
 Identities = 165/617 (26%), Positives = 249/617 (40%), Gaps = 104/617 (16%)

Query: 478   GLYTIRVRMGEYY----EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQP 533
             G Y  RVR    Y    E  S  V ++D    + G P  P   K L   K  +++SW  P
Sbjct: 15567 GQYEFRVRAVNKYGISDECKSDKVVIQDP-YRLPGPPGKP---KVLARTKGSMLVSWTPP 15622

Query: 534   AVDGGSPILGYFIDKCEVGTDSWSQCNDTPV-----KFARFPVTGLIEGRSYIFRVRAVN 588
               +GGSPI GY+++K E G+  WS+ +  P+     K   F V  L+EG  Y FR  A+N
Sbjct: 15623 LDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAIN 15682

Query: 589   KMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTE 648
               GIG PS  S+P  A DP                              PGPP+   V +
Sbjct: 15683 AAGIGPPSEPSDPEVAGDPI---------------------------FPPGPPSCPEVKD 15715

Query: 649   ATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNT-ELPVKSPRFALFDLAEGK 706
              T+S + L WKPP + G   I  Y VE  E GT +W+RVN  +  + +    + +L E +
Sbjct: 15716 KTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCECVVPNLKELR 15775

Query: 707   SYCFRVRCSNSAGVGEPSEATE-----------------------VTVVGDKLDIPKAPG 743
              Y FRV+  N AG  EPS+ T                        V   G ++ IP    
Sbjct: 15776 KYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPA--- 15832

Query: 744   KIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVT 803
              +I  R T  S   SWE    AK+ +   +   +    + E   N+ V      C    T
Sbjct: 15833 -VIKGRPTPKS---SWEFDGKAKKAMKDGVH-DIPEDAQLETAENSSVIIIP-ECKRSHT 15886

Query: 804   GQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHE 863
             G+   + + A N AG     Q +    VK     G   D+   +SD    +T    R+  
Sbjct: 15887 GK---YSITAKNKAG-----QKTANCRVKVMDVPGPPKDL--KVSD----ITRGSCRLSW 15932

Query: 864   ASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKS- 922
               P     D + G    K ++   +      +    +  V + L+        + +++  
Sbjct: 15933 KMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFG 15992

Query: 923   -----DPLKKKTDRAP---PSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYR- 973
                  + +++ T R P   P PP  +      ++++ L WK P   GG+ +T Y V    
Sbjct: 15993 IGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLA 16052

Query: 974   -EVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCE 1032
              +        WR+ N + V E  + + +L E   Y+F+V A+N AG+  PSA      C+
Sbjct: 16053 WDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQ 16112

Query: 1033  EWTIAVPGPPHSLKCSE 1049
                   P  P S+   E
Sbjct: 16113 R-----PDMPPSIDLKE 16124



 Score =  150 bits (380), Expect = 8e-36
 Identities = 169/756 (22%), Positives = 290/756 (38%), Gaps = 92/756 (12%)

Query: 287   TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
             T+    +++L  S++G P P +TW K  + +   A     II++      L ++  +  D
Sbjct: 29457 TIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRA-----IIDTTESYSLLIVDKVNRYD 29511

Query: 347   TAQYRASAMNVKGELSAYASVVVKRYKGEFDETRF-HAGASTMPLSFGVTPYGYASRFEI 405
               +Y   A N  G+ SA   V V    G     +       ++ +++ +      +    
Sbjct: 29512 AGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNN 29571

Query: 406   HFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERA 465
             +  +K + +  R  +T++  C   +             YR          +  L  G   
Sbjct: 29572 YIVEKREAAM-RAFKTVTTKCSKTL-------------YR----------ISGLVEG--- 29604

Query: 466   TLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDY 525
               T  +     E +Y I    GE  E   A +        +   P  P  ++ ++  K  
Sbjct: 29605 --TMYYFRVLPENIYGI----GEPCETSDAVL--------VSEVPLVPAKLEVVDVTKST 29650

Query: 526   IIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVR 585
             + ++W++P  DGGS + GY ++ C+ GT+ W +            VT L EG  Y+FR+R
Sbjct: 29651 VTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIR 29710

Query: 586   AVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLS 645
             A N+ G+  P      V   D      L+  P+       + T  + +  +  G P +L 
Sbjct: 29711 AQNEKGVSEPRETVTAVTVQD------LRVLPTID-----LSTMPQKTIHVPAGRPVELV 29759

Query: 646   VTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEG 705
             +  A R     SW   G +  E                +RV  E   K  +  + +    
Sbjct: 29760 IPIAGRPPPAASWFFAGSKLRES---------------ERVTVETHTKVAKLTIRETTIR 29804

Query: 706   KSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE--ESK 763
              +  + +   N  G    SE  +V ++ DK   P  P KI       TS+ +SWE  E  
Sbjct: 29805 DTGEYTLELKNVTGT--TSETIKVIIL-DKPGPPTGPIKI--DEIDATSITISWEPPELD 29859

Query: 764   DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYS 823
                 L GY +E   A    W P + + V  S F    L  G  Y+FRV A N  G+  Y 
Sbjct: 29860 GGAPLSGYVVEQRDAHRPGWLPVSES-VTRSTFKFTRLTEGNEYVFRVAATNRFGIGSYL 29918

Query: 824   QDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTAS------RGRVHEASPPTFQKDALLGS 877
             Q SE IE +++I     P+          G+T +       G          +K+     
Sbjct: 29919 Q-SEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADR 29977

Query: 878   KPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPP 937
                   +P +      T +++  E  +  +T    + + +    S P+      APP  P
Sbjct: 29978 WVRVNKVPVTMTRYRSTGLTEGLE-YEHRVTAINARGSGKPSRPSKPIVAMDPIAPPGKP 30036

Query: 938   CDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYK 997
              +    ++ R S+ L W  P+  GG+++TGY +  ++V      +W + N        Y 
Sbjct: 30037 QNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQ---HEWTKCNTTPTKIREYT 30093

Query: 998   ISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEE 1033
             +++L +   Y+F+V A N  G G P+ V    K  E
Sbjct: 30094 LTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTE 30129



 Score =  145 bits (366), Expect = 3e-34
 Identities = 132/461 (28%), Positives = 195/461 (42%), Gaps = 55/461 (11%)

Query: 367   VVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKF-DVSFGREGETMSLG 425
             V+ +   G F E    +GA        +T            D K+ DV     GET  L 
Sbjct: 24677 VIARNAAGNFSEPSDSSGA--------ITARDEIDAPNASLDPKYKDVIVVHAGETFVLE 24728

Query: 426   CRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSG-ERATLTFSHLNKEDEGLYTIRV 484
               +   P      P++ W ++G  L  +     + S  ++ TL      + D G Y +++
Sbjct: 24729 ADIRGKPI-----PDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKL 24783

Query: 485   RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGY 544
                   +     V V D      G P  PL V  + A K Y+  +W  P  DGG+ I  Y
Sbjct: 24784 SNVGGTKSIPITVKVLDRP----GPPEGPLKVTGVTAEKCYL--AWNPPLQDGGANISHY 24837

Query: 545   FIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAA 604
              I+K E    SW+Q + T V+   + VT L+ G  YIFRV AVNK GIG P   S PV A
Sbjct: 24838 IIEKRETSRLSWTQVS-TEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLE-SGPVTA 24895

Query: 605   LDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQ 663
              +P +                            PGPP+   V+  T+  +V++W +P   
Sbjct: 24896 CNPYKP---------------------------PGPPSTPEVSAITKDSMVVTWARPVDD 24928

Query: 664   RGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEP 723
              G E   Y +EK +     W + N +  +   R  +  L EG SY FRV   N+AGVGEP
Sbjct: 24929 GGTEIEGYILEKRDKEGVRWTKCNKKT-LTDLRLRVTGLTEGHSYEFRVAAENAAGVGEP 24987

Query: 724   SEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSG 781
             SE +      D L  P  P     +  + +SV ++W +        + GY +E   A + 
Sbjct: 24988 SEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAAD 25047

Query: 782   KWEPCN-NNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSE 821
             +W  C     ++G +FT   L     Y FR+ A+N+ G+ E
Sbjct: 25048 EWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGE 25088



 Score =  145 bits (365), Expect = 4e-34
 Identities = 179/719 (24%), Positives = 290/719 (40%), Gaps = 83/719 (11%)

Query: 638   PGPPTDLSVTEATRSYVVLSWKPP-GQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPR 696
             PGPP +    +  ++ V+  W+PP    G E I Y +EK +    + + +     ++  +
Sbjct: 14802 PGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCK 14861

Query: 697   FALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVV 756
             +++  L EGK Y FRVR  N  G G P   ++  V  D    P AP K I    T  S++
Sbjct: 14862 YSVTKLIEGKEYLFRVRAENRFGPGPPC-VSKPLVAKDPFGPPDAPDKPIVEDVTSNSML 14920

Query: 757   VSWEESKD-AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVN 815
             V W E KD    ++GY++E     S  W   N + +   +    GL+ G +Y+FRV A N
Sbjct: 14921 VKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAEN 14980

Query: 816   AAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDA-L 874
             AAG  ++S  S+       I     P   P ++D     T+S     E  PP F     +
Sbjct: 14981 AAGPGKFSPPSDPKTAHDPISPPGPP--IPRVTD-----TSSTTIELEWEPPAFNGGGEI 15033

Query: 875   LGSKPNKPSLPSSSQN--------LGQTEVSKVSETVQEELTPPPQKAAPQGK-SKSDPL 925
             +G   +K  + ++  +        + Q  V ++ E    +L      AA +G   ++ P+
Sbjct: 15034 VGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGETQPV 15093

Query: 926   KKKTDRAPPSPPCDITCLESFR---------DSMVLGWKQPDKIGGAEITGYYVNYREVI 976
                  + PP+   D++     +          ++V G   P K+   E  G     R VI
Sbjct: 15094 TVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKE-EGELDKDRVVI 15152

Query: 977   DGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTI 1036
             D         NV   SE   K +  K++  Y   + A N  G    +A  E F       
Sbjct: 15153 D---------NVGTKSELIIKDALRKDHGRYV--ITATNSCGSKFAAARVEVFD------ 15195

Query: 1037  AVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIK 1096
              VPGP   LK     +   +L W  P   G + +TG+ ++ K+AK     WR   E   +
Sbjct: 15196 -VPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKM--HTWRQPIET--E 15250

Query: 1097  NVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPG----TKEVVVNVDDDG 1152
                  + GL EG  Y FRV A N+ G G P ++ GP++A    G     + +        
Sbjct: 15251 RSKCDITGLLEGQEYKFRVIAKNKFGCGPPVEI-GPILAVDPLGPPTSPERLTYTERTKS 15309

Query: 1153  VISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDV 1212
              I+L+++  +    S            D P  E  +K      +F    +D+  +Y   V
Sbjct: 15310 TITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRV 15369

Query: 1213  TDTDGIASS-------YLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQ 1265
                + I  S        +I ++E+   + L    +  T+ VK+   V I           
Sbjct: 15370 KAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHI----------- 15418

Query: 1266  AEKLSG--NAKVNYIFNEKEIFEGPK-----YKMHIDRNTGIIEMFMEKLQDEDEGTYT 1317
                ++G    K+ +  NE  + E P       K  + R+    E+ + K   ED+GTYT
Sbjct: 15419 PADVTGLPMPKIEWSKNE-TVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYT 15476



 Score =  139 bits (351), Expect = 2e-32
 Identities = 139/561 (24%), Positives = 228/561 (40%), Gaps = 59/561 (10%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P  P+DV+      + + I+WK P  DGGS I+GY I+K   G + W +CN+  V    +
Sbjct: 14580 PDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTY 14639

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
                GL EG+ Y FRVRA N  GI  PSR + P  A+DP +  ++  R S     ++   +
Sbjct: 14640 TAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSL----EVKRGD 14695

Query: 630   EEPSEGIVPGPP-------TDLSV---TEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAG 679
             E   +  + G P        D +V    E  +    L  +  G+   E            
Sbjct: 14696 EIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLS 14755

Query: 680   TENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIP 739
              +N ++  ++L V+       D        + ++  N  G+ +      V      LD P
Sbjct: 14756 IDNSKKGESQLRVR-------DSLRPDHGLYMIKVENDHGIAKAPCTVSV------LDTP 14802

Query: 740   KAPGKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEA--SVAGSGKWEPCNNNPVKGSR 795
               P   +      TSV+  WE   D    E++ Y +E         +W    +  ++  +
Sbjct: 14803 GPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTST-LRHCK 14861

Query: 796   FTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLT 855
             ++   L+ G+ Y+FRVRA N  G       S+ +  K   G   +PD  P + D      
Sbjct: 14862 YSVTKLIEGKEYLFRVRAENRFGPGPPCV-SKPLVAKDPFGPPDAPDK-PIVED-----V 14914

Query: 856   ASRGRVHEASPPTFQKDALLGSKPNKPSLPS--------SSQNLGQTEVSKVSETVQEEL 907
              S   + + + P      +LG    K  + S        S  N  +  V  + E +    
Sbjct: 14915 TSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVF 14974

Query: 908   TPPPQKAAPQGK--SKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEI 965
                 + AA  GK    SDP       +PP PP      ++   ++ L W+ P   GG EI
Sbjct: 14975 RVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIP-RVTDTSSTTIELEWEPPAFNGGGEI 15033

Query: 966   TGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAV 1025
              GY+V+ + V      +W     K +    Y +  ++E   Y+ +V+A+N AG G P   
Sbjct: 15034 VGYFVDKQLV---GTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPG-- 15088

Query: 1026  SECFKCEEWTIAVPGPPHSLK 1046
                 + +  T+A P  P +++
Sbjct: 15089 ----ETQPVTVAEPQEPPAVE 15105



 Score =  134 bits (337), Expect = 7e-31
 Identities = 227/973 (23%), Positives = 378/973 (38%), Gaps = 127/973 (13%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFI-----DKCEVGTDSWSQCNDTPV 564
             P  P+ +K     K+ + +SWK P  DGGSP+  Y +     D      ++W QCN   V
Sbjct: 16012 PDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDV 16071

Query: 565   KFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQ 624
             +  +F V  L+EG  Y FRV+AVN  G      VS+P A + P +  R    PS     +
Sbjct: 16072 EELQFTVEDLVEGGEYEFRVKAVNAAG------VSKPSATVGPCDCQRPDMPPSID-LKE 16124

Query: 625   IIVTEEEPSEGIV---PGPPTDLSVTEATRSYVVLSW-KPPGQR--GHEGIMYFVEKCEA 678
              +  EE  +  IV    G P           +  L+W K P ++    E ++Y       
Sbjct: 16125 FMEVEEGTNVNIVAKIKGVP-----------FPTLTWFKAPPKKPDNKEPVLYDT----- 16168

Query: 679   GTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDI 738
                    VN  +   +    +       +  + +   N+  +G  S+   + V+G +   
Sbjct: 16169 ------HVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNN--LGTASKEMRLNVLG-RPGP 16219

Query: 739   PKAPGKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRF 796
             P  P K   S + D  + +SW   KD    ++  Y IE   A    W   ++ P K   +
Sbjct: 16220 PVGPIK-FESVSAD-QMTLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSEP-KECTY 16276

Query: 797   TCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTA 856
             T   L+ G  Y+FR+ A N  G+ E   DSE    +       +PD     S     +T 
Sbjct: 16277 TIPKLLEGHEYVFRIMAQNKYGIGE-PLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTV 16335

Query: 857   S--RGRVHEASPPT----FQKDALLGSKPNKPSLPSSSQNLGQT-EVSKVSETVQEELTP 909
             +         SP T      KD            P  +  LG + +V+ + E    +   
Sbjct: 16336 NWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRV 16395

Query: 910   PPQKAAPQGKSK--SDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITG 967
                 AA  G +   SDP   +   APP PP      +  + S  L W  P K GG+++TG
Sbjct: 16396 YAINAAGVGPASLPSDPATARDPIAPPGPPFP-KVTDWTKSSADLEWSPPLKDGGSKVTG 16454

Query: 968   YYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSE 1027
             Y V Y+E  +G   +W +   K V      ++ LKE   Y+F+V A+N+AG+G P  V++
Sbjct: 16455 YIVEYKE--EG-KEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTD 16511

Query: 1028  CFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVH-----SGRTPVTGYFVDLKEAKA 1082
               + ++  ++   P   L  S   +D +V+     +      SG+ P T   V     + 
Sbjct: 16512 VIEMKDRLVS---PDLQLDASV--RDRIVVHAGGVIRIIAYVSGKPPPT---VTWNMNER 16563

Query: 1083  KEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPS------DLAGPVVAE 1136
                Q   +   AI +  + ++  +     V+ + A N+AG  K +      D+ GPV   
Sbjct: 16564 TLPQEATIETTAISS-SMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPV--- 16619

Query: 1137  TRPGTKEVVVNVDDDGVISLNF--ECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTK 1194
                GT  +  N+ ++      F  E D  +P + +   K     E   R         T+
Sbjct: 16620 ---GTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEK----RESDRRAWTPVTYTVTR 16672

Query: 1195  MTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEI 1254
                   G+     Y   +   + I     ++  E    L +      P  P   +L V+ 
Sbjct: 16673 QNATVQGLIQGKAYFFRIAAENSIGMGPFVETSE---ALVIREPITVPERP--EDLEVKE 16727

Query: 1255  LEKGQVRFWMQAEKLSGNAK-VNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDE 1313
             + K  V       K  G ++ +NY+   + I      K H   N  ++         ++ 
Sbjct: 16728 VTKNTVTLTWNPPKYDGGSEIINYVLESRLI---GTEKFHKVTNDNLLSRKYTVKGLKEG 16784

Query: 1314  GTYTFQLQ------DGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWE 1367
              TY +++        GK +  +  +   D         +F+ +  IR  G  F       
Sbjct: 16785 DTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIR-VGEAFA------ 16837

Query: 1368  VTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKK--DAGI 1425
             +TG  +   K KV+         W+KDE ++  D++   K    TL + +   K  D+G 
Sbjct: 16838 LTGRYSGKPKPKVS---------WFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGK 16888

Query: 1426  YEVILKDDRGKDK 1438
             Y V++++  G  K
Sbjct: 16889 YCVVVENSTGSRK 16901



 Score =  131 bits (330), Expect = 5e-30
 Identities = 219/1039 (21%), Positives = 387/1039 (37%), Gaps = 164/1039 (15%)

Query: 287   TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
             T+    ++ L  ++ G PEP++ W K    +++     K  ++      T  I  CD  D
Sbjct: 29058 TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCE---KVSLQYTGKRATAVIKFCDRSD 29114

Query: 347   TAQYRASAMNVKGELSAYASVVVKRYK-----GEFDETRFHAGASTMPLSFGVTPYGYAS 401
             + +Y  +  N  G  +   SV+VK        G+   +R      T+  S      G   
Sbjct: 29115 SGKYTLTVKNASG--TKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGG--- 29169

Query: 402   RFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWS 461
                                            EI H+  E +        S   WV  +  
Sbjct: 29170 ------------------------------AEITHYIVERR------ETSRLNWV--IVE 29191

Query: 462   GERATLTF--SHLNKEDEGLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVK 517
             GE  TL++  + L K +E ++ +R   + G      S  +  R++   I   P  P +V 
Sbjct: 29192 GECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNS-FTIPSPPGIPEEV- 29249

Query: 518   CLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCN-DTPVKFARFPVTGLIE 576
                  K++III W +P  DGG+ I  Y +DK E  +  W++ N D  V   R  VT L+E
Sbjct: 29250 --GTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLME 29307

Query: 577   GRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGI 636
             G  Y FRV AVN  G   PS  S  ++  +P+                            
Sbjct: 29308 GCDYQFRVTAVNAAGNSEPSEASNFISCREPS---------------------------Y 29340

Query: 637   VPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSP 695
              PGPP+   V + T+  + L+W KP    G + + Y +E  E  T+ W RV+T   +++ 
Sbjct: 29341 TPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNT 29400

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSV 755
              F + DL  G+ Y FRV   N  G+ E SE+       ++++IP                
Sbjct: 29401 EFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIP---------------- 29444

Query: 756   VVSWEESKDAKELV----GYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLV-TGQSY-IF 809
                 E + D K+ V    G  +   V+ SG+  P      +G       ++ T +SY + 
Sbjct: 29445 --DLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSLL 29502

Query: 810   RVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGR--VHEASPP 867
              V  VN     +Y+ ++E         G  S  V   + D PG   + + +    ++   
Sbjct: 29503 IVDKVNRYDAGKYTIEAE------NQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTI 29556

Query: 868   TFQKDALLGSKPNKPSL---PSSSQNLGQTEVSKVSETVQE-----ELTPPPQKAAPQGK 919
             T++   + G  P    +     ++    +T  +K S+T+       E T    +  P+  
Sbjct: 29557 TWEIPTIDGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENI 29616

Query: 920   SKSDPLKKKTDRA----PPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREV 975
                    + +D       P  P  +  ++  + ++ L W++P   GG+ +TGY +   E 
Sbjct: 29617 YGIGEPCETSDAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVL---EA 29673

Query: 976   IDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWT 1035
                   +W +      +   + +++L E   Y F++ A N  G+  P         ++  
Sbjct: 29674 CKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLR 29733

Query: 1036  I-----AVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGL 1090
             +         P  ++     R   LV+    P+     P   +F     +K +E + R  
Sbjct: 29734 VLPTIDLSTMPQKTIHVPAGRPVELVI----PIAGRPPPAASWF--FAGSKLRESE-RVT 29786

Query: 1091  NEAAIKNVYLKVR--GLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNV 1148
              E   K   L +R   +++   Y   ++ +     G  S+    ++ + +PG     + +
Sbjct: 29787 VETHTKVAKLTIRETTIRDTGEYTLELKNV----TGTTSETIKVIILD-KPGPPTGPIKI 29841

Query: 1149  DDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPR---LEVESKGNKTKMTFKDLGMDDL 1205
             D+    S+    +          S   V   D+ R   L V     ++   F  L   + 
Sbjct: 29842 DEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNE 29901

Query: 1206  GIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQ 1265
              ++    T+  GI  SYL  E     ++      + P  P   ++  ++   G    W  
Sbjct: 29902 YVFRVAATNRFGI-GSYLQSE-----VIECRSSIRIPGPPETLQI-FDVSRDGMTLTWYP 29954

Query: 1266  AEKLSGNAKVNYIFNEKEI 1284
              E   G+    YI   KE+
Sbjct: 29955 PEDDGGSQVTGYIVERKEV 29973



 Score =  131 bits (329), Expect = 6e-30
 Identities = 97/326 (29%), Positives = 140/326 (42%), Gaps = 46/326 (14%)

Query: 418   EGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDE 477
             EGE +S+       P      P + W+++G  +  S  +        A L      + D 
Sbjct: 14400 EGEKLSIPVPFRAVPV-----PTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADA 14454

Query: 478   GLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAV 535
             G+YTI +  ++G               + ++ G P    D+K  +  K    ++W+ P  
Sbjct: 14455 GIYTITLENKLGSA---------TASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEF 14505

Query: 536   DGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFP 595
             DGG+PIL Y +++ E G  ++        K + + V  LI    Y FRV+AVNK+G G  
Sbjct: 14506 DGGTPILHYVLERREAGRRTYIPVMSGENKLS-WTVKDLIPNGEYFFRVKAVNKVGGGEY 14564

Query: 596   SRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVV 655
               +  PV A DP +                            P PP D+ V   T   + 
Sbjct: 14565 IELKNPVIAQDPKQP---------------------------PDPPVDVEVHNPTAEAMT 14597

Query: 656   LSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRC 714
             ++WKPP   G   IM Y +EK   G E W+R N  L V    +    L EGK Y FRVR 
Sbjct: 14598 ITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHL-VPILTYTAKGLEEGKEYQFRVRA 14656

Query: 715   SNSAGVGEPSEATEVTVVGDKLDIPK 740
              N+AG+ EPS AT  T   D +D PK
Sbjct: 14657 ENAAGISEPSRATPPTKAVDPIDAPK 14682



 Score =  129 bits (323), Expect = 3e-29
 Identities = 129/471 (27%), Positives = 187/471 (39%), Gaps = 95/471 (20%)

Query: 288   VWEKENVKLHCSIAGWPEPRVTWYK-------NQVPINVHANPGKYIIESRYGMHTLEIN 340
             V E  NV +   I G P P +TW+K       N+ P+    +  K +++      TL I 
Sbjct: 16128 VEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTC---TLVIP 16184

Query: 341   GCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYA 400
                  DT  Y  +A+N  G  S               E R +      P      P G  
Sbjct: 16185 QSRRSDTGLYTITAVNNLGTAS--------------KEMRLNVLGRPGP------PVG-P 16223

Query: 401   SRFEIHFDDKFDVS-FGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTL 459
              +FE    D+  +S F  + +  S     VI                    +   WV   
Sbjct: 16224 IKFESVSADQMTLSWFPPKDDGGSKITNYVIEKR---------------EANRKTWVHVS 16268

Query: 460   WSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGA------PAAP 513
                +  T T   L +  E ++ I  +        + Y      D+E E A      P AP
Sbjct: 16269 SEPKECTYTIPKLLEGHEYVFRIMAQ--------NKYGIGEPLDSEPETARNLFSVPGAP 16320

Query: 514   LDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKF----ARF 569
                      ++ + ++W++P  DGGSP+ GY+++  +  +  W + N  P+K       +
Sbjct: 16321 DKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSY 16380

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              VTGLIEG  Y FRV A+N  G+G  S  S+P  A DP           AP         
Sbjct: 16381 KVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPI----------AP--------- 16421

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNT 688
                     PGPP    VT+ T+S   L W PP + G   +  Y VE  E G E W++   
Sbjct: 16422 --------PGPPFP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEK-GK 16471

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIP 739
             +  V+  +  +  L EG  Y FRVR  N AG+GEP E T+V  + D+L  P
Sbjct: 16472 DKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSP 16522



 Score =  125 bits (313), Expect = 5e-28
 Identities = 183/774 (23%), Positives = 298/774 (38%), Gaps = 129/774 (16%)

Query: 274   LHAPEFIIKP---RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIES 330
             L APE  I     ++H V    +++L  +  G P P   W K    +++ A+     I +
Sbjct: 28352 LTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRAD-----IHT 28406

Query: 331   RYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPL 390
                  TL +  C+  D  +Y  +  N  G  S   +V V    G              P+
Sbjct: 28407 TDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGP-----------PGPI 28455

Query: 391   SFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPL 450
             +F     G A+                +   +  G R      I H+  E +        
Sbjct: 28456 TFKDVTRGSATLMW-------------DAPLLDGGAR------IHHYVVEKR------EA 28490

Query: 451   SPSKWVQTLWSGERATLTFSHLNKEDEGL-YTIRVRMGEYYEQYSAYVFVRDADAEIEGA 509
             S   W Q +   E+ T     +N   EG+ Y  RV     Y     Y       A  + A
Sbjct: 28491 SRRSW-QVI--SEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPA 28547

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P   LDV  ++ +K   +++W +P  DGGS I GY ++  + G+D W +   T  K   F
Sbjct: 28548 PPRRLDV--VDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHT--KQLTF 28603

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTG---QII 626
              V  L+E   Y FRV+A N  G   P      V   +P      +  P+A  TG   Q+I
Sbjct: 28604 TVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEP------QIEPTADLTGITNQLI 28657

Query: 627   VTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRV 686
               +         G P  + V  + R    ++WK    R        +++ +  +    + 
Sbjct: 28658 TCK--------AGSPFTIDVPISGRPAPKVTWKLEEMR--------LKETDRVSITTTKD 28701

Query: 687   NTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKII 746
              T L VK       D   G S  + +   N+AGV   + +  V V+G    +    G I 
Sbjct: 28702 RTTLTVK-------DSMRGDSGRYFLTLENTAGV--KTFSVTVVVIGRPGPV---TGPIE 28749

Query: 747   PSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTG 804
              S  +  S V+SW E KD    E+  Y +E   +G+  W+  N++ VK ++     L   
Sbjct: 28750 VSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSS-VKRTQIKVTHLTKY 28808

Query: 805   QSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRV--- 861
               Y FRV + N  G+S+  + +  I           P V P+    P     S   +   
Sbjct: 28809 MEYSFRVSSENRFGVSKPLESAPII--------AEHPFVPPSAPTRPEVYHVSANAMSIR 28860

Query: 862   -----HEASPPTF-------QKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTP 909
                  H+             +++ +L  K NK  +P    N    +V+ + E ++ +   
Sbjct: 28861 WEEPYHDGGSKIIGYWVEKKERNTILWVKENK--VPCLECNY---KVTGLVEGLEYQFRT 28915

Query: 910   PPQKAAPQGKSK--SDPLKKKTDRAPPSPP--CDITCLESFRDSMVLGWKQPDKIGGAEI 965
                 AA   K+   S P+  +     P  P   D+T     R ++ L W  P   GG+++
Sbjct: 28916 YALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVT-----RSTVSLIWSAPAYDGGSKV 28970

Query: 966   TGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 1019
              GY +  + V +   G+W + N   VS+  + ++ L E   Y+F+V A N AG+
Sbjct: 28971 VGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGV 29024



 Score =  122 bits (307), Expect = 2e-27
 Identities = 234/997 (23%), Positives = 368/997 (36%), Gaps = 139/997 (13%)

Query: 508   GAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFA 567
             G P +P  +   E  K  I + WK+P  +GGSPI GY I+K       + + N       
Sbjct: 15293 GPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTT 15352

Query: 568   RFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALD---PAEKARLKSRPSAPWTGQ 624
              F V  L E + Y FRV+AVN++G   PS     V   D   P  K RL  R        
Sbjct: 15353 SFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDT----- 15407

Query: 625   IIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQ 684
             I V   EP    +P   T L + +       + W     +    I    +  +   E   
Sbjct: 15408 IKVKAGEPVH--IPADVTGLPMPK-------IEWS----KNETVIEKPTDALQITKEEVS 15454

Query: 685   RVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGK 744
             R   +  +  P+    D        + V  SN  G    +   EV       D P  P  
Sbjct: 15455 RSEAKTELSIPKAVREDKGT-----YTVTASNRLGSVFRNVHVEV------YDRPSPPRN 15503

Query: 745   IIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGK--WEPCNNNPVKGSRFTCHG 800
             +  +     S  ++W+   D    E+  Y I+   A   K  WE   N  V+  R+    
Sbjct: 15504 LAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVE-KRYGIWK 15562

Query: 801   LVTGQSYIFRVRAVNAAGLSEYSQDSEAI--------------EVKAAIGGGVSPDVCPA 846
             L+    Y FRVRAVN  G+S+  +  + +              +V A   G +     P 
Sbjct: 15563 LIPNGQYEFRVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPP 15622

Query: 847   LSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEE 906
             L +    +T       E   P +       S+ ++  +        +  V ++ E V+ +
Sbjct: 15623 LDNGGSPITGYWLEKREEGSPYW-------SRVSRAPITKVGLKGVEFNVPRLLEGVKYQ 15675

Query: 907   LTPPPQKAAPQG--KSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAE 964
                    AA  G     SDP        PP PP      +  + S+ LGWK P K GG+ 
Sbjct: 15676 FRAMAINAAGIGPPSEPSDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSP 15735

Query: 965   ITGYYVNYREVIDGVPGKWREANV--KAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAP 1022
             I GY V  +E  +G    W+  N   K ++     + NLKE   Y+F+V A+N AG   P
Sbjct: 15736 IKGYIVEMQE--EGTTD-WKRVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEP 15792

Query: 1023  SAVSECFKC----EEWTIAVP-GPPHSLKCSEVRKDSLVLQWKPPVHSGR-TPVTGYFVD 1076
             S  +         EE  + +  G    L C    +  +     P V  GR TP + +  D
Sbjct: 15793 SDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRI-----PAVIKGRPTPKSSWEFD 15847

Query: 1077  LKEAKAKEDQWRGLNE-----AAIKNVYLKVRGLKEGVSYVFRVRAINQAGVG------K 1125
              K  KA +D    + E      A  +  + +   K   +  + + A N+AG        K
Sbjct: 15848 GKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVK 15907

Query: 1126  PSDLAGP-----VVAETRPGTKEVVVNVDDDGVISLN-FECDKMTPKSEFSWSKDYVSTE 1179
               D+ GP     V   TR   +      DDDG   +  +  +K T   + +W+K      
Sbjct: 15908 VMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGK-AWTK------ 15960

Query: 1180  DSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEH 1239
                   V      T     DL  +    +     +  GI        E ++R  A    +
Sbjct: 15961 ------VNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPV----ETIQRTTARDPIY 16010

Query: 1240  KFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFE--GPKYKMHIDRN 1297
               P  P+K  L + ++ K  V    +  K  G + V +   E   ++  G K +     N
Sbjct: 16011 P-PDPPIK--LKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCN 16067

Query: 1298  TGIIEMFMEKLQDEDEG-TYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQ 1356
                +E     ++D  EG  Y F++   KA N + V          +  A     +  R  
Sbjct: 16068 KRDVEELQFTVEDLVEGGEYEFRV---KAVNAAGVS---------KPSATVGPCDCQRPD 16115

Query: 1357  GPHFVEYLSW-EVTGECNVLLKCKVANIKKETHIVWYK------DEREISVDEKHDFK-- 1407
              P  ++   + EV    NV +  K+  +   T + W+K      D +E  + + H  K  
Sbjct: 16116 MPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPT-LTWFKAPPKKPDNKEPVLYDTHVNKLV 16174

Query: 1408  -DGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKL 1443
              D  CTL+I +  + D G+Y +   ++ G     ++L
Sbjct: 16175 VDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRL 16211



 Score =  121 bits (304), Expect = 5e-27
 Identities = 115/467 (24%), Positives = 177/467 (37%), Gaps = 86/467 (18%)

Query: 287   TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
             TV   + ++L   + G P P V W K++   ++  +P +  I++R       +      D
Sbjct: 18212 TVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSP-RVKIDTRADSSKFSLTKAKRSD 18270

Query: 347   TAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIH 406
               +Y  +A N  G   AYA+V V    G     +                          
Sbjct: 18271 GGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKI------------------------- 18305

Query: 407   FDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERAT 466
                  DVS  R        C V   P       EIQ Y     L   +  + +WS   AT
Sbjct: 18306 ----VDVSSDR--------CTVCWDPPEDDGGCEIQNY----ILEKCETKRMVWSTYSAT 18349

Query: 467   L-----TFSHLNKEDEGLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCL 519
             +     T + L + +E ++ +R   ++G      S  V  +         P  P   +  
Sbjct: 18350 VLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTK----YDKPGRPDPPEVT 18405

Query: 520   EANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRS 579
             + +K+ + + W  P  DGG  I GYF++K E  +  W   N + +   R  V  L+    
Sbjct: 18406 KVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHE 18465

Query: 580   YIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPG 639
             Y FRV+A N++GIG PS  S PV A DP E                            PG
Sbjct: 18466 YQFRVKAENEIGIGEPSLPSRPVVAKDPIEP---------------------------PG 18498

Query: 640   PPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCE------AGTENWQRVNTELPVK 693
             PPT+  V + T+  + L W  P   G   I+ +V +        +  E W+R N    + 
Sbjct: 18499 PPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLV 18558

Query: 694   SPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPK 740
                F +  L E + Y FRV   N  G+G P+E  E     + L+ P+
Sbjct: 18559 RKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPE 18605



 Score =  120 bits (300), Expect = 1e-26
 Identities = 118/471 (25%), Positives = 184/471 (39%), Gaps = 81/471 (17%)

Query: 277   PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
             P   +   ++++   E++K+   + G P P ++W K+  P+       +  +E       
Sbjct: 24312 PSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLK---QTTRVNVEETATSTV 24368

Query: 337   LEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTP 396
             L I   + +D  +Y  +A N  G  +   SV+V    G                     P
Sbjct: 24369 LHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPG--------------------PP 24408

Query: 397   YGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWV 456
              G     E+  D    V    E    + GC++      K       W+     ++     
Sbjct: 24409 VGPVRFDEVSAD---FVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVA----- 24460

Query: 457   QTLWSGERATLTFSHLNKEDEGLYTIRV----RMGEYYEQYSAYVFVRDADAEIEGAPAA 512
                    R T+  + L    E  Y  R+    R G+     S  V V+    E  G P  
Sbjct: 24461 -------RTTIKITKLKTGTE--YQFRIFAENRYGKSAPLDSKAVIVQYPFKE-PGPPGT 24510

Query: 513   PLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVT 572
             P        +KD +++ W +P  DGG+ I+GY +++ E  +  W + N TP++  +F  T
Sbjct: 24511 PF---VTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTT 24567

Query: 573   GLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEP 632
             GL EG  Y F+V A N +GIG PS+VSE   A DP +                       
Sbjct: 24568 GLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDP---------------------- 24605

Query: 633   SEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELP 691
                  PG P  + +   TR+ V L WK P   G   I  Y VEK +     W + +    
Sbjct: 24606 -----PGRPEAIVI---TRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASF-TN 24656

Query: 692   VKSPRFALFDLAEGKSYCFRVRCSNSAG-VGEPSEATEVTVVGDKLDIPKA 741
             V    F +  L E + Y FRV   N+AG   EPS+++      D++D P A
Sbjct: 24657 VLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNA 24707



 Score =  117 bits (293), Expect = 9e-26
 Identities = 95/316 (30%), Positives = 144/316 (45%), Gaps = 39/316 (12%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P+ PLD+   +A + +I I+WK P  +GGSPI+GY ++ C VGT+ W + N  P+K  +F
Sbjct: 14285 PSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKF 14344

Query: 570   PV-TGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVT 628
              V  G++  + Y+ RVRAVN +G+  PS +SE V A DP  K  +        T  IIV 
Sbjct: 14345 KVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLE-----THDIIVI 14399

Query: 629   EEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNT 688
             E E     +P P   + V         +SW   G+         V+  +  T     ++ 
Sbjct: 14400 EGEKLS--IPVPFRAVPVP-------TVSWHKDGKE--------VKASDRLTMKNDHISA 14442

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPS 748
              L V  P+    D        + +   N   +G  + +  V V+G    +P     I  S
Sbjct: 14443 HLEV--PKSVRADAG-----IYTITLENK--LGSATASINVKVIG----LPGPCKDIKAS 14489

Query: 749   RNTDTSVVVSWE--ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQS 806
               T +S  ++WE  E      ++ Y +E   AG   + P  +   K S +T   L+    
Sbjct: 14490 DITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLS-WTVKDLIPNGE 14548

Query: 807   YIFRVRAVNAAGLSEY 822
             Y FRV+AVN  G  EY
Sbjct: 14549 YFFRVKAVNKVGGGEY 14564



 Score =  117 bits (292), Expect = 1e-25
 Identities = 89/308 (28%), Positives = 141/308 (45%), Gaps = 18/308 (5%)

Query: 922   SDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPG 981
             SDP+  +     P  P          +S+ L W +P+  GG+EI  Y +  RE       
Sbjct: 28140 SDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKKST--- 28196

Query: 982   KW-REANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPG 1040
             +W +  + + +SE  +K++ L E   Y+F V A N AG+G  S +S   KC E  +  PG
Sbjct: 28197 RWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCRE-PVNPPG 28255

Query: 1041  PPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN-EAAIKNVY 1099
             PP  +K ++  K ++ L+W  PV  G   + GY +++   KA    W  +N EA +K  Y
Sbjct: 28256 PPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEM--CKADLGDWHKVNAEACVKTRY 28313

Query: 1100  LKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVV-------NVDDDG 1152
               V  L+ G  Y FRV AIN AG G   ++ G + A  R    E+ +       +V   G
Sbjct: 28314 -TVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAG 28372

Query: 1153  VISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDV 1212
                  F   +  P     WSK    +  S R ++ +  + + +T ++   +D G Y+  V
Sbjct: 28373 ASIRLFIAYQGRPTPTAVWSKP--DSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTV 28430

Query: 1213  TDTDGIAS 1220
              +  G  S
Sbjct: 28431 ENNSGSKS 28438



 Score =  116 bits (290), Expect = 2e-25
 Identities = 133/548 (24%), Positives = 220/548 (40%), Gaps = 61/548 (11%)

Query: 638   PGPPTD-LSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSP 695
             PGPP   +   E +  +VV+SW+PP   G   I  Y VEK +  T  W  V+    V   
Sbjct: 24405 PGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSAT--VART 24462

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSV 755
                +  L  G  Y FR+   N  G   P ++  V +V      P  PG    +  +   +
Sbjct: 24463 TIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAV-IVQYPFKEPGPPGTPFVTSISKDQM 24521

Query: 756   VVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRA 813
             +V W E  +    +++GY++E     S  W   N  P++ ++F   GL  G  Y F+V A
Sbjct: 24522 LVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSA 24581

Query: 814   VNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGG-----LTASRGRVHEASPPT 868
              N  G+ + S+ SE           V+ D C    D PG      +T +   +    P  
Sbjct: 24582 ENIVGIGKPSKVSECF---------VARDPC----DPPGRPEAIVITRNNVTLKWKKPAY 24628

Query: 869   FQKDALLGSKPNKPSLP------SSSQNLGQTE--VSKVSETVQEELTPPPQKAAPQGKS 920
                  + G    K  LP      +S  N+ +TE  VS + E  + E     + AA     
Sbjct: 24629 DGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSE 24688

Query: 921   KSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVP 980
              SD     T R     P + +    ++D +V+        G   +    +  + + D V 
Sbjct: 24689 PSDSSGAITARDEIDAP-NASLDPKYKDVIVV------HAGETFVLEADIRGKPIPDVVW 24741

Query: 981   GKWREANVKAVSEEAYKISNLKENMVYQFQVAA------MNMAGLGAPSAVSECFKCEEW 1034
              K  +   +  +    K +  K  +V +  +        + ++ +G   ++    K    
Sbjct: 24742 SKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVK---- 24797

Query: 1035  TIAVPGPPHS-LKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEA 1093
              +  PGPP   LK + V  +   L W PP+  G   ++ Y ++ +E       W  ++  
Sbjct: 24798 VLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLS--WTQVS-T 24854

Query: 1094  AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA------ETRPGTKEVVVN 1147
              ++ +  KV  L  G  Y+FRV A+N+ G+G+P + +GPV A         P T EV   
Sbjct: 24855 EVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLE-SGPVTACNPYKPPGPPSTPEVSAI 24913

Query: 1148  VDDDGVIS 1155
               D  V++
Sbjct: 24914 TKDSMVVT 24921



 Score =  115 bits (289), Expect = 3e-25
 Identities = 166/757 (21%), Positives = 275/757 (36%), Gaps = 129/757 (17%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYR 351
             E +K++  IAG P P ++W K+ + I   A   +  I S      L +  C   DT QY 
Sbjct: 25805 EVLKINADIAGRPLPVISWAKDGIEIEERA---RTEIISTDNHTLLTVKDCIRRDTGQYV 25861

Query: 352   ASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF-GVTPYGYASRFEIHFDDK 410
              +  NV G  S   +  V       D+    AG    PL   G+T             +K
Sbjct: 25862 LTLKNVAGTRSVAVNCKV------LDKPGPPAG----PLEINGLTA------------EK 25899

Query: 411   FDVSFGREGET--MSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGE--RAT 466
               +S+GR  E     +   +V   E  H    + W              T+  GE    +
Sbjct: 25900 CSLSWGRPQEDGGADIDYYIVEKRETSH----LAW--------------TICEGELQMTS 25941

Query: 467   LTFSHLNKEDEGLYTI----RVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEAN 522
                + L K +E ++ +    +  +GE  E     V ++  D      P+ P  ++     
Sbjct: 25942 CKVTKLLKGNEYIFRVTGVNKYGVGEPLES----VAIKALDPFT--VPSPPTSLEITSVT 25995

Query: 523   KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIF 582
             K+ + + W +P  DGGS I GY I++ E  +  W + N  PV   R   TGL EG  Y +
Sbjct: 25996 KESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEY 26055

Query: 583   RVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPT 642
             RV A N  G+  PS  S  + A DP                             +P PP+
Sbjct: 26056 RVYAENAAGLSLPSETSPLIRAEDPV---------------------------FLPSPPS 26088

Query: 643   DLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFD 701
                + ++ ++ + ++W KP    G     Y VE  ++   +W+     L  +   + +  
Sbjct: 26089 KPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTSIQSL--RGTEYTISG 26146

Query: 702   LAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK-------LDIPKAPGKIIPSRNTDTS 754
             L  G  Y FRV+  N  G  +PS++++  +  ++       +D       I+ +  + T 
Sbjct: 26147 LTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASFTM 26206

Query: 755   VV---------VSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQ 805
              V         V W +         Y        S   E  N N       T   +++  
Sbjct: 26207 TVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAA 26266

Query: 806   SYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEAS 865
             S    V+ ++  G        +  +  A +   V         +  GG       + +  
Sbjct: 26267 SLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDV--------PENDGGAPVKNYHIEKRE 26318

Query: 866   PPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPL 925
                  K A +    N   L     NL +  +     + + E          +G       
Sbjct: 26319 A---SKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEG------- 26368

Query: 926   KKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWRE 985
              K T++  P     +T +   +DS+ L W +P+  GG+ I  Y V   E ++     W +
Sbjct: 26369 VKITEKPSPPEKLGVTSIS--KDSVSLTWLKPEHDGGSRIVHYVV---EALEKGQKNWVK 26423

Query: 986   ANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAP 1022
               V       + +S L+EN  Y F+V A N AGL  P
Sbjct: 26424 CAV--AKSTHHVVSGLRENSEYFFRVFAENQAGLSDP 26458



 Score =  113 bits (282), Expect = 2e-24
 Identities = 82/300 (27%), Positives = 136/300 (45%), Gaps = 26/300 (8%)

Query: 934   PSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSE 993
             P PP          D M L W  P   GG+E+TG++V  +E    +   W++ N   +S 
Sbjct: 27757 PGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSIL---WQKVNTSPISG 27813

Query: 994   EAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVP--GPPHSLKCSEVR 1051
               Y+ + L E + YQF+V A N AGL +PS  S+      +T+AV    PP +    +V 
Sbjct: 27814 REYRATGLVEGLDYQFRVYAENSAGLSSPSDPSK------FTLAVSPVDPPGTPDYIDVT 27867

Query: 1052  KDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSY 1111
             ++++ L+W PP+  G + + GY ++ ++     ++W   N   +      V GL  G  Y
Sbjct: 27868 RETITLKWNPPLRDGGSKIVGYSIEKRQGN---ERWVRCNFTDVSECQYTVTGLSPGDRY 27924

Query: 1112  VFRVRAINQAG-VGKPSDLAGPVVAETRPGTKEVVVNVDD---DGVISLNFECDKMT--- 1164
              FR+ A N  G +  PS  +G ++  TR      +V       DG+I  + E  ++    
Sbjct: 27925 EFRIIARNAVGTISPPSQSSGIIM--TRDENVPPIVEFGPEYFDGLIIKSGESLRIKALV 27982

Query: 1165  ---PKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1221
                P    +W KD V  E    +E+      T +  +D   D  G+Y+ +  +  G A +
Sbjct: 27983 QGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKA 28042



 Score =  112 bits (279), Expect = 4e-24
 Identities = 71/232 (30%), Positives = 103/232 (44%), Gaps = 28/232 (12%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P  P   +     KD ++++W +P  DGG+ I GY ++K +     W++CN   +   R 
Sbjct: 24902 PGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWTKCNKKTLTDLRL 24961

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              VTGL EG SY FRV A N  G+G PS  S    A D                       
Sbjct: 24962 RVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDAL--------------------- 25000

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNT 688
                     PGPP++  VT+ +RS V L+W  P   G   +  Y VE  EA  + W     
Sbjct: 25001 ------YPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTP 25054

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPK 740
                ++  +F +  L E   Y FR+   NS GVGEP+      V  ++++ P+
Sbjct: 25055 PTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPE 25106



 Score =  108 bits (269), Expect = 6e-23
 Identities = 127/511 (24%), Positives = 214/511 (41%), Gaps = 52/511 (10%)

Query: 638   PGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPR 696
             PGPP  + + E +   + +SW PP   G   I  Y VEK E  +  W  V+  +   S +
Sbjct: 25488 PGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSIK 25547

Query: 697   FALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVV 756
               +  L  G  Y FRV   N  G    SE++ V V       P  PG       T ++++
Sbjct: 25548 --IVRLTTGSEYQFRVCAENRYGKSSYSESSAV-VAEYPFSPPGPPGTPKVVHATKSTML 25604

Query: 757   VSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAV 814
             V+W+   +     ++GY++E     S  W   N   +  ++    GL  G  Y +RV A 
Sbjct: 25605 VTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAE 25664

Query: 815   NAAGLSEYSQDSEAIEVKAAIGGGVSPDVC-PALSDEPGGLTASRGRVHEASPPTFQKDA 873
             N AG+ + S+  E +  +         D C P    E   +T     +  + P       
Sbjct: 25665 NIAGIGKCSKSCEPVPAR---------DPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAK 25715

Query: 874   LLGSKPNKPSLPS------SSQNLGQT--EVSKVSETVQEELTPPPQKAAPQGKSKSD-- 923
             + G    +  LP       +  N+ +T  EV++++E  + E     + AA      S+  
Sbjct: 25716 ITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSEST 25775

Query: 924   -PLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGY---YVNYREVIDGV 979
              P+  K D  PP    D+     FRD +V+   +  KI  A+I G     +++ +  DG+
Sbjct: 25776 GPIIVKDDVEPPRVMMDV----KFRDVIVVKAGEVLKI-NADIAGRPLPVISWAK--DGI 25828

Query: 980   PGKWREANVKAVSEEAYKISNLKENM---VYQFQVAAMNMAGLGAPSAVSECFKCEEWTI 1036
               + R A  + +S + + +  +K+ +     Q+ +   N+AG       S    C+   +
Sbjct: 25829 EIEER-ARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAG-----TRSVAVNCK--VL 25880

Query: 1037  AVPGPPHS-LKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAI 1095
               PGPP   L+ + +  +   L W  P   G   +  Y V+ +E       W  + E  +
Sbjct: 25881 DKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRE--TSHLAWT-ICEGEL 25937

Query: 1096  KNVYLKVRGLKEGVSYVFRVRAINQAGVGKP 1126
             +    KV  L +G  Y+FRV  +N+ GVG+P
Sbjct: 25938 QMTSCKVTKLLKGNEYIFRVTGVNKYGVGEP 25968



 Score =  107 bits (267), Expect = 1e-22
 Identities = 81/279 (29%), Positives = 125/279 (44%), Gaps = 45/279 (16%)

Query: 462   GERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEA 521
             G ++ L      ++D G Y I         +++A      A  E+   P   LD+K +  
Sbjct: 15156 GTKSELIIKDALRKDHGRYVITAT-NSCGSKFAA------ARVEVFDVPGPVLDLKPVVT 15208

Query: 522   NKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYI 581
             N+   +++W  P  DGGS I G+ I++ +    +W Q  +T  + ++  +TGL+EG+ Y 
Sbjct: 15209 NRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIET--ERSKCDITGLLEGQEYK 15266

Query: 582   FRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPP 641
             FRV A NK G G P  +  P+ A+DP                               GPP
Sbjct: 15267 FRVIAKNKFGCGPPVEIG-PILAVDPL------------------------------GPP 15295

Query: 642   TD---LSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRF 697
             T    L+ TE T+S + L WK P   G   I  Y +EK      +++RVN  L   +  F
Sbjct: 15296 TSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRL-CPTTSF 15354

Query: 698   ALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKL 736
              + +L E + Y FRV+  N  G  EPS    V +  D++
Sbjct: 15355 LVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEV 15393



 Score =  103 bits (256), Expect = 2e-21
 Identities = 108/504 (21%), Positives = 202/504 (40%), Gaps = 70/504 (13%)

Query: 1164 TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1223
            T   + +W+KD          ++    N   +T   +G  D G Y+C  ++  G      
Sbjct: 7238 TAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAG------ 7291

Query: 1224 IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIF--NE 1281
              ++     L +    +F    +K      I++  Q  F     K+ G+ ++  ++  +E
Sbjct: 7292 --KDSCSAQLGVQEPPRF----IKKLEPSRIVK--QDEFTRYECKIGGSPEIKVLWYKDE 7343

Query: 1282 KEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKL 1341
             EI E  K++M    +  ++E  M  L  ED G YT +  +   +  S+  L      K+
Sbjct: 7344 TEIQESSKFRMSFVDSVAVLE--MHNLSVEDSGDYTCEAHNAAGSASSSTSL------KV 7395

Query: 1342 QKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVD 1401
            ++   F+++       PH +E L        +V L+C++       H+ WYKD+RE+   
Sbjct: 7396 KEPPIFRKK-------PHPIETLK-----GADVHLECELQG-TPPFHVSWYKDKRELRSG 7442

Query: 1402 EKHDF--KDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKI 1459
            +K+    ++ + ++ I      D G Y+    +D G D     +  +A    + ++    
Sbjct: 7443 KKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDIS 7502

Query: 1460 ALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQIN 1519
             +   ++++Q+T EG +  S V +            G  +R SD +    +     LQ +
Sbjct: 7503 TVVGKEVQLQTTIEGAEPISVVWF---------KDKGEIVRESDNIWISYSENIATLQFS 7553

Query: 1520 EPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLP 1579
               P + GKY  ++             +     E +A    L+ A I EK         P
Sbjct: 7554 RVEPANAGKYTCQI------------KNDAGMQECFATLSVLEPATIVEK---------P 7592

Query: 1580 DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
            + + +  G    L C V G P     W K+ K L SD+   + F   + +   I  V+ +
Sbjct: 7593 ESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISF-FNKVSGLKIINVAPS 7651

Query: 1640 DSGKYGLVVKNKYGSETSDFTVSV 1663
            DSG Y   V+N  G ++   ++ V
Sbjct: 7652 DSGVYSFEVQNPVGKDSCTASLQV 7675



 Score =  103 bits (256), Expect = 2e-21
 Identities = 71/193 (36%), Positives = 91/193 (47%), Gaps = 7/193 (3%)

Query: 638   PGPPTD-LSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSP 695
             PGPP   L VT  T     L+W PP Q G   I  Y +EK E    +W +V+TE  V++ 
Sbjct: 24802 PGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTE--VQAL 24859

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSV 755
              + +  L  G  Y FRV   N  G+GEP E+  VT   +    P  P     S  T  S+
Sbjct: 24860 NYKVTKLLPGNEYIFRVMAVNKYGIGEPLESGPVTAC-NPYKPPGPPSTPEVSAITKDSM 24918

Query: 756   VVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRA 813
             VV+W    D    E+ GY +E       +W  CN   +   R    GL  G SY FRV A
Sbjct: 24919 VVTWARPVDDGGTEIEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAA 24978

Query: 814   VNAAGLSEYSQDS 826
              NAAG+ E S+ S
Sbjct: 24979 ENAAGVGEPSEPS 24991



 Score = 95.1 bits (235), Expect = 5e-19
 Identities = 161/728 (22%), Positives = 271/728 (37%), Gaps = 135/728 (18%)

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
             VF R  DA     P  P + K  + ++  + ++W +P  DGG+P+ GY ++  E   D W
Sbjct: 24992 VFYRACDALYP--PGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEW 25049

Query: 557   SQCND-TPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKS 615
             + C   T ++  +F VT L E   Y FR+ A+N  G+G P+ +   V A +  E   ++ 
Sbjct: 25050 TTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIEL 25109

Query: 616   RPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQ---RGHEGIMYF 672
                     +++V                L  +   R +V +  +P  +      EGI+  
Sbjct: 25110 DAD---LRKVVV----------------LRASATLRLFVTIKGRPEPEVKWEKAEGIL-- 25148

Query: 673   VEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVV 732
                         R   E+        + ++    S  + +   N++G    S+   V V 
Sbjct: 25149 ----------TDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSG----SKTAFVNV- 25193

Query: 733   GDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCNNNP 790
                LD P AP  +        SV +SWE        ++  Y +E        +    NN 
Sbjct: 25194 -RVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNC 25252

Query: 791   VKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDE 850
              K + F    L  G SY FRV A N  G+   ++ +E ++V             P L   
Sbjct: 25253 TK-TTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSE-----------PPL--P 25298

Query: 851   PGGLTASRGRVHEASPPTFQKDALLGSKPN----KPSLPSSSQNLGQTEVSKVSETVQEE 906
             PG +T      + A+    + ++  GSK      +     S +    T+V  +  T+   
Sbjct: 25299 PGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATI-SG 25357

Query: 907   LTPPPQ----KAAPQGKSKSDP-----------LKKKTDRAPPSPPCDITCLESF----- 946
             LT   +     AA   K +SDP           ++ K     P    ++   E       
Sbjct: 25358 LTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKIDVP 25417

Query: 947   ---RDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKE 1003
                R    + W++ D     E T   V+  + +  +  K  EA+ + V      +SN   
Sbjct: 25418 FKGRPQATVNWRK-DGQTLKETTRVNVSSSKTVTSLSIK--EASKEDVGTYELCVSNSAG 25474

Query: 1004  NMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPV 1063
             ++     +  ++  G   P  + E   C+  TI+                     W PP 
Sbjct: 25475 SITVPITIIVLDRPGPPGPIRIDE-VSCDSITIS---------------------WNPPE 25512

Query: 1064  HSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGV 1123
             + G   ++ Y V+ KE  +    W  +++ A+    +K+  L  G  Y FRV A N+ G 
Sbjct: 25513 YDGGCQISNYIVEKKETTS--TTWHIVSQ-AVARTSIKIVRLTTGSEYQFRVCAENRYGK 25569

Query: 1124  GKPSDLAGPVVAE------TRPGTKEVV------------VNVDDDGVISLNFECDKMTP 1165
                S+ +  VVAE        PGT +VV            V V+D G   + +  +    
Sbjct: 25570 SSYSE-SSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLE-YKE 25627

Query: 1166  KSEFSWSK 1173
             +S   WSK
Sbjct: 25628 RSSILWSK 25635



 Score = 94.0 bits (232), Expect = 1e-18
 Identities = 84/340 (24%), Positives = 135/340 (39%), Gaps = 45/340 (13%)

Query: 274   LHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYII-ESRY 332
             + AP F  + R+  V  + N  L C + G P+P V WY+    I   A+  KY I E + 
Sbjct: 30925 IQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEII--ADGLKYRIQEFKG 30982

Query: 333   GMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF 392
             G H L I     +D   Y+  A N  G +S  AS+ V+         + H   +   +  
Sbjct: 30983 GYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEV------PAKIHLPKTLEGMGA 31036

Query: 393   GVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSP 452
                  G     +I F  K D                          P I W +    +  
Sbjct: 31037 VHALRGEVVSIKIPFSGKPD--------------------------PVITWQKGQDLIDN 31070

Query: 453   SKWVQTLWSGERATLTFSH-LNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPA 511
             +   Q + +    +L F + + ++D G Y +  +     +Q       +  + ++   P 
Sbjct: 31071 NGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQ-------KTVELDVADVPD 31123

Query: 512   APLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPV 571
              P  VK  + ++D + ++W +PA DGGS I  Y ++KC    + W +      +  R+ V
Sbjct: 31124 PPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQ--ARETRYTV 31181

Query: 572   TGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKA 611
               L    SY FRV A NK G+  PS  SEP    +   +A
Sbjct: 31182 INLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRA 31221



 Score = 93.6 bits (231), Expect = 1e-18
 Identities = 118/540 (21%), Positives = 205/540 (37%), Gaps = 75/540 (13%)

Query: 1146 VNVDDDGVISLNFECDKMTPKS-EFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDD 1204
            V++D     S +FEC     +    +WSKD           +   GN   +    +G  D
Sbjct: 6278 VSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGD 6337

Query: 1205 LGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWM 1264
             G Y+C  T+  G            K + +     K P   VK   A ++ ++G+    +
Sbjct: 6338 SGQYTCQATNDVG------------KDMCSAQLSVKEPPKFVKKLEASKVAKQGES---I 6382

Query: 1265 QAE-KLSGNA--KVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQ 1321
            Q E K+SG+   KV++  N+ E+ E  KY M    +  ++ +   +   ED G Y  +  
Sbjct: 6383 QLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTI--NEASAEDSGDYICEAH 6440

Query: 1322 DGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVA 1381
            +G      +  L               +   +  Q P  V  L        +V+L+C+++
Sbjct: 6441 NGVGDASCSTALT-------------VKAPPVFTQKPSPVGALKGS-----DVILQCEIS 6482

Query: 1382 NIKKETHIVWYKDEREISVDEKHDF--KDGICTLLITEFSKKDAGIYEVILKDDRGKDKS 1439
                   +VW KD +++   +K     K    +L I      D G Y     ++ G D  
Sbjct: 6483 GTPP-FEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTC 6541

Query: 1440 RLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAI 1499
               +  +     + ++     L    +++++  EG Q  S V  +++D        G  I
Sbjct: 6542 SCSVKFKEPPRFVKKLSDTSTLIGDAVELRAIVEGFQPISVV--WLKD-------RGEVI 6592

Query: 1500 RYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQ 1559
            R S+  +         LQ+  P  ++ GKY+ ++             +     E  A   
Sbjct: 6593 RESENTRISFIDNIATLQLGSPEASNSGKYICQI------------KNDAGMRECSAVLT 6640

Query: 1560 RLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHC 1619
             L+ A I EK         P+ +T+  G    L C V G P     W K+ + L++D   
Sbjct: 6641 VLEPARIIEK---------PEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKH 6691

Query: 1620 NLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALESLK 1679
            ++ F   + A   I     +D G Y   VKN  G   S+ TVSV + +     + +  LK
Sbjct: 6692 HITF-INKVASLKIPCAEMSDKGLYSFEVKNSVGK--SNCTVSVHVSDRIVPPSFIRKLK 6748



 Score = 89.7 bits (221), Expect = 2e-17
 Identities = 111/507 (21%), Positives = 197/507 (38%), Gaps = 72/507 (14%)

Query: 1162 KMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1221
            K TP  +  W KD V     P+  +  +G+ + +    +     G Y+C VT+  G    
Sbjct: 5354 KGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVG---- 5409

Query: 1222 YLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIF-- 1279
                 +    +L ++   KF    VK   A +I++ G         K++G+ ++  ++  
Sbjct: 5410 ----SDSCTTMLLVTEPPKF----VKKLEASKIVKAGDSS--RLECKIAGSPEIRVVWFR 5459

Query: 1280 NEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQD-GKATNHSTVVLVGDVF 1338
            NE E+    KY+M    +  +I+  M  L  ED G +  + Q+   +T+ ST V+V    
Sbjct: 5460 NEHELPASDKYRMTFIDSVAVIQ--MNNLSTEDSGDFICEAQNPAGSTSCSTKVIV---- 5513

Query: 1339 KKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREI 1398
                      ++  +    P  VE L         V L+C+++       +VWYKD+R++
Sbjct: 5514 ----------KEPPVFSSFPPIVETLK-----NAEVSLECELSG-TPPFEVVWYKDKRQL 5557

Query: 1399 SVDEKHDF--KDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVC 1456
               +K+    K+   ++ I      D G Y    +++ G D     +  +     + ++ 
Sbjct: 5558 RSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLN 5617

Query: 1457 KKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWL 1516
                ++    ++Q++ EG Q       +V+ LK         IR S+ ++         L
Sbjct: 5618 SLTVVAGEPAELQASIEGAQ-----PIFVQWLK----EKEEVIRESENIRITFVENVATL 5668

Query: 1517 QINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLG 1576
            Q  +  P + GKY+ ++             +     E  A    L+ A I EK       
Sbjct: 5669 QFAKAEPANAGKYICQI------------KNDGGMRENMATLMVLEPAVIVEK------- 5709

Query: 1577 GLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGV 1636
                 +T+  G+   L C V G P   V W K+ K L S       F   + +   I  V
Sbjct: 5710 --AGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSF-YNKISSLRILSV 5766

Query: 1637 STADSGKYGLVVKNKYGSETSDFTVSV 1663
               D+G Y   V+N  G  +    V V
Sbjct: 5767 ERQDAGTYTFQVQNNVGKSSCTAVVDV 5793



 Score = 89.7 bits (221), Expect = 2e-17
 Identities = 124/594 (20%), Positives = 223/594 (37%), Gaps = 84/594 (14%)

Query: 1100 LKVRGLKEGVSYVFRVRAINQAGVGKPSD---LAGPVVAETRPGTKEVVVNVDDDGVISL 1156
            L++  L    S  +   A N AG    S    +  P +   +P   E +   D      +
Sbjct: 7363 LEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGAD------V 7416

Query: 1157 NFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDT 1215
            + EC+   TP    SW KD        + ++ S+   T +   ++   D+G Y C  T+ 
Sbjct: 7417 HLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATND 7476

Query: 1216 DGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKV 1275
             G         +     +AL    +F  V   S+++  + ++ Q++       + G   +
Sbjct: 7477 VG--------SDTCVGSIALKAPPRF--VKKLSDISTVVGKEVQLQ-----TTIEGAEPI 7521

Query: 1276 NYI-FNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLV 1334
            + + F +K         + I  +  I  +   +++  + G YT Q+++          L 
Sbjct: 7522 SVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATL- 7580

Query: 1335 GDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKD 1394
                  L+     ++ E I+             VT      L+C VA    E    W+KD
Sbjct: 7581 ----SVLEPATIVEKPESIK-------------VTTGDTCTLECTVAGTP-ELSTKWFKD 7622

Query: 1395 EREISVDEKH--DFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELM 1452
             +E++ D K+   F + +  L I   +  D+G+Y   +++  GKD     L         
Sbjct: 7623 GKELTSDNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASL--------- 7673

Query: 1453 MEVCKKIALSATDLKIQSTAEGIQLYSFV----TYYVEDLKVNWSHNGSAIRYSDRVKTG 1508
             +V  +    +   K++ T  G+   S V     Y    + V+W H G+ I    + +T 
Sbjct: 7674 -QVSDRTVPPSFTRKLKET-NGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTT 7731

Query: 1509 VTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAE 1568
            +T     L +N    +D G Y               +++G   DE  A     +  +  +
Sbjct: 7732 LTDNTCALTVNMLEESDSGDYTCI----------ATNMAGS--DECSAPLTVREPPSFVQ 7779

Query: 1569 KNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRT 1628
            K         PD + +  G  +  T  V G PP  VSW K    L   D CN+  E    
Sbjct: 7780 K---------PDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLE-DSV 7829

Query: 1629 AYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALESLKGGK 1682
            A   +  V T+ SG+Y  +V N+ G  +    + +  P +  +     S++ GK
Sbjct: 7830 AELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGK 7883



 Score = 86.7 bits (213), Expect = 2e-16
 Identities = 115/512 (22%), Positives = 199/512 (38%), Gaps = 49/512 (9%)

Query: 1158 FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
            FEC+   P     W KD    + + R++++ +    ++      M D G Y+  V     
Sbjct: 3077 FECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYT--VVAGGN 3134

Query: 1218 IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQ--VRFWMQAEKLSGNAKV 1275
            ++++ L  E    R+ ++  E             V+++EK +  V F +  + +  +   
Sbjct: 3135 VSTAKLFVEGRDVRIRSIKKE-------------VQVIEKQRAVVEFEVNEDDVDAHWYK 3181

Query: 1276 NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVG 1335
            + I    ++ E  KY   ++R   I  MF+ + +  D G YTF        N S+V L  
Sbjct: 3182 DGIEINFQVQERHKYV--VERR--IHRMFISETRQSDAGEYTFVA----GRNRSSVTLYV 3233

Query: 1336 DVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDE 1395
            +  +  Q   E Q       +   F                 C V + + +  I WYK+E
Sbjct: 3234 NAPEPPQVLQELQPVTVQSGKPARF-----------------CAVISGRPQPKISWYKEE 3276

Query: 1396 REISVDEKHDF-KDGI-CTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMM 1453
            + +S   K  F  DG   TLL+ E   +DA +Y    K+D G   +   L  E  + +  
Sbjct: 3277 QLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSP 3336

Query: 1454 EVCKKIALSA--TDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTG 1511
            +    +   A  T L+   T+EG            DLKV+W      I+ S   +     
Sbjct: 3337 DQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFE 3396

Query: 1512 EQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNR 1571
            +   L+I E  P D+G Y     +       T +LS +A +    E  R++Q    E   
Sbjct: 3397 DTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHE--RIEQEIEMEMKA 3454

Query: 1572 ARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYF 1631
            A V+    + + +  G     TC +   P     W K  + +   D C+++  +   +  
Sbjct: 3455 APVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIR-SSKYISSL 3513

Query: 1632 TINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
             I      D G+Y     N+YGS +   T++V
Sbjct: 3514 EILRTQVVDCGEYTCKASNEYGSVSCTATLTV 3545



 Score = 85.1 bits (209), Expect = 5e-16
 Identities = 121/565 (21%), Positives = 222/565 (39%), Gaps = 93/565 (16%)

Query: 1132 PVVAETRPGTKEVVVNVDDDGVISLNFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKG 1190
            P V  + P   E + N +      ++ EC+   TP  E  W KD      S + ++ SK 
Sbjct: 5516 PPVFSSFPPIVETLKNAE------VSLECELSGTPPFEVVWYKDKRQLRSSKKYKIASKN 5569

Query: 1191 NKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTV----PV 1246
              T +   ++   D+G Y C   +  G  S   +   +LK       +    TV    P 
Sbjct: 5570 FHTSIHILNVDTSDIGEYHCKAQNEVG--SDTCVCTVKLKEPPRFVSKLNSLTVVAGEPA 5627

Query: 1247 KSELAVEILEKGQVRFWMQAEKL---SGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEM 1303
            + + ++E  +   V++  + E++   S N ++ ++ N                   +  +
Sbjct: 5628 ELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVEN-------------------VATL 5668

Query: 1304 FMEKLQDEDEGTYTFQLQD--GKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFV 1361
               K +  + G Y  Q+++  G   N +T++++             +    + K GP  V
Sbjct: 5669 QFAKAEPANAGKYICQIKNDGGMRENMATLMVL-------------EPAVIVEKAGPMTV 5715

Query: 1362 EYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFK--DGICTLLITEFS 1419
                    GE    L+CKVA    E  + WYKD + ++  +KH F   + I +L I    
Sbjct: 5716 ------TVGE-TCTLECKVAGTP-ELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVE 5767

Query: 1420 KKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYS 1479
            ++DAG Y   ++++ GK  S   +VD + + +     +++  +   L      E     S
Sbjct: 5768 RQDAGTYTFQVQNNVGKS-SCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGS 5826

Query: 1480 FVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTG 1539
                    + V W H  + I    + +T  +     LQ+N    +D G Y          
Sbjct: 5827 ------SPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCV------- 5873

Query: 1540 HQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGD 1599
                 +++G   DE  A     +  +  ++         P+ + +  GK +  T  + G 
Sbjct: 5874 ---AANVAGS--DECRAVLTVQEPPSFVKE---------PEPLEVLPGKNVTFTSVIRGT 5919

Query: 1600 PPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDF 1659
            PP +V+W +  + L   D CN+ FE    A   +  +  + SG+Y  VV N  G   +  
Sbjct: 5920 PPFKVNWFRGARELVKGDRCNIYFE-DTVAELELFNIDISQSGEYTCVVSNNAGQ--ASC 5976

Query: 1660 TVSVFIPEEEARMAAL--ESLKGGK 1682
            T  +F+ E  A +  L   S++ GK
Sbjct: 5977 TTRLFVKEPAAFLKRLSDHSVEPGK 6001



 Score = 82.0 bits (201), Expect = 4e-15
 Identities = 131/602 (21%), Positives = 222/602 (36%), Gaps = 83/602 (13%)

Query: 1065 SGRTPVT-GYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGV 1123
            +G  P++  +F D +E  A E      ++      +L++  L+   S  +   A N+AG 
Sbjct: 4699 AGSHPISIQWFKDDQEISASEKYKFSFHD---NTAFLEISQLEGTDSGTYTCSATNKAGH 4755

Query: 1124 GKPSD---LAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTED 1180
             + S    +  P     +P +++V  N      + L        P +   W KD      
Sbjct: 4756 NQCSGHLTVKEPPYFVEKPQSQDVNPNTR----VQLKALVGGTAPMT-IKWFKDNKELHS 4810

Query: 1181 SPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHK 1240
                 V      T +        D G Y C +++  G A+S        K  L +    +
Sbjct: 4811 GAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATS--------KATLFVKEPPQ 4862

Query: 1241 FPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMH-IDRNTG 1299
            F    +K    V +L  GQ   +      +   +V++  +  EI    K+ +  ID   G
Sbjct: 4863 F----IKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFID---G 4915

Query: 1300 IIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPH 1359
            +    +   + E+ GTY  + ++   T   ++ L                     K+ P 
Sbjct: 4916 LATFQISGARVENSGTYVCEARNDAGTASCSIELKV-------------------KEPPT 4956

Query: 1360 FVEYLS-WEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKD--GICTLLIT 1416
            F+  L   EV    +V L+C+V        + W K+ REI   +K+   D   +  L IT
Sbjct: 4957 FIRELKPVEVVKYSDVELECEVTGTPP-FEVTWLKNNREIRSSKKYTLTDRVSVFNLHIT 5015

Query: 1417 EFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQ 1476
            +    D G Y+ I+ ++ G      ++   A KE    + KKI  + T LK  +T +   
Sbjct: 5016 KCDPSDTGEYQCIVSNEGGSCSCSTRV---ALKEPPSFI-KKIENTTTVLKSSATFQSTV 5071

Query: 1477 LYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDG 1536
              S        + + W  +   +   D V          LQI        G+Y  +    
Sbjct: 5072 AGS------PPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQA--- 5122

Query: 1537 KTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNV 1596
                      +    +  YA     + A I EK ++         V + E   + L C V
Sbjct: 5123 ---------KNESGVERCYAFLLVQEPAQIVEKAKS---------VDVTEKDPMTLECVV 5164

Query: 1597 WGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSET 1656
             G P  +V WLK+ K +    + ++ FE    A F I  V   DSG+Y   V+N +GS +
Sbjct: 5165 AGTPELKVKWLKDGKQIVPSRYFSMSFE-NNVASFRIQSVMKQDSGQYTFKVENDFGSSS 5223

Query: 1657 SD 1658
             D
Sbjct: 5224 CD 5225



 Score = 82.0 bits (201), Expect = 4e-15
 Identities = 112/536 (20%), Positives = 205/536 (38%), Gaps = 86/536 (16%)

Query: 1144 VVVNVDDDGVISLNFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGM 1202
            V V+V D    S + +C    TP+   SW K       +   ++  + N   + F  + +
Sbjct: 7970 VKVSVGD----SASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDI 8025

Query: 1203 DDLGIYSCDVTDTDG--IASSYL-IDEEELKRLLALSHEHKFPTV--PVKSELAVEILEK 1257
            +D G Y C   ++ G   AS++L + E++L    +        TV  PV  + A+   E 
Sbjct: 8026 NDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEP 8085

Query: 1258 GQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYT 1317
              V ++   + L  +  V   F +               NT  + +F        + + T
Sbjct: 8086 ISVSWYKDGKPLKDSPNVQTSFLD---------------NTATLNIFKTDRSLAGQYSCT 8130

Query: 1318 FQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSW--EVTGECNVL 1375
                 G A++ + ++L                     K  P F   L+    V GE +  
Sbjct: 8131 ATNPIGSASSSARLILTEG------------------KNPPFFDIRLAPVDAVVGE-SAD 8171

Query: 1376 LKCKVANIKKETHIVWYKDEREISVDEKHD--FKDGICTLLITEFSKKDAGIYEVILKDD 1433
             +C V   +    + W KD REI    K+   + +    L + +  K D+G Y     ++
Sbjct: 8172 FECHVTGTQP-IKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNE 8230

Query: 1434 RGKDKS------RLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVED 1487
             GKD        + +L+  +F + + E  ++        K++    G Q           
Sbjct: 8231 VGKDSCTAQLNIKERLIPPSFTKRLSETVEET--EGNSFKLEGRVAGSQ----------P 8278

Query: 1488 LKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLS 1547
            + V W  N   I+ +   +       + LQ+ +   ND G Y  ++ +           +
Sbjct: 8279 ITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSND----------A 8328

Query: 1548 GQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWL 1607
            G A   +    +  K+  + +++   V        T+ EG+ + L+C+V G  P  + WL
Sbjct: 8329 GSALCTSSIVIKEPKKPPVFDQHLTPV--------TVSEGEYVQLSCHVQGSEPIRIQWL 8380

Query: 1608 KNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
            K  + +   D C+  F +G TA   +  V+ ADSG Y     N  GS+T+   V++
Sbjct: 8381 KAGREIKPSDRCSFSFASG-TAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTI 8435



 Score = 78.6 bits (192), Expect = 5e-14
 Identities = 110/511 (21%), Positives = 199/511 (38%), Gaps = 76/511 (14%)

Query: 1164 TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1223
            +P+ +  W KD    ++S +  +    +   +   +L ++D G Y+C+  +  G ASS  
Sbjct: 7332 SPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASS-- 7389

Query: 1224 IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1283
                      + S + K P +  K    +E L+   V    + +  +    V++  +++E
Sbjct: 7390 ----------STSLKVKEPPIFRKKPHPIETLKGADVHLECELQG-TPPFHVSWYKDKRE 7438

Query: 1284 IFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNH-STVVLVGDVFKKLQ 1342
            +  G KYK  I     +  + +  +   D G Y       KATN   +   VG +     
Sbjct: 7439 LRSGKKYK--IMSENFLTSIHILNVDAADIGEY-----QCKATNDVGSDTCVGSI----- 7486

Query: 1343 KEAEFQRQEWIRKQGPHFVEYLS--WEVTGECNVLLKCKVANIKKETHIVWYKDEREISV 1400
                        K  P FV+ LS    V G+  V L+  +    +   +VW+KD+ EI  
Sbjct: 7487 ----------ALKAPPRFVKKLSDISTVVGK-EVQLQTTIEG-AEPISVVWFKDKGEIVR 7534

Query: 1401 DEKH---DFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCK 1457
            +  +    + + I TL  +     +AG Y   +K+D G        + E F  L +    
Sbjct: 7535 ESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAG--------MQECFATLSVLEPA 7586

Query: 1458 KIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQ 1517
             I      +K+ +T +   L   V     +L   W  +G  +   ++ K     +   L+
Sbjct: 7587 TIVEKPESIKV-TTGDTCTLECTVA-GTPELSTKWFKDGKELTSDNKYKISFFNKVSGLK 7644

Query: 1518 INEPTPNDKGKYVMELFD--GKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVL 1575
            I    P+D G Y  E+ +  GK     ++ +S +    ++   ++LK+            
Sbjct: 7645 IINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFT--RKLKET----------- 7691

Query: 1576 GGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTING 1635
             GL        G ++ + C V+G PP  VSW      ++S            T   T+N 
Sbjct: 7692 NGL-------SGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTL-TDNTCALTVNM 7743

Query: 1636 VSTADSGKYGLVVKNKYGSETSDFTVSVFIP 1666
            +  +DSG Y  +  N  GS+     ++V  P
Sbjct: 7744 LEESDSGDYTCIATNMAGSDECSAPLTVREP 7774



 Score = 77.8 bits (190), Expect = 8e-14
 Identities = 58/224 (25%), Positives = 109/224 (48%), Gaps = 17/224 (7%)

Query: 157   ERIKEAAAYIAQRNLLASEEGITTSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTA 216
             E +K++AA   +++++  E  IT + Q++   +T A  ++ +++ S    Q    + + A
Sbjct: 33006 EEVKKSAATSLEKSIVHEE--ITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIA 33063

Query: 217   SRQSVV----SKQATSALQQEETSEKKSRKVVIREKAER-----LSLRKTLEETET--YH 265
                 V       + T++ +         + + I++ + R       + KT E      Y 
Sbjct: 33064 GATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYD 33123

Query: 266   AKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGK 325
               L+++ L  AP FI +PRS  + E +NV   C I+G P P + W+KN +PI++ +N   
Sbjct: 33124 LTLSKE-LSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVS- 33181

Query: 326   YIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVV 369
               I     +++LEI      D+ +Y   A N +G+ SA AS++V
Sbjct: 33182 --ISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV 33223



 Score = 76.3 bits (186), Expect = 2e-13
 Identities = 110/529 (20%), Positives = 204/529 (38%), Gaps = 79/529 (14%)

Query: 1164 TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGI----A 1219
            TP  E  W KD  +   SP   +    NK  +   +L + D G+YSC  ++  G     A
Sbjct: 3577 TPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQA 3636

Query: 1220 SSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIF 1279
               +ID+    + L           PV+S +  ++  + QV    +  K++    V +  
Sbjct: 3637 ELIIIDKPHFIKELE----------PVQSAINKKVHLECQVD---EDRKVT----VTWSK 3679

Query: 1280 NEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFK 1339
            + +++  G  YK+  +     +E+ + KL+D      T   + G ++  +TV +      
Sbjct: 3680 DGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTV------ 3733

Query: 1340 KLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREIS 1399
                    +   +++K  P ++      + GE +  L CK+        + W+K+ +E+S
Sbjct: 3734 -------REPPSFVKKVDPSYL-----MLPGE-SARLHCKLKG-SPVIQVTWFKNNKELS 3779

Query: 1400 VDE--KHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCK 1457
                 +  F +    L IT+   +D+G Y     +D G D    ++V +     +  +  
Sbjct: 3780 ESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEP 3839

Query: 1458 KIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQ 1517
               +  T+  +Q    G              +++W  +   IR S + +       + L+
Sbjct: 3840 ADIVRGTNALLQCEVSG----------TGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLE 3889

Query: 1518 INEPTPNDKGKY--VMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVL 1575
            I      D G+Y  V+    GK G   T                 LK+     K      
Sbjct: 3890 IFSFNSADVGEYECVVANEVGKCGCMAT---------------HLLKEPPTFVKK----- 3929

Query: 1576 GGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTING 1635
              + D++ +  G+ + L   V G  P  V+W+K ++ +  D    + F  G  A   I  
Sbjct: 3930 --VDDLIAL-GGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNG-VAVLIIPD 3985

Query: 1636 VSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALESLKGGKKA 1684
            V  +  GKY  + +N+ GS+TS   + V  P +    A L  +  G  A
Sbjct: 3986 VQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERAELIQVTAGDPA 4034



 Score = 75.5 bits (184), Expect = 4e-13
 Identities = 114/537 (21%), Positives = 192/537 (35%), Gaps = 87/537 (16%)

Query: 1164 TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS-- 1221
            TP+   SW K++     +P  +++ K N   +    +   D+G YSC   ++ G  +S  
Sbjct: 7046 TPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSA 7105

Query: 1222 -YLIDEEELKRLLA--LSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYI 1278
              +I   +L    A  L   H+    PV  E  +   E  QV ++     L  +A +   
Sbjct: 7106 VLVIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTS 7165

Query: 1279 FNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVF 1338
            F            +H      I++     +     G Y     +   T  S+  L+    
Sbjct: 7166 F------------VHNVATLQILQTDQSHI-----GQYNCSASNPLGTASSSAKLILS-- 7206

Query: 1339 KKLQKEAEFQRQEWIRKQGPHFVEYLSWEVT---GECNVLLKCKVANIKKETHIVWYKDE 1395
                             + P F +     V    GE     KC V        I W KD 
Sbjct: 7207 ---------------EHEVPPFFDLKPVSVDLALGESGTF-KCHVTGTAP-IKITWAKDN 7249

Query: 1396 REISV--DEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKL-VDEA---FK 1449
            REI    + K    +   TL + +  K DAG Y     +  GKD    +L V E     K
Sbjct: 7250 REIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPPRFIK 7309

Query: 1450 ELM-MEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTG 1508
            +L    + K+   +  + KI  + E              +KV W  + + I+ S + +  
Sbjct: 7310 KLEPSRIVKQDEFTRYECKIGGSPE--------------IKVLWYKDETEIQESSKFRMS 7355

Query: 1509 VTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAE 1568
                   L+++  +  D G Y  E  +       +  L             ++K+  I  
Sbjct: 7356 FVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSL-------------KVKEPPIFR 7402

Query: 1569 KNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRT 1628
            K         P  +   +G  ++L C + G PP  VSW K+++ L S     +  E   T
Sbjct: 7403 KK--------PHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLT 7454

Query: 1629 AYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALESLKGGKKAK 1685
            +   +N V  AD G+Y     N  GS+T   ++++  P    +  +  S   GK+ +
Sbjct: 7455 SIHILN-VDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQ 7510



 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 104/533 (19%), Positives = 203/533 (38%), Gaps = 97/533 (18%)

Query: 1158  FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
             F C+  T  ++  W ++  +  DS +  +  K     +  +D  +DD   Y+  +T+  G
Sbjct: 12659 FNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRG 12718

Query: 1218  ----IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNA 1273
                  A++ +++EE+L+ +            P+K    +E +EK  V FW +  +L  N 
Sbjct: 12719 ENVKSAANLIVEEEDLRIV-----------EPLKD---IETMEKKSVTFWCKVNRL--NV 12762

Query: 1274  KVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVL 1333
              + +  N +E+    +    +D+   ++ +  +     DEG Y       K+     ++ 
Sbjct: 12763 TLKWTKNGEEVPFDNRVSYRVDKYKHMLTI--KDCGFPDEGEYIVTAGQDKSVAELLII- 12819

Query: 1334  VGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECN-VLLKCKVANIKKETHIVWY 1392
                                  +    FVE+L  +   E +  +  C+++  +++ ++ WY
Sbjct: 12820 ---------------------EAPTEFVEHLEDQTVTEFDDAVFSCQLS--REKANVKWY 12856

Query: 1393  KDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKE-- 1450
             ++ REI   +K+ F+             KD  I+ +I+KD R  D+       E  K   
Sbjct: 12857 RNGREIKEGKKYKFE-------------KDGSIHRLIIKDCRLDDECEYACGVEDRKSRA 12903

Query: 1451  --LMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTG 1508
                + E+  +I     D+     A G  +        + ++V W  N   +   D+ +  
Sbjct: 12904 RLFVEEIPVEIIRPPQDIL---EAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMM 12960

Query: 1509  VTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAE 1568
               G+   LQI +  P D+G+Y     D                 EA A+ +      I  
Sbjct: 12961 SEGKIHRLQICDIKPRDQGEYRFIAKD----------------KEARAKLELAAAPKIKT 13004

Query: 1569  KNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRT 1628
              ++  V         +  GK L +       P  E  W K  + L++     +   A +T
Sbjct: 13005 ADQDLV---------VDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTK---TIDTTAEQT 13052

Query: 1629  AYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVF-IPEEEARMAALESLKG 1680
             + F I      D G+Y +V++NK+G       + V  +P     +   E+  G
Sbjct: 13053 S-FRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDG 13104



 Score = 72.0 bits (175), Expect = 5e-12
 Identities = 88/403 (21%), Positives = 162/403 (40%), Gaps = 63/403 (15%)

Query: 1268 KLSGNA--KVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQ-LQDGK 1324
            KL G+   +V +  N KE+ E    +M+   +  I+++   K+  ED G+Y+ + + D  
Sbjct: 3760 KLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKV--EDSGSYSCEAVNDVG 3817

Query: 1325 ATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLS-WEVTGECNVLLKCKVANI 1383
            + + ST +++                    K+ P F++ L   ++    N LL+C+V+  
Sbjct: 3818 SDSCSTEIVI--------------------KEPPSFIKTLEPADIVRGTNALLQCEVSGT 3857

Query: 1384 KKETHIVWYKDEREISVDEKHDF---KDGICTLLITEFSKKDAGIYEVILKDDRGKDKSR 1440
                 I W+KD+++I   +K+     K  +C L I  F+  D G YE ++ ++ GK    
Sbjct: 3858 GP-FEISWFKDKKQIRSSKKYRLFSQKSLVC-LEIFSFNSADVGEYECVVANEVGKCGCM 3915

Query: 1441 LKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIR 1500
               + +     + +V   IAL    + +Q+   G           E + V W      IR
Sbjct: 3916 ATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGS----------EPISVTWMKGQEVIR 3965

Query: 1501 YSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQR 1560
               ++K   +     L I +   +  GKY   L + + G Q +V            E   
Sbjct: 3966 EDGKIKMSFSNGVAVLIIPDVQISFGGKYTC-LAENEAGSQTSV-----------GELIV 4013

Query: 1561 LKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCN 1620
             + A I E+          +++ +  G    L   V G P  +  W K+ + L +     
Sbjct: 4014 KEPAKIIER---------AELIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKYR 4064

Query: 1621 LKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
            + F+    A          DSG+Y   + N+ GS + + T +V
Sbjct: 4065 ISFK-NNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTV 4106



 Score = 71.6 bits (174), Expect = 6e-12
 Identities = 116/505 (22%), Positives = 186/505 (36%), Gaps = 60/505 (11%)

Query: 1170 SWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEEL 1229
            SW KD    +DSP ++     N   +          G YSC  T+  G ASS        
Sbjct: 8089 SWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASS-------- 8140

Query: 1230 KRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPK 1289
               L L+     P   ++  LA      G+   +      +   KV++  + +EI  G K
Sbjct: 8141 SARLILTEGKNPPFFDIR--LAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGGK 8198

Query: 1290 YKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQR 1349
            Y++    N+  + +   K+   D G YT    +    +  T              A+   
Sbjct: 8199 YQISYLENSAHLTVL--KVDKGDSGQYTCYAVNEVGKDSCT--------------AQLNI 8242

Query: 1350 QEWIRKQGPHFVEYLSWEV--TGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHD-- 1405
            +E  R   P F + LS  V  T   +  L+ +VA  +  T + WYK+  EI      +  
Sbjct: 8243 KE--RLIPPSFTKRLSETVEETEGNSFKLEGRVAGSQPIT-VAWYKNNIEIQPTSNCEIT 8299

Query: 1406 FKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATD 1465
            FK+    L + +    DAG+Y   + +D G       +V        ++  KK  +    
Sbjct: 8300 FKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIV--------IKEPKKPPVFDQH 8351

Query: 1466 LKIQSTAEG--IQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTP 1523
            L   + +EG  +QL   V    E +++ W   G  I+ SDR           L++ +   
Sbjct: 8352 LTPVTVSEGEYVQLSCHVQGS-EPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAK 8410

Query: 1524 NDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGL----- 1578
             D G YV           K  +++G    ++    +     A A K +A V G L     
Sbjct: 8411 ADSGDYVC----------KASNVAGSDTTKSKVTIKDKPAVAPATK-KAAVDGRLFFVSE 8459

Query: 1579 PDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVST 1638
            P  + + E         V GDP P V W K +    +        + G  A   I   + 
Sbjct: 8460 PQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTK 8519

Query: 1639 ADSGKYGLVVKNKYGSETSDFTVSV 1663
             DSG Y  V  N++G   S+  + V
Sbjct: 8520 TDSGLYRCVAFNEHGEIESNVNLQV 8544



 Score = 71.2 bits (173), Expect = 8e-12
 Identities = 110/519 (21%), Positives = 189/519 (36%), Gaps = 92/519 (17%)

Query: 1164 TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG--IASS 1221
            TP  E  W KD     +S + ++ SK   T +   +L   D+G Y C  T+  G    S 
Sbjct: 6484 TPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSC 6543

Query: 1222 YLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAE----KLSGNAKVNY 1277
             +  +E  + +  LS         V+    VE  +   V  W++      + S N ++++
Sbjct: 6544 SVKFKEPPRFVKKLSDTSTLIGDAVELRAIVEGFQPISV-VWLKDRGEVIRESENTRISF 6602

Query: 1278 IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDV 1337
            I N                   I  + +   +  + G Y  Q+++       + VL    
Sbjct: 6603 IDN-------------------IATLQLGSPEASNSGKYICQIKNDAGMRECSAVLT--- 6640

Query: 1338 FKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDERE 1397
                      +    I K  P  V       TG     L+C V     E    W+KD RE
Sbjct: 6641 --------VLEPARIIEKPEPMTV------TTGN-PFALECVVTGTP-ELSAKWFKDGRE 6684

Query: 1398 ISVDEKHD--FKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRL------KLVDEAFK 1449
            +S D KH   F + + +L I      D G+Y   +K+  GK    +      ++V  +F 
Sbjct: 6685 LSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFI 6744

Query: 1450 ELMMEVCKKIALSAT-DLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTG 1508
              + +V   +  S   + ++  +A               + V W  +G+ I    + ++ 
Sbjct: 6745 RKLKDVNAILGASVVLECRVSGSAP--------------ISVGWFQDGNEIVSGPKCQSS 6790

Query: 1509 VTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAE 1568
             +     L ++   P+D G Y               +++G   DE  A     +  +  +
Sbjct: 6791 FSENVCTLNLSLLEPSDTGIYTCV----------AANVAGS--DECSAVLTVQEPPSFEQ 6838

Query: 1569 KNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRT 1628
                      PD V +  G +L  T  + G PP +V W K  + L   + CN+  E   T
Sbjct: 6839 T---------PDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVT 6889

Query: 1629 AYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPE 1667
                +  V   +SG Y  +V N  GS  +  T  +F+ E
Sbjct: 6890 E-LELFEVQPLESGDYSCLVTNDAGS--ASCTTHLFVKE 6925



 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 86/395 (21%), Positives = 145/395 (36%), Gaps = 50/395 (12%)

Query: 1275 VNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLV 1334
            V++   + ++   P+Y+ +   N  +  +   K+   D G YT + ++   T  S  V  
Sbjct: 6110 VSWYKGDTKLRPTPEYRTYFTNN--VATLVFNKVNINDSGEYTCKAENSIGTASSKTV-- 6165

Query: 1335 GDVFKKLQKEAEFQRQEWIRKQGPHFVEYLS-WEVTGECNVLLKCKVANIKKETHIVWYK 1393
                        F+ QE  R+  P F   L   E T    V L C++ N      + WY+
Sbjct: 6166 ------------FRIQE--RQLPPSFARQLKDIEQTVGLPVTLTCRL-NGSAPIQVCWYR 6210

Query: 1394 DEREISVDE--KHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKEL 1451
            D   +  DE  +  F D + TL I +     +G Y     +  G   S  +L     K+ 
Sbjct: 6211 DGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKS 6270

Query: 1452 MMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTG 1511
                 K +++           E       VT   + +++ WS +   IR          G
Sbjct: 6271 PFFDIKPVSIDVI------AGESADFECHVTG-AQPMRITWSKDNKEIRPGGNYTITCVG 6323

Query: 1512 EQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNR 1571
                L+I +    D G+Y           Q T D+            + +  A ++ K  
Sbjct: 6324 NTPHLRILKVGKGDSGQYTC---------QATNDVG-----------KDMCSAQLSVKEP 6363

Query: 1572 ARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYF 1631
             + +  L      ++G+++ L C + G P  +VSW +N+  L      N+ F     A  
Sbjct: 6364 PKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSF-INSVALL 6422

Query: 1632 TINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIP 1666
            TIN  S  DSG Y     N  G  +    ++V  P
Sbjct: 6423 TINEASAEDSGDYICEAHNGVGDASCSTALTVKAP 6457



 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 67/296 (22%), Positives = 117/296 (39%), Gaps = 27/296 (9%)

Query: 1378  CKVANIKKETHIVWYKDEREISVDEKHD--FKDGICTLLITEFSKKDAGIYEVILKDDRG 1435
             CK+ N  + T + WY   R++   EK++  ++DG+  L + + +K D G Y   + +D G
Sbjct: 31589 CKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYG 31648

Query: 1436  KDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHN 1495
             +D S  +L  +  +E+    C++     T  KI+   + ++L      +   L    ++ 
Sbjct: 31649 EDSSYAELFVKGVREVYDYYCRR-----TMKKIKRRTDTMRLLERPPEFTLPLYNKTAYV 31703

Query: 1496  GSAIRYSDRVKTGVTGEQIWLQINE---PTPNDKGKYVMELFDGKTGHQKTVDLSGQAYD 1552
             G  +R+   +         W +  +   P  NDK KY  E    K  +Q T++      D
Sbjct: 31704 GENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDK-KYTFE--SDKGLYQLTINSVTTDDD 31760

Query: 1553  EAYAEFQRLKQAAIAEKNRARVLGGLPDV--------------VTIQEGKALNLTCNVWG 1598
               Y    R K    + K +  V    P                   QEG+++     V G
Sbjct: 31761 AEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSG 31820

Query: 1599  DPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGS 1654
              PPP + W K+ + L+   +  +  E        I      D+G Y +   N  GS
Sbjct: 31821 IPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGS 31876



 Score = 69.7 bits (169), Expect = 2e-11
 Identities = 102/489 (20%), Positives = 180/489 (36%), Gaps = 79/489 (16%)

Query: 1165 PKSEFSWSKDYVSTEDSPRLE-VESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1223
            P  E  W K+ V  E S R+     + N  ++  +D+  +D         +  G  SS+ 
Sbjct: 2105 PDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHA 2164

Query: 1224 IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1283
                + K+L+  + E +      K  +A             + E      KV +  +  E
Sbjct: 2165 FLLVQAKQLITFTQELQDVVAKEKDTMAT-----------FECETSEPFVKVKWYKDGME 2213

Query: 1284 IFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQK 1343
            + EG KY+MH DR    + +      D ++ +    ++D      + +++ G V + +++
Sbjct: 2214 VHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVL-VEDENVKTTAKLIVEGAVVEFVKE 2272

Query: 1344 EAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVA--NIKKETHIVWYKDEREISVD 1401
              + +  E                 +GE    L+C V+  NI+ +    WY ++ E+  +
Sbjct: 2273 LQDIEVPE---------------SYSGE----LECIVSPENIEGK----WYHNDVELKSN 2309

Query: 1402 EKHDF--KDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKI 1459
             K+    + G   L + + +K+D G Y  ++  D  K   +LK+       L        
Sbjct: 2310 GKYTITSRRGRQNLTVKDVTKEDQGEYSFVI--DGKKTTCKLKMKPRPIAILQ------- 2360

Query: 1460 ALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQIN 1519
                  L  Q   EG  +   V   +E ++  W  +G  ++ SDRV   +  +   L I 
Sbjct: 2361 -----GLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIE 2415

Query: 1520 EPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLP 1579
            + T  D G Y   +          + LS       Y+                 V+  L 
Sbjct: 2416 DMTKEDAGNYSFTI--------PALGLSTSGRVSVYS---------------VDVITPLK 2452

Query: 1580 DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
            DV  I+  KA+ L C V       V W  N++ +  DD        G      IN    +
Sbjct: 2453 DVNVIEGTKAV-LECKVSVPDVTSVKWYLNDEQIKPDDRVQ-AIVKGTKQRLVINRTHAS 2510

Query: 1640 DSGKYGLVV 1648
            D G Y L+V
Sbjct: 2511 DEGPYKLIV 2519



 Score = 69.7 bits (169), Expect = 2e-11
 Identities = 121/559 (21%), Positives = 206/559 (36%), Gaps = 117/559 (20%)

Query: 1168  EFSWSKDYVSTEDSPRLEVESKGNKT-KMTFKDLGMDDLGIYSCDVTDTDGIASSYL--- 1223
             E +W KD    +++   +     + T ++   +L   D G Y C+++   G + + L   
Sbjct: 32748 EVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFM 32807

Query: 1224  -------------------IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWM 1264
                                 D++  +  +    E K P       + V  L+   V    
Sbjct: 32808 GQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDS 32867

Query: 1265  QAE---KLSGNAKVNYIFNE--KEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQ 1319
              A+   K +G  +   I+ +  K I +G KYK+  D+    +E+   K    D G YT  
Sbjct: 32868 VAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEI--HKTDTSDSGLYTCT 32925

Query: 1320  LQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCK 1379
             +++   +  S+  L      K  K+ E Q+              +S + T E   +   K
Sbjct: 32926 VKNSAGSVSSSCKLT----IKAIKDTEAQK--------------VSTQKTSE---ITPQK 32964

Query: 1380  VANIKKETHIVWYKDER----EISVDEKHDFKDGICTLLITEFSKKDAG-------IYEV 1428
              A +++E      + E     E    EK   K+    +LI+E  KK A        ++E 
Sbjct: 32965 KAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEE 33024

Query: 1429  ILKDDRGKDKSRLKLVDEAFKELMME------VCKKIALSATDLKIQSTAEGIQLYSFVT 1482
             I K  +  ++ R     +AF   M        V K     ATD+K               
Sbjct: 33025 ITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGATDVK--------------- 33069

Query: 1483  YYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKG--KYVMELFDGKTGH 1540
                      W  NG  +  S+  + GV+G    L I + +  D+G    + +  +G    
Sbjct: 33070 ---------WVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKC 33120

Query: 1541  QKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDP 1600
             Q  + LS +  D           A I++          P    I EG+ +  TC + G+P
Sbjct: 33121 QYDLTLSKELSDAP---------AFISQ----------PRSQNINEGQNVLFTCEISGEP 33161

Query: 1601  PPEVSWLKNEKALASDDHCNLKFEAGRTAY-FTINGVSTADSGKYGLVVKNKYGSETSDF 1659
              PE+ W KN   ++     N+     R  Y   I   S +DSGKY +  KN  G  ++  
Sbjct: 33162 SPEIEWFKNNLPISISS--NVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATA 33219

Query: 1660  TVSVF-IPEEEARMAALES 1677
             ++ V  + EE +R   L +
Sbjct: 33220 SLMVLPLVEEPSREVVLRT 33238



 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 91/360 (25%), Positives = 148/360 (41%), Gaps = 39/360 (10%)

Query: 175  EEGITTSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEE 234
            E  I  S  +T  K+ +A+  S+A K + + K  T     T  R               +
Sbjct: 831  EASIAGSAIATLQKELSAT--SSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPD 888

Query: 235  TSEKKSRKVVIREKAERLSLRKTLEET-ETYH---AKLNEDHLLHAP-EFIIKP------ 283
            T + ++   V +E    ++     EE  E  H   AK+ E   + AP E  + P      
Sbjct: 889  TYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSG 948

Query: 284  -RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGC 342
             ++ TV E E+V L C I+G+P P VTWY+    I    +   + I  + G+  L I   
Sbjct: 949  LKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSID---FQITFQSGIARLMIREA 1005

Query: 343  DFEDTAQYRASAMNVKGEL--SAYASVVVKR----------YKGEFDETRFHAGASTMPL 390
              ED+ ++  SA+N  G +  S Y +V V             K   +E RF      +  
Sbjct: 1006 FAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMT 1065

Query: 391  SFGVT--PYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGV 448
               +T    G       +F  K  V    EG ++  GC+V   P     +P + W ++GV
Sbjct: 1066 DTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNP-----KPHVYWKKSGV 1120

Query: 449  PLSPSKWVQTLWSGE--RATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEI 506
            PL+     +  ++ +     L  S    +D G YTI VR  ++ E  ++   + +AD E+
Sbjct: 1121 PLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVR-NKHGETSASASLLEEADYEL 1179



 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 63/303 (20%), Positives = 130/303 (42%), Gaps = 23/303 (7%)

Query: 1039  PGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNV 1098
             P  P +L   EV+KDS+ L W+PP+  G   +T Y V+ +E   K   +  +     K  
Sbjct: 25199 PSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRK--AYATITNNCTKTT 25256

Query: 1099  YLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVD-DDGVISLN 1157
             + ++  L+EG SY FRV A N+ G+G P++   PV     P     V  VD      ++ 
Sbjct: 25257 F-RIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIK 25315

Query: 1158  FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
             +E  +    S+ +     + T+ S +    ++    + T   L   +  ++     +  G
Sbjct: 25316 WEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATISGLTAGEEYVFRVAAVNEKG 25375

Query: 1218  IASSYLIDEEELKRLLALSHEHKFP----TVPVKSELAVEILEKGQVRFWMQAEKLSGNA 1273
              +    +    + R + +    + P     V  + +L +++  KG+ +           A
Sbjct: 25376 RSDPRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKIDVPFKGRPQ-----------A 25424

Query: 1274  KVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQD--GKATNHSTV 1331
              VN+  + + + E    ++++  +  +  + +++   ED GTY   + +  G  T   T+
Sbjct: 25425 TVNWRKDGQTLKE--TTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITI 25482

Query: 1332  VLV 1334
             +++
Sbjct: 25483 IVL 25485



 Score = 67.4 bits (163), Expect = 1e-10
 Identities = 62/233 (26%), Positives = 93/233 (39%), Gaps = 35/233 (15%)

Query: 251   RLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTW 310
             R +++K    T+T         L   PEF +   + T +  ENV+   +I   PEP VTW
Sbjct: 31670 RRTMKKIKRRTDTMRL------LERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTW 31723

Query: 311   YKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
             YK+   I    N  KY  ES  G++ L IN    +D A+Y   A N  GE S  A + V 
Sbjct: 31724 YKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVT 31783

Query: 371   RYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVI 430
              +    D T         P+                F      +  +EG+++    RV  
Sbjct: 31784 LHPPPTDST-------LRPM----------------FKRLLANAECQEGQSVCFEIRVSG 31820

Query: 431   TPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSG-ERATLTFSHLNKEDEGLYTI 482
              P      P ++W ++G PLS    ++ +  G +   L       ED G Y +
Sbjct: 31821 IP-----PPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRV 31868



 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 110/549 (20%), Positives = 203/549 (36%), Gaps = 91/549 (16%)

Query: 1132  PVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGN 1191
             P V  T+P   + V    ++G  ++  EC+     ++  W K+      S + E+ + G 
Sbjct: 12283 PPVEFTKPLEDQTV----EEGATAV-LECEVSRENAKVKWFKNGTEILKSKKYEIVADGR 12337

Query: 1192  KTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELA 1251
               K+   D   +D+  Y+CD  D     +  ++                 P V     L 
Sbjct: 12338 VRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVP----------------PHVEFLRPLT 12381

Query: 1252  -VEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQD 1310
              +++ EK   RF  + E    NAKV +  +  EI +G KY   I     +  + + K   
Sbjct: 12382 DLQVREKEMARF--ECELSRENAKVKWFKDGAEIKKGKKY--DIISKGAVRILVINKCLL 12437

Query: 1311  EDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTG 1370
             +DE  Y+ +++  + +   TV         L++EA F +               + EV+ 
Sbjct: 12438 DDEAEYSCEVRTARTSGMLTV---------LEEEAVFTK------------NLANIEVSE 12476

Query: 1371  ECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVIL 1430
                + L C+V+  K    ++WYK + EI    +++        ++TE  K+   I    L
Sbjct: 12477 TDTIKLVCEVS--KPGAEVIWYKGDEEIIETGRYE--------ILTEGRKRILVIQNAHL 12526

Query: 1431  KDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKV 1490
              +D G    RL       K  + E+  +      +L+I    EG +     +   E   V
Sbjct: 12527 -EDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEI---LEGEKAEFVCSISKESFPV 12582

Query: 1491  NWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQA 1550
              W  +   +   D+      G++  L + + T  D G YV+ +   +     TV      
Sbjct: 12583 QWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTV------ 12636

Query: 1551  YDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNE 1610
                                 + R++  L D   ++E + +   C V      +  W +NE
Sbjct: 12637 ------------------IEKLRIVVPLKD-TRVKEQQEVVFNCEV-NTEGAKAKWFRNE 12676

Query: 1611  KALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEA 1670
             +A+  D    +  +        I      D   Y + + N  G E      ++ + EE+ 
Sbjct: 12677 EAI-FDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRG-ENVKSAANLIVEEEDL 12734

Query: 1671  RMAALESLK 1679
             R+  +E LK
Sbjct: 12735 RI--VEPLK 12741



 Score = 65.9 bits (159), Expect = 3e-10
 Identities = 121/586 (20%), Positives = 216/586 (36%), Gaps = 86/586 (14%)

Query: 1092 EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDD 1151
            E  I  + + +  LK+  +YV    A N+AG    S  +  V     P     V  VD  
Sbjct: 3695 EDKIATLEIPLAKLKDSGTYV--CTASNEAG---SSSCSATVTVREPPS---FVKKVDPS 3746

Query: 1152 GVI----SLNFECD-KMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLG 1206
             ++    S    C  K +P  + +W K+     +S  + +    ++  +   D+ ++D G
Sbjct: 3747 YLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSG 3806

Query: 1207 IYSCDVTD---TDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFW 1263
             YSC+  +   +D  ++  +I E               P   +K+    +I+ +G     
Sbjct: 3807 SYSCEAVNDVGSDSCSTEIVIKE---------------PPSFIKTLEPADIV-RGTNALL 3850

Query: 1264 MQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDG 1323
                  +G  ++++  ++K+I    KY++   ++   +E+F     D  E       + G
Sbjct: 3851 QCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVG 3910

Query: 1324 KATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVT-GECNVLLKCKVAN 1382
            K    +T +L                     K+ P FV+ +   +  G   V L+  V  
Sbjct: 3911 KCGCMATHLL---------------------KEPPTFVKKVDDLIALGGQTVTLQAAVRG 3949

Query: 1383 IKKETHIVWYKDEREISVDE--KHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSR 1440
              +   + W K +  I  D   K  F +G+  L+I +      G Y  + +++ G   S 
Sbjct: 3950 -SEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTS- 4007

Query: 1441 LKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIR 1500
                     EL+++   KI   A    IQ TA       +      +LK  W  +G  + 
Sbjct: 4008 -------VGELIVKEPAKIIERAE--LIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLV 4058

Query: 1501 YSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQR 1560
             S + +         L+      +D G+Y  E+   + G   + + +    D   A F  
Sbjct: 4059 ASKKYRISFKNNVAQLKFYSAELHDSGQYTFEI-SNEVG-SSSCETTFTVLDRDIAPF-- 4114

Query: 1561 LKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCN 1620
                             L +V ++  G    L C + G  P  VSW K+ K +A+ D   
Sbjct: 4115 -------------FTKPLRNVDSVVNG-TCRLDCKIAGSLPMRVSWFKDGKEIAASDRYR 4160

Query: 1621 LKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIP 1666
            + F  G TA   I  V   D+G +     N  GS+ S   + V  P
Sbjct: 4161 IAFVEG-TASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEP 4205



 Score = 65.5 bits (158), Expect = 4e-10
 Identities = 62/235 (26%), Positives = 100/235 (42%), Gaps = 13/235 (5%)

Query: 142   SGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITTSKQSTASKQTTASKQSTASKQ 201
             S RQ+ V+ IT+ EEE   E + + AQR   +S   +   ++S +       +  +   +
Sbjct: 32235 SRRQREVTEITEIEEEY--EISKH-AQRESSSSASRLLRRRRSLSPTYIELMRPVSELIR 32291

Query: 202   STAS-----KQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKVVIREKAERLSLRK 256
             S        +  T  R  T  R    S    S+ +     E+ +R  +        +  K
Sbjct: 32292 SRPQPAEEYEDDTERRSPTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALK 32351

Query: 257   TLEETETYHAKLNEDH--LLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQ 314
             T + +E  +  L++    L HAP   ++ RSH V   +N +   ++   P   V WY N 
Sbjct: 32352 TQKTSERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNG 32411

Query: 315   VPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVV 369
             V +       K    +  G+ TLEI  C  +D+  YRA   N KGE S YA++ V
Sbjct: 32412 VELQ---ESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDV 32463



 Score = 64.7 bits (156), Expect = 7e-10
 Identities = 81/390 (20%), Positives = 142/390 (36%), Gaps = 58/390 (14%)

Query: 1282 KEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKL 1341
            KE+    KYK+        +++    +   D G Y+F++Q+    +  T  L        
Sbjct: 7624 KELTSDNKYKISFFNKVSGLKII--NVAPSDSGVYSFEVQNPVGKDSCTASL-------- 7673

Query: 1342 QKEAEFQRQEWIRKQGPHFVEYLSWEVTG--ECNVLLKCKVANIKKETHIVWYKDEREIS 1399
                    Q   R   P F   L  E  G    +V+++CKV        + W+ +  EIS
Sbjct: 7674 --------QVSDRTVPPSFTRKLK-ETNGLSGSSVVMECKVYG-SPPISVSWFHEGNEIS 7723

Query: 1400 VDEKHD--FKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCK 1457
               K+     D  C L +    + D+G Y  I  +  G D+    L        + +   
Sbjct: 7724 SGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPDP 7783

Query: 1458 KIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQ 1517
               L+ T++   S  +G   +S          V+W    S +   DR    +      L+
Sbjct: 7784 MDVLTGTNVTFTSIVKGTPPFS----------VSWFKGSSELVPGDRCNVSLEDSVAELE 7833

Query: 1518 INEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEF-QRLKQAAIAEKNRARVLG 1576
            + +   +  G+Y   + +       T  L    Y +A A+F +RL               
Sbjct: 7834 LFDVDTSQSGEYTCIVSNEAGKASCTTHL----YIKAPAKFVKRLND------------- 7876

Query: 1577 GLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGV 1636
                  +I++GK L L     G PP  V+W KN   +     CN+     ++A   I   
Sbjct: 7877 -----YSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNIT-TTEKSAILEIPSS 7930

Query: 1637 STADSGKYGLVVKNKYGSETSDFTVSVFIP 1666
            +  D+G+Y   ++N  G ++    + +  P
Sbjct: 7931 TVEDAGQYNCYIENASGKDSCSAQILILEP 7960



 Score = 64.3 bits (155), Expect = 9e-10
 Identities = 79/374 (21%), Positives = 143/374 (38%), Gaps = 61/374 (16%)

Query: 1289 KYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQD--GKATNHSTVVLVGDVFKKLQKEAE 1346
            KY++    N   ++ +  +L D   G YTF++ +  G ++  +T  ++            
Sbjct: 4062 KYRISFKNNVAQLKFYSAELHDS--GQYTFEISNEVGSSSCETTFTVLD----------- 4108

Query: 1347 FQRQEWIRKQGPHFVEYL---SWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEK 1403
                   R   P F + L      V G C   L CK+A       + W+KD +EI+  ++
Sbjct: 4109 -------RDIAPFFTKPLRNVDSVVNGTCR--LDCKIAG-SLPMRVSWFKDGKEIAASDR 4158

Query: 1404 HD--FKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIAL 1461
            +   F +G  +L I      DAG +     +  G   S   L+ +     + +   K  L
Sbjct: 4159 YRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPGSKDVL 4218

Query: 1462 SATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEP 1521
              + + ++ST +G             L + W      +         V+G   ++   E 
Sbjct: 4219 PGSAVCLKSTFQGST----------PLTIRWFKGNKEL---------VSGGSCYIT-KEA 4258

Query: 1522 TPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDV 1581
              +    Y+++  D  T   K  +++G    E  A     + A   EK     L      
Sbjct: 4259 LESSLELYLVKTSDSGTYTCKVSNVAGGV--ECSANLFVKEPATFVEKLEPSQL------ 4310

Query: 1582 VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADS 1641
              +++G A  L C V G PP +++W  N++ +       + F    TA   +  V   DS
Sbjct: 4311 --LKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSF-VESTAVLRLTDVGIEDS 4367

Query: 1642 GKYGLVVKNKYGSE 1655
            G+Y    +N+ GS+
Sbjct: 4368 GEYMCEAQNEAGSD 4381



 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 114/567 (20%), Positives = 201/567 (35%), Gaps = 78/567 (13%)

Query: 1110 SYVFRVRAINQAGVGKPSDLAGPVVAETR--PGTKEVVVNVDDDGVISLNFECDKMTPKS 1167
            +Y F+V    Q  VGK S  A   V++    P     + N       S   EC K+   S
Sbjct: 5773 TYTFQV----QNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILEC-KVAGSS 5827

Query: 1168 EFS--WSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLID 1225
              S  W  +        + +     N   +    L   D+G Y+C   +  G        
Sbjct: 5828 PISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAG-------- 5879

Query: 1226 EEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNA--KVNYIFNEKE 1283
             +E + +L +     F    VK    +E+L    V F      + G    KVN+    +E
Sbjct: 5880 SDECRAVLTVQEPPSF----VKEPEPLEVLPGKNVTF---TSVIRGTPPFKVNWFRGARE 5932

Query: 1284 IFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQK 1343
            + +G +  ++ +     +E+F   +     G YT  + +       T  L       +++
Sbjct: 5933 LVKGDRCNIYFEDTVAELELF--NIDISQSGEYTCVVSNNAGQASCTTRLF------VKE 5984

Query: 1344 EAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEK 1403
             A F     +++   H VE       G+  +L       +     + W KD   I+  EK
Sbjct: 5985 PAAF-----LKRLSDHSVE------PGKSIILESTYTGTL--PISVTWKKDGFNITTSEK 6031

Query: 1404 HDF--KDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIAL 1461
             +    +  C L I   +K+DAG Y   ++++ G+D     +        + E+    A 
Sbjct: 6032 CNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAA 6091

Query: 1462 SATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEP 1521
                + +Q    G            ++ V+W    + +R +   +T  T     L  N+ 
Sbjct: 6092 VGDSVSLQCQVAG----------TPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKV 6141

Query: 1522 TPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDV 1581
              ND G+Y            K  +  G A  +     Q  +       + AR L  +   
Sbjct: 6142 NINDSGEYTC----------KAENSIGTASSKTVFRIQERQ----LPPSFARQLKDIEQT 6187

Query: 1582 VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADS 1641
            V    G  + LTC + G  P +V W ++   L  D++    F     A   I     + S
Sbjct: 6188 V----GLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSF-VDNVATLKILQTDLSHS 6242

Query: 1642 GKYGLVVKNKYGSETSDFTVSVFIPEE 1668
            G+Y     N  G+ +S   ++   P++
Sbjct: 6243 GQYSCSASNPLGTASSSARLTAREPKK 6269



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 105/531 (19%), Positives = 200/531 (37%), Gaps = 98/531 (18%)

Query: 1147 NVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLG 1206
            N++     + +FEC+         W K+ V  E S + ++  +G   ++   +   +D  
Sbjct: 2890 NIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSA 2949

Query: 1207 IYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQA 1266
             Y+  V   D ++++  +    +  +L   +  +  T+  +    V +  +G    W++ 
Sbjct: 2950 EYTF-VCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFE----VTVNYEGISYKWLK- 3003

Query: 1267 EKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKAT 1326
                         N  EI    K +M   + T  + +    +   D   YTF    GKAT
Sbjct: 3004 -------------NGVEIKSTDKCQMRTKKLTHSLNI--RNVHFGDAADYTFVA--GKAT 3046

Query: 1327 NHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKE 1386
            + +T+ +         +  EF++         H  +    +V  +   + +C+V+  + +
Sbjct: 3047 STATLYVEA-------RHIEFRK---------HIKDI---KVLEKKRAMFECEVS--EPD 3085

Query: 1387 THIVWYKDEREISVDEKHDFKDG--ICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLV 1444
              + W KD++E+ + ++   +    +  LLI      DAG Y V+     G + S  KL 
Sbjct: 3086 ITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVA----GGNVSTAKLF 3141

Query: 1445 DEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVE------DLKVNWSHNGSA 1498
             E                  D++I+S  + +Q+       VE      D+  +W  +G  
Sbjct: 3142 VEG----------------RDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIE 3185

Query: 1499 IRYS--DRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYA 1556
            I +   +R K  V      + I+E   +D G+Y      G+     T+ ++     +   
Sbjct: 3186 INFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA--GRNRSSVTLYVNAPEPPQVLQ 3243

Query: 1557 EFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASD 1616
            E Q                      VT+Q GK       + G P P++SW K E+ L++ 
Sbjct: 3244 ELQP---------------------VTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTG 3282

Query: 1617 DHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPE 1667
              C    +        I      D+  Y    KN YG  T+  ++SV +PE
Sbjct: 3283 FKCKFLHDGQEYTLLLIEAF-PEDAAVYTCEAKNDYGVATTSASLSVEVPE 3332



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 46/149 (30%), Positives = 67/149 (44%), Gaps = 9/149 (6%)

Query: 637   VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSP 695
             VP PP  + V++ +R  V L+W  P   G   I  Y VEKC    E W RV      +  
Sbjct: 31121 VPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQ---ARET 31177

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVV-GDKLDIPKAPGKIIPSRNTDTS 754
             R+ + +L    SY FRV   N  G+ +PSE +E T+   DK        ++  +R     
Sbjct: 31178 RYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDETR----E 31233

Query: 755   VVVSWEESKDAKELVGYYIEASVAGSGKW 783
             V ++       KEL   Y+ A   G G++
Sbjct: 31234 VSMTKASHSSTKELYEKYMIAEDLGRGEF 31262



 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 101/468 (21%), Positives = 186/468 (39%), Gaps = 77/468 (16%)

Query: 1073  YFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGP 1132
             +F D  E K K  ++  +++ A++ + +    L +   Y   VR    +G+         
Sbjct: 12406 WFKDGAEIK-KGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLT------- 12457

Query: 1133  VVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNK 1192
             V+ E    TK +  N++     ++   C+   P +E  W K      ++ R E+ ++G K
Sbjct: 12458 VLEEEAVFTKNLA-NIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRK 12516

Query: 1193  TKMTFKDLGMDDLGIYSCDVTD--TDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSEL 1250
               +  ++  ++D G Y+C +    TDG    + +  E + +   L               
Sbjct: 12517 RILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNL--------------- 12561

Query: 1251  AVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQD 1310
               EILE  +  F     K S    V +  ++K +  G KY +  D    ++ +    LQD
Sbjct: 12562 --EILEGEKAEFVCSISKES--FPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQD 12617

Query: 1311  EDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTG 1370
                GTY   +   +A  H TV+    +   L+     ++QE                   
Sbjct: 12618 M--GTYVVMVGAARAAAHLTVIEKLRIVVPLKDTRVKEQQE------------------- 12656

Query: 1371  ECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDF--KDGICTLLITEFSKKDAGIYEV 1428
                V+  C+V    +     W+++E  I    K+    KD + TL I +    D   Y V
Sbjct: 12657 ---VVFNCEVNT--EGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNV 12711

Query: 1429  ILKDDRGKD-KSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVED 1487
              L + RG++ KS   L+ E     ++E  K I             E ++  S VT++ + 
Sbjct: 12712 SLTNHRGENVKSAANLIVEEEDLRIVEPLKDI-------------ETMEKKS-VTFWCKV 12757

Query: 1488  LKVN----WSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVM 1531
              ++N    W+ NG  + + +RV   V   +  L I +    D+G+Y++
Sbjct: 12758 NRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIV 12805



 Score = 60.8 bits (146), Expect = 1e-08
 Identities = 47/165 (28%), Positives = 74/165 (44%), Gaps = 14/165 (8%)

Query: 1038  VPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKN 1097
             VP PP  +K S+V +DS+ L W  P   G + +T Y V+  +     ++W  + +A  + 
Sbjct: 31121 VPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVE--KCATTAERWLRVGQA--RE 31176

Query: 1098  VYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLN 1157
                 V  L    SY FRV A N+ G+ KPS+ + P + +     K   +N D++   +  
Sbjct: 31177 TRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKE---DKTRAMNYDEEVDETRE 31233

Query: 1158  FECDKMTPKSEFSWSKDYVSTEDSPRLE-------VESKGNKTKM 1195
                 K +  S     + Y+  ED  R E       VE+   KT M
Sbjct: 31234 VSMTKASHSSTKELYEKYMIAEDLGRGEFGIVHRCVETSSKKTYM 31278



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 102/499 (20%), Positives = 176/499 (35%), Gaps = 65/499 (13%)

Query: 1171 WSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELK 1230
            W +D V   D   L+     N   +      +   G YSC  ++  G ASS         
Sbjct: 6208 WYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASS--------S 6259

Query: 1231 RLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKY 1290
              L      K P   +K  ++++++      F       +   ++ +  + KEI  G  Y
Sbjct: 6260 ARLTAREPKKSPFFDIK-PVSIDVIAGESADFECHVTG-AQPMRITWSKDNKEIRPGGNY 6317

Query: 1291 KMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQ 1350
             +    NT  + +   K+   D G YT Q  +    +  +  L      K  K+ E  + 
Sbjct: 6318 TITCVGNTPHLRIL--KVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASK- 6374

Query: 1351 EWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHD--FKD 1408
              + KQG               ++ L+CK++    E  + W++++ E+    K++  F +
Sbjct: 6375 --VAKQGE--------------SIQLECKISG-SPEIKVSWFRNDSELHESWKYNMSFIN 6417

Query: 1409 GICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKI 1468
             +  L I E S +D+G Y     +  G       L  +A      +     AL  +D+ +
Sbjct: 6418 SVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGALKGSDVIL 6477

Query: 1469 QSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGK 1528
            Q    G   +  V          W  +   +R S + K         L I     +D G+
Sbjct: 6478 QCEISGTPPFEVV----------WVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGE 6527

Query: 1529 YVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGK 1588
            Y          H K  +  G        +F          K   R +  L D  T+  G 
Sbjct: 6528 Y----------HCKATNEVGSDTCSCSVKF----------KEPPRFVKKLSDTSTL-IGD 6566

Query: 1589 ALNLTCNVWGDPPPEVSWLKNE-KALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLV 1647
            A+ L   V G  P  V WLK+  + +   ++  + F     A   +     ++SGKY   
Sbjct: 6567 AVELRAIVEGFQPISVVWLKDRGEVIRESENTRISF-IDNIATLQLGSPEASNSGKYICQ 6625

Query: 1648 VKNKYGSETSDFTVSVFIP 1666
            +KN  G       ++V  P
Sbjct: 6626 IKNDAGMRECSAVLTVLEP 6644



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 36/116 (31%), Positives = 59/116 (50%), Gaps = 7/116 (6%)

Query: 1036  IAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKE--DQWRGLNEA 1093
             I +PGP   +K S++ K S  L W+PP   G TP+  Y ++ +EA  +       G N+ 
Sbjct: 14477 IGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKL 14536

Query: 1094  AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVD 1149
             +       V+ L     Y FRV+A+N+ G G+  +L  PV+A+      +  V+V+
Sbjct: 14537 S-----WTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVE 14587



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 63/288 (21%), Positives = 114/288 (39%), Gaps = 96/288 (33%)

Query: 1489  KVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKY--VMELFDGKTGHQKTVDL 1546
             +V W HNG  ++ S ++    T   + L+I +   +D G Y  V   + G+     T+D+
Sbjct: 32404 EVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDV 32463

Query: 1547  SGQAYD----------------------EAYA--EFQR---------------------- 1560
             +G  Y                       EAYA   F++                      
Sbjct: 32464 TGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRE 32523

Query: 1561  ------------LKQAAIAEKN--------------RARVLGGLPDVVTIQEGKALNLTC 1594
                         +K AA+ EK+               AR+L   P  +T+ EG++   +C
Sbjct: 32524 SLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTK-PRSMTVYEGESARFSC 32582

Query: 1595  NVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAY---FTINGVSTADSGKYGLVVKNK 1651
             +  G+P P V+WL+  + L++    + + +   T Y   F I+ V  +D G Y +VV+N 
Sbjct: 32583 DTDGEPVPTVTWLRKGQVLST----SARHQVTTTKYKSTFEISSVQASDEGNYSVVVENS 32638

Query: 1652  YGSETSDFTVSV--------------FIPEEEARMAALESLKGGKKAK 1685
              G + ++FT+++               +   E R+ + E++K  K+ K
Sbjct: 32639 EGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVK 32686



 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 102/522 (19%), Positives = 181/522 (34%), Gaps = 66/522 (12%)

Query: 1164 TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG--IASS 1221
            TP    SW KD      S R  +      T +   +  ++D   YSC + +  G  I  +
Sbjct: 6953 TPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEA 7012

Query: 1222 YLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNE 1281
             +   E    +  L H       P   +  V+   + ++ ++ +  KL            
Sbjct: 7013 LVSVLEPPYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLR----------- 7061

Query: 1282 KEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKL 1341
                  P YKM    N  +  + + K+   D G Y+ +  +      S+ VL   V K  
Sbjct: 7062 ----SAPAYKMQFKNN--VASLVINKVDHSDVGEYSCKADNSVGAVASSAVL---VIKAR 7112

Query: 1342 QKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVD 1401
            +    F R    + +  H  E L + V  EC +       N  +   + WYKD   +  D
Sbjct: 7113 KLPPFFAR----KLKDVH--ETLGFPVAFECRI-------NGSEPLQVSWYKDGVLLKDD 7159

Query: 1402 E--KHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKI 1459
               +  F   + TL I +  +   G Y     +  G   S  KL+    +       K +
Sbjct: 7160 ANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPV 7219

Query: 1460 ALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQIN 1519
            ++   DL +  +      +         +K+ W+ +   IR     K  +      L + 
Sbjct: 7220 SV---DLALGESG----TFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVL 7272

Query: 1520 EPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLP 1579
            +    D G+Y             T   S  A  ++ +       A +  +   R +  L 
Sbjct: 7273 KVGKGDAGQY-------------TCYASNIAGKDSCS-------AQLGVQEPPRFIKKLE 7312

Query: 1580 DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
                +++ +     C + G P  +V W K+E  +       + F     A   ++ +S  
Sbjct: 7313 PSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSF-VDSVAVLEMHNLSVE 7371

Query: 1640 DSGKYGLVVKNKYGSETSDFTVSVFIPE-EEARMAALESLKG 1680
            DSG Y     N  GS +S  ++ V  P     +   +E+LKG
Sbjct: 7372 DSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKG 7413



 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 103/508 (20%), Positives = 188/508 (37%), Gaps = 43/508 (8%)

Query: 1165 PKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLI 1224
            P+ + SW K+        + +    G +  +   +   +D  +Y+C+  +  G+A++   
Sbjct: 3266 PQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSAS 3325

Query: 1225 DEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQ-VRFWMQAEKLSGNAKVNYIFNEKE 1283
               E+  +++   E       + + L   +  +GQ  RF  Q      + KV++   +K+
Sbjct: 3326 LSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARF--QCRVSGTDLKVSWYSKDKK 3383

Query: 1284 IFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQK 1343
            I     ++M    +T  +E+   +   EDEGTYTF   +      ST  L  +  + +  
Sbjct: 3384 IKPSRFFRMTQFEDTYQLEI--AEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILH 3441

Query: 1344 EAEFQRQEWIRKQGPHFVEYLS-WEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDE 1402
            E   Q  E   K  P     +   EV         C++ +        W+K  REI   +
Sbjct: 3442 ERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQS-APNVRFQWFKAGREIYESD 3500

Query: 1403 KHDFKDG--ICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKL-VDEAFKELMMEVCKKI 1459
            K   +    I +L I      D G Y     ++ G       L V EA+    +   K +
Sbjct: 3501 KCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSL 3560

Query: 1460 -ALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQI 1518
                    K   T  G  +          ++  W  +G+A+  S   +      +  L++
Sbjct: 3561 TTFVGKAAKFICTVTGTPV----------IETIWQKDGAALSPSPNWRISDAENKHILEL 3610

Query: 1519 NEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGL 1578
            +  T  D+G Y                 S +A ++  A+  + +   I + +  + L  +
Sbjct: 3611 SNLTIQDRGVY-----------------SCKASNKFGADICQAELIIIDKPHFIKELEPV 3653

Query: 1579 PDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVST 1638
               +     K ++L C V  D    V+W K+ + L       + FE  + A   I     
Sbjct: 3654 QSAI----NKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFE-DKIATLEIPLAKL 3708

Query: 1639 ADSGKYGLVVKNKYGSETSDFTVSVFIP 1666
             DSG Y     N+ GS +   TV+V  P
Sbjct: 3709 KDSGTYVCTASNEAGSSSCSATVTVREP 3736



 Score = 58.5 bits (140), Expect = 5e-08
 Identities = 93/508 (18%), Positives = 193/508 (37%), Gaps = 82/508 (16%)

Query: 1170 SWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEEL 1229
            +W KD     +   + +  + N   +    + +   G Y C   +  GI        +  
Sbjct: 4518 TWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGI--------QRC 4569

Query: 1230 KRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVN--YIFNEKEIFEG 1287
              LL++    K P    +  +++++ +       +   K SG  ++   +  + +E+  G
Sbjct: 4570 SALLSV----KEPATITEEAVSIDVTQGDPATLQV---KFSGTKEITAKWFKDGQELTLG 4622

Query: 1288 PKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDG------KATNHSTVVLVGDVFKKL 1341
             KYK+ +     I+++     + +D G YTF++Q+       KA  +   +++   F K 
Sbjct: 4623 SKYKISVTDTVSILKII--STEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKK 4680

Query: 1342 QKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVD 1401
             K+ +  +  +I                      L+C VA       I W+KD++EIS  
Sbjct: 4681 LKKMDSIKGSFID---------------------LECIVAG-SHPISIQWFKDDQEISAS 4718

Query: 1402 EKHDFK--DGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKI 1459
            EK+ F   D    L I++    D+G Y     +  G ++    L  +     + +   + 
Sbjct: 4719 EKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQD 4778

Query: 1460 ALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIR-YSDRVKTGVTGEQIWLQI 1518
                T +++++   G    + + ++ ++ ++   H+G+A   + D   T        L++
Sbjct: 4779 VNPNTRVQLKALVGGTAPMT-IKWFKDNKEL---HSGAARSVWKDDTSTS-------LEL 4827

Query: 1519 NEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGL 1578
                  D G Y+ +L +            G A            +A +  K   + +   
Sbjct: 4828 FAAKATDSGTYICQLSNDV----------GTA----------TSKATLFVKEPPQFIKKP 4867

Query: 1579 PDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVST 1638
              V+ ++ G++    C + G P   VSW  +   + +     + F  G  A F I+G   
Sbjct: 4868 SPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDG-LATFQISGARV 4926

Query: 1639 ADSGKYGLVVKNKYGSETSDFTVSVFIP 1666
             +SG Y    +N  G+ +    + V  P
Sbjct: 4927 ENSGTYVCEARNDAGTASCSIELKVKEP 4954



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 57/235 (24%), Positives = 100/235 (42%), Gaps = 27/235 (11%)

Query: 1466  LKIQSTAEGIQLYSFVTYYVEDLK-VNWSHNGSAIRYSDRVKTGVTGEQIW-LQINEPTP 1523
             LK +++ E  +L   V   V   K V W  +G  ++ +   +   + +  + L+IN  T 
Sbjct: 32724 LKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTE 32783

Query: 1524  NDKGKYVMELFDGKTGHQKT-VDLSGQAY----------DEAYAEFQRLKQAAIAEKNRA 1572
             +D+G+YV E+  G+ G  KT +   GQA+           E     Q+  ++ +  K   
Sbjct: 32784 SDQGEYVCEI-SGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEP 32842

Query: 1573  R----------VLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLK 1622
             +          ++ GL D  T+             G+P P   W K+ KA+       L 
Sbjct: 32843 KAPEPISSKPVIVTGLQD-TTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLS 32901

Query: 1623  FEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV-FIPEEEARMAALE 1676
              + G   +  I+   T+DSG Y   VKN  GS +S   +++  I + EA+  + +
Sbjct: 32902 EDKG-GFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQ 32955



 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 96/519 (18%), Positives = 188/519 (36%), Gaps = 75/519 (14%)

Query: 1155 SLNFECDKMTPKSEFS--WSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDV 1212
            S++ EC K++     S  W KD      S +  +        +   +L ++D   Y+C V
Sbjct: 5253 SIHMEC-KVSGSLPISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKV 5311

Query: 1213 TDT--DGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLS 1270
            ++   D   S  L  +E    L+    +   P     S +  + + KG   F        
Sbjct: 5312 SNVAGDDACSGILTVKEPPSFLVKPGRQQAIP----DSTVEFKAILKGTPPF-------- 5359

Query: 1271 GNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHST 1330
               K+ +  ++ E+  GPK  + ++ +T  + ++   +     G YT  + +   ++  T
Sbjct: 5360 ---KIKWFKDDVELVSGPKCFIGLEGSTSFLNLY--SVDASKTGQYTCHVTNDVGSDSCT 5414

Query: 1331 VVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIV 1390
             +L+     K  K+ E  +   I K G               +  L+CK+A    E  +V
Sbjct: 5415 TMLLVTEPPKFVKKLEASK---IVKAGD--------------SSRLECKIAG-SPEIRVV 5456

Query: 1391 WYKDEREISVDEKH--DFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAF 1448
            W+++E E+   +K+   F D +  + +   S +D+G +    ++  G      K++ +  
Sbjct: 5457 WFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEP 5516

Query: 1449 KELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTG 1508
                        L   ++ ++    G   +  V          W  +   +R S + K  
Sbjct: 5517 PVFSSFPPIVETLKNAEVSLECELSGTPPFEVV----------WYKDKRQLRSSKKYKIA 5566

Query: 1509 VTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAE 1568
                   + I     +D G+Y  +    + G    V                     +  
Sbjct: 5567 SKNFHTSIHILNVDTSDIGEYHCKA-QNEVGSDTCV-------------------CTVKL 5606

Query: 1569 KNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLK-NEKALASDDHCNLKFEAGR 1627
            K   R +  L + +T+  G+   L  ++ G  P  V WLK  E+ +   ++  + F    
Sbjct: 5607 KEPPRFVSKL-NSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITF-VEN 5664

Query: 1628 TAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIP 1666
             A         A++GKY   +KN  G   +  T+ V  P
Sbjct: 5665 VATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEP 5703



 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 52/212 (24%), Positives = 80/212 (37%), Gaps = 43/212 (20%)

Query: 273  LLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRY 332
            +L  P F+ +     V   ++  L C +AG PE  V+WYK    +        Y +  R 
Sbjct: 7957 ILEPPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTT---YKMHFRN 8013

Query: 333  GMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF 392
             + TL  N  D  D+ +Y   A N  GE+SA   + V+                      
Sbjct: 8014 NVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQ---------------------- 8051

Query: 393  GVTPYGYASRFEIHFDDKFDVSFGREGETM--SLGCRVVITPEIKHFQP-EIQWYRNGVP 449
                           + K   SF R+   +  ++G  VV    I   +P  + WY++G P
Sbjct: 8052 ---------------EQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKP 8096

Query: 450  LSPSKWVQTLWSGERATLTFSHLNKEDEGLYT 481
            L  S  VQT +    ATL     ++   G Y+
Sbjct: 8097 LKDSPNVQTSFLDNTATLNIFKTDRSLAGQYS 8128



 Score = 55.8 bits (133), Expect = 3e-07
 Identities = 75/381 (19%), Positives = 137/381 (35%), Gaps = 56/381 (14%)

Query: 1291 KMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTV-VLVGDVFKKLQKEAEFQR 1349
            K HI     +  + +   +  D+G Y+F++++    ++ TV V V D             
Sbjct: 6690 KHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSD------------- 6736

Query: 1350 QEWIRKQGPHFVEYLSWEVTG--ECNVLLKCKVANIKKETHIVWYKDEREISVDEK--HD 1405
                R   P F+  L  +V      +V+L+C+V+       + W++D  EI    K    
Sbjct: 6737 ----RIVPPSFIRKLK-DVNAILGASVVLECRVSG-SAPISVGWFQDGNEIVSGPKCQSS 6790

Query: 1406 FKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATD 1465
            F + +CTL ++     D GIY  +  +  G D+    L  +              L    
Sbjct: 6791 FSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSVEVLPGMS 6850

Query: 1466 LKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPND 1525
            L   S   G   +          KV W      +   +     +      L++ E  P +
Sbjct: 6851 LTFTSVIRGTPPF----------KVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLE 6900

Query: 1526 KGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQ 1585
             G Y   + +       T  L              +K+ A   K  A          +++
Sbjct: 6901 SGDYSCLVTNDAGSASCTTHLF-------------VKEPATFVKRLADF--------SVE 6939

Query: 1586 EGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYG 1645
             G  + L     G PP  VSW+K+E  ++  + C++     ++    I   +  D  +Y 
Sbjct: 6940 TGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITM-TEKSTILEILESTIEDYAQYS 6998

Query: 1646 LVVKNKYGSETSDFTVSVFIP 1666
             +++N+ G +  +  VSV  P
Sbjct: 6999 CLIENEAGQDICEALVSVLEP 7019



 Score = 55.8 bits (133), Expect = 3e-07
 Identities = 148/740 (20%), Positives = 274/740 (37%), Gaps = 142/740 (19%)

Query: 983  WREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPP 1042
            W + N++       +I+     +V Q + A MN AGL              +T  V    
Sbjct: 8283 WYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGL--------------YTCKVSNDA 8328

Query: 1043 HSLKCSEVRKDSLVLQW--KPPVHSGR-TPVT---GYFVDLK-EAKAKED---QW----- 1087
             S  C+     S+V++   KPPV     TPVT   G +V L    +  E    QW     
Sbjct: 8329 GSALCTS----SIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGR 8384

Query: 1088 ------RGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGV----GKPSDLAGPVVAET 1137
                  R     A     L++R + +  S  +  +A N AG      K +    P VA  
Sbjct: 8385 EIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKPAVA-- 8442

Query: 1138 RPGTKEVVVNVDDDGVISLNFE------CDKMT----------PKSEFSWSKD-YVSTED 1180
             P TK+  V    DG +    E       +K T          P     W+K  +     
Sbjct: 8443 -PATKKAAV----DGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQ 8497

Query: 1181 SPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL---IDEEELKRLLALSH 1237
              R+ +  KG++ K+  +D    D G+Y C   +  G   S +   +DE + +  +    
Sbjct: 8498 GGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIEGDL 8557

Query: 1238 EHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKY-KMH-ID 1295
                   P        IL+KG      + E++     +  +    +  E  KY +M+ I 
Sbjct: 8558 RAMLKKTP--------ILKKGAG----EEEEID----IMELLKNVDPKEYEKYARMYGIT 8601

Query: 1296 RNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRK 1355
               G+++ F    Q ++E T+  ++++ + +            K+ ++   F +Q   + 
Sbjct: 8602 DFRGLLQAFELLKQSQEEETHRLEIEEIERSERDE--------KEFEELVSFIQQRLSQT 8653

Query: 1356 QGPHFVEYLSWE-VTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFK-DGIC-T 1412
            +    ++ +  + V  + + + +  +     E  + WYK   ++   +K +   DG   T
Sbjct: 8654 EPVTLIKDIENQTVLKDNDAVFEIDIKINYPEIKLSWYKGTEKLEPSDKFEISIDGDRHT 8713

Query: 1413 LLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTA 1472
            L +     KD G Y ++        K  L +++ A++  + +V  K              
Sbjct: 8714 LRVKNCQLKDQGNYRLVCGPHIASAK--LTVIEPAWERHLQDVTLK-------------- 8757

Query: 1473 EGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVME 1532
            EG        + V ++K  W  NG  ++   R KT V  +   L I +    D+G+Y  +
Sbjct: 8758 EGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRHKTEVEHKVHKLTIADVRAEDQGQYTCK 8817

Query: 1533 LFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNL 1592
              D +T  +  ++       E     +R++                   + + E ++   
Sbjct: 8818 YEDLETSAELRIEA------EPIQFTKRIQN------------------IVVSEHQSATF 8853

Query: 1593 TCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKY 1652
             C V  D    V+W K    L      N + + GR  Y TI+ V+  D G Y ++ + + 
Sbjct: 8854 ECEVSFD-DAIVTWYKGPTELTESQKYNFRND-GRCHYMTIHNVTPDDEGVYSVIARLEP 8911

Query: 1653 GSETSDFTVSVFIPEEEARM 1672
              E    T  +++  +E ++
Sbjct: 8912 RGEARS-TAELYLTTKEIKL 8930



 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 98/507 (19%), Positives = 176/507 (34%), Gaps = 83/507 (16%)

Query: 1170 SWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEEL 1229
            SW KD      S R  +        +    + M+D G ++C  T++ G   S        
Sbjct: 4145 SWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDS-------- 4196

Query: 1230 KRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPK 1289
               L +     F T P   ++       G         + S    + +    KE+  G  
Sbjct: 4197 SGALIVQEPPSFVTKPGSKDVL-----PGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGS 4251

Query: 1290 YKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQR 1349
              +  +     +E+++ K  D   GTYT ++ +          + G V        E   
Sbjct: 4252 CYITKEALESSLELYLVKTSDS--GTYTCKVSN----------VAGGV--------ECSA 4291

Query: 1350 QEWIRKQGPHFVEYLSWEVTGECNVLLK--------CKVANIKKETHIVWYKDEREISVD 1401
              ++ K+   FVE L      E + LLK        CKV        I W+ ++REI   
Sbjct: 4292 NLFV-KEPATFVEKL------EPSQLLKKGDATQLACKVTGTPP-IKITWFANDREIKES 4343

Query: 1402 EKH--DFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKI 1459
             KH   F +    L +T+   +D+G Y    +++ G D     ++ +       E     
Sbjct: 4344 SKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKPIE 4403

Query: 1460 ALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQIN 1519
             L   D+ + +   G   +          ++ W  + + +R   + KT +    + LQI 
Sbjct: 4404 VLKEYDVMLLAEVAGTPPF----------EITWFKDNTILRSGRKYKTFIQDHLVSLQIL 4453

Query: 1520 EPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLP 1579
            +    D G+Y   +   + G                     +  A +  +     +  + 
Sbjct: 4454 KFVAADAGEYQCRV-TNEVG-------------------SSICSARVTLREPPSFIKKIE 4493

Query: 1580 DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
               +++ G A      + G  P  V+WLK+   +  DD+  + FE    A   ++G+   
Sbjct: 4494 STSSLRGGTAA-FQATLKGSLPITVTWLKDSDEITEDDNIRMTFE-NNVASLYLSGIEVK 4551

Query: 1640 DSGKYGLVVKNKYGSETSDFTVSVFIP 1666
              GKY    KN  G +     +SV  P
Sbjct: 4552 HDGKYVCQAKNDAGIQRCSALLSVKEP 4578



 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 53/229 (23%), Positives = 89/229 (38%), Gaps = 40/229 (17%)

Query: 273  LLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRY 332
            L   P FI K  + T   K +     ++AG P   +TW K+   ++   N     ++S  
Sbjct: 5044 LKEPPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDS-- 5101

Query: 333  GMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF 392
             + TL+I   D   + +Y   A N  G    YA ++V+      ++ +          S 
Sbjct: 5102 -VATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIVEKAK----------SV 5150

Query: 393  GVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSP 452
             VT                      E + M+L C V  TPE+K     ++W ++G  + P
Sbjct: 5151 DVT----------------------EKDPMTLECVVAGTPELK-----VKWLKDGKQIVP 5183

Query: 453  SKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRD 501
            S++    +    A+     + K+D G YT +V          AY+ V D
Sbjct: 5184 SRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLD 5232



 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 93/428 (21%), Positives = 159/428 (37%), Gaps = 58/428 (13%)

Query: 1039  PGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNV 1098
             PGP   L  S V ++   L W  P   G   +T Y V+ +E       W  +        
Sbjct: 29141 PGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLN--WVIVEGECPTLS 29198

Query: 1099  YLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA--------------ETRPGTKEV 1144
             Y+  R +K    Y+FRVRA+N+ G G P + + P+VA              E   G + +
Sbjct: 29199 YVVTRLIKNN-EYIFRVRAVNKYGPGVPVE-SEPIVARNSFTIPSPPGIPEEVGTGKEHI 29256

Query: 1145  VVN----VDDDGVISLNFECDKMTPKSEFSWS---KDYVSTEDSPRLEVESKGNKTKMTF 1197
             ++       D G    N+  DK   KS   W+   KDYV  +            + K+T 
Sbjct: 29257 IIQWTKPESDGGNEISNYLVDKREKKS-LRWTRVNKDYVVYD-----------TRLKVTS 29304

Query: 1198  KDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEK 1257
                G D    Y   VT  +   +S   +  E    ++   E  +   P  +   V+  + 
Sbjct: 29305 LMEGCD----YQFRVTAVNAAGNS---EPSEASNFISC-REPSYTPGPPSAPRVVDTTKH 29356

Query: 1258  GQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYT 1317
                  W +     G   V Y+   +E      Y++H +      E  +  L+   +  Y+
Sbjct: 29357 SISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQK--YS 29414

Query: 1318  FQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLK 1377
             F++           V V  + +  +  AE +  E I        + L   VT      L+
Sbjct: 29415 FRV---------AAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGASLR 29465

Query: 1378  CKVANIKKETHIV-WYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGK 1436
               V+   +   ++ W K   +++     D  +    L++ + ++ DAG Y +  ++  GK
Sbjct: 29466 LMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGK 29525

Query: 1437  DKSRLKLV 1444
              KS   LV
Sbjct: 29526 -KSATVLV 29532



 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 92/500 (18%), Positives = 192/500 (38%), Gaps = 81/500 (16%)

Query: 1164 TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1223
            TP  + +W  +    ++S +  +    +   +   D+G++D G Y C+  +  G      
Sbjct: 4326 TPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAG------ 4379

Query: 1224 IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNA--KVNYIFNE 1281
               +    ++ +     F     K    +E+L++  V   M   +++G    ++ +  + 
Sbjct: 4380 --SDHCSSIVIVKESPYF----TKEFKPIEVLKEYDV---MLLAEVAGTPPFEITWFKDN 4430

Query: 1282 KEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQD--GKATNHSTVVLVGDVFK 1339
              +  G KYK  I  +  ++ + + K    D G Y  ++ +  G +   + V L      
Sbjct: 4431 TILRSGRKYKTFIQDH--LVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTL------ 4482

Query: 1340 KLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIV--WYKDERE 1397
                           ++ P F++ +  E T           A +K    I   W KD  E
Sbjct: 4483 ---------------REPPSFIKKI--ESTSSLRGGTAAFQATLKGSLPITVTWLKDSDE 4525

Query: 1398 ISVDE--KHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEV 1455
            I+ D+  +  F++ + +L ++    K  G Y    K+D G  +    L   + KE     
Sbjct: 4526 ITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALL---SVKEPATIT 4582

Query: 1456 CKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIW 1515
             + +++  T    Q     +Q+    T   +++   W  +G  +    + K  VT     
Sbjct: 4583 EEAVSIDVT----QGDPATLQVKFSGT---KEITAKWFKDGQELTLGSKYKISVTDTVSI 4635

Query: 1516 LQINEPTPNDKGKYVMELFD--GKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRAR 1573
            L+I      D G+Y  E+ +  G++  +  +++       ++ +  +LK+          
Sbjct: 4636 LKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTK--KLKKM--------- 4684

Query: 1574 VLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTI 1633
                  D +   +G  ++L C V G  P  + W K+++ +++ +     F    TA+  I
Sbjct: 4685 ------DSI---KGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFH-DNTAFLEI 4734

Query: 1634 NGVSTADSGKYGLVVKNKYG 1653
            + +   DSG Y     NK G
Sbjct: 4735 SQLEGTDSGTYTCSATNKAG 4754



 Score = 54.7 bits (130), Expect = 8e-07
 Identities = 100/495 (20%), Positives = 186/495 (37%), Gaps = 92/495 (18%)

Query: 1158  FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
             FEC+     ++  W KD    +   + ++ SKG    +      +DD   YSC+V     
Sbjct: 12393 FECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTART 12452

Query: 1218  IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNY 1277
                  +++EE                V  K+   +E+ E   ++   +  K    A+V +
Sbjct: 12453 SGMLTVLEEE---------------AVFTKNLANIEVSETDTIKLVCEVSK--PGAEVIW 12495

Query: 1278  IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQL----QDGKATNHSTVVL 1333
                ++EI E  +Y++  +    I  + ++    ED G Y  +L     DGK   H     
Sbjct: 12496 YKGDEEIIETGRYEILTEGRKRI--LVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAA- 12552

Query: 1334  VGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYK 1393
                              E+I K  P  +E L  E          C ++  K+   + W +
Sbjct: 12553 -----------------EFISK--PQNLEILEGE-----KAEFVCSIS--KESFPVQWKR 12586

Query: 1394  DEREISVDEKHD-FKDG-ICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKEL 1451
             D++ +   +K+D   DG    L++ + + +D G Y V++   R    + L ++++     
Sbjct: 12587 DDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARA--AAHLTVIEKL---- 12640

Query: 1452  MMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTG 1511
                   +I +   D +++   E +      T   E  K  W  N  AI  S +       
Sbjct: 12641 ------RIVVPLKDTRVKEQQEVVFNCEVNT---EGAKAKWFRNEEAIFDSSKYIILQKD 12691

Query: 1512  EQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAA--IAEK 1569
                 L+I +   +D+  Y + L    T H+                 + +K AA  I E+
Sbjct: 12692 LVYTLRIRDAHLDDQANYNVSL----TNHRG----------------ENVKSAANLIVEE 12731

Query: 1570  NRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTA 1629
                R++  L D+ T+ E K++   C V       + W KN + +  D+  + + +  +  
Sbjct: 12732 EDLRIVEPLKDIETM-EKKSVTFWCKV-NRLNVTLKWTKNGEEVPFDNRVSYRVDKYK-H 12788

Query: 1630  YFTINGVSTADSGKY 1644
               TI      D G+Y
Sbjct: 12789 MLTIKDCGFPDEGEY 12803



 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1637
             +P+ +TI+ GK L +  +V+G P P   W K E  + +  H  +  +A  ++   I  V+
Sbjct: 18904 MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAV-HKADSSSILIIKDVT 18962

Query: 1638  TADSGKYGLVVKNKYGSETSDFTVSV 1663
               DSG Y L  +N  G++T    V V
Sbjct: 18963 RKDSGYYSLTAENSSGTDTQKIKVVV 18988



 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 44/192 (22%), Positives = 83/192 (43%), Gaps = 30/192 (15%)

Query: 180   TSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKK 239
             T   + +S + T+  ++++S +   S Q T +R+S +S +   S +  SA  +E++ E  
Sbjct: 32491 TEAYAVSSFKKTSEMEASSSVREVKS-QMTETRESLSSYEHSASAEMKSAALEEKSLE-- 32547

Query: 240   SRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCS 299
                    EK+    ++ TL                 A   + KPRS TV+E E+ +  C 
Sbjct: 32548 -------EKSTTRKIKTTL-----------------AARILTKPRSMTVYEGESARFSCD 32583

Query: 300   IAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKG 359
               G P P VTW +    ++  A   ++ + +     T EI+     D   Y     N +G
Sbjct: 32584 TDGEPVPTVTWLRKGQVLSTSA---RHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEG 32640

Query: 360   ELSAYASVVVKR 371
             +  A  ++ +++
Sbjct: 32641 KQEAEFTLTIQK 32652



 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 1/84 (1%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             D +TI+ G+A  LT    G P P+VSW K+E  +  DD  ++K      A   I     +
Sbjct: 16826 DKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIK-AKRS 16884

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
             DSGKY +VV+N  GS      V+V
Sbjct: 16885 DSGKYCVVVENSTGSRKGFCQVNV 16908



 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 47/166 (28%), Positives = 72/166 (43%), Gaps = 9/166 (5%)

Query: 1503  DRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQ--- 1559
             +R      G+  WL+ N    +D    V  L +G T   + +  +        +E     
Sbjct: 28976 ERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPV 29035

Query: 1560  --RLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDD 1617
               R + A    +  AR+ G   D+VTI+ G  L L   V G P P++ W K +K L   +
Sbjct: 29036 TCRDEYAPPKAELDARLHG---DLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCE 29092

Query: 1618  HCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
               +L++  G+ A   I     +DSGKY L VKN  G++     V V
Sbjct: 29093 KVSLQY-TGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKV 29137



 Score = 52.0 bits (123), Expect = 5e-06
 Identities = 47/205 (22%), Positives = 81/205 (39%), Gaps = 38/205 (18%)

Query: 277  PEFIIKPRSHT-VWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMH 335
            P + I+P  H      E   L C + G PE R++WYK    +    +   Y ++ +  + 
Sbjct: 7019 PPYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLR---SAPAYKMQFKNNVA 7075

Query: 336  TLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVT 395
            +L IN  D  D  +Y   A N  G +++ A +V+K  K                    + 
Sbjct: 7076 SLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARK--------------------LP 7115

Query: 396  PYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKW 455
            P+      ++H    F V+F          CR+  +  +     ++ WY++GV L     
Sbjct: 7116 PFFARKLKDVHETLGFPVAF---------ECRINGSEPL-----QVSWYKDGVLLKDDAN 7161

Query: 456  VQTLWSGERATLTFSHLNKEDEGLY 480
            +QT +    ATL     ++   G Y
Sbjct: 7162 LQTSFVHNVATLQILQTDQSHIGQY 7186



 Score = 51.6 bits (122), Expect = 6e-06
 Identities = 101/517 (19%), Positives = 179/517 (34%), Gaps = 70/517 (13%)

Query: 1155 SLNFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVT 1213
            S  FEC    TPK   SW  D        +  +               +++ G Y C+  
Sbjct: 4878 STTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEAR 4937

Query: 1214 DTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNA 1273
            +  G AS  +  E ++K       E K   V   S++ +E    G   F           
Sbjct: 4938 NDAGTASCSI--ELKVKEPPTFIRELKPVEVVKYSDVELECEVTGTPPF----------- 4984

Query: 1274 KVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQ-DGKATNHSTVV 1332
            +V ++ N +EI    KY +  DR   +  + + K    D G Y   +  +G + + ST V
Sbjct: 4985 EVTWLKNNREIRSSKKYTL-TDR-VSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRV 5042

Query: 1333 LVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTG-ECNVLLKCKVANIKKETHIVW 1391
             +                    K+ P F++ +    T  + +   +  VA       I W
Sbjct: 5043 AL--------------------KEPPSFIKKIENTTTVLKSSATFQSTVAG-SPPISITW 5081

Query: 1392 YKDEREISVDEKH--DFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFK 1449
             KD++ +  D+     F D + TL I       +G Y    K++ G        V+  + 
Sbjct: 5082 LKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESG--------VERCYA 5133

Query: 1450 ELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGV 1509
             L+++   +I   A  + +  T +       V     +LKV W  +G  I  S       
Sbjct: 5134 FLLVQEPAQIVEKAKSVDV--TEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSF 5191

Query: 1510 TGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEK 1569
                   +I      D G+Y  ++ +         D    + D       +    +  +K
Sbjct: 5192 ENNVASFRIQSVMKQDSGQYTFKVEN---------DFGSSSCDAYLRVLDQNIPPSFTKK 5242

Query: 1570 NRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTA 1629
                 L  +  V+    G ++++ C V G  P    W K+ K +++     L     R+ 
Sbjct: 5243 -----LTKMDKVL----GSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHE-RSV 5292

Query: 1630 YFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIP 1666
               +N +   D+  Y   V N  G +     ++V  P
Sbjct: 5293 SLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEP 5329



 Score = 51.6 bits (122), Expect = 6e-06
 Identities = 124/579 (21%), Positives = 217/579 (37%), Gaps = 83/579 (14%)

Query: 1099 YLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNF 1158
            +L++  + +G S  +  +A N   VGK    A   V E     K++  +       S+  
Sbjct: 6327 HLRILKVGKGDSGQYTCQATND--VGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQL 6384

Query: 1159 ECD-KMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
            EC    +P+ + SW ++     +S +  +    +   +T  +   +D G Y C+  +  G
Sbjct: 6385 ECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVG 6444

Query: 1218 IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNA--KV 1275
             AS             + +   K P V  +    V  L+   V   +Q E +SG    +V
Sbjct: 6445 DASC------------STALTVKAPPVFTQKPSPVGALKGSDVI--LQCE-ISGTPPFEV 6489

Query: 1276 NYIFNEKEIFEGPKYKM---HIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVV 1332
             ++ + K++    K+K+   H D +  I+      L+  D G Y       KATN     
Sbjct: 6490 VWVKDRKQVRNSKKFKITSKHFDTSLHILN-----LEASDVGEYHC-----KATNE---- 6535

Query: 1333 LVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWY 1392
             VG          +F       K+ P FV+ LS   T   + +    +    +   +VW 
Sbjct: 6536 -VGS--DTCSCSVKF-------KEPPRFVKKLSDTSTLIGDAVELRAIVEGFQPISVVWL 6585

Query: 1393 KDEREI---SVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFK 1449
            KD  E+   S + +  F D I TL +      ++G Y   +K+D G  +    L      
Sbjct: 6586 KDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLT----- 6640

Query: 1450 ELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGV 1509
              ++E  + I     +    +T     L   VT   E L   W  +G  +    +     
Sbjct: 6641 --VLEPARII--EKPEPMTVTTGNPFALECVVTGTPE-LSAKWFKDGRELSADSKHHITF 6695

Query: 1510 TGEQIWLQINEPTPNDKGKYVMELFD--GKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIA 1567
              +   L+I     +DKG Y  E+ +  GK+    +V +S +    ++            
Sbjct: 6696 INKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSF------------ 6743

Query: 1568 EKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGR 1627
                   +  L DV  I  G ++ L C V G  P  V W ++   + S   C   F +  
Sbjct: 6744 -------IRKLKDVNAIL-GASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSF-SEN 6794

Query: 1628 TAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIP 1666
                 ++ +  +D+G Y  V  N  GS+     ++V  P
Sbjct: 6795 VCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEP 6833



 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 78/375 (20%), Positives = 132/375 (35%), Gaps = 84/375 (22%)

Query: 184  STASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKV 243
            +T +K+    K++         ++S   R     R      +A +A++ +   + +S + 
Sbjct: 1970 TTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEE 2029

Query: 244  VIREKAERLSLRKTLEETETYHAKLNEDHLL----------------HAPEFIIKPRSHT 287
            ++R+  + L L  T E TE     L E+  +                 AP+   + +S T
Sbjct: 2030 LLRKTKDEL-LHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQT 2088

Query: 288  VWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDT 347
            V +  +      + G P+P   WYKN V I        Y  E    +  L I     ED+
Sbjct: 2089 VGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPED--NVCELVIRDVTAEDS 2146

Query: 348  AQYRASAMNVKGELSAYASVVVKRYK-------------GEFDETRFHAGASTMPLSFGV 394
            A     A+N+ GE S++A ++V+  +              E D        ++ P    V
Sbjct: 2147 ASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPF---V 2203

Query: 395  TPYGYASRFEIHFDDKFDVSFGR-----------------------EGETMSLGCRVVIT 431
                Y    E+H  DK+ +   R                       E E +    ++++ 
Sbjct: 2204 KVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVE 2263

Query: 432  PEIKHFQPEIQ------------------------WYRNGVPL-SPSKWVQTLWSGERAT 466
              +  F  E+Q                        WY N V L S  K+  T   G R  
Sbjct: 2264 GAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRG-RQN 2322

Query: 467  LTFSHLNKEDEGLYT 481
            LT   + KED+G Y+
Sbjct: 2323 LTVKDVTKEDQGEYS 2337



 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 55/227 (24%), Positives = 79/227 (34%), Gaps = 39/227 (17%)

Query: 261  TETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVH 320
            T +  A+L       +P F IKP S  V   E+    C + G    R+TW K+   I   
Sbjct: 6255 TASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPG 6314

Query: 321  ANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETR 380
             N   Y I        L I      D+ QY   A N  G+    A + VK          
Sbjct: 6315 GN---YTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKE--------- 6362

Query: 381  FHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPE 440
                           P  +  + E            ++GE++ L C++  +PEIK     
Sbjct: 6363 ---------------PPKFVKKLEAS-------KVAKQGESIQLECKISGSPEIK----- 6395

Query: 441  IQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMG 487
            + W+RN   L  S      +    A LT +  + ED G Y      G
Sbjct: 6396 VSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNG 6442



 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 59/299 (19%), Positives = 114/299 (38%), Gaps = 36/299 (12%)

Query: 1373  NVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDG--ICTLLITEFSKKDAGIYEVIL 1430
             NVL  C+++  +    I W+K+   IS+           + +L I   S  D+G Y +  
Sbjct: 33150 NVLFTCEISG-EPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKA 33208

Query: 1431  KDDRGKDKSR-----LKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYV 1485
             K+ RG+  +      L LV+E  +E+++          T L+   +++ +Q+ +      
Sbjct: 33209 KNFRGQCSATASLMVLPLVEEPSREVVLRTS-----GDTSLQGSFSSQSVQMSAS----- 33258

Query: 1486  EDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVD 1545
                        S   +S    + +T  +      +   + +  +V        G      
Sbjct: 33259 -------KQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQ 33311

Query: 1546  LSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVS 1605
             L             ++ +A I  +     +  LP  ++I EGK L + C   G+P PEV+
Sbjct: 33312 LESST--------SKMLKAGI--RGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVT 33361

Query: 1606  WLKNEKALASDDHCNLKFE-AGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
             W    + + S +      E         I  V   D G Y L + N++GS+++   + +
Sbjct: 33362 WSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 33420



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 42/157 (26%), Positives = 69/157 (43%), Gaps = 20/157 (12%)

Query: 217  SRQS-VVSKQATSALQQEETSEK---KSRKVVIREKAERLSLRKTLEETETYHAKLNEDH 272
            SR S +++ +AT+    + TS     K  K ++ E+++    RK L+  E      +E  
Sbjct: 1769 SRDSGIITCRATNKYGTDHTSATLIVKDEKSLV-EESQLPEGRKGLQRIEELERMAHEGA 1827

Query: 273  LL---------HAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANP 323
            L            P+ ++ P    V E E  +  C + G+P+P+V WY N   I      
Sbjct: 1828 LTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKR- 1886

Query: 324  GKYIIESRY-GMHTLEINGCDFEDTAQYRASAMNVKG 359
                   RY G+H L+I  C   DT + + +A N +G
Sbjct: 1887 ----FRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEG 1919



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 30/94 (31%), Positives = 42/94 (44%), Gaps = 3/94 (3%)

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
            P FI + +   V +  +V+L C + G P   VTW KN   I    +  KY +  R  +  
Sbjct: 4955 PTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIR---SSKKYTLTDRVSVFN 5011

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
            L I  CD  DT +Y+    N  G  S    V +K
Sbjct: 5012 LHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALK 5045



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 93/463 (20%), Positives = 166/463 (35%), Gaps = 72/463 (15%)

Query: 1114  RVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSK 1173
             RV A+  +   K + L G        G  +    V+ D VI    +C+     +   W K
Sbjct: 11999 RVEAMGMSSEAKLTVLEGDPYFT---GKLQDYTGVEKDEVI---LQCEISKADAPVKWFK 12052

Query: 1174  DYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLL 1233
             D    + S    +++ G K  +  K     D+G Y+CD   TD  +    I++ E+K + 
Sbjct: 12053 DGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCD-CGTDKTSGKLDIEDREIKLVR 12111

Query: 1234  ALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMH 1293
              L               +VE++E    RF  + E    +   N+    + + + P     
Sbjct: 12112 PLH--------------SVEVMETETARF--ETEISEDDIHANWKLKGEALLQTP--DCE 12153

Query: 1294  IDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTV-VLVGDVFKKLQKEAEFQRQEW 1352
             I     I  + +   + +  G   FQ  + K++ H  V   V  + + L+          
Sbjct: 12154 IKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVT------- 12206

Query: 1353  IRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICT 1412
                            VT        C+++   ++  + WY   +++   +K         
Sbjct: 12207 ---------------VTAGETATFDCELS--YEDIPVEWYLKGKKLEPSDK--------- 12240

Query: 1413  LLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSAT-DLKIQST 1471
                    + +  ++ + L+D + +D   ++L  + FK       K+  +  T  L+ Q+ 
Sbjct: 12241 ----VVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKPLEDQTV 12296

Query: 1472  AEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVM 1531
              EG           E+ KV W  NG+ I  S + +    G    L I++ TP D   Y  
Sbjct: 12297 EEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTC 12356

Query: 1532  ELFDGKTGHQKTVDLSGQAYDEAYAEFQR-LKQAAIAEKNRAR 1573
             +  D KT     V          + EF R L    + EK  AR
Sbjct: 12357 DAKDFKTSCNLNV-------VPPHVEFLRPLTDLQVREKEMAR 12392



 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 56/244 (22%), Positives = 92/244 (37%), Gaps = 39/244 (15%)

Query: 273  LLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRY 332
            +L     + KP S  V   +   L C++AG PE    W+K+   +    +  KY I    
Sbjct: 7582 VLEPATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKEL---TSDNKYKISFFN 7638

Query: 333  GMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF 392
             +  L+I      D+  Y     N  G+ S  AS+ V                 T+P S 
Sbjct: 7639 KVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQV--------------SDRTVPPS- 7683

Query: 393  GVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSP 452
                          F  K   + G  G ++ + C+V  +P I      + W+  G  +S 
Sbjct: 7684 --------------FTRKLKETNGLSGSSVVMECKVYGSPPI-----SVSWFHEGNEISS 7724

Query: 453  SKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAA 512
             +  QT  +     LT + L + D G YT         ++ SA + VR+  + ++     
Sbjct: 7725 GRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQ--KPD 7782

Query: 513  PLDV 516
            P+DV
Sbjct: 7783 PMDV 7786



 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 109/563 (19%), Positives = 209/563 (37%), Gaps = 91/563 (16%)

Query: 1121 AGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNF-ECDKMTPKSEFSWSKDYVSTE 1179
            A V    + +  +  +  P  ++   +V+    +SL F    + TP  +  W K      
Sbjct: 6816 ANVAGSDECSAVLTVQEPPSFEQTPDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELV 6875

Query: 1180 DSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIAS--SYLIDEEE---LKRLLA 1234
                  +  +   T++   ++   + G YSC VT+  G AS  ++L  +E    +KRL  
Sbjct: 6876 PGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLAD 6935

Query: 1235 LSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHI 1294
             S E   P V       +E    G           +    V++I +E  I +  +  + +
Sbjct: 6936 FSVETGSPIV-------LEATYTG-----------TPPISVSWIKDEYLISQSERCSITM 6977

Query: 1295 DRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIR 1354
               + I+E+    ++D  + +   + + G+    + V ++                    
Sbjct: 6978 TEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVL-------------------- 7017

Query: 1355 KQGPHFVEYLSW--EVTGECNVLLKCKVANIKKETHIVWYKDEREI--SVDEKHDFKDGI 1410
             + P+F+E L     V GE    L+CKV     E  I WYK+  ++  +   K  FK+ +
Sbjct: 7018 -EPPYFIEPLEHVEAVIGE-PATLQCKVDGTP-EIRISWYKEHTKLRSAPAYKMQFKNNV 7074

Query: 1411 CTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEA------FKELMMEVCKKIALS-A 1463
             +L+I +    D G Y     +  G   S   LV +A      F   + +V + +    A
Sbjct: 7075 ASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLPPFFARKLKDVHETLGFPVA 7134

Query: 1464 TDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTP 1523
             + +I  +              E L+V+W  +G  ++    ++T        LQI +   
Sbjct: 7135 FECRINGS--------------EPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQ 7180

Query: 1524 NDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVT 1583
            +  G+Y          +    +  G A   A        +  ++E          P  V 
Sbjct: 7181 SHIGQY----------NCSASNPLGTASSSA--------KLILSEHEVPPFFDLKPVSVD 7222

Query: 1584 IQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGK 1643
            +  G++    C+V G  P +++W K+ + +    +  +      TA  T+  V   D+G+
Sbjct: 7223 LALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTL-VENTATLTVLKVGKGDAGQ 7281

Query: 1644 YGLVVKNKYGSETSDFTVSVFIP 1666
            Y     N  G ++    + V  P
Sbjct: 7282 YTCYASNIAGKDSCSAQLGVQEP 7304



 Score = 49.3 bits (116), Expect = 3e-05
 Identities = 96/436 (22%), Positives = 168/436 (38%), Gaps = 62/436 (14%)

Query: 1100 LKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFE 1159
            L +R +    S    V+AIN AG             +    T+E+   V  +      FE
Sbjct: 2136 LVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFE 2195

Query: 1160 CDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIA 1219
            C+   P  +  W KD +   +  +  + S      ++   +   D   YSC + + + + 
Sbjct: 2196 CETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVK 2255

Query: 1220 SSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILE--KGQVRFWMQAEKLSGNAKVNY 1277
            ++         +L+      +F    VK    +E+ E   G++   +  E + G     +
Sbjct: 2256 TT--------AKLIVEGAVVEF----VKELQDIEVPESYSGELECIVSPENIEG----KW 2299

Query: 1278 IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDV 1337
              N+ E+    KY   I    G   + ++ +  ED+G Y+F + DGK T           
Sbjct: 2300 YHNDVELKSNGKYT--ITSRRGRQNLTVKDVTKEDQGEYSFVI-DGKKTT---------- 2346

Query: 1338 FKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVL-LKCKVANIKKETHIVWYKDER 1396
              KL+          ++ +    ++ LS +   E +++ L+ KV+   +    VW KD +
Sbjct: 2347 -CKLK----------MKPRPIAILQGLSDQKVCEGDIVQLEVKVS--LESVEGVWMKDGQ 2393

Query: 1397 EIS-VDEKHDFKDGIC-TLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMME 1454
            E+   D  H   D     LLI + +K+DAG Y   +         R+ +         ++
Sbjct: 2394 EVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYS-------VD 2446

Query: 1455 VCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDL-KVNWSHNGSAIRYSDRVKTGVTGEQ 1513
            V        T LK  +  EG +        V D+  V W  N   I+  DRV+  V G +
Sbjct: 2447 V-------ITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTK 2499

Query: 1514 IWLQINEPTPNDKGKY 1529
              L IN    +D+G Y
Sbjct: 2500 QRLVINRTHASDEGPY 2515



 Score = 48.9 bits (115), Expect = 4e-05
 Identities = 115/564 (20%), Positives = 203/564 (35%), Gaps = 88/564 (15%)

Query: 1090  LNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVD 1149
             L E   + + ++   L++  +Y  R+ +    G  K  +LA   ++  +P   E++    
Sbjct: 12511 LTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFIS--KPQNLEILEGEK 12568

Query: 1150  DDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYS 1209
              + V S++ E   +       W +D  + E   + +V + G K  +  KD  + D+G Y 
Sbjct: 12569 AEFVCSISKESFPV------QWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYV 12622

Query: 1210  CDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKL 1269
               V      A   +I++  +              VP+K      + E+ +V F    E  
Sbjct: 12623 VMVGAARAAAHLTVIEKLRI-------------VVPLKD---TRVKEQQEVVF--NCEVN 12664

Query: 1270  SGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHS 1329
             +  AK  +  NE+ IF+  KY   I +   +  + +     +D+  Y   L + +  N  
Sbjct: 12665 TEGAKAKWFRNEEAIFDSSKYI--ILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVK 12722

Query: 1330  TVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHI 1389
             +   +    + L+     +  E + K+   F     W      NV LK            
Sbjct: 12723 SAANLIVEEEDLRIVEPLKDIETMEKKSVTF-----WCKVNRLNVTLK------------ 12765

Query: 1390  VWYKDEREISVDEKHDFKDGICTLLIT--EFSKKDAGIYEVILKDDRGKDKSRLKLVDEA 1447
              W K+  E+  D +  ++      ++T  +    D G Y V      G+DKS  +L    
Sbjct: 12766 -WTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTA----GQDKSVAEL---- 12816

Query: 1448  FKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKT 1507
                L++E   +      D   Q+  E            E   V W  NG  I+   + K 
Sbjct: 12817 ---LIIEAPTEFVEHLED---QTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKF 12870

Query: 1508  GVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIA 1567
                G    L I +   +D+ +Y   + D K+  +  V       +E   E  R  Q  + 
Sbjct: 12871 EKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFV-------EEIPVEIIRPPQDILE 12923

Query: 1568  EKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGR 1627
                         DVV + E   LN           EV WL+N   +   D   +  E G+
Sbjct: 12924 APG--------ADVVFLAE---LN-------KDKVEVQWLRNNMVVVQGDKHQMMSE-GK 12964

Query: 1628  TAYFTINGVSTADSGKYGLVVKNK 1651
                  I  +   D G+Y  + K+K
Sbjct: 12965 IHRLQICDIKPRDQGEYRFIAKDK 12988



 Score = 48.9 bits (115), Expect = 4e-05
 Identities = 44/200 (22%), Positives = 83/200 (41%), Gaps = 11/200 (5%)

Query: 1484  YVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKT 1543
             Y +  +V W      +  S++ +         L + + T  D G Y  ++ +        
Sbjct: 31594 YDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSY 31653

Query: 1544  VDLSGQAYDEAYAEFQRLKQAAIAEK-NRARVLGGLPDVV------TIQEGKALNLTCNV 1596
              +L  +   E Y  + R     I  + +  R+L   P+        T   G+ +     +
Sbjct: 31654 AELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTI 31713

Query: 1597  WGDPPPEVSWLKN-EKALASDDHCNLKFEAGRTAY-FTINGVSTADSGKYGLVVKNKYGS 1654
                P P V+W K+ +K    D+     FE+ +  Y  TIN V+T D  +Y +V +NKYG 
Sbjct: 31714 TVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGE 31773

Query: 1655  ET--SDFTVSVFIPEEEARM 1672
             ++  +  TV++  P  ++ +
Sbjct: 31774 DSCKAKLTVTLHPPPTDSTL 31793



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 49/207 (23%), Positives = 79/207 (38%), Gaps = 35/207 (16%)

Query: 276 APEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMH 335
           AP F    +S  V E         I+G+P P V+W+++   I+    PG  I  S  G  
Sbjct: 5   APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD-GRA 63

Query: 336 TLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVT 395
            L I      ++ +Y   A N  G+ ++ A ++VK              A T P      
Sbjct: 64  KLTIPAVTKANSGRYSLKATNGSGQATSTAELLVK--------------AETAP------ 103

Query: 396 PYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKW 455
                     +F  +      R+G  + L  RV   P      P +++YR+G  +  S  
Sbjct: 104 ---------PNFVQRLQSMTVRQGSQVRLQVRVTGIP-----TPVVKFYRDGAEIQSSLD 149

Query: 456 VQTLWSGERATLTFSHLNKEDEGLYTI 482
            Q    G+  +L  +    ED G Y++
Sbjct: 150 FQISQEGDLYSLLIAEAYPEDSGTYSV 176



 Score = 48.1 bits (113), Expect = 7e-05
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query: 1575  LGGLPDVVTI-QEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTI 1633
             L GLPD+  + +E     L   + G P P VSW K E  LA+D   +++  A  T    +
Sbjct: 19984 LKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTT-LIV 20042

Query: 1634  NGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
                  +D+GKY + +KN  G++    ++ V
Sbjct: 20043 YDCQKSDAGKYTITLKNVAGTKEGTISIKV 20072



 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 4/95 (4%)

Query: 277  PEFIIK-PRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMH 335
            P F+ K   S+ +   E+ +LHC + G P  +VTW+KN   ++       Y + S     
Sbjct: 3737 PSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSE---A 3793

Query: 336  TLEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
             L+I     ED+  Y   A+N  G  S    +V+K
Sbjct: 3794 ILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIK 3828



 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 112/499 (22%), Positives = 178/499 (35%), Gaps = 92/499 (18%)

Query: 1158  FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
             FEC+       F W K         R E+   G K  M  K    +D   Y  +  D   
Sbjct: 11859 FECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKH- 11917

Query: 1218  IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNY 1277
              +   +I+   LK L            P+K    V   EK    F    E    N +V +
Sbjct: 11918 TSGKLIIEGIRLKFL-----------TPLKD---VTAKEKESAVF--TVELSHDNIRVKW 11961

Query: 1278  IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDV 1337
               N++ +       M  +  T  I    + L  +D      +   G ++     VL GD 
Sbjct: 11962 FKNDQRLHTTRSVSMQDEGKTHSIT--FKDLSIDDTSQIRVEAM-GMSSEAKLTVLEGDP 12018

Query: 1338  F--KKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDE 1395
             +   KLQ     ++ E                      V+L+C+++  K +  + W+KD 
Sbjct: 12019 YFTGKLQDYTGVEKDE----------------------VILQCEIS--KADAPVKWFKDG 12054

Query: 1396  REISVDEKHDFK-DGICTLLITEFS-KKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMM 1453
             +EI   +    K DG   +LI + + K D G Y      D G DK+  KL D   +E+  
Sbjct: 12055 KEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC----DCGTDKTSGKL-DIEDREI-- 12107

Query: 1454  EVCKKIALSATDLKIQSTAEGIQLYSFVTYYVE-DLKVNWSHNGSAIRYSDRVKTGVTGE 1512
                 K+      +++  T    +   F T   E D+  NW   G A+             
Sbjct: 12108 ----KLVRPLHSVEVMET----ETARFETEISEDDIHANWKLKGEAL------------- 12146

Query: 1513  QIWLQINEPTPNDKGK-YVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNR 1571
                LQ  +    ++GK + + L + +      VD   QA +   +   R+K   I     
Sbjct: 12147 ---LQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDF--QAANVKSSAHLRVKPRVIG---- 12197

Query: 1572  ARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYF 1631
               +L  L D VT+  G+     C +  +  P V W    K L   D    + E G+    
Sbjct: 12198 --LLRPLKD-VTVTAGETATFDCELSYEDIP-VEWYLKGKKLEPSDKVVPRSE-GKVHTL 12252

Query: 1632  TINGVSTADSGKYGLVVKN 1650
             T+  V   D+G+  L  K+
Sbjct: 12253 TLRDVKLEDAGEVQLTAKD 12271



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 2/95 (2%)

Query: 1582  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADS 1641
             V  + G+ + +     G PPP V+W K+EK L SD   +++     ++  TI  V+  D+
Sbjct: 27281 VIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIE-NTDSSSLLTIPQVTRNDT 27339

Query: 1642  GKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALE 1676
             GKY L ++N  G E    TVSV + +  A    L+
Sbjct: 27340 GKYILTIENGVG-EPKSSTVSVKVLDTPAACQKLQ 27373



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 7/122 (5%)

Query: 1544  VDLSGQA-YDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPP 1602
             V++ G + Y E+ AE + +++  I +   A     L   VTI+ G +L L  +V G PPP
Sbjct: 29420 VNVKGMSEYSESIAEIEPVERIEIPDLELA---DDLKKTVTIRAGASLRLMVSVSGRPPP 29476

Query: 1603  EVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVS 1662
              ++W K    LAS    +        +   ++ V+  D+GKY +  +N+ G +++   V 
Sbjct: 29477 VITWSKQGIDLASRAIID---TTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVK 29533

Query: 1663  VF 1664
             V+
Sbjct: 29534 VY 29535



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 152/790 (19%), Positives = 286/790 (36%), Gaps = 153/790 (19%)

Query: 997  KISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLV 1056
            KIS  K    Y+  +A   +A L     +S     ++ T +V  P  ++K SE R     
Sbjct: 820  KISVPKTEHGYEASIAGSAIATL--QKELSATSSAQKITKSVKAP--TVKPSETR----- 870

Query: 1057 LQWKPPVHSGRTPVTGY-FVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRV 1115
                  V +  TP+  + F D  +    E       E  +      VR  +  V +    
Sbjct: 871  ------VRAEPTPLPQFPFADTPDTYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREA 924

Query: 1116 RAINQAGVGKPSDLAGPVVAETR-PGTKEVVVNVDDDGVISLNFECD-KMTPKSEFSWSK 1173
            +    A V  P ++  PV   T   G K V V   +    S+  EC     P    +W +
Sbjct: 925  KVTETARVPAPVEI--PVTPPTLVSGLKNVTVIEGE----SVTLECHISGYPSPTVTWYR 978

Query: 1174 DYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS--YL---IDEE- 1227
            +    E S   ++  +    ++  ++   +D G ++C   +  G  S+  YL   + EE 
Sbjct: 979  EDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEF 1038

Query: 1228 -------------ELKRLL----------ALSHEHKFPTVP-----VKSELAVEILEKGQ 1259
                         E KR +          +L+ E   P  P     +   +  +++E G 
Sbjct: 1039 EKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGS 1098

Query: 1260 VRFWMQAEKLSGNAKVNYIFNEKEI--FEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYT 1317
            V F  Q   + GN K +  + +  +    G +YK+  ++ TG  ++ +     +D G YT
Sbjct: 1099 VVFGCQ---VGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYT 1155

Query: 1318 FQLQDGKATNHSTVVLVGD----VFKKLQKEAEFQRQEWIRKQGPHFVE------YLSWE 1367
              +++      ++  L+ +    +  K Q+E  +Q Q     Q P   E      Y  +E
Sbjct: 1156 IVVRNKHGETSASASLLEEADYELLMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYE 1215

Query: 1368 VTGECN-VLLKCKVANIKKETHIV-WYKDEREISVDEKHDFKDGICTLLITEFSKKDAGI 1425
               E    L++ K+A   K+T +V  Y +++E  +     F++ +   +     K     
Sbjct: 1216 KEYEKEQALIRKKMA---KDTVVVRTYVEDQEFHISS---FEERLIKEIEYRIIKTTL-- 1267

Query: 1426 YEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQS----TAEGIQLYSFV 1481
             E +L++D G++K  + + +    E           S  D +I++       G+  +  +
Sbjct: 1268 -EELLEED-GEEKMAVDISESEAVE-----------SGFDSRIKNYRILEGMGVTFHCKM 1314

Query: 1482 TYYVEDLKVNWSHNGSAIRYSDRVKTGVTGE-QIWLQINEPTPNDKGKYVM--------E 1532
            + Y    K+ W  +G  I++ +R +     + +  L+I    P D+G Y           
Sbjct: 1315 SGYPLP-KIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNA 1373

Query: 1533 LFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNR--------------------- 1571
            +  GK   +    L    Y        R++  +    +R                     
Sbjct: 1374 ICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMS 1433

Query: 1572 -ARVLGGL---------------------PDVVTIQEGKALNLTCNVWGDPPPEVSWLKN 1609
             AR+  G                      P      EG+       V G P PE  W  +
Sbjct: 1434 PARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHD 1493

Query: 1610 EKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEE 1669
             + + +D    +  +   T    I   + +DSG++ +V +N+ G  +    ++V   E +
Sbjct: 1494 GQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQ 1553

Query: 1670 ARMAALESLK 1679
             +   +E LK
Sbjct: 1554 VKPMFVEKLK 1563



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 30/95 (31%), Positives = 44/95 (46%), Gaps = 4/95 (4%)

Query: 277  PEFIIKPR-SHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMH 335
            P FI K   S  V + E  +  C I G PE +V WYK++  I   +      ++S   + 
Sbjct: 7305 PRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDS---VA 7361

Query: 336  TLEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
             LE++    ED+  Y   A N  G  S+  S+ VK
Sbjct: 7362 VLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVK 7396



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 86/408 (21%), Positives = 152/408 (37%), Gaps = 50/408 (12%)

Query: 1155 SLNFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVT 1213
            S +FEC    T   + SW+KD        + ++    N   +T   +   D G Y+C   
Sbjct: 8169 SADFECHVTGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTC--- 8225

Query: 1214 DTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNA 1273
                    Y ++E       A  +  +    P  ++   E +E+ +   +    +++G+ 
Sbjct: 8226 --------YAVNEVGKDSCTAQLNIKERLIPPSFTKRLSETVEETEGNSFKLEGRVAGSQ 8277

Query: 1274 KVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQD--GKATNHSTV 1331
             +   + +  I   P     I      + + + K    D G YT ++ +  G A   S++
Sbjct: 8278 PITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSI 8337

Query: 1332 VLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECN-VLLKCKVANIKKETHIV 1390
            V+         KE          K+ P F ++L+     E   V L C V    +   I 
Sbjct: 8338 VI---------KEP---------KKPPVFDQHLTPVTVSEGEYVQLSCHVQG-SEPIRIQ 8378

Query: 1391 WYKDEREISVDEK--HDFKDGICTLLITEFSKKDAGIYEVILKDDRGKD--KSRLKLVDE 1446
            W K  REI   ++    F  G   L + + +K D+G Y     +  G D  KS++ + D 
Sbjct: 8379 WLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKD- 8437

Query: 1447 AFKELMMEVCKKIALSATDLKIQSTAEGIQLY-----SFVTYYVED--LKVNWSH-NGSA 1498
              K  +    KK A+    L   S  + I++      +F+     D    V W+      
Sbjct: 8438 --KPAVAPATKKAAVDGR-LFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQ 8494

Query: 1499 IRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDL 1546
            +    RV     G++  L+I + T  D G Y    F+     +  V+L
Sbjct: 8495 LNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNL 8542



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 41/205 (20%), Positives = 77/205 (37%), Gaps = 33/205 (16%)

Query: 1358  PHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFK---DGICTLL 1414
             P   ++L  E + E   L     +++ +   + WYKD +++  +    F    DG   L 
Sbjct: 32718 PKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELK 32777

Query: 1415  ITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTA-- 1472
             I   ++ D G Y   +  + G  K+ L+ + +AFK +  +V K      +D K   +   
Sbjct: 32778 INNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVT 32837

Query: 1473  --------EGIQLYSFVTYYVEDLKVN--------------------WSHNGSAIRYSDR 1504
                     E I     +   ++D  V+                    W+ +G AI    +
Sbjct: 32838 RKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGK 32897

Query: 1505  VKTGVTGEQIWLQINEPTPNDKGKY 1529
              K        +L+I++   +D G Y
Sbjct: 32898 YKLSEDKGGFFLEIHKTDTSDSGLY 32922



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 64/306 (20%), Positives = 122/306 (39%), Gaps = 34/306 (11%)

Query: 184   STASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKV 243
             S++ K T  + + T +++ +  K S  + Q  A  Q  +S++A  + + + +  K   K+
Sbjct: 32934 SSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKL 32993

Query: 244   VIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGW 303
              ++E+A ++ +    EE +   A   E  ++H  E I K    T    E V+ H  I   
Sbjct: 32994 ALKEEASKVLIS---EEVKKSAATSLEKSIVH--EEITK----TSQASEEVRTHAEIKA- 33043

Query: 304   PEPRVTWYKNQVPINVHANPGKYIIESRYGMHT---LEINGCDFEDTAQYRASAMNVKGE 360
                    +  Q+ IN      + ++++     T     +NG +  ++ +YR         
Sbjct: 33044 -------FSTQMSIN---EGQRLVLKANIAGATDVKWVLNGVELTNSEEYRYG------- 33086

Query: 361   LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGE 420
             +S     +  +     DE      + T     G+    Y         D          +
Sbjct: 33087 VSGSDQTLTIKQASHRDEGILTCISKTKE---GIVKCQYDLTLSKELSDAPAFISQPRSQ 33143

Query: 421   TMSLGCRVVITPEIK-HFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGL 479
              ++ G  V+ T EI     PEI+W++N +P+S S  V    S    +L   + +  D G 
Sbjct: 33144 NINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGK 33203

Query: 480   YTIRVR 485
             YTI+ +
Sbjct: 33204 YTIKAK 33209



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 46/190 (24%), Positives = 78/190 (41%), Gaps = 28/190 (14%)

Query: 1492 WSHNGSAI--RYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQ 1549
            W H+G  I   Y+ +V     G Q  L I   TP+D G++ +   +       +V L+ +
Sbjct: 1490 WFHDGQQIVNDYTHKVVIKEDGTQS-LIIVPATPSDSGEWTVVAQNRAGRSSISVILTVE 1548

Query: 1550 AYDEAYAEF--QRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWL 1607
            A +        ++LK                   V I+EG  L +     G+P P++ WL
Sbjct: 1549 AVEHQVKPMFVEKLKN------------------VNIKEGSRLEMKVRATGNPNPDIVWL 1590

Query: 1608 KNEKALASDDHCNLKFEAGR-TAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFI- 1665
            KN   +    +  ++ E  +  A   I+   + DS  Y     NK G +T+   V+V + 
Sbjct: 1591 KNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVE 1650

Query: 1666 ---PEEEARM 1672
               PE E ++
Sbjct: 1651 FAEPEPERKL 1660



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 28/95 (29%), Positives = 49/95 (51%), Gaps = 4/95 (4%)

Query: 277  PEFIIKPRSHTVWEK-ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMH 335
            P+F+ K  +  V ++ E+++L C I+G PE +V+W++N   ++      KY +     + 
Sbjct: 6364 PKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELH---ESWKYNMSFINSVA 6420

Query: 336  TLEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
             L IN    ED+  Y   A N  G+ S   ++ VK
Sbjct: 6421 LLTINEASAEDSGDYICEAHNGVGDASCSTALTVK 6455



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 60/252 (23%), Positives = 86/252 (34%), Gaps = 40/252 (15%)

Query: 266  AKLNEDHLLHAPEFIIKPRSHTVWEKE--NVKLHCSIAGWPEPRVTWYKNQVPINVHANP 323
            A+LN    L  P F  K  S TV E E  + KL   +AG     V WYKN + I   +N 
Sbjct: 8238 AQLNIKERLIPPSFT-KRLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSN- 8295

Query: 324  GKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHA 383
                I  +     L++      D   Y     N  G     +S+V+K  K          
Sbjct: 8296 --CEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPK---------- 8343

Query: 384  GASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQW 443
                 P+                FD         EGE + L C V  +  I+     IQW
Sbjct: 8344 ---KPPV----------------FDQHLTPVTVSEGEYVQLSCHVQGSEPIR-----IQW 8379

Query: 444  YRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDAD 503
             + G  + PS      ++   A L    + K D G Y  +       +   + V ++D  
Sbjct: 8380 LKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKP 8439

Query: 504  AEIEGAPAAPLD 515
            A       A +D
Sbjct: 8440 AVAPATKKAAVD 8451



 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 8/97 (8%)

Query: 277  PEFIIK-PRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPG--KYIIESRYG 333
            P+F+ K   S  V   ++ +L C IAG PE RV W++N+     H  P   KY +     
Sbjct: 5423 PKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNE-----HELPASDKYRMTFIDS 5477

Query: 334  MHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
            +  +++N    ED+  +   A N  G  S    V+VK
Sbjct: 5478 VAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVK 5514



 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 5/65 (7%)

Query: 419  GETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEG 478
            G+++SL C+V  TPEI      + WY+    L P+   +T ++   ATL F+ +N  D G
Sbjct: 6093 GDSVSLQCQVAGTPEIT-----VSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSG 6147

Query: 479  LYTIR 483
             YT +
Sbjct: 6148 EYTCK 6152



 Score = 44.7 bits (104), Expect = 8e-04
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 5/91 (5%)

Query: 1582 VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASD--DHCNLKFEAGRTAYFTINGVSTA 1639
            V + EG       ++ G P PEVSW ++ + +++       + F  GR A  TI  V+ A
Sbjct: 15   VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR-AKLTIPAVTKA 73

Query: 1640 DSGKYGLVVKNKYGSETSDFTVSVFIPEEEA 1670
            +SG+Y L   N  G  TS  T  + +  E A
Sbjct: 74   NSGRYSLKATNGSGQATS--TAELLVKAETA 102



 Score = 44.7 bits (104), Expect = 8e-04
 Identities = 72/366 (19%), Positives = 128/366 (34%), Gaps = 61/366 (16%)

Query: 136  YMVPIFSGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITTSKQSTASKQTTASKQ 195
            + V  F G ++ V G  D      ++  A +   N+  S+ G  T   S  + Q + + +
Sbjct: 5922 FKVNWFRGARELVKG--DRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTR 5979

Query: 196  STASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKVVIREKAERLSLR 255
                K+  A  +  +       +  ++    T  L    T +K    +   EK   ++  
Sbjct: 5980 LFV-KEPAAFLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTE 6038

Query: 256  KTL---------EETETYHAKLNED----------HLLHAPEFIIKPRSHTVWEKENVKL 296
            KT           +   Y  ++  +            L  P F+ +         ++V L
Sbjct: 6039 KTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSL 6098

Query: 297  HCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMN 356
             C +AG PE  V+WYK    +        Y   +   + TL  N  +  D+ +Y   A N
Sbjct: 6099 QCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNN---VATLVFNKVNINDSGEYTCKAEN 6155

Query: 357  VKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFG 416
              G  S+              +T F      +P SF       A + +       D+   
Sbjct: 6156 SIGTASS--------------KTVFRIQERQLPPSF-------ARQLK-------DIE-- 6185

Query: 417  REGETMSLGCRVVITPEIKHFQP-EIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKE 475
                  ++G  V +T  +    P ++ WYR+GV L   + +QT +    ATL     +  
Sbjct: 6186 -----QTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLS 6240

Query: 476  DEGLYT 481
              G Y+
Sbjct: 6241 HSGQYS 6246



 Score = 44.7 bits (104), Expect = 8e-04
 Identities = 51/263 (19%), Positives = 95/263 (36%), Gaps = 51/263 (19%)

Query: 278  EFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYI-IESRYGMHT 336
            +F+ +   +++ + + + L  +  G P   VTW KN     ++  P +   I +      
Sbjct: 7869 KFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKN----GINVTPSQRCNITTTEKSAI 7924

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTP 396
            LEI     ED  QY     N  G+ S  A +++                          P
Sbjct: 7925 LEIPSSTVEDAGQYNCYIENASGKDSCSAQILILE-----------------------PP 7961

Query: 397  YGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWV 456
            Y         F  + +      G++ SL C++  TPEI      + WY+    L P+   
Sbjct: 7962 Y---------FVKQLEPVKVSVGDSASLQCQLAGTPEIG-----VSWYKGDTKLRPTTTY 8007

Query: 457  QTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDAD---------AEIE 507
            +  +    ATL F+ ++  D G Y  +          S ++ V++            +++
Sbjct: 8008 KMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQ 8067

Query: 508  GAPAAPLDVKCLEANKDYIIISW 530
                 P+   C  +  + I +SW
Sbjct: 8068 ETVGLPVVFDCAISGSEPISVSW 8090



 Score = 44.7 bits (104), Expect = 8e-04
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             DV+T++ G+ + +   V G P P+++W K  K L  +   +L  +  R     I     A
Sbjct: 17916 DVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVE-LQIKEAVRA 17974

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
             D GKY +  KN  G       V+V
Sbjct: 17975 DHGKYIISAKNSSGHAQGSAIVNV 17998



 Score = 44.7 bits (104), Expect = 8e-04
 Identities = 29/86 (33%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1637
             L  VV ++    L L   + G P PEV W K E  L   D   ++  +  T    I+ V+
Sbjct: 25113 LRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT--DRAQIEVTSSFTM-LVIDNVT 25169

Query: 1638  TADSGKYGLVVKNKYGSETSDFTVSV 1663
               DSG+Y L ++N  GS+T+   V V
Sbjct: 25170 RFDSGRYNLTLENNSGSKTAFVNVRV 25195



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 56/255 (21%), Positives = 97/255 (38%), Gaps = 41/255 (16%)

Query: 238  KKSRKVVIREKAERLSLRKTLEETE---TYHAKLNEDHLL------HAPEFIIKPRSHTV 288
            ++  K V+  +  R+ + +T +      T+ A  N   +         P+ + + +  TV
Sbjct: 3191 QERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTV 3250

Query: 289  WEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTA 348
               +  +    I+G P+P+++WYK +  ++      K++ + +   +TL +     ED A
Sbjct: 3251 QSGKPARFCAVISGRPQPKISWYKEEQLLST-GFKCKFLHDGQ--EYTLLLIEAFPEDAA 3307

Query: 349  QYRASAMNVKG--ELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIH 406
             Y   A N  G    SA  SV V        E   +  A   PL   VT  G  +RF+  
Sbjct: 3308 VYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQ-- 3365

Query: 407  FDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERAT 466
                               CRV  T        ++ WY     + PS++ +     +   
Sbjct: 3366 -------------------CRVSGT------DLKVSWYSKDKKIKPSRFFRMTQFEDTYQ 3400

Query: 467  LTFSHLNKEDEGLYT 481
            L  +    EDEG YT
Sbjct: 3401 LEIAEAYPEDEGTYT 3415



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 110/529 (20%), Positives = 206/529 (38%), Gaps = 75/529 (14%)

Query: 1164 TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1223
            TP+ +  W KD      S +  +  K N  ++ F    + D G Y+ ++++  G +SS  
Sbjct: 4043 TPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVG-SSSCE 4101

Query: 1224 IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNA--KVNYIFNE 1281
                 L R +A      F T P+++   V+ +  G  R      K++G+   +V++  + 
Sbjct: 4102 TTFTVLDRDIA-----PFFTKPLRN---VDSVVNGTCRLDC---KIAGSLPMRVSWFKDG 4150

Query: 1282 KEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKL 1341
            KEI    +Y++     T  +E+   ++   D G +T +  +   +  S+  L+      +
Sbjct: 4151 KEIAASDRYRIAFVEGTASLEII--RVDMNDAGNFTCRATNSVGSKDSSGALI------V 4202

Query: 1342 QKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDERE-ISV 1400
            Q+   F     + K G       S +V     V LK         T I W+K  +E +S 
Sbjct: 4203 QEPPSF-----VTKPG-------SKDVLPGSAVCLKSTFQGSTPLT-IRWFKGNKELVSG 4249

Query: 1401 DEKHDFKDGICTLLITEFSK-KDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKI 1459
               +  K+ + + L     K  D+G Y   + +  G  +    L    F +      +K+
Sbjct: 4250 GSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANL----FVKEPATFVEKL 4305

Query: 1460 ALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQIN 1519
              S    ++    +  QL   VT     +K+ W  N   I+ S + +         L++ 
Sbjct: 4306 EPS----QLLKKGDATQLACKVTG-TPPIKITWFANDREIKESSKHRMSFVESTAVLRLT 4360

Query: 1520 EPTPNDKGKYVMELF-DGKTGHQKTVDLSGQA--YDEAYAEFQRLKQAAIAEKNRARVLG 1576
            +    D G+Y+ E   +  + H  ++ +  ++  + + +   + LK+             
Sbjct: 4361 DVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKPIEVLKEY------------ 4408

Query: 1577 GLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGV 1636
               DV+ + E         V G PP E++W K+   L S       F         I   
Sbjct: 4409 ---DVMLLAE---------VAGTPPFEITWFKDNTILRSGRKYK-TFIQDHLVSLQILKF 4455

Query: 1637 STADSGKYGLVVKNKYGSETSDFTVSVFIPEE-EARMAALESLKGGKKA 1684
              AD+G+Y   V N+ GS      V++  P     ++ +  SL+GG  A
Sbjct: 4456 VAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGGTAA 4504



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 51/214 (23%), Positives = 80/214 (37%), Gaps = 51/214 (23%)

Query: 278  EFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTL 337
            + + K +S  V EK+ + L C +AG PE +V W K+          GK I+ SRY   + 
Sbjct: 5142 QIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKD----------GKQIVPSRYFSMSF 5191

Query: 338  EINGCDF-------EDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPL 390
            E N   F       +D+ QY     N  G  S  A + V                    L
Sbjct: 5192 ENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRV--------------------L 5231

Query: 391  SFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPL 450
               + P          F  K        G ++ + C+V  +  I       QW+++G  +
Sbjct: 5232 DQNIPP---------SFTKKLTKMDKVLGSSIHMECKVSGSLPIS-----AQWFKDGKEI 5277

Query: 451  SPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRV 484
            S S   + +      +L  ++L  ED   YT +V
Sbjct: 5278 STSAKYRLVCHERSVSLEVNNLELEDTANYTCKV 5311



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 53/230 (23%), Positives = 86/230 (37%), Gaps = 47/230 (20%)

Query: 294  VKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRAS 353
            V   C I G    +V+WYK+ V +   AN     +   + + TL+I   D     QY  S
Sbjct: 7133 VAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFV---HNVATLQILQTDQSHIGQYNCS 7189

Query: 354  AMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDV 413
            A N  G  S+ A +++  ++              +P  F + P               D+
Sbjct: 7190 ASNPLGTASSSAKLILSEHE--------------VPPFFDLKPV------------SVDL 7223

Query: 414  SFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLN 473
            + G  G   +  C V  T  IK     I W ++   + P    +       ATLT   + 
Sbjct: 7224 ALGESG---TFKCHVTGTAPIK-----ITWAKDNREIRPGGNYKMTLVENTATLTVLKVG 7275

Query: 474  KEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANK 523
            K D G YT           Y++ +  +D+ +   G    P  +K LE ++
Sbjct: 7276 KGDAGQYTC----------YASNIAGKDSCSAQLGVQEPPRFIKKLEPSR 7315



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 83/367 (22%), Positives = 145/367 (39%), Gaps = 60/367 (16%)

Query: 1181  SPRLEVESKGNKTKMTFKDLGMDDLG--IYSCDVTDTDGIASSYLIDEEELKRLLALSHE 1238
             SP  E++++G K  +T   + +D  G  +Y      T  I +   + E EL         
Sbjct: 11439 SPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILT---VKEIELDF------- 11488

Query: 1239  HKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNT 1298
                  VP+K    V + E+ Q RF      L+  A V +      I    K+ +  D   
Sbjct: 11489 ----AVPLKD---VTVPERRQARFECV---LTREANVIWSKGPDIIKSSDKFDIIADGKK 11538

Query: 1299  GIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGP 1358
              I+   +   Q +DEG YT +++ GK T  S  + V  +  K     E Q  +       
Sbjct: 11539 HIL--VINDSQFDDEGVYTAEVE-GKKT--SARLFVTGIRLKFMSPLEDQTVK------- 11586

Query: 1359  HFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEF 1418
                        GE    + C++++ K   H+VW+K++ ++             T+LI+  
Sbjct: 11587 ----------EGETATFV-CELSHEKM--HVVWFKNDAKLHTSR---------TVLISSE 11624

Query: 1419  SKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLY 1478
              K      + +  DD  + K+++K +    +  ++E      +   D K     + I L 
Sbjct: 11625 GKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHD-KTAVEKDEITLK 11683

Query: 1479  SFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKT 1538
               V+   +D+ V W  +G  I  S +      G +  L+I +    DKG+YV +    KT
Sbjct: 11684 CEVS---KDVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKT 11740

Query: 1539  GHQKTVD 1545
                 TV+
Sbjct: 11741 KANVTVE 11747



 Score = 43.5 bits (101), Expect = 0.002
 Identities = 99/525 (18%), Positives = 179/525 (34%), Gaps = 73/525 (13%)

Query: 1164 TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1223
            +P    SW  +        + +     N   +T   L   D G Y+C  T+  G      
Sbjct: 7708 SPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAG------ 7761

Query: 1224 IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1283
               +E    L +     F    V+    +++L    V F     K +    V++     E
Sbjct: 7762 --SDECSAPLTVREPPSF----VQKPDPMDVLTGTNVTF-TSIVKGTPPFSVSWFKGSSE 7814

Query: 1284 IFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKA--TNHSTVVLVGDVFKKL 1341
            +  G +  + ++ +   +E+F        E T     + GKA  T H  +       K+L
Sbjct: 7815 LVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRL 7874

Query: 1342 QKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVD 1401
               +       I K  P  +E  ++  T   +V  K    N+              I+  
Sbjct: 7875 NDYS-------IEKGKPLILEG-TFTGTPPISVTWKKNGINVTPSQRC-------NITTT 7919

Query: 1402 EKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDK--SRLKLVDEAFKELMMEVCKKI 1459
            EK         L I   + +DAG Y   +++  GKD   +++ +++  +    +E  K  
Sbjct: 7920 EKS------AILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVS 7973

Query: 1460 ALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQIN 1519
               +  L+ Q                 ++ V+W    + +R +   K         L  N
Sbjct: 7974 VGDSASLQCQLAG------------TPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFN 8021

Query: 1520 EPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLP 1579
            +   ND G+Y+ +            ++S   +     + Q+L  +   +    +   GLP
Sbjct: 8022 QVDINDSGEYICK------AENSVGEVSASTF--LTVQEQKLPPSFSRQLRDVQETVGLP 8073

Query: 1580 DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             V            C + G  P  VSW K+ K L    +    F    TA   I     +
Sbjct: 8074 VV----------FDCAISGSEPISVSWYKDGKPLKDSPNVQTSF-LDNTATLNIFKTDRS 8122

Query: 1640 DSGKYGLVVKNKYGSETSD----FTVSVFIPEEEARMAALESLKG 1680
             +G+Y     N  GS +S      T     P  + R+A ++++ G
Sbjct: 8123 LAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVG 8167



 Score = 43.5 bits (101), Expect = 0.002
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEA-GRTAYFTINGV 1636
             L  V+T++ G  + L   V G P PEV+W K++ A        +K +    ++ F++   
Sbjct: 18207 LSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKA 18266

Query: 1637  STADSGKYGLVVKNKYGSETSDFTVSV 1663
               +D GKY +   N  GS  +  TV+V
Sbjct: 18267 KRSDGGKYVVTATNTAGSFVAYATVNV 18293



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 30/116 (25%), Positives = 51/116 (43%), Gaps = 5/116 (4%)

Query: 1552  DEAYAEFQRLKQAAIAEKNR----ARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWL 1607
             D  Y+E +    + I ++ +    A + G    ++T + G    +   + G P P+V+W 
Sbjct: 28623 DAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWK 28682

Query: 1608  KNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
               E  L   D  ++     RT   T+      DSG+Y L ++N  G +T   TV V
Sbjct: 28683 LEEMRLKETDRVSITTTKDRTT-LTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVV 28737



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 62/262 (23%), Positives = 104/262 (39%), Gaps = 55/262 (20%)

Query: 225  QATSALQQEETSEKKSRKVVIREKAERLSLRKTLEETETY-HAKLNEDHLLHAPEFIIKP 283
            QA   L+Q +  E    ++   E++ER    K  EE  ++   +L++      P  +IK 
Sbjct: 8608 QAFELLKQSQEEETHRLEIEEIERSERDE--KEFEELVSFIQQRLSQTE----PVTLIKD 8661

Query: 284  -RSHTVWEKENVKLHCSIA-GWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEING 341
              + TV +  +      I   +PE +++WYK    +       K+ I      HTL +  
Sbjct: 8662 IENQTVLKDNDAVFEIDIKINYPEIKLSWYKGTEKLEPS---DKFEISIDGDRHTLRVKN 8718

Query: 342  CDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYAS 401
            C  +D   YR     V G   A A + V                        + P     
Sbjct: 8719 CQLKDQGNYRL----VCGPHIASAKLTV------------------------IEP----- 8745

Query: 402  RFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWS 461
             +E H  D   V+  +EG+T ++ C+  + P +K      +W+RNG  L P    +T   
Sbjct: 8746 AWERHLQD---VTL-KEGQTCTMTCQFSV-PNVKS-----EWFRNGRILKPQGRHKTEVE 8795

Query: 462  GERATLTFSHLNKEDEGLYTIR 483
             +   LT + +  ED+G YT +
Sbjct: 8796 HKVHKLTIADVRAEDQGQYTCK 8817



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 22/84 (26%), Positives = 35/84 (41%), Gaps = 1/84 (1%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             D + +  G+   L  +V G P P + WL+ +K +     C +K      A   +      
Sbjct: 23633 DTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIK-NTDFKALLIVKDAIRI 23691

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
             D G+Y L   N  GS++    V V
Sbjct: 23692 DGGQYILRASNVAGSKSFPVNVKV 23715



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 1/94 (1%)

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
            P F+ K ++  + E   +++     G P P + W KN   I  H  P K  IE   G   
Sbjct: 1556 PMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYP-KIRIEGTKGEAA 1614

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
            L+I+    +D+A Y A+A+N  G  +    V V+
Sbjct: 1615 LKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVE 1648



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 29/95 (30%), Positives = 42/95 (44%), Gaps = 4/95 (4%)

Query: 277  PEFIIKPRSHTVWEK-ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMH 335
            P+FI KP    V    ++    C I G P+ RV+WY +   I      G   I+   G+ 
Sbjct: 4861 PQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFID---GLA 4917

Query: 336  TLEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
            T +I+G   E++  Y   A N  G  S    + VK
Sbjct: 4918 TFQISGARVENSGTYVCEARNDAGTASCSIELKVK 4952



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 72/365 (19%), Positives = 133/365 (36%), Gaps = 62/365 (16%)

Query: 124   LSGEEKENLPSDYMVPIFSGRQKHVSGITDTEEERIKE----AAAYIAQRNLLASEEGIT 179
             L G++ E  PSD +VP   G+  H   + D + E   E    A  +    NL   E  + 
Sbjct: 12230 LKGKKLE--PSDKVVPRSEGKV-HTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVE 12286

Query: 180   TSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKK 239
              +K           +  T  + +TA  +   SR++   +      +   + + E  ++ +
Sbjct: 12287 FTKPL---------EDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGR 12337

Query: 240   SRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCS 299
              RK+VI +      ++    + + +    N + +    EF+       V EKE  +  C 
Sbjct: 12338 VRKLVIHDCTPE-DIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFECE 12396

Query: 300   IAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKG 359
             ++     +V W+K+   I       KY I S+  +  L IN C  +D A+Y       + 
Sbjct: 12397 LSR-ENAKVKWFKDGAEIK---KGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTAR- 12451

Query: 360   ELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREG 419
               S   +V+        +E  F    + + +S                          E 
Sbjct: 12452 -TSGMLTVLE-------EEAVFTKNLANIEVS--------------------------ET 12477

Query: 420   ETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGL 479
             +T+ L C      E+     E+ WY+    +  +   + L  G +  L   + + ED G 
Sbjct: 12478 DTIKLVC------EVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGN 12531

Query: 480   YTIRV 484
             Y  R+
Sbjct: 12532 YNCRL 12536



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 26/84 (30%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             D++ I EG+ L++       P P VSW K+ K + + D   +K +   +A+  +     A
Sbjct: 14395 DIIVI-EGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKND-HISAHLEVPKSVRA 14452

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
             D+G Y + ++NK GS T+   V V
Sbjct: 14453 DAGIYTITLENKLGSATASINVKV 14476



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 50/209 (23%), Positives = 82/209 (39%), Gaps = 25/209 (11%)

Query: 286   HTVWEKE-NVKLHCSIAGWPEP-RVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCD 343
             H V E+  +VK  C I  + +  +VTWY     +    N  KY I    G+  L +    
Sbjct: 31576 HAVGEEGGHVKYVCKIENYDQSTQVTWYFG---VRQLENSEKYEITYEDGVAILYVKDIT 31632

Query: 344   FEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASR- 402
               D   YR   +N  GE S+YA + VK  +  +D   ++   +   +           R 
Sbjct: 31633 KLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYD---YYCRRTMKKIKRRTDTMRLLERP 31689

Query: 403   --FEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSP----SKWV 456
               F +   +K        GE +  G  + + PE     P + WY++G  + P     K+ 
Sbjct: 31690 PEFTLPLYNK----TAYVGENVRFGVTITVHPE-----PHVTWYKSGQKIKPGDNDKKYT 31740

Query: 457   QTLWSGERATLTFSHLNKEDEGLYTIRVR 485
                  G    LT + +  +D+  YT+  R
Sbjct: 31741 FESDKG-LYQLTINSVTTDDDAEYTVVAR 31768



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             D + +  G++  +  +++G P P + W+K ++ L++     +K     T+  ++      
Sbjct: 22551 DTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATS-LSVKDAVRV 22609

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
             DSG Y L  KN  G  +    V V
Sbjct: 22610 DSGNYILKAKNVAGERSVTVNVKV 22633



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 29/96 (30%), Positives = 42/96 (43%), Gaps = 5/96 (5%)

Query: 290   EKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQ 349
             E ++V     ++G P P + W K+  P+++   P   II      + L I     EDT  
Sbjct: 31808 EGQSVCFEIRVSGIPPPTLKWEKDGQPLSL--GPNIEIIHEGLDYYALHIRDTLPEDTGY 31865

Query: 350   YRASAMNVKGELSAYASVVVKRY---KGEFDETRFH 382
             YR +A N  G  S  A + V+R    K EF     H
Sbjct: 31866 YRVTATNTAGSTSCQAHLQVERLRYKKQEFKSKEEH 31901



 Score = 41.2 bits (95), Expect = 0.009
 Identities = 55/214 (25%), Positives = 82/214 (38%), Gaps = 51/214 (23%)

Query: 278  EFIIKPRSHTVWEKENVK--------LHCSIAGWPEPRVTWYKNQVPINVHANPGK-YII 328
            E II  + H + E E V+        L C +    +  VTW K+   +     PGK Y I
Sbjct: 3637 ELIIIDKPHFIKELEPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLP----PGKDYKI 3692

Query: 329  ESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTM 388
                 + TLEI     +D+  Y  +A N  G  S  A+V V+                  
Sbjct: 3693 CFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVRE----------------- 3735

Query: 389  PLSFGVTPYGYASRFEIHFDDKFDVSFGR-EGETMSLGCRVVITPEIKHFQPEIQWYRNG 447
            P SF                 K D S+    GE+  L C++  +P I     ++ W++N 
Sbjct: 3736 PPSFV---------------KKVDPSYLMLPGESARLHCKLKGSPVI-----QVTWFKNN 3775

Query: 448  VPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYT 481
              LS S  V+  +    A L  + +  ED G Y+
Sbjct: 3776 KELSESNTVRMYFVNSEAILDITDVKVEDSGSYS 3809



 Score = 41.2 bits (95), Expect = 0.009
 Identities = 30/121 (24%), Positives = 54/121 (44%), Gaps = 14/121 (11%)

Query: 419  GETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEG 478
            GET +L C+V  TPE+      ++WY++G  L+ S+  +  +  + ++L    + ++D G
Sbjct: 5718 GETCTLECKVAGTPELS-----VEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAG 5772

Query: 479  LYTIRVRMGEYYEQYSAYVFVRDADA---------EIEGAPAAPLDVKCLEANKDYIIIS 529
             YT +V+        +A V V D               G   A   ++C  A    I ++
Sbjct: 5773 TYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVA 5832

Query: 530  W 530
            W
Sbjct: 5833 W 5833



 Score = 41.2 bits (95), Expect = 0.009
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 1/81 (1%)

Query: 1583  TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSG 1642
             +IQ G+ L +   V G P P +SW+K+ + L      N++  A  T      G +  D G
Sbjct: 24322 SIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEG-NKDDFG 24380

Query: 1643  KYGLVVKNKYGSETSDFTVSV 1663
             KY +   N  G+ T + +V V
Sbjct: 24381 KYTVTATNSAGTATENLSVIV 24401



 Score = 40.8 bits (94), Expect = 0.011
 Identities = 104/521 (19%), Positives = 194/521 (37%), Gaps = 76/521 (14%)

Query: 1155 SLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTD 1214
            ++ FE         + W K+ V  + + + ++ +K     +  +++   D    + D T 
Sbjct: 2985 TITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGD----AADYTF 3040

Query: 1215 TDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAK 1274
              G A+S      E + +    H        +K    +++LEK +  F  + E    +  
Sbjct: 3041 VAGKATSTATLYVEARHIEFRKH--------IKD---IKVLEKKRAMF--ECEVSEPDIT 3087

Query: 1275 VNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLV 1334
            V ++ +++E+    + K  I +   +  + +   +  D G YT  +  G  +     V  
Sbjct: 3088 VQWMKDDQELQITDRIK--IQKEKYVHRLLIPSTRMSDAGKYTV-VAGGNVSTAKLFVEG 3144

Query: 1335 GDV-FKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYK 1393
             DV  + ++KE +      I KQ                  +++ +V     + H  WYK
Sbjct: 3145 RDVRIRSIKKEVQV-----IEKQ----------------RAVVEFEVNEDDVDAH--WYK 3181

Query: 1394 DEREIS--VDEKHDF--KDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFK 1449
            D  EI+  V E+H +  +  I  + I+E  + DAG Y  +     G+++S + L   A +
Sbjct: 3182 DGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA----GRNRSSVTLYVNAPE 3237

Query: 1450 --ELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKT 1507
              +++ E+      S    +  +   G              K++W      +    + K 
Sbjct: 3238 PPQVLQELQPVTVQSGKPARFCAVISGRP----------QPKISWYKEEQLLSTGFKCKF 3287

Query: 1508 GVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIA 1567
               G++  L + E  P D   Y  E  +       +  LS +   E  +  Q +     A
Sbjct: 3288 LHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEV-PEVVSPDQEMPVYPPA 3346

Query: 1568 EKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNL-KFEAG 1626
                  ++  L D VT  EG+     C V G    +VSW   +K +       + +FE  
Sbjct: 3347 ------IITPLQDTVT-SEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFED- 3397

Query: 1627 RTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPE 1667
             T    I      D G Y  V  N  G  +S   +S+  PE
Sbjct: 3398 -TYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPE 3437



 Score = 40.8 bits (94), Expect = 0.011
 Identities = 49/257 (19%), Positives = 89/257 (34%), Gaps = 50/257 (19%)

Query: 233  EETSEKKSRKVVIREKAERLSLRKT-LEETETYHAKLNEDH----------LLHAPEFII 281
            +E S     ++V  E++  L +    LE+T  Y  K++             +   P F++
Sbjct: 5275 KEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLV 5334

Query: 282  KPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEING 341
            KP          V+    + G P  ++ W+K+ V +    +  K  I        L +  
Sbjct: 5335 KPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVEL---VSGPKCFIGLEGSTSFLNLYS 5391

Query: 342  CDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYAS 401
             D   T QY     N  G  S    ++V                          P  +  
Sbjct: 5392 VDASKTGQYTCHVTNDVGSDSCTTMLLV------------------------TEPPKFVK 5427

Query: 402  RFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWS 461
            + E            + G++  L C++  +PEI+     + W+RN   L  S   +  + 
Sbjct: 5428 KLEAS-------KIVKAGDSSRLECKIAGSPEIR-----VVWFRNEHELPASDKYRMTFI 5475

Query: 462  GERATLTFSHLNKEDEG 478
               A +  ++L+ ED G
Sbjct: 5476 DSVAVIQMNNLSTEDSG 5492



 Score = 40.8 bits (94), Expect = 0.011
 Identities = 40/166 (24%), Positives = 64/166 (38%), Gaps = 21/166 (12%)

Query: 1492  WSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAY 1551
             W  +GS IR S + +    G+   L I +   +D G+Y   L  G      T  L     
Sbjct: 11151 WMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKL----- 11205

Query: 1552  DEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEK 1611
                           + E+   R +  L + VT+ +G+ L L+C +  +   +V W K+ K
Sbjct: 11206 --------------VVEELPVRFVKTLEEEVTVVKGQPLYLSCEL--NKERDVVWRKDGK 11249

Query: 1612  ALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETS 1657
              +       +    G     TIN     D+G Y + V+N    E S
Sbjct: 11250 IVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECS 11295



 Score = 40.8 bits (94), Expect = 0.011
 Identities = 61/309 (19%), Positives = 119/309 (38%), Gaps = 50/309 (16%)

Query: 1143  EVVVNVDDDGVISLN---FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKD 1199
             E V +++D  V   +   F C     K+   W ++    ++  + + E  G+  ++  KD
Sbjct: 12824 EFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKD 12883

Query: 1200  LGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVK-SELAVEILEKG 1258
               +DD   Y+C V D    A  ++ +                  +PV+      +ILE  
Sbjct: 12884 CRLDDECEYACGVEDRKSRARLFVEE------------------IPVEIIRPPQDILEAP 12925

Query: 1259  QVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTF 1318
                    AE      +V ++ N   + +G K++M  +    I  + +  ++  D+G Y F
Sbjct: 12926 GADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGK--IHRLQICDIKPRDQGEYRF 12983

Query: 1319  QLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKC 1378
               +D +A     +     +     K A+   Q+ +   G      + ++           
Sbjct: 12984 IAKDKEARAKLELAAAPKI-----KTAD---QDLVVDVGKPLTMVVPYD----------- 13024

Query: 1379  KVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDK 1438
               A  K E    W+K+   +S  +  D      +  I E  K D G Y+++L++  GK +
Sbjct: 13025 --AYPKAEAE--WFKENEPLST-KTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAE 13079

Query: 1439  S--RLKLVD 1445
                 LK++D
Sbjct: 13080 GFINLKVID 13088



 Score = 40.4 bits (93), Expect = 0.015
 Identities = 52/250 (20%), Positives = 85/250 (34%), Gaps = 51/250 (20%)

Query: 252  LSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWY 311
            +S   TL  TE Y            P F+ +P+S T +  +  K  C++ G P     W 
Sbjct: 3537 VSCTATLTVTEAY-----------PPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQ 3585

Query: 312  KNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKR 371
            K+   ++   N   + I      H LE++    +D   Y   A N  G     A +++  
Sbjct: 3586 KDGAALSPSPN---WRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELII-- 3640

Query: 372  YKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVIT 431
                 D+  F            + P   A   ++H + + D              +V +T
Sbjct: 3641 ----IDKPHFIK---------ELEPVQSAINKKVHLECQVDED-----------RKVTVT 3676

Query: 432  PEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYE 491
                       W ++G  L P K  +  +  + ATL       +D G Y           
Sbjct: 3677 -----------WSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSS 3725

Query: 492  QYSAYVFVRD 501
              SA V VR+
Sbjct: 3726 SCSATVTVRE 3735



 Score = 40.4 bits (93), Expect = 0.015
 Identities = 51/252 (20%), Positives = 86/252 (34%), Gaps = 46/252 (18%)

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
            P F+ KP S  V     V L  +  G     + W+K    +    + G   I       +
Sbjct: 4206 PSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKEL---VSGGSCYITKEALESS 4262

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTP 396
            LE+      D+  Y     NV G +   A++ VK                         P
Sbjct: 4263 LELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKE------------------------P 4298

Query: 397  YGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWV 456
              +  + E            ++G+   L C+V  TP IK     I W+ N   +  S   
Sbjct: 4299 ATFVEKLE-------PSQLLKKGDATQLACKVTGTPPIK-----ITWFANDREIKESSKH 4346

Query: 457  QTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDV 516
            +  +    A L  + +  ED G Y    +     +  S+ V V++       +P    + 
Sbjct: 4347 RMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKE-------SPYFTKEF 4399

Query: 517  KCLEANKDYIII 528
            K +E  K+Y ++
Sbjct: 4400 KPIEVLKEYDVM 4411



 Score = 40.4 bits (93), Expect = 0.015
 Identities = 29/85 (34%), Positives = 37/85 (43%), Gaps = 3/85 (3%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVST- 1638
             D V ++ G+A  L  +V G PPP + W K+ K L       +K     T    +N  ST 
Sbjct: 21469 DTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTN--LVNKDSTR 21526

Query: 1639  ADSGKYGLVVKNKYGSETSDFTVSV 1663
              DSG Y L   N  G     F V V
Sbjct: 21527 RDSGAYTLTATNPGGFAKHIFNVKV 21551



 Score = 40.4 bits (93), Expect = 0.015
 Identities = 36/155 (23%), Positives = 63/155 (40%), Gaps = 16/155 (10%)

Query: 1510  TGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEK 1569
             +G+  W + N+    DK   +  L +         +   + + E      R ++ A++ K
Sbjct: 30472 SGDSAWKKSNKERIKDKQFTIGGLLEA-------TEYEFRVFAENETGLSRPRRTAMSIK 30524

Query: 1570  NRARVLGGLPDV------VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKF 1623
              +    G  P +      VT + G+A  L+C + G P P++ W +  K L       +  
Sbjct: 30525 TKL-TSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSS 30583

Query: 1624  EAGRTAYFTINGVSTADSGKYGLVVKNKYGS-ETS 1657
             + GRT   T+      D G Y  +  N+ G  ETS
Sbjct: 30584 D-GRTHTLTVMTEEQEDEGVYTCIATNEVGEVETS 30617



 Score = 40.0 bits (92), Expect = 0.019
 Identities = 112/546 (20%), Positives = 188/546 (34%), Gaps = 108/546 (19%)

Query: 1110 SYVFRVRAINQAGVGKPSDLAGPVVAETRP-----GTKEVVVNVDDDGVISLNFECDKMT 1164
            +Y F + A+  +  G+ S  +  V+   +      GTK V+             EC    
Sbjct: 2424 NYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVL-------------ECKVSV 2470

Query: 1165 PK-SEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1223
            P  +   W  +    +   R++   KG K ++        D G Y   V     + ++  
Sbjct: 2471 PDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIV---GRVETNCN 2527

Query: 1224 IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1283
            +  E++K +  L       T  V  E  VE+   G    W               F +KE
Sbjct: 2528 LSVEKIKIIRGLRDLTCTETQNVVFE--VELSHSGIDVLWN--------------FKDKE 2571

Query: 1284 IFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQK 1343
            I    KYK  I+ +  I ++ +  +  +DEG YTF   +   +   TV   G + K L  
Sbjct: 2572 IKPSSKYK--IEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVA-GGAISKPLTD 2628

Query: 1344 EAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEK 1403
            +   + QE                       + +C+VAN   ++   W +D + + +   
Sbjct: 2629 QTVAESQE----------------------AVFECEVAN--PDSKGEWLRDGKHLPLTNN 2664

Query: 1404 -HDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALS 1462
                 DG    LI   +K D  I E   K    K  ++LK+  EA          KI  +
Sbjct: 2665 IRSESDGHKRRLIIAATKLD-DIGEYTYKVATSKTSAKLKV--EAV---------KIKKT 2712

Query: 1463 ATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPT 1522
              +L +  T + +         V+   V W  NG  +  +++    V G    L+I    
Sbjct: 2713 LKNLTVTETQDAVFTVELTHPNVKG--VQWIKNGVVLESNEKYAISVKGTIYSLRIKNCA 2770

Query: 1523 PNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVV 1582
              D+  Y   L  G+ G    +                ++   I +K         P  V
Sbjct: 2771 IVDESVYGFRL--GRLGASARL---------------HVETVKIIKK---------PKDV 2804

Query: 1583 TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSG 1642
            T  E   +    +V  D  P V W      +   D   L  E  +     +  +S +D+G
Sbjct: 2805 TALENATVAFEVSVSHDTVP-VKWFHKSVEIKPSDKHRLVSER-KVHKLMLQNISPSDAG 2862

Query: 1643 KYGLVV 1648
            +Y  VV
Sbjct: 2863 EYTAVV 2868



 Score = 40.0 bits (92), Expect = 0.019
 Identities = 26/94 (27%), Positives = 42/94 (44%), Gaps = 3/94 (3%)

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
            P F  KP      +  +V L C + G P   V+WYK++  +    +  KY I S   + +
Sbjct: 7399 PIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELR---SGKKYKIMSENFLTS 7455

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
            + I   D  D  +Y+  A N  G  +   S+ +K
Sbjct: 7456 IHILNVDAADIGEYQCKATNDVGSDTCVGSIALK 7489



 Score = 40.0 bits (92), Expect = 0.019
 Identities = 41/193 (21%), Positives = 67/193 (34%), Gaps = 36/193 (18%)

Query: 292  ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYR 351
            E+    C + G    +V+W K+   I    + GKY I        L +   D  D+ QY 
Sbjct: 8168 ESADFECHVTGTQPIKVSWAKDSREIR---SGGKYQISYLENSAHLTVLKVDKGDSGQYT 8224

Query: 352  ASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKF 411
              A+N  G+ S  A + +K                       + P  +  R     ++  
Sbjct: 8225 CYAVNEVGKDSCTAQLNIKE---------------------RLIPPSFTKRLSETVEE-- 8261

Query: 412  DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSH 471
                  EG +  L  RV  +  I      + WY+N + + P+   +  +      L    
Sbjct: 8262 -----TEGNSFKLEGRVAGSQPI-----TVAWYKNNIEIQPTSNCEITFKNNTLVLQVRK 8311

Query: 472  LNKEDEGLYTIRV 484
                D GLYT +V
Sbjct: 8312 AGMNDAGLYTCKV 8324



 Score = 40.0 bits (92), Expect = 0.019
 Identities = 29/86 (33%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1637
             L  VVTI+    L L   + G P PEV W ++     S D  +++  +  T    +  V+
Sbjct: 21866 LRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGE--SLDKASIESTSSYTLLI-VGNVN 21922

Query: 1638  TADSGKYGLVVKNKYGSETSDFTVSV 1663
               DSGKY L V+N  GS+++   V V
Sbjct: 21923 RFDSGKYILTVENSSGSKSAFVNVRV 21948



 Score = 40.0 bits (92), Expect = 0.019
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1637
             L  ++ I+ G +L L   + G P PEV W K +  +   D   +   +  T+   ++ V+
Sbjct: 22948 LRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIR--DAAIIDVTSSFTS-LVLDNVN 23004

Query: 1638  TADSGKYGLVVKNKYGSETSDFTVSV 1663
               DSGKY L ++N  G++++  TV V
Sbjct: 23005 RYDSGKYTLTLENSSGTKSAFVTVRV 23030



 Score = 40.0 bits (92), Expect = 0.019
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 7/82 (8%)

Query: 1584  IQEGKALNLTCNVWGDPPPEVSWLKNEK--ALASDDHCNLKFEAGRTAYFTINGVSTADS 1641
             ++ G ++ L     G P P   W K +   +L +D H    F        T+   +  D+
Sbjct: 28369 VRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTTDSFST-----LTVENCNRNDA 28423

Query: 1642  GKYGLVVKNKYGSETSDFTVSV 1663
             GKY L V+N  GS++  FTV V
Sbjct: 28424 GKYTLTVENNSGSKSITFTVKV 28445



 Score = 40.0 bits (92), Expect = 0.019
 Identities = 27/78 (34%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1356  QGPHFVEYL-SWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVD----EKHDFKDGI 1410
             Q PHF E L +  V  + N  L CKV    K   + WY+  +EI  D       +FK G 
Sbjct: 30926 QAPHFKEELRNLNVRYQSNATLVCKVTGHPKPI-VKWYRQGKEIIADGLKYRIQEFKGGY 30984

Query: 1411  CTLLITEFSKKDAGIYEV 1428
               L+I   +  DA +Y+V
Sbjct: 30985 HQLIIASVTDDDATVYQV 31002



 Score = 39.7 bits (91), Expect = 0.025
 Identities = 34/135 (25%), Positives = 52/135 (38%), Gaps = 9/135 (6%)

Query: 245   IREKAERLSL-----RKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENV-KLHC 298
             I EK  ++S      +KT E T T   +      + +   I+     T    ++V K   
Sbjct: 32814 IHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAV 32873

Query: 299   SIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVK 358
                G P P   W K+   I      GKY +    G   LEI+  D  D+  Y  +  N  
Sbjct: 32874 KATGEPRPTAIWTKDGKAIT---QGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSA 32930

Query: 359   GELSAYASVVVKRYK 373
             G +S+   + +K  K
Sbjct: 32931 GSVSSSCKLTIKAIK 32945



 Score = 39.3 bits (90), Expect = 0.033
 Identities = 36/157 (22%), Positives = 63/157 (40%), Gaps = 10/157 (6%)

Query: 1511  GEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKN 1570
             G   W+   EP    K + V  L +GK    +   L+ Q   +     + ++     E  
Sbjct: 13630 GSDKWVACGEPVAETKME-VTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAP 13688

Query: 1571  R----ARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAG 1626
                   ++L GL    T++ G  + L   V G P P+++W K +  L  D    ++    
Sbjct: 13689 EIFLDVKLLAGL----TVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIE-NVP 13743

Query: 1627  RTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
             + +  TI     +D+G Y +   N  G  T+   V+V
Sbjct: 13744 KKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 13780



 Score = 39.3 bits (90), Expect = 0.033
 Identities = 46/191 (24%), Positives = 78/191 (40%), Gaps = 11/191 (5%)

Query: 180   TSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKK 239
             TS Q + S Q   S Q +ASKQ  +    ++S  S+ +     S  A S    +E+  + 
Sbjct: 33242 TSLQGSFSSQ---SVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEM 33298

Query: 240   SRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCS 299
             S    +      +S    LE + +   K     +   P+    P   ++ E + + + C+
Sbjct: 33299 SSSSFMG-----ISNMTQLESSTSKMLKAGIRGI--PPKIEALPSDISIDEGKVLTVACA 33351

Query: 300   IAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKG 359
               G P P VTW      I+     G++ IE+   + TL I     +D   Y  S  N  G
Sbjct: 33352 FTGEPTPEVTWSCGGRKIH-SQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFG 33410

Query: 360   ELSAYASVVVK 370
               SA  ++ ++
Sbjct: 33411 SDSATVNIHIR 33421



 Score = 38.9 bits (89), Expect = 0.043
 Identities = 54/228 (23%), Positives = 97/228 (42%), Gaps = 27/228 (11%)

Query: 144  RQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITTSKQSTASKQT-----TASKQSTA 198
            R KH  G T      ++EA   +    L+ S++ +    Q TA  Q      TA     +
Sbjct: 1159 RNKH--GETSASASLLEEADYEL----LMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYS 1212

Query: 199  SKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKVVIREKAERLSLRKTL 258
              +    K+    R+  A    VV     + ++ +E       + +I+E   R+ ++ TL
Sbjct: 1213 EYEKEYEKEQALIRKKMAKDTVVVR----TYVEDQEFHISSFEERLIKEIEYRI-IKTTL 1267

Query: 259  EET------ETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYK 312
            EE       E     ++E   + +  F  + +++ + E   V  HC ++G+P P++ WYK
Sbjct: 1268 EELLEEDGEEKMAVDISESEAVESG-FDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYK 1326

Query: 313  NQVPINVHANPGKYIIE-SRYGMHTLEINGCDFEDTAQYRASAMNVKG 359
            +   I    +  +Y ++  + G  +L I     ED   Y A A N+KG
Sbjct: 1327 DGKRIK---HGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKG 1371



 Score = 38.9 bits (89), Expect = 0.043
 Identities = 63/315 (20%), Positives = 110/315 (34%), Gaps = 43/315 (13%)

Query: 171  LLASEEGITTSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSA- 229
            +L  +EGI T+  S        S +      +     +        SR   +S ++ S  
Sbjct: 1354 VLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRS 1413

Query: 230  -LQQEETSEKKSRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTV 288
             ++        +R    R    R+S  + LEET+      ++   L+ P F++KP S   
Sbjct: 1414 PIRMSPARMSPARMSPARMSPARMSPGRRLEETDE-----SQLERLYKPVFVLKPVSFKC 1468

Query: 289  WEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTA 348
             E +  +    + G P P   W+ +   I V+    K +I+   G  +L I      D+ 
Sbjct: 1469 LEGQTARFDLKVVGRPMPETFWFHDGQQI-VNDYTHKVVIKED-GTQSLIIVPATPSDSG 1526

Query: 349  QYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFD 408
            ++   A N  G  S    + V+  + +                  V P          F 
Sbjct: 1527 EWTVVAQNRAGRSSISVILTVEAVEHQ------------------VKPM---------FV 1559

Query: 409  DKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGER--AT 466
            +K      +EG  + +  R    P      P+I W +N   + P K+ +    G +  A 
Sbjct: 1560 EKLKNVNIKEGSRLEMKVRATGNP-----NPDIVWLKNSDIIVPHKYPKIRIEGTKGEAA 1614

Query: 467  LTFSHLNKEDEGLYT 481
            L       +D   YT
Sbjct: 1615 LKIDSTVSQDSAWYT 1629



 Score = 38.9 bits (89), Expect = 0.043
 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 3/94 (3%)

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
            P F  KP      +  +V L C I+G P   V W K++  +    N  K+ I S++   +
Sbjct: 6458 PVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVR---NSKKFKITSKHFDTS 6514

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
            L I   +  D  +Y   A N  G  +   SV  K
Sbjct: 6515 LHILNLEASDVGEYHCKATNEVGSDTCSCSVKFK 6548



 Score = 38.5 bits (88), Expect = 0.056
 Identities = 51/214 (23%), Positives = 73/214 (34%), Gaps = 41/214 (19%)

Query: 272  HLL-HAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIES 330
            HLL   P F+ K         + V L  ++ G     VTW K Q  I      GK  +  
Sbjct: 3918 HLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIR---EDGKIKMSF 3974

Query: 331  RYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPL 390
              G+  L I         +Y   A N  G  ++   ++VK                    
Sbjct: 3975 SNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKE------------------- 4015

Query: 391  SFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPL 450
                 P     R E+       V+    G+  +L   V  TPE+K      +WY++G PL
Sbjct: 4016 -----PAKIIERAEL-----IQVT---AGDPATLEYTVAGTPELKP-----KWYKDGRPL 4057

Query: 451  SPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRV 484
              SK  +  +    A L F      D G YT  +
Sbjct: 4058 VASKKYRISFKNNVAQLKFYSAELHDSGQYTFEI 4091



 Score = 38.5 bits (88), Expect = 0.056
 Identities = 43/205 (20%), Positives = 75/205 (36%), Gaps = 39/205 (19%)

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
            P F +KP S  +   E+    C + G    ++TW K+   I    N    ++E+   +  
Sbjct: 7212 PFFDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTV 7271

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTP 396
            L++      D  QY   A N+ G+ S  A + V+                         P
Sbjct: 7272 LKVGK---GDAGQYTCYASNIAGKDSCSAQLGVQE------------------------P 7304

Query: 397  YGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWV 456
              +  + E            ++ E     C++  +PEIK     + WY++   +  S   
Sbjct: 7305 PRFIKKLE-------PSRIVKQDEFTRYECKIGGSPEIK-----VLWYKDETEIQESSKF 7352

Query: 457  QTLWSGERATLTFSHLNKEDEGLYT 481
            +  +    A L   +L+ ED G YT
Sbjct: 7353 RMSFVDSVAVLEMHNLSVEDSGDYT 7377



 Score = 38.5 bits (88), Expect = 0.056
 Identities = 76/371 (20%), Positives = 137/371 (36%), Gaps = 83/371 (22%)

Query: 231   QQEETSEKKSRKVVIREKAERLSLRK--TLEETETYHAKLNEDH------LLHAPEFIIK 282
             + ++T E   +  VI +  +R+ + K  TL++  TY   +          ++     ++ 
Sbjct: 12586 RDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIVVP 12645

Query: 283   PRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGC 342
              +   V E++ V  +C +      +  W++N+  I    +  KYII  +  ++TL I   
Sbjct: 12646 LKDTRVKEQQEVVFNCEV-NTEGAKAKWFRNEEAI---FDSSKYIILQKDLVYTLRIRDA 12701

Query: 343   DFEDTAQYRASAMNVKGE-LSAYASVVVKR------------YKGEFDETRFHAGASTMP 389
               +D A Y  S  N +GE + + A+++V+                E     F    + + 
Sbjct: 12702 HLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLN 12761

Query: 390   LSFGVTPYGYASRFEIHFD-------DKF-------DVSFGREGETM-------SLGCRV 428
             ++   T  G     E+ FD       DK+       D  F  EGE +       S+   +
Sbjct: 12762 VTLKWTKNGE----EVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELL 12817

Query: 429   VI---TPEIKHFQPE--------------------IQWYRNGVPLSPSKWVQTLWSGERA 465
             +I   T  ++H + +                    ++WYRNG  +   K  +    G   
Sbjct: 12818 IIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIH 12877

Query: 466   TLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLD------VKCL 519
              L       +DE  Y      G    +  A +FV +   EI   P   L+      V   
Sbjct: 12878 RLIIKDCRLDDECEYA----CGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLA 12933

Query: 520   EANKDYIIISW 530
             E NKD + + W
Sbjct: 12934 ELNKDKVEVQW 12944



 Score = 38.5 bits (88), Expect = 0.056
 Identities = 27/105 (25%), Positives = 47/105 (44%), Gaps = 5/105 (4%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKAL--ASDDHCNLKFEAGRTAYFTINGVS 1637
             D + ++ G+ +++  +V G P P++ W KNE  +   +D     K E  R+   T   + 
Sbjct: 15406 DTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIP 15465

Query: 1638  TA---DSGKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALESLK 1679
              A   D G Y +   N+ GS   +  V V+      R  A+  +K
Sbjct: 15466 KAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIK 15510



 Score = 38.1 bits (87), Expect = 0.073
 Identities = 27/122 (22%), Positives = 55/122 (45%), Gaps = 7/122 (5%)

Query: 1532 ELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALN 1591
            +L +G+ G Q+  +L   A++ A       ++    EK +  ++   P+ V + EG+   
Sbjct: 1805 QLPEGRKGLQRIEELERMAHEGALTGVTTDQK----EKQKPDIVL-YPEPVRVLEGETAR 1859

Query: 1592 LTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNK 1651
              C V G P P+V+W  N + +       ++++     Y  I    + D+G+  +  +N 
Sbjct: 1860 FRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG--IHYLDIVDCKSYDTGEVKVTAENP 1917

Query: 1652 YG 1653
             G
Sbjct: 1918 EG 1919



 Score = 38.1 bits (87), Expect = 0.073
 Identities = 36/174 (20%), Positives = 69/174 (39%), Gaps = 20/174 (11%)

Query: 1158  FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
             F C+    K    W K+      S  + + S+G   K+  K++ +DD+      V +   
Sbjct: 11593 FVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSS 11652

Query: 1218  IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNY 1277
              A   +++ +             + TV +  + AV   EK ++    +  K   +  V +
Sbjct: 11653 TAQLKVLEAD------------PYFTVKLHDKTAV---EKDEITLKCEVSK---DVPVKW 11694

Query: 1278  IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTV 1331
               + +EI   PKY +  D    I++  ++K   +D+G Y       K   + TV
Sbjct: 11695 FKDGEEIVPSPKYSIKADGLRRILK--IKKADLKDKGEYVCDCGTDKTKANVTV 11746



 Score = 37.7 bits (86), Expect = 0.095
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 3/78 (3%)

Query: 293  NVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRA 352
            ++ + C ++G       W+K+   I+  A   KY +       +LE+N  + EDTA Y  
Sbjct: 5253 SIHMECKVSGSLPISAQWFKDGKEISTSA---KYRLVCHERSVSLEVNNLELEDTANYTC 5309

Query: 353  SAMNVKGELSAYASVVVK 370
               NV G+ +    + VK
Sbjct: 5310 KVSNVAGDDACSGILTVK 5327



 Score = 37.7 bits (86), Expect = 0.095
 Identities = 158/804 (19%), Positives = 285/804 (35%), Gaps = 152/804 (18%)

Query: 903   VQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDK--- 959
             +++   PPP++  P+   +   LK +    PP+PP +    + F+   +   K P+K   
Sbjct: 10855 IKKPEAPPPKEPEPEKVIEKPKLKPRPPPPPPAPPKEDVKEKIFQLKAIPKKKVPEKPQV 10914

Query: 960   -----IGGAEITGYYVNYREVI-DGVPGKWREANVKAV-----SEEAYKISNLKENMVYQ 1008
                  +   ++ G     R+++ +  P    E  +K+V      EE  K+   K   V +
Sbjct: 10915 PEKVELTPLKVPGGEKKVRKLLPERKPEPKEEVVLKSVLRKRPEEEEPKVEPKKLEKVKK 10974

Query: 1009  FQVAA----MNMAGLGAPSA------VSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQ 1058
               V        +  +  P+       + E  K  E   A+P P    K     +   +  
Sbjct: 10975 PAVPEPPPPKPVEEVEVPTVTKRERKIPEPTKVPEIKPAIPLPAPEPKPKPEAEVKTIKP 11034

Query: 1059  WKPPVHSGRTP----VTGYFVDLK-EAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVF 1113
               PPV    TP    VT   V  K EAKA +++     +  IK V  K     E      
Sbjct: 11035 --PPVEPEPTPIAAPVTVPVVGKKAEAKAPKEE-AAKPKGPIKGVPKKTPSPIEAERRKL 11091

Query: 1114  RVRAINQAGVGKPSDLAG------PVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKS 1167
             R  +    G  KP D A        V  +     K++++   +    S  FEC      +
Sbjct: 11092 RPGS----GGEKPPDEAPFTYQLKAVPLKFVKEIKDIILTESEFVGSSAIFECLVSPSTA 11147

Query: 1168  EFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEE 1227
               +W KD  +  +SP+    + G   K+   D+ + D G Y+C                 
Sbjct: 11148 ITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTC----------------- 11190

Query: 1228  ELKRLLALSHEHKFPTVP-VKSELAVEILEKGQVRFW-MQAEKLSGNAKVNYIFNEKEIF 1285
                 +L L ++ K  T   V  EL V  ++  +     ++ + L  + ++N    E+++ 
Sbjct: 11191 ----VLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSCELN---KERDVV 11243

Query: 1286  EGPKYKMHIDRNTGII--------EMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDV 1337
                  K+ +++   I+         + +    D D GTYT  +++      S+ V V +V
Sbjct: 11244 WRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEV 11303

Query: 1338  FKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDERE 1397
              +           +W+ K            V  +   +  C +A  K   +I W+K   E
Sbjct: 11304 IR-----------DWLVK------PIRDQHVKPKGTAIFACDIA--KDTPNIKWFKGYDE 11344

Query: 1398  ISV---DEKHDFKDG-ICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMM 1453
             I     D+    +DG    L I     +D   Y V ++  R                   
Sbjct: 11345 IPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKR------------------- 11385

Query: 1454  EVCKKIALSATDLKIQSTAEGIQLY-----SFVTYYVE-DLKVNWSHNGSAIRYSDRVKT 1507
                 K+ L   ++++    E + +Y     SF     E D+   W   G  +R S   + 
Sbjct: 11386 -YPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSPTCEI 11444

Query: 1508  GVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIA 1567
                G + +L +++   +  G+ + +  +  T    T  L+ +  +  +A    LK   + 
Sbjct: 11445 KAEGGKRFLTLHKVKLDQAGEVLYQALNAIT----TAILTVKEIELDFA--VPLKDVTVP 11498

Query: 1568  EKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGR 1627
             E+ +AR      + V  +E                 V W K    + S D  ++    G+
Sbjct: 11499 ERRQARF-----ECVLTREA---------------NVIWSKGPDIIKSSDKFDI-IADGK 11537

Query: 1628  TAYFTINGVSTADSGKYGLVVKNK 1651
                  IN     D G Y   V+ K
Sbjct: 11538 KHILVINDSQFDDEGVYTAEVEGK 11561



 Score = 37.7 bits (86), Expect = 0.095
 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 1/83 (1%)

Query: 1581  VVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTAD 1640
             +V  + G  + +   V G P P V+W K ++ L      N +  A  T    IN    +D
Sbjct: 21074 LVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATST-ILNINECVRSD 21132

Query: 1641  SGKYGLVVKNKYGSETSDFTVSV 1663
             SG Y L  +N  G      T+ V
Sbjct: 21133 SGPYPLTARNIVGEVGDVITIQV 21155



 Score = 37.7 bits (86), Expect = 0.095
 Identities = 18/77 (23%), Positives = 36/77 (46%)

Query: 1587  GKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGL 1646
             G+ +++     G P P ++W K +  + ++ H  +      T+    NGV   D+G Y +
Sbjct: 31042 GEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVV 31101

Query: 1647  VVKNKYGSETSDFTVSV 1663
               KN++G +     + V
Sbjct: 31102 CAKNRFGIDQKTVELDV 31118



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 25/94 (26%), Positives = 39/94 (41%), Gaps = 3/94 (3%)

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
            P F   P      +   V L C ++G P   V WYK++  +    +  KY I S+    +
Sbjct: 5517 PVFSSFPPIVETLKNAEVSLECELSGTPPFEVVWYKDKRQLR---SSKKYKIASKNFHTS 5573

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
            + I   D  D  +Y   A N  G  +   +V +K
Sbjct: 5574 IHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLK 5607



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 21/84 (25%), Positives = 33/84 (39%), Gaps = 3/84 (3%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             D + +  G  + +   V G PPP V+W  NE+ L  +           ++   I     +
Sbjct: 16532 DRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIE---TTAISSSMVIKNCQRS 16588

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
               G Y L+ KN+ G       V V
Sbjct: 16589 HQGVYSLLAKNEAGERKKTIIVDV 16612



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1637
             +  ++T++ G  + L   V+G P P VSW K+   L   +   +  +        +  V+
Sbjct: 19301 MKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQR-NLCTLELFSVN 19359

Query: 1638  TADSGKYGLVVKNKYGSETSDFTVSV 1663
               DSG Y +  +N  GS+++   + V
Sbjct: 19360 RKDSGDYTITAENSSGSKSATIKLKV 19385



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 20/79 (25%), Positives = 35/79 (44%), Gaps = 1/79 (1%)

Query: 1583  TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSG 1642
             ++Q G+ L +   + G P P ++W K+   L      N+      T   +I      D G
Sbjct: 23240 SVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTT-LSIKETHKDDGG 23298

Query: 1643  KYGLVVKNKYGSETSDFTV 1661
             +YG+ V N  G +T+   +
Sbjct: 23299 QYGITVANVVGQKTASIEI 23317



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 3/84 (3%)

Query: 1582  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADS 1641
             + +  G+ + L   + G PPP  SW      L   +   ++    + A  TI   +  D+
Sbjct: 29748 IHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHT-KVAKLTIRETTIRDT 29806

Query: 1642  GKYGLVVKNKYGSETSDFTVSVFI 1665
             G+Y L +KN  G  T+  T+ V I
Sbjct: 29807 GEYTLELKNVTG--TTSETIKVII 29828



 Score = 37.0 bits (84), Expect = 0.16
 Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 8/93 (8%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLK-------NEKALASDDHCNLKFEAGRTAY 1630
             L + + ++EG  +N+   + G P P ++W K       N++ +  D H N K     T  
Sbjct: 16122 LKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVN-KLVVDDTCT 16180

Query: 1631  FTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
               I     +D+G Y +   N  G+ + +  ++V
Sbjct: 16181 LVIPQSRRSDTGLYTITAVNNLGTASKEMRLNV 16213



 Score = 37.0 bits (84), Expect = 0.16
 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 19/86 (22%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKN-----EKA----LASDDHCNLKFEAGRTAY 1630
             DV+ ++ G+ L +  ++ G P P +SW K+     E+A    +++D+H  L         
Sbjct: 25797 DVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLL--------- 25847

Query: 1631  FTINGVSTADSGKYGLVVKNKYGSET 1656
              T+      D+G+Y L +KN  G+ +
Sbjct: 25848 -TVKDCIRRDTGQYVLTLKNVAGTRS 25872



 Score = 36.2 bits (82), Expect = 0.28
 Identities = 27/96 (28%), Positives = 40/96 (41%), Gaps = 4/96 (4%)

Query: 279  FIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQ-VPINVHANPGKYIIESRYGMHTL 337
            F+ +P+S  V EK        + G P P V W K +   +N     G+  I  +     L
Sbjct: 8456 FVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLN---QGGRVFIHQKGDEAKL 8512

Query: 338  EINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYK 373
            EI      D+  YR  A N  GE+ +  ++ V   K
Sbjct: 8513 EIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERK 8548



 Score = 36.2 bits (82), Expect = 0.28
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 293   NVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRA 352
             ++++   I G P P VTW K+ + +   AN     IE+      L I  C+  DT ++  
Sbjct: 20793 SIRIFVPIKGRPAPEVTWTKDNINLKNRAN-----IENTESFTLLIIPECNRYDTGKFVM 20847

Query: 353   SAMNVKGELSAYASVVV 369
             +  N  G+ S + +V V
Sbjct: 20848 TIENPAGKKSGFVNVRV 20864



 Score = 36.2 bits (82), Expect = 0.28
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 2/85 (2%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKAL-ASDDHCNLKFEAGRTAYFTINGVST 1638
             DV+ +  G+   L  ++ G P P+V W K+ K L  +     +K    +T     + + T
Sbjct: 24715 DVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRT 24774

Query: 1639  ADSGKYGLVVKNKYGSETSDFTVSV 1663
              D G+Y L + N  G+++   TV V
Sbjct: 24775 -DGGQYILKLSNVGGTKSIPITVKV 24798



 Score = 35.8 bits (81), Expect = 0.36
 Identities = 24/94 (25%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 277 PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
           P F+ + +S TV +   V+L   + G P P V +Y++   I    +   + I     +++
Sbjct: 104 PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLD---FQISQEGDLYS 160

Query: 337 LEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
           L I     ED+  Y  +A N  G  ++ A ++V+
Sbjct: 161 LLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 35.8 bits (81), Expect = 0.36
 Identities = 38/153 (24%), Positives = 61/153 (39%), Gaps = 11/153 (7%)

Query: 221   VVSKQATSALQQEETSEKKSRKVVIREKA-ERLSLRKTLEETETYHAKLNEDHLLHAPEF 279
             V   +  +  + E T  ++ +    R KA  R    K    TE   A   ++    APE 
Sbjct: 13635 VACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQE----APEI 13690

Query: 280   IIKPR---SHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
              +  +     TV     ++L  ++ G PEP++TW K  +   +     +  IE+     T
Sbjct: 13691 FLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADM---ILKQDKRITIENVPKKST 13747

Query: 337   LEINGCDFEDTAQYRASAMNVKGELSAYASVVV 369
             + I      DT  Y   A+NV G  +A   V V
Sbjct: 13748 VTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 13780



 Score = 35.8 bits (81), Expect = 0.36
 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             +VV  + G ++ L   + G P P + W K++K L ++    ++      A   I      
Sbjct: 26880 EVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVE-NTTDLASILIKDADRL 26938

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
             +SG Y L ++N  GS ++   V +
Sbjct: 26939 NSGCYELKLRNAMGSASATIRVQI 26962



 Score = 35.4 bits (80), Expect = 0.47
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             D + I+ G++L +   V G P P V+W K+   +    +  +    G T+ F +   +  
Sbjct: 27966 DGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLF-VRDATRD 28024

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
               G Y +  KN  GS  ++  V V
Sbjct: 28025 HRGVYTVEAKNASGSAKAEIKVKV 28048



 Score = 35.0 bits (79), Expect = 0.62
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 439 PEIQWYRNGVPLSPS--KWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAY 496
           PE+ W+R+G  +S S    VQ  +S  RA LT   + K + G Y+++   G      +A 
Sbjct: 35  PEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAE 94

Query: 497 VFVR 500
           + V+
Sbjct: 95  LLVK 98



 Score = 35.0 bits (79), Expect = 0.62
 Identities = 51/247 (20%), Positives = 100/247 (40%), Gaps = 40/247 (16%)

Query: 14  DLSYRNKDVRST------VSHYQREKKRSAVYTQGSTAYSSRSSAAHRRESEAFRRASAS 67
           +L  R K+V +T      V+H Q  K+    +           SAA  +E E       +
Sbjct: 490 ELKSRTKEVITTKQEQMHVTHEQIRKETEKTFVPKVVI-----SAAKAKEQETRISEEIT 544

Query: 68  SSQQQASQHALSSEVSRKAASAYDYGSSHGLTDSSLLLDDYSSKLSPKPKRAKHSLLSGE 127
             Q+Q +Q A+  E    AAS     ++             S+KL   P          +
Sbjct: 545 KKQKQVTQEAIRQETEITAASMVVVATAK------------STKLETVP--------GAQ 584

Query: 128 EKENLPSDYMVPIFSGRQKHVSGITDTEEERIKEAAAYIAQRNLLA-SEEGITTSKQSTA 186
           E+     D M       +K +     T   ++  A   + +++L++   EGITT ++   
Sbjct: 585 EETTTQQDQM---HLSYEKIMKETRKTVVPKVIVATPKVKEQDLVSRGREGITTKREQVQ 641

Query: 187 SKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKVVIR 246
             Q    K++  +  ST +  +  +++    +++++  + T A +QE+  +    KV + 
Sbjct: 642 ITQEKMRKEAEKTALSTIAVATAKAKE----QETILRTRETMATRQEQI-QVTHGKVDVG 696

Query: 247 EKAERLS 253
           +KAE ++
Sbjct: 697 KKAEAVA 703



 Score = 35.0 bits (79), Expect = 0.62
 Identities = 43/207 (20%), Positives = 77/207 (37%), Gaps = 20/207 (9%)

Query: 171  LLASEEGITTSKQS-----TASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQ 225
            LL+ +E  T ++++     T     T   + + +K+ TA         +  S+  +    
Sbjct: 4572 LLSVKEPATITEEAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTD 4631

Query: 226  ATSALQQEETSEKKSRKVV--IREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKP 283
              S L+   T +K S +    ++    R S +          A++N   L+  P F  K 
Sbjct: 4632 TVSILKIISTEKKDSGEYTFEVQNDVGRSSCK----------ARINVLDLIIPPSFTKKL 4681

Query: 284  RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCD 343
            +     +   + L C +AG     + W+K+   I+      KY          LEI+  +
Sbjct: 4682 KKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASE---KYKFSFHDNTAFLEISQLE 4738

Query: 344  FEDTAQYRASAMNVKGELSAYASVVVK 370
              D+  Y  SA N  G       + VK
Sbjct: 4739 GTDSGTYTCSATNKAGHNQCSGHLTVK 4765



 Score = 35.0 bits (79), Expect = 0.62
 Identities = 17/75 (22%), Positives = 35/75 (46%), Gaps = 1/75 (1%)

Query: 1582  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADS 1641
             + ++ G  +     + G P P   W  +   + +D+H  ++ +   ++  TI      D+
Sbjct: 17520 LVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETD-NFSSVLTIKNCLRRDT 17578

Query: 1642  GKYGLVVKNKYGSET 1656
             G+Y + V N  GS+T
Sbjct: 17579 GEYQITVSNAAGSKT 17593



 Score = 35.0 bits (79), Expect = 0.62
 Identities = 23/84 (27%), Positives = 35/84 (41%), Gaps = 3/84 (3%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYR 351
             E++++   + G P PRVTW+K+ V I    N     I    G  +L +     +    Y 
Sbjct: 27974 ESLRIKALVQGRPVPRVTWFKDGVEIEKRMN---MEITDVLGSTSLFVRDATRDHRGVYT 28030

Query: 352   ASAMNVKGELSAYASVVVKRYKGE 375
               A N  G   A   V V+   G+
Sbjct: 28031 VEAKNASGSAKAEIKVKVQDTPGK 28054



 Score = 34.7 bits (78), Expect = 0.80
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 3/76 (3%)

Query: 295  KLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASA 354
            +L C IAG    RV+W+K+   I   A   +Y I    G  +LEI   D  D   +   A
Sbjct: 4131 RLDCKIAGSLPMRVSWFKDGKEI---AASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRA 4187

Query: 355  MNVKGELSAYASVVVK 370
             N  G   +  +++V+
Sbjct: 4188 TNSVGSKDSSGALIVQ 4203



 Score = 34.7 bits (78), Expect = 0.80
 Identities = 44/195 (22%), Positives = 66/195 (33%), Gaps = 37/195 (18%)

Query: 287  TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
            TV   E   L C +AG PE  V WYK+     +  +  K+       + +L I   + +D
Sbjct: 5714 TVTVGETCTLECKVAGTPELSVEWYKDG---KLLTSSQKHKFSFYNKISSLRILSVERQD 5770

Query: 347  TAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIH 406
               Y     N  G+ S  A V V                     S    P  +  R +  
Sbjct: 5771 AGTYTFQVQNNVGKSSCTAVVDV---------------------SDRAVPPSFTRRLK-- 5807

Query: 407  FDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERAT 466
                   + G  G +  L C+V  +  I      + W+     +      QT +S    T
Sbjct: 5808 ------NTGGVLGASCILECKVAGSSPI-----SVAWFHEKTKIVSGAKYQTTFSDNVCT 5856

Query: 467  LTFSHLNKEDEGLYT 481
            L  + L+  D G YT
Sbjct: 5857 LQLNSLDSSDMGNYT 5871



 Score = 34.7 bits (78), Expect = 0.80
 Identities = 22/86 (25%), Positives = 37/86 (43%), Gaps = 1/86 (1%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1637
             L   + ++ G  + L   V G PPP+++W K    L      ++K       +     V+
Sbjct: 19699 LRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIK-STDFDTFLRCENVN 19757

Query: 1638  TADSGKYGLVVKNKYGSETSDFTVSV 1663
               D+GKY L ++N  G +     V V
Sbjct: 19758 KYDAGKYILTLENSCGKKEYTIVVKV 19783



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 41/195 (21%), Positives = 77/195 (39%), Gaps = 19/195 (9%)

Query: 1389 IVWYKDEREISVDE----KHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLV 1444
            + W++D + IS       +  F DG   L I   +K ++G Y +   +  G+  S  +L+
Sbjct: 37   VSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELL 96

Query: 1445 ---DEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRY 1501
               + A    +  +        + +++Q    GI     V +Y          +G+ I+ 
Sbjct: 97   VKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPT-PVVKFY---------RDGAEIQS 146

Query: 1502 SDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQR- 1560
            S   +    G+   L I E  P D G Y +   +       T +L  Q  +E  A+  + 
Sbjct: 147  SLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKT 206

Query: 1561 -LKQAAIAEKNRARV 1574
             +  A I+E  + R+
Sbjct: 207  IVSTAQISESRQTRI 221



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 25/94 (26%), Positives = 43/94 (45%), Gaps = 7/94 (7%)

Query: 1577  GLPDVVTIQEGKALNLTCNVWGDPPPEVSWL---KNEKALASDDHC---NLKFE-AGRTA 1629
             G  D +  + G  + +   + G P P+ SW    K +KA+    H    + + E A  ++
Sbjct: 15815 GAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSS 15874

Query: 1630  YFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
                I     + +GKY +  KNK G +T++  V V
Sbjct: 15875 VIIIPECKRSHTGKYSITAKNKAGQKTANCRVKV 15908



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 21/83 (25%), Positives = 39/83 (46%), Gaps = 5/83 (6%)

Query: 1582  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAG-RTAYFTINGVSTAD 1640
             + ++ G +  +     G P PE++W + E          ++ E G      +I+     D
Sbjct: 24034 IVVRAGGSARIHIPFKGRPTPEITWSREEGEFTD----KVQIEKGVNYTQLSIDNCDRND 24089

Query: 1641  SGKYGLVVKNKYGSETSDFTVSV 1663
             +GKY L ++N  GS+++  TV V
Sbjct: 24090 AGKYILKLENSSGSKSAFVTVKV 24112



 Score = 33.9 bits (76), Expect = 1.4
 Identities = 26/87 (29%), Positives = 33/87 (37%), Gaps = 10/87 (11%)

Query: 1582  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASD----DHCNLKFEAGRTAYFTINGVS 1637
             + I  GK L +   V G P P   W K E  L  D    D+   K E        I    
Sbjct: 15114 IQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSE------LIIKDAL 15167

Query: 1638  TADSGKYGLVVKNKYGSETSDFTVSVF 1664
               D G+Y +   N  GS+ +   V VF
Sbjct: 15168 RKDHGRYVITATNSCGSKFAAARVEVF 15194



 Score = 33.5 bits (75), Expect = 1.8
 Identities = 31/109 (28%), Positives = 54/109 (49%), Gaps = 4/109 (3%)

Query: 1358 PHFVEYL-SWEVTGECNVLLKCKVANIKKETHIVWYKDEREI--SVDEKHDFKDGICTLL 1414
            P+FV+ L S  V     V L+ +V  I     + +Y+D  EI  S+D +   +  + +LL
Sbjct: 104  PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPV-VKFYRDGAEIQSSLDFQISQEGDLYSLL 162

Query: 1415 ITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSA 1463
            I E   +D+G Y V   +  G+  S  +L+ +  +E+  +  K I  +A
Sbjct: 163  IAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIVSTA 211



 Score = 33.5 bits (75), Expect = 1.8
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 5/67 (7%)

Query: 418  EGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDE 477
            EG    L C+V + P++      ++WY N   + P   VQ +  G +  L  +  +  DE
Sbjct: 2458 EGTKAVLECKVSV-PDVT----SVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDE 2512

Query: 478  GLYTIRV 484
            G Y + V
Sbjct: 2513 GPYKLIV 2519



 Score = 33.1 bits (74), Expect = 2.3
 Identities = 22/94 (23%), Positives = 40/94 (42%), Gaps = 3/94 (3%)

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
            P FI       +    N  L C ++G     ++W+K++  I    +  KY + S+  +  
Sbjct: 3831 PSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIR---SSKKYRLFSQKSLVC 3887

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
            LEI   +  D  +Y     N  G+    A+ ++K
Sbjct: 3888 LEIFSFNSADVGEYECVVANEVGKCGCMATHLLK 3921



 Score = 33.1 bits (74), Expect = 2.3
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 3/80 (3%)

Query: 1584  IQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGK 1643
             I+ G  L L+  + G P P+V+W K ++   +    ++     +     I   +  D G 
Sbjct: 17230 IKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGSK---LEIRNAAHEDGGI 17286

Query: 1644  YGLVVKNKYGSETSDFTVSV 1663
             Y L V+N  GS+T    V V
Sbjct: 17287 YSLTVENPAGSKTVSVKVLV 17306



 Score = 33.1 bits (74), Expect = 2.3
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 13/87 (14%)

Query: 1582  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAG--RTAYFT---INGV 1636
             + ++ G ++ +   + G P PEV+W K        D+ NLK  A    T  FT   I   
Sbjct: 20786 LVVRAGLSIRIFVPIKGRPAPEVTWTK--------DNINLKNRANIENTESFTLLIIPEC 20837

Query: 1637  STADSGKYGLVVKNKYGSETSDFTVSV 1663
             +  D+GK+ + ++N  G ++    V V
Sbjct: 20838 NRYDTGKFVMTIENPAGKKSGFVNVRV 20864



 Score = 32.7 bits (73), Expect = 3.1
 Identities = 38/176 (21%), Positives = 75/176 (42%), Gaps = 16/176 (9%)

Query: 1165 PKSEFSWSKD--YVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSY 1222
            P  E SW +D   +ST   P +++     + K+T   +   + G YS   T+  G A+S 
Sbjct: 33   PVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATS- 91

Query: 1223 LIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEK 1282
                 EL     L      P   V+   ++ + +  QVR  ++   +     V +  +  
Sbjct: 92   ---TAEL-----LVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIP-TPVVKFYRDGA 142

Query: 1283 EIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQD--GKATNHSTVVLVGD 1336
            EI     ++  I +   +  + + +   ED GTY+    +  G+AT+ + +++ G+
Sbjct: 143  EIQSSLDFQ--ISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGE 196



 Score = 32.7 bits (73), Expect = 3.1
 Identities = 43/204 (21%), Positives = 67/204 (32%), Gaps = 47/204 (23%)

Query: 278  EFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTL 337
            + I KP+  T  E   V    S++    P V W+   V I       K+ + S   +H L
Sbjct: 2796 KIIKKPKDVTALENATVAFEVSVSHDTVP-VKWFHKSVEIKPS---DKHRLVSERKVHKL 2851

Query: 338  EINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPY 397
             +      D  +Y A    V G+L   A + V+                           
Sbjct: 2852 MLQNISPSDAGEYTA----VVGQLECKAKLFVET-------------------------- 2881

Query: 398  GYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQ 457
                   +H           E +T S  C      E+ HF     W +NGV +  S+  +
Sbjct: 2882 -------LHITKTMKNIEVPETKTASFEC------EVSHFNVPSMWLKNGVEIEMSEKFK 2928

Query: 458  TLWSGERATLTFSHLNKEDEGLYT 481
             +  G+   L   + + ED   YT
Sbjct: 2929 IVVQGKLHQLIIMNTSTEDSAEYT 2952



 Score = 32.3 bits (72), Expect = 4.0
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 3/80 (3%)

Query: 1584  IQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGK 1643
             ++ G +  +T    G P P V W K +  L +  + +      RT+  TI   +  DSGK
Sbjct: 26198 VKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDT--TDSRTS-LTIENANRNDSGK 26254

Query: 1644  YGLVVKNKYGSETSDFTVSV 1663
             Y L ++N   + +    V V
Sbjct: 26255 YTLTIQNVLSAASLTLVVKV 26274



 Score = 32.0 bits (71), Expect = 5.2
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 5/45 (11%)

Query: 418  EGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSG 462
            EGET    CRV   P     QP++ WY NG  +  SK  +  + G
Sbjct: 1854 EGETARFRCRVTGYP-----QPKVNWYLNGQLIRKSKRFRVRYDG 1893



 Score = 32.0 bits (71), Expect = 5.2
 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 3/74 (4%)

Query: 296  LHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAM 355
            L  ++AG PE +  WYK+  P+       KY I  +  +  L+    +  D+ QY     
Sbjct: 4036 LEYTVAGTPELKPKWYKDGRPL---VASKKYRISFKNNVAQLKFYSAELHDSGQYTFEIS 4092

Query: 356  NVKGELSAYASVVV 369
            N  G  S   +  V
Sbjct: 4093 NEVGSSSCETTFTV 4106



 Score = 32.0 bits (71), Expect = 5.2
 Identities = 23/89 (25%), Positives = 36/89 (40%), Gaps = 17/89 (19%)

Query: 1582  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALA-------SDDHCNLKFEAGRTAYFTIN 1634
             + +++G  + LT  + G P P   W K  + ++       S+ H  L           I 
Sbjct: 30146 IFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTEL----------VIK 30195

Query: 1635  GVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
                  DSG Y LV++NK G +     V V
Sbjct: 30196 EADRGDSGTYDLVLENKCGKKAVYIKVRV 30224



 Score = 31.6 bits (70), Expect = 6.8
 Identities = 44/203 (21%), Positives = 71/203 (34%), Gaps = 46/203 (22%)

Query: 278   EFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTL 337
             +F+      TV E E     C ++   +  V W+KN   ++        +I S    H L
Sbjct: 11575 KFMSPLEDQTVKEGETATFVCELSH-EKMHVVWFKNDAKLHTSRT---VLISSEGKTHKL 11630

Query: 338   EINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPY 397
             E+     +D +Q +A       ELS+ A + V                          PY
Sbjct: 11631 EMKEVTLDDISQIKAQVK----ELSSTAQLKVLE----------------------ADPY 11664

Query: 398   GYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQ 457
                  F +   DK  V    E + ++L C V     +K       W+++G  + PS    
Sbjct: 11665 -----FTVKLHDKTAV----EKDEITLKCEVSKDVPVK-------WFKDGEEIVPSPKYS 11708

Query: 458   TLWSGERATLTFSHLNKEDEGLY 480
                 G R  L     + +D+G Y
Sbjct: 11709 IKADGLRRILKIKKADLKDKGEY 11731



 Score = 31.2 bits (69), Expect = 8.9
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 8/88 (9%)

Query: 1598 GDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTIN-GVS-TADSGKYGLVVKNKYGSE 1655
            GDP   V WL + K L + +   +  E G   Y +++ GV+ + DSG       NKYG  
Sbjct: 1730 GDPTMVVEWLHDGKPLEAANRLRMINEFG---YCSLDYGVAYSRDSGIITCRATNKYG-- 1784

Query: 1656 TSDFTVSVFIPEEEARMAALESLKGGKK 1683
             +D T +  I ++E  +     L  G+K
Sbjct: 1785 -TDHTSATLIVKDEKSLVEESQLPEGRK 1811



 Score = 31.2 bits (69), Expect = 8.9
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 6/60 (10%)

Query: 419   GETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEG 478
             GET +  C      E+ +    ++WY  G  L PS  V     G+  TLT   +  ED G
Sbjct: 12210 GETATFDC------ELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAG 12263



 Score = 31.2 bits (69), Expect = 8.9
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 6/88 (6%)

Query: 1598  GDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETS 1657
             G P P  +W   +K L + D   +K      A   I+    +D G Y L ++N+  + + 
Sbjct: 13420 GYPRPTATWCFGDKVLETGDRVKMK-TLSAYAELVISPSERSDKGIYTLKLENRVKTISG 13478

Query: 1658  DFTVSVFIPEEEARMAALESLKGGKKAK 1685
             +  V+V      AR +A + LK G   K
Sbjct: 13479 EIDVNVI-----ARPSAPKELKFGDITK 13501



 Score = 31.2 bits (69), Expect = 8.9
 Identities = 24/91 (26%), Positives = 38/91 (41%), Gaps = 7/91 (7%)

Query: 1592  LTCNVWGDPPPEVSWLKNEKALASDDHCNLKFE----AGRTAYFTINGVSTADSGKYGLV 1647
             L C V G P P V W +  K + +D    LK+      G      I  V+  D+  Y + 
Sbjct: 30947 LVCKVTGHPKPIVKWYRQGKEIIAD---GLKYRIQEFKGGYHQLIIASVTDDDATVYQVR 31003

Query: 1648  VKNKYGSETSDFTVSVFIPEEEARMAALESL 1678
               N+ GS +   ++ V +P +      LE +
Sbjct: 31004 ATNQGGSVSGTASLEVEVPAKIHLPKTLEGM 31034


>gi|110349717 titin isoform novex-2 [Homo sapiens]
          Length = 27118

 Score =  257 bits (656), Expect = 8e-68
 Identities = 233/902 (25%), Positives = 381/902 (42%), Gaps = 102/902 (11%)

Query: 405   IHFDDKF-DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGE 463
             +  D KF DV   + GE + +   +   P      P I W ++G+ +      + + +  
Sbjct: 19484 VMMDVKFRDVIVVKAGEVLKINADIAGRP-----LPVISWAKDGIEIEERARTEIISTDN 19538

Query: 464   RATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANK 523
                LT     + D G Y + ++        +    V D      G PA PL++  L A K
Sbjct: 19539 HTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKP----GPPAGPLEINGLTAEK 19594

Query: 524   DYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFR 583
                 +SW +P  DGG+ I  Y ++K E    +W+ C +  ++     VT L++G  YIFR
Sbjct: 19595 --CSLSWGRPQEDGGADIDYYIVEKRETSHLAWTIC-EGELQMTSCKVTKLLKGNEYIFR 19651

Query: 584   VRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTD 643
             V  VNK G+G P   S  + ALDP                             VP PPT 
Sbjct: 19652 VTGVNKYGVGEPLE-SVAIKALDPFT---------------------------VPSPPTS 19683

Query: 644   LSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDL 702
             L +T  T+  + L W +P    G E   Y +E+ E  +  W RVN + PV   R     L
Sbjct: 19684 LEITSVTKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKK-PVYDLRVKSTGL 19742

Query: 703   AEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES 762
              EG  Y +RV   N+AG+  PSE + +    D + +P  P K     +  T++ ++W + 
Sbjct: 19743 REGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKP 19802

Query: 763   --KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLS 820
                    + GY +E   +    W+    + ++G+ +T  GL TG  Y+FRV++VN  G S
Sbjct: 19803 LFDGGAPITGYTVEYKKSDDTDWKTSIQS-LRGTEYTISGLTTGAEYVFRVKSVNKVGAS 19861

Query: 821   EYSQDSE---AIEVKAAIGGGVSPDVCPALSDEPGG----LTASRGR----VHEASPPT- 868
             + S  S+   A E +      +  ++   L  + G         RGR    V  + P T 
Sbjct: 19862 DPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTD 19921

Query: 869   FQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKK 928
              +  A + +  ++ SL  + +N  + +  K + T+Q  L+           +    + K 
Sbjct: 19922 LRTRAYVDTTDSRTSL--TIENANRNDSGKYTLTIQNVLS----------AASLTLVVKV 19969

Query: 929   TDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANV 988
              D   P PP +IT  +  ++S VL W  P+  GGA +  Y++  RE       K   +  
Sbjct: 19970 LD--TPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKRE----ASKKAWVSVT 20023

Query: 989   KAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCS 1048
                +  +YK++NL+E  +Y F+V+  N  G+G P+   E  K  E     P PP  L  +
Sbjct: 20024 NNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVKITE----KPSPPEKLGVT 20079

Query: 1049  EVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEG 1108
              + KDS+ L W  P H G + +  Y V+  E   K   W  +  A  K+ +  V GL+E 
Sbjct: 20080 SISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQK--NW--VKCAVAKSTHHVVSGLREN 20135

Query: 1109  VSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISL----NFECD--- 1161
               Y FRV A NQAG+  P +L  PV+ + +    E+ +       + +    N + D   
Sbjct: 20136 SEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPI 20195

Query: 1162  KMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1221
                P  + + S+D V  + + R   E       +  K+    D G Y     ++ G   +
Sbjct: 20196 SGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKA 20255

Query: 1222  YLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNE 1281
             ++        ++ L      P  P    +  +I E+     W   +   G+   NYI  +
Sbjct: 20256 FI-------NIVVLDR----PGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLK 20304

Query: 1282  KE 1283
             +E
Sbjct: 20305 RE 20306



 Score =  248 bits (632), Expect = 5e-65
 Identities = 214/828 (25%), Positives = 356/828 (42%), Gaps = 107/828 (12%)

Query: 429  VITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGE 488
            ++ P   + + E +W++   PLS +K + T  + E+ +       K D+G Y I ++   
Sbjct: 6714 MVVPYDAYPKAEAEWFKENEPLS-TKTIDT--TAEQTSFRILEAKKGDKGRYKIVLQ--N 6768

Query: 489  YYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDK 548
             + +   ++ ++  D      P    +++  E     + ++W++P  DGGS I+GY +++
Sbjct: 6769 KHGKAEGFINLKVIDV-----PGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVER 6823

Query: 549  CEVGTDSWSQCNDTPVKFARFPVTGLIEGR-SYIFRVRAVNKMGIGFPSRVSEPVAALDP 607
             ++   +W    D   +   F VTGL +G   Y+FRV A N++G G P     PV     
Sbjct: 6824 RDIKRKTWVLATDR-AESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPV----- 6877

Query: 608  AEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHE 667
                                  E  S+  VPGPP ++++T+  R  V L+W+PP   G  
Sbjct: 6878 ----------------------EARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGA 6915

Query: 668  GIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEA 726
             I  Y +E  +  +  W    T +  +     + D+ EG+ Y FRVR  N  GVG+PS A
Sbjct: 6916 EITNYVIELRDKTSIRWDTAMT-VRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAA 6974

Query: 727  TEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES-KD-AKELVGYYIEASVAGSGKWE 784
            T    V D ++ P  P  +  S  T +SV + WE   KD    ++GY IE    G   W 
Sbjct: 6975 TPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWI 7034

Query: 785  PCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVC 844
             CN   V    +   GL  G  Y++RV A N AG+S+ S+                    
Sbjct: 7035 RCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEIL------------------ 7076

Query: 845  PALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVS-----KV 899
                   G LTA    V      +  KD L    PN  ++   S    +   +     KV
Sbjct: 7077 -------GPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKV 7129

Query: 900  SET----------VQEELTPPPQKAAPQG------KSKSDPLKKKTD---RAPPSPPCDI 940
             ET             EL   P + + +G      +++   +  + D    A PS P ++
Sbjct: 7130 LETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKEL 7189

Query: 941  TCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISN 1000
               +  +DS+ L W+ PD  GG+ +TGY V  REV       W +  +  V++  + + +
Sbjct: 7190 KFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKT---WTKV-MDFVTDLEFTVPD 7245

Query: 1001 LKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWK 1060
            L +   Y F+V A N  G G P+ V E          VP PP ++K  +   +S+ L W 
Sbjct: 7246 LVQGKEYLFKVCARNKCGPGEPAYVDEPVNMST-PATVPDPPENVKWRDRTANSIFLTWD 7304

Query: 1061 PPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQ 1120
            PP + G + + GY V+        D+W    E  +    ++V GL+EG  Y +RV+A+N+
Sbjct: 7305 PPKNDGGSRIKGYIVE--RCPRGSDKWVACGE-PVAETKMEVTGLEEGKWYAYRVKALNR 7361

Query: 1121 AGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISL----NFECDKMT---PKSEFSWSK 1173
             G  KPS     + A       E+ ++V     +++      E        P+ + +W+K
Sbjct: 7362 QGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTK 7421

Query: 1174 DYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1221
              +  +   R+ +E+   K+ +T  D    D G Y  +  +  G A++
Sbjct: 7422 ADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATA 7469



 Score =  247 bits (631), Expect = 6e-65
 Identities = 233/877 (26%), Positives = 353/877 (40%), Gaps = 116/877 (13%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P + W ++G  L P++ ++        TL    +N++D G YTI        +  +  + 
Sbjct: 13020 PTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLK 13079

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V D        P  P  VK  +   D  ++SW+ P  DGGS I  Y +DK E    +W+Q
Sbjct: 13080 VLDK-------PGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQ 13132

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
              + T V      V  LIEG  Y FR+ A NK G+G P   +EP  A +P +         
Sbjct: 13133 VSAT-VPITSCSVEKLIEGHEYQFRICAENKYGVGDPV-FTEPAIAKNPYDP-------- 13182

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                                PG      ++  T+ ++ +SWKPP   G   I  Y +EK E
Sbjct: 13183 -------------------PGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRE 13223

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
                 NW +VN + P+         L EG  Y FRV   N AG G+PS+A++     D   
Sbjct: 13224 TQAVNWTKVNRK-PIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQY 13282

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCN-NNPVKGS 794
              P  P        T +SV +SW +        ++GY +E   A S  W  CN    ++ +
Sbjct: 13283 PPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKT 13342

Query: 795   RFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAI---GGGVSPDVCPALSDEP 851
             RF   GL+    Y FRV AVN  G S+ S   +    K  +    G +  D+   L    
Sbjct: 13343 RFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRA 13402

Query: 852   GGLTASRGRVHEASPPTFQKDALLGSKPN-----KPSLPSSS---------QNLGQTEVS 897
             G        V    PP      +  SKPN     +  L   S         +N+ + +  
Sbjct: 13403 GVTMRLYVPVKGRPPP-----KITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAG 13457

Query: 898   KVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQP 957
             K   T++             GK +   + K  D   P PP ++T  E  +DS  + W+ P
Sbjct: 13458 KYILTLENSC----------GKKEYTIVVKVLD--TPGPPVNVTVKEISKDSAYVTWEPP 13505

Query: 958   DKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMA 1017
                GG+ I  Y V  R   D     W     +  S+ +++++NL+E   Y F+V A N  
Sbjct: 13506 IIDGGSPIINYVVQKR---DAERKSWSTVTTEC-SKTSFRVANLEEGKSYFFRVFAENEY 13561

Query: 1018  GLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDL 1077
             G+G P    +  K  +     PGP   LK   V K S  + WK P   G + + GY VD 
Sbjct: 13562 GIGDPGETRDAVKASQ----TPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDF 13617

Query: 1078  KEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAET 1137
                  +E++W+ + ++   ++    + L EG  Y FRV A N+ G G PS++   VVA  
Sbjct: 13618 ---LTEENKWQRVMKSL--SLQYSAKDLTEGKEYTFRVSAENENGEGTPSEIT--VVAR- 13669

Query: 1138  RPGTKEVVVNVDDDGVISL--------NFECD---KMTPKSEFSWSKDYVSTEDSPRLEV 1186
                   V  ++D  G+  L        NF      K  P    SW K         R+ V
Sbjct: 13670 ---DDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSV 13726

Query: 1187  ESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPV 1246
             ES    T +   D    D G Y+  + +  G     +         + +  +   PT P+
Sbjct: 13727 ESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTI--------SIKVVGKPGIPTGPI 13778

Query: 1247  KSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1283
             K +   E+  +     W   +   G+   NYI  +++
Sbjct: 13779 KFD---EVTAEAMTLKWAPPKDDGGSEITNYILEKRD 13812



 Score =  247 bits (630), Expect = 8e-65
 Identities = 216/807 (26%), Positives = 347/807 (42%), Gaps = 78/807 (9%)

Query: 438  QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
            +P+I W +  + L   K +      +++T+T     + D G Y I         + +A V
Sbjct: 7414 EPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAV--NVCGRATAVV 7471

Query: 498  FVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
             V   D      P  P      +   +  +++W  P  DGGS I  Y +++    ++ W 
Sbjct: 7472 EVNVLDK-----PGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWH 7526

Query: 558  QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAA---LDPAEKARLK 614
            + + T VK   F  T LI  + YIFRV A N  G+G P + S P+ A    DP       
Sbjct: 7527 KLSST-VKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQAS-PITAKYQFDP------- 7577

Query: 615  SRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFV 673
                                   PGPPT L  ++ T+  V L+W  P   G   I  Y+V
Sbjct: 7578 -----------------------PGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWV 7614

Query: 674  EKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVG 733
            E+ +  T+ W R N ++PVK   + +  L   K Y FRV   N AG G+PS++TE  ++ 
Sbjct: 7615 ERLDPDTDKWVRCN-KMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIK 7673

Query: 734  DKLDIPKAPGKIIPSRNTDTSVVVSW--EESKDAKELVGYYIEASVAGSGKWEPCNNNPV 791
            D +D P  PGK        TSV ++W   E     ++  Y IE    G+ +W       V
Sbjct: 7674 DPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEG-V 7732

Query: 792  KGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEP 851
              ++    GL+ GQ Y FRVRAVN AG SE S+ S+ +  +  +     P     ++   
Sbjct: 7733 PTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVIN--- 7789

Query: 852  GGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETV---QEELT 908
              +T +   +    P       +      K  +         T V     TV    E   
Sbjct: 7790 --ITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSL 7847

Query: 909  PPPQKAAPQGKSKS------DPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGG 962
               + AA     +S      D +  K     P PP  +  ++  +  + L W+ P   GG
Sbjct: 7848 YVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGG 7907

Query: 963  AEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAP 1022
              I  Y +  +E +     +W +A   A  +  ++++++ E    QFQV A N AG+G P
Sbjct: 7908 RPIQRYVIEKKERLG---TRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHP 7964

Query: 1023 SAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKA 1082
            S  +E    E+ T + P PP  L  ++  +  + + WKPP  +G +P+ GY V++     
Sbjct: 7965 SEPTEILSIEDPT-SPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEM--CPV 8021

Query: 1083 KEDQWRGLNEAAIKNVYLKV-RGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA---ETR 1138
              ++W  +N   IK++  KV  G+     YV RVRA+N  GV +PS+++  VVA   + +
Sbjct: 8022 GTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCK 8081

Query: 1139 P----GTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTK 1194
            P     T +++V   +   I + F   +  P    SW KD    + S RL +++      
Sbjct: 8082 PTIDLETHDIIVIEGEKLSIPVPF---RAVPVPTVSWHKDGKEVKASDRLTMKNDHISAH 8138

Query: 1195 MTFKDLGMDDLGIYSCDVTDTDGIASS 1221
            +        D GIY+  + +  G A++
Sbjct: 8139 LEVPKSVRADAGIYTITLENKLGSATA 8165



 Score =  244 bits (623), Expect = 5e-64
 Identities = 210/715 (29%), Positives = 320/715 (44%), Gaps = 77/715 (10%)

Query: 432   PEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHL---NKEDEGLYTIRVR--M 486
             P I   +P I W ++G PL  +  V      E AT T  H+   NK+D G YT+      
Sbjct: 18029 PVIGRPRPNISWVKDGEPLKQTTRVNV---EETATSTVLHIKEGNKDDFGKYTVTATNSA 18085

Query: 487   GEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFI 546
             G   E  S  V       E  G P  P  V+  E + D+++ISW+ PA  GG  I  Y +
Sbjct: 18086 GTATENLSVIVL------EKPGPPVGP--VRFDEVSADFVVISWEPPAYTGGCQISNYIV 18137

Query: 547   DKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALD 606
             +K +  T +W   + T  +     +T L  G  Y FR+ A N+ G               
Sbjct: 18138 EKRDTTTTTWHMVSATVAR-TTIKITKLKTGTEYQFRIFAENRYG--------------- 18181

Query: 607   PAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGH 666
                        SAP   + ++ +    E   PGPP    VT  ++  +++ W  P   G 
Sbjct: 18182 ----------KSAPLDSKAVIVQYPFKE---PGPPGTPFVTSISKDQMLVQWHEPVNDGG 18228

Query: 667   EGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSE 725
               I+ Y +E+ E  +  W ++N + P++  +F    L EG  Y F+V   N  G+G+PS+
Sbjct: 18229 TKIIGYHLEQKEKNSILWVKLN-KTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSK 18287

Query: 726   ATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKW 783
              +E  V  D  D P  P  I+ +RN   +V + W++       ++ GY +E      G+W
Sbjct: 18288 VSECFVARDPCDPPGRPEAIVITRN---NVTLKWKKPAYDGGSKITGYIVEKKDLPDGRW 18344

Query: 784   EPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAI---GGGV 839
                +   V  + FT  GLV  Q Y FRV A NAAG  SE S  S AI  +  I      +
Sbjct: 18345 MKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASL 18404

Query: 840   SP---DVCPALSDEPGGLTAS-RGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTE 895
              P   DV    + E   L A  RG+        + KD   G +  + +     ++  Q  
Sbjct: 18405 DPKYKDVIVVHAGETFVLEADIRGK--PIPDVVWSKD---GKELEETAARMEIKSTIQKT 18459

Query: 896   VSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKT-DR-APPSPPCDITCLESFRDSMVLG 953
                V + ++ +      K +  G +KS P+  K  DR  PP  P  +T + +  +   L 
Sbjct: 18460 TLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTA--EKCYLA 18517

Query: 954   WKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAA 1013
             W  P + GGA I+ Y +  RE        W + + + V    YK++ L     Y F+V A
Sbjct: 18518 WNPPLQDGGANISHYIIEKRET---SRLSWTQVSTE-VQALNYKVTKLLPGNEYIFRVMA 18573

Query: 1014  MNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGY 1073
             +N  G+G P        C  +    PGPP + + S + KDS+V+ W  PV  G T + GY
Sbjct: 18574 VNKYGIGEPLESGPVTACNPY--KPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGY 18631

Query: 1074  FVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSD 1128
              ++ ++ +    +W   N+  + ++ L+V GL EG SY FRV A N AGVG+PS+
Sbjct: 18632 ILEKRDKEGV--RWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSE 18684



 Score =  240 bits (612), Expect = 1e-62
 Identities = 232/891 (26%), Positives = 374/891 (41%), Gaps = 101/891 (11%)

Query: 417   REGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKED 476
             R G  + L   V   PE     P+I W +    L   + V   ++G+RAT      ++ D
Sbjct: 22755 RAGSDLVLDAAVGGKPE-----PKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSD 22809

Query: 477   EGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVD 536
              G YT+ V+     +  S  V V D+       P   L V  +   K    ++W  P  D
Sbjct: 22810 SGKYTLTVKNASGTKAVSVMVKVLDSPG-----PCGKLTVSRVTQEK--CTLAWSLPQED 22862

Query: 537   GGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPS 596
             GG+ I  Y +++ E    +W          + + VT LI+   YIFRVRAVNK G G P 
Sbjct: 22863 GGAEITHYIVERRETSRLNWVIVEGECPTLS-YVVTRLIKNNEYIFRVRAVNKYGPGVPV 22921

Query: 597   RVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVL 656
               SEP+ A +                              +P PP         + ++++
Sbjct: 22922 E-SEPIVARNSFT---------------------------IPSPPGIPEEVGTGKEHIII 22953

Query: 657   SW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCS 715
              W KP    G+E   Y V+K E  +  W RVN +  V   R  +  L EG  Y FRV   
Sbjct: 22954 QWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAV 23013

Query: 716   NSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYI 773
             N+AG  EPSEA+      +    P  P        T  S+ ++W +       ++VGY +
Sbjct: 23014 NAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVL 23073

Query: 774   EASVAGSGKWEPCNNN-PVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVK 832
             E     + +W   + N  ++ + FT   L  GQ Y FRV AVN  G+SEYS+    IE  
Sbjct: 23074 EMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPV 23133

Query: 833   AAI---GGGVSPDVCPALSDEPGGLTASRGRVHEASPP--TFQKDAL-LGSKPNKPSLPS 886
               I      ++ D+   ++   G        V    PP  T+ K  + L S+    ++  
Sbjct: 23134 ERIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASR----AIID 23189

Query: 887   SSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESF 946
             ++++     V KV+     + T   +  +  GK  +  L K  D   P P   +   E  
Sbjct: 23190 TTESYSLLIVDKVNRYDAGKYTIEAENQS--GKKSATVLVKVYDTPGPCP--SVKVKEVS 23245

Query: 947   RDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMV 1006
             RDS+ + W+ P   GGA +  Y V  RE        ++    K  S+  Y+IS L E  +
Sbjct: 23246 RDSVTITWEIPTIDGGAPVNNYIVEKRE---AAMRAFKTVTTKC-SKTLYRISGLVEGTM 23301

Query: 1007  YQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSG 1066
             Y F+V   N+ G+G P   S+     E    VP  P  L+  +V K ++ L W+ P++ G
Sbjct: 23302 YYFRVLPENIYGIGEPCETSDAVLVSE----VPLVPAKLEVVDVTKSTVTLAWEKPLYDG 23357

Query: 1067  RTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLK--VRGLKEGVSYVFRVRAINQAGVG 1124
              + +TGY   L+  KA  ++W  +    +K   L+  V  L EG  Y+FR+RA N+ GV 
Sbjct: 23358 GSRLTGYV--LEACKAGTERW--MKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVS 23413

Query: 1125  KPSDLAGPVVAE-----------TRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSK 1173
             +P +    V  +           T P   +  ++V     + L        P +  SW  
Sbjct: 23414 EPRETVTAVTVQDLRVLPTIDLSTMP---QKTIHVPAGRPVELVIPIAGRPPPAA-SWFF 23469

Query: 1174  DYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLL 1233
                   +S R+ VE+     K+T ++  + D G Y+ ++ +  G  S       E  +++
Sbjct: 23470 AGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTS-------ETIKVI 23522

Query: 1234  ALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVN-YIFNEKE 1283
              L      PT P+K    ++ ++   +    +  +L G A ++ Y+  +++
Sbjct: 23523 ILDKPGP-PTGPIK----IDEIDATSITISWEPPELDGGAPLSGYVVEQRD 23568



 Score =  239 bits (609), Expect = 2e-62
 Identities = 243/973 (24%), Positives = 389/973 (39%), Gaps = 133/973 (13%)

Query: 339   INGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYG 398
             + G    DT +YR SA+N+ G+            K E      H                
Sbjct: 10473 VKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLH---------------- 10516

Query: 399   YASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQT 458
                   + F DK  +   R GE  +L  R    P+     P++ W+++   +        
Sbjct: 10517 ------LDFRDKLTI---RVGEAFALTGRYSGKPK-----PKVSWFKDEADVLEDDRTHI 10562

Query: 459   LWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKC 518
               +     L      + D G Y + V       +    V V D      G P  P+    
Sbjct: 10563 KTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRP----GPPVGPVSFD- 10617

Query: 519   LEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGR 578
              E  KDY++ISWK P  DGGS I  Y I+K EVG D W        K     V+ L+EG+
Sbjct: 10618 -EVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAK-TTCKVSKLLEGK 10675

Query: 579   SYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVP 638
              YIFR+ A N  GI      S+P+ +     K R +                      VP
Sbjct: 10676 DYIFRIHAENLYGI------SDPLVSDSMKAKDRFR----------------------VP 10707

Query: 639   GPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFA 698
               P    VTE T+   +++W  P   G     Y +EK E  ++ W RV  +      +F 
Sbjct: 10708 DAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKRETMSKRWARVTKDPIHPYTKFR 10767

Query: 699   LFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVS 758
             + DL EG  Y FRV   N  G+G+PS  ++     D +  P  P        T  SV ++
Sbjct: 10768 VPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLT 10827

Query: 759   WEESK--DAKELVGYYIEASVAGSGKWEPCNNNP--VKGSRFTCHGLVTGQSYIFRVRAV 814
             W+  +     +++GY +E    G  +W   N+ P     +++   GL  GQ+Y FRV AV
Sbjct: 10828 WQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVLAV 10887

Query: 815   NAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGR-VHEASPPTFQKDA 873
             NAAG S+ +   E + VK  +     P++          L A+  R  H     T +  A
Sbjct: 10888 NAAGESDPAHVPEPVLVKDRL---EPPELI---------LDANMAREQHIKVGDTLRLSA 10935

Query: 874   LLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSD---------- 923
             ++   P  P +    ++      +++      ++TP   K   +  +  D          
Sbjct: 10936 IIKGVP-FPKVTWKKEDRDAPTKARI------DVTPVGSKLEIRNAAHEDGGIYSLTVEN 10988

Query: 924   PLKKKTDRA------PPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVID 977
             P   KT          P PP D+   E  +DS  L WK+P   GG+ IT Y V  R+V  
Sbjct: 10989 PAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDV-- 11046

Query: 978   GVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIA 1037
                 +W   +  +  ++++   +L E   Y F+VAA N  G G      +  K  +  + 
Sbjct: 11047 -ASAQWSPLSATS-KKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALD-PLH 11103

Query: 1038  VPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKN 1097
              PGPP  L   +V K  + L W  P   G +P+TGY V+ +E   ++  W  +    + N
Sbjct: 11104 PPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQD--W--IKFKTVTN 11159

Query: 1098  VYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETR--PGTKEVVVNVDDDGVI- 1154
             +   V GL++G +Y FRV+A N  G+G P D   P+  + +  P + E+ V + +  V+ 
Sbjct: 11160 LECVVTGLQQGKTYRFRVKAENIVGLGLP-DTTIPIECQEKLVPPSVELDVKLIEGLVVK 11218

Query: 1155  ---SLNFEC-DKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSC 1210
                ++ F    +  P     W+ D    +      VE+    + +T K+    D G Y  
Sbjct: 11219 AGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQI 11278

Query: 1211  DVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLS 1270
              V++  G         + +   L +      PT P+     +++  +     W   +   
Sbjct: 11279 TVSNAAG--------SKTVAVHLTVLDVPGPPTGPIN---ILDVTPEHMTISWQPPKDDG 11327

Query: 1271  GNAKVNYIFNEKE 1283
             G+  +NYI  +++
Sbjct: 11328 GSPVINYIVEKQD 11340



 Score =  238 bits (606), Expect = 5e-62
 Identities = 256/1027 (24%), Positives = 414/1027 (40%), Gaps = 150/1027 (14%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYR 351
             +N+K+   + G P+P VTW K      +     +   E+      L IN C   D+  Y 
Sbjct: 14776 DNIKVEIPVLGRPKPTVTWKKGD---QILKQTQRVNFETTATSTILNINECVRSDSGPYP 14832

Query: 352   ASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKF 411
              +A N+ GE+    ++ V    G            T P+ F      +            
Sbjct: 14833 LTARNIVGEVGDVITIQVHDIPGP----------PTGPIKFDEVSSDF------------ 14870

Query: 412   DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSH 471
              V+F  +      G        I ++  E++          + WV+   +  R T   + 
Sbjct: 14871 -VTFSWDPPENDGGV------PISNYVVEMR------QTDSTTWVELATTVIRTTYKATR 14917

Query: 472   LNKEDEGLYTIRVRMGEYY---EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIII 528
             L    E  Y  RV+    Y      ++   V +   ++ G P  P   +     KD + I
Sbjct: 14918 LTTGLE--YQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTP---QVTAVTKDSMTI 14972

Query: 529   SWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVN 588
             SW +P  DGGSPILGY +++ E     W   +   V    F  +GL +G +Y FRV A N
Sbjct: 14973 SWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAEN 15032

Query: 589   KMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTE 648
               G   PS+ SEP+ ALDP +                            PG P  L++T 
Sbjct: 15033 MAGKSKPSKPSEPMLALDPIDP---------------------------PGKPVPLNITR 15065

Query: 649   ATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKS 707
              T   V L W KP    G +   Y VEK +     W + N    +++  F +  L E  +
Sbjct: 15066 HT---VTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILEN-EFTVSGLTEDAA 15121

Query: 708   YCFRVRCSNSAG-VGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAK 766
             Y FRV   N+AG +  PSE ++     D ++ PK              V V ++++   K
Sbjct: 15122 YEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKI------------KVDVKFKDTVILK 15169

Query: 767   ELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDS 826
                 + +EA V  SG+  P       G        +  +   F    VN        +DS
Sbjct: 15170 AGEAFRLEADV--SGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNK---DSTRRDS 15224

Query: 827   EAIEVKAAIGGGVSPDVC-------PALSDEPGGLT--ASRGRVHEASPPTFQKDALLG- 876
              A  + A   GG +  +        P   + P  +T   S   V    PP     A +  
Sbjct: 15225 GAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDH 15284

Query: 877   --------SKPNKPSLPSSSQ--NLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLK 926
                     S+    ++ S  Q   L  T++ K +E +   +     K       +S+P+ 
Sbjct: 15285 YIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAV--NKYGVGEPLESEPVL 15342

Query: 927   KKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREA 986
                   PP PP +       +DSMV+ W  PD  GG+EI  Y V  R   D    +W + 
Sbjct: 15343 AVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERR---DKAGQRWIKC 15399

Query: 987   NVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFK-CEEWTIAVPGPPHSL 1045
             N K +++  YK+S L E   Y+F++ A N AG+ APS  S  +K C+  T+  PGPP + 
Sbjct: 15400 NKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACD--TVFKPGPPGNP 15457

Query: 1046  KCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN-EAAIKNVYLKVRG 1104
             +  +  + S+ + W  P++ G + +TGY V++  A  +ED+W+ +   A +K     + G
Sbjct: 15458 RVLDTSRSSISIAWNKPIYDGGSEITGYMVEI--ALPEEDEWQIVTPPAGLKATSYTITG 15515

Query: 1105  LKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECD--- 1161
             L E   Y  R+ A+N  G+G+P+ + G   AE R    E+ ++ D   V+++   C    
Sbjct: 15516 LTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRL 15575

Query: 1162  ----KMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
                 K  P  E  W++D+  + D  +  +ES  + T +   ++   D G Y   V ++ G
Sbjct: 15576 FVPIKGRPAPEVKWARDHGESLD--KASIESTSSYTLLIVGNVNRFDSGKYILTVENSSG 15633

Query: 1218  IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKV-N 1276
               S+++             +     T     +L V+ + K  V        L G +K+ N
Sbjct: 15634 SKSAFV-------------NVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKN 15680

Query: 1277  YIFNEKE 1283
             YI  ++E
Sbjct: 15681 YIVEKRE 15687



 Score =  236 bits (602), Expect = 1e-61
 Identities = 213/769 (27%), Positives = 319/769 (41%), Gaps = 97/769 (12%)

Query: 398   GYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPE-----------IQWYRN 446
             G   +F +   +   VS  RE E +      ++ P+I    PE           I+ +  
Sbjct: 12561 GKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKI--LMPEQITIKAGKKLRIEAHVY 12618

Query: 447   GVPLSPSKWVQTLWSGERATLTFSHL----------------NKEDEGLYTIRVRMGEYY 490
             G P    KW +    GE   +T SHL                 ++D G Y++        
Sbjct: 12619 GKPHPTCKWKK----GEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGT 12674

Query: 491   EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCE 550
             +     V V DA     G P  P D+  ++A  D   +SW  P  DGGS I  Y ++KC+
Sbjct: 12675 DTQKIKVVVMDAP----GPPQPPFDISDIDA--DACSLSWHIPLEDGGSNITNYIVEKCD 12728

Query: 551   VGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEK 610
             V    W     +  K +   V  LI G+ YIFRVRA N+ GI  P    + VA       
Sbjct: 12729 VSRGDWVTALASVTKTS-CRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMVAQFPFG-- 12785

Query: 611   ARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM 670
                                       VP  P +  VT+  +  + ++W  P   G   I+
Sbjct: 12786 --------------------------VPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPII 12819

Query: 671   -YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEV 729
              Y +E+ E  +  W + N  L V+S  +    L EG  Y FR+   N AG   PS+ TE 
Sbjct: 12820 GYLIERKERNSLLWVKANDTL-VRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEY 12878

Query: 730   TVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNN 789
                   +D P  P  I  +++T  S++ +  +     +++GY++EA      KW  CN  
Sbjct: 12879 VTARMPVDPPGKPEVIDVTKST-VSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTA 12937

Query: 790   P--VKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSP--DVCP 845
             P  +    +T  GL     Y FR  A  A  +S  S+ S+ + + A     V P  D+  
Sbjct: 12938 PHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAE---NVPPRIDLSV 12994

Query: 846   ALSD----EPGGLTASRGRVHEASPPT--FQKDALLGSKPNKPSLPSSSQNLGQTEVSKV 899
             A+      + G        V     PT  ++KD  L  KP +    +  +NL   E+  V
Sbjct: 12995 AMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTL-LKPAEGIKMAMQRNLCTLELFSV 13053

Query: 900   SETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDK 959
             +     + T   + ++    SKS  +K K     P PP  +   + + D  +L W+ P +
Sbjct: 13054 NRKDSGDYTITAENSSG---SKSATIKLKV-LDKPGPPASVKINKMYSDRAMLSWEPPLE 13109

Query: 960   IGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 1019
              GG+EIT Y V+ RE        W + +   V   +  +  L E   YQF++ A N  G+
Sbjct: 13110 DGGSEITNYIVDKRETSRP---NWAQVSA-TVPITSCSVEKLIEGHEYQFRICAENKYGV 13165

Query: 1020  GAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE 1079
             G P           +    PG       S + KD + + WKPP   G +P+TGY ++ +E
Sbjct: 13166 GDPVFTEPAIAKNPYD--PPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRE 13223

Query: 1080  AKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSD 1128
              +A    W  +N   I    LK  GL+EG  Y FRV AIN+AG GKPSD
Sbjct: 13224 TQAVN--WTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSD 13270



 Score =  235 bits (600), Expect = 2e-61
 Identities = 248/1071 (23%), Positives = 420/1071 (39%), Gaps = 153/1071 (14%)

Query: 294   VKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRAS 353
             V+L   IAG P P  +W+     +       +  +E+   +  L I      DT +Y   
Sbjct: 23451 VELVIPIAGRPPPAASWFFAGSKLR---ESERVTVETHTKVAKLTIRETTIRDTGEYTLE 23507

Query: 354   AMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDV 413
               NV G  S    V++    G                     P G     EI   D   +
Sbjct: 23508 LKNVTGTTSETIKVIILDKPGP--------------------PTGPIKIDEI---DATSI 23544

Query: 414   SFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLN 473
             +   E   +  G      P   +   +   +R G       W+    S  R+T  F+ L 
Sbjct: 23545 TISWEPPELDGGA-----PLSGYVVEQRDAHRPG-------WLPVSESVTRSTFKFTRLT 23592

Query: 474   KEDEGLYTI----RVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIIS 529
             + +E ++ +    R  +G Y +       V +  + I   P  P  ++  + ++D + ++
Sbjct: 23593 EGNEYVFRVAATNRFGIGSYLQSE-----VIECRSSIR-IPGPPETLQIFDVSRDGMTLT 23646

Query: 530   WKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNK 589
             W  P  DGGS + GY +++ EV  D W + N  PV   R+  TGL EG  Y  RV A+N 
Sbjct: 23647 WYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINA 23706

Query: 590   MGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEA 649
              G G PSR S+P+ A+DP           AP                 PG P +  VT+ 
Sbjct: 23707 RGSGKPSRPSKPIVAMDPI----------AP-----------------PGKPQNPRVTDT 23739

Query: 650   TRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSY 708
             TR+ V L+W  P   G   +  Y +E  +     W + NT  P K   + L  L +G  Y
Sbjct: 23740 TRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTT-PTKIREYTLTHLPQGAEY 23798

Query: 709   CFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKEL 768
              FRV   N+ G GEP+E      V + L+ P            D  +   ++E    ++ 
Sbjct: 23799 RFRVLACNAGGPGEPAEVPGTVKVTEMLEYP------------DYELDERYQEGIFVRQ- 23845

Query: 769   VGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLV-TGQSYIFRVRAVNAAGLS------- 820
              G  I  ++   GK  P      +G   +   ++ T +++   V      G S       
Sbjct: 23846 -GGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTELVIKEADRGDSGTYDLVL 23904

Query: 821   EYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPN 880
             E     +A+ +K  + G  +    P   D+   +     RV    P       +LG    
Sbjct: 23905 ENKCGKKAVYIKVRVIGSPNSPEGPLEYDD---IQVRSVRVSWRPPADDGGADILGYILE 23961

Query: 881   KPSLPSSSQNLGQTEVSKVSETVQE---------ELTPPPQKAAPQGKSKSDPLKKKTDR 931
             +  +P ++     + V   S  V+           ++   Q    +     +P+  KT  
Sbjct: 23962 RREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPL 24021

Query: 932   APPSPPCDIT-CLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKA 990
              PP PP +    L+  + S+ L W +P   GG+ +TGYY+  +E       KW   N   
Sbjct: 24022 NPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTD---KWVRHNKTQ 24078

Query: 991   VSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEV 1050
             ++   Y ++ L  +  YQF++ A N  GL   S  SE   C++     P  P  L+   +
Sbjct: 24079 ITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKD-PFDKPSQPGELEILSI 24137

Query: 1051  RKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVS 1110
              KDS+ LQW+ P   G   + GY+V+ ++  + +  W+  N+  IK+    + GL E   
Sbjct: 24138 SKDSVTLQWEKPECDGGKEILGYWVEYRQ--SGDSAWKKSNKERIKDKQFTIGGLLEATE 24195

Query: 1111  YVFRVRAINQAGVGKPSDLAGPV----VAETRPGTKEVVVNVDDDGVISLNFECDKM-TP 1165
             Y FRV A N+ G+ +P   A  +     +   PG ++ + +V      +    C  +  P
Sbjct: 24196 YEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRP 24255

Query: 1166  KSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLID 1225
               +  W +       S + ++ S G    +T      +D G+Y+C       IA++ + +
Sbjct: 24256 LPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTC-------IATNEVGE 24308

Query: 1226  EEELKRLLALSHEHKFPTVPVK--------SELAVEILEKGQ---VRFWMQAEKLSGNAK 1274
              E   +LL  +     P  P+K        S L + ++  G+      W   +KL  N++
Sbjct: 24309 VETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSE 24368

Query: 1275  VNYIFNEKEI-----------FEGPKYKMHIDRNTGIIEMFME-KLQDEDE 1313
                I N +                 KYK+ +    G ++  ++ ++QD+ +
Sbjct: 24369 NITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPD 24419



 Score =  234 bits (597), Expect = 5e-61
 Identities = 319/1304 (24%), Positives = 521/1304 (39%), Gaps = 194/1304 (14%)

Query: 273   LLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRY 332
             L+  P F +   + TV   E++K+     G P P VTW+K+ VP+       +   ES  
Sbjct: 15839 LVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLK---QTTRVNAESTE 15895

Query: 333   GMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKG------EFDETRFHAGAS 386
                 L I     ED   Y     N  GE     +V+V    G      + DE      A 
Sbjct: 15896 NNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVT----AD 15951

Query: 387   TMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRN 446
             ++ LS+G   Y   S    +  +K D S                                
Sbjct: 15952 SITLSWGPPKYDGGSSINNYIVEKRDTS-------------------------------- 15979

Query: 447   GVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAE- 505
                   + W     +  R T+    L    E  Y  R+     Y + S Y+      A+ 
Sbjct: 15980 -----TTTWQIVSATVARTTIKACRLKTGCE--YQFRIAAENRYGK-STYLNSEPTVAQY 16031

Query: 506   ---IEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDT 562
                + G P  P+      +++D + + W +P  DGGS ++GY +++ E  +  W + N T
Sbjct: 16032 PFKVPGPPGTPVVTL---SSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKT 16088

Query: 563   PVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWT 622
             P+   +F  TGL EG  Y FRV A N +GIG PS+VSE   A DP +             
Sbjct: 16089 PIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDP------------ 16136

Query: 623   GQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTE 681
                            PG P  + VT   R+ V L WK P   G   I  Y VEK E    
Sbjct: 16137 ---------------PGRPEAIIVT---RNSVTLQWKKPTYDGGSKITGYIVEKKELPEG 16178

Query: 682   NWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGV-GEPSEATEVTVVGDKLDIPK 740
              W + +    + +  F +  L E   Y FRV   N+AGV  EPSE+T      D++D P+
Sbjct: 16179 RWMKASFTNIIDT-HFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPR 16237

Query: 741   APGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNN--PVKGSRF-- 796
                  +  +  DT VV + E  K   ++ G  I       G  E  N     +K + F  
Sbjct: 16238 IS---MDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFAT 16294

Query: 797   --TCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGL 854
               +    V   S  + ++A N AG     + S  + VK     G  P   P +     G+
Sbjct: 16295 SLSVKDAVRVDSGNYILKAKNVAG-----ERSVTVNVKVLDRPG--PPEGPVVIS---GV 16344

Query: 855   TASRGRVHEASPPTFQKDA------LLGSKPNKPSLPSSSQNLGQTEVSKVSETVQ-EEL 907
             TA +  +  A  P  Q         ++  +     + +      QT   KV++ ++  E 
Sbjct: 16345 TAEKCTL--AWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEY 16402

Query: 908   TPPPQKAAPQGKSK---SDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAE 964
             T         G  +   S+P+  K     P  P         +DSM++ W++P   GG+E
Sbjct: 16403 TFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSE 16462

Query: 965   ITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSA 1024
             I GY +  R+  +G+  +W   + + + E   +++ L EN  Y+F+V+A N AGL  PS 
Sbjct: 16463 ILGYVLEKRDK-EGI--RWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSP 16519

Query: 1025  VSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKE 1084
              S   K  +  I  PGPP++ K  ++ + S+ L W  P++ G   + GY V+  +    E
Sbjct: 16520 PSAYQKACD-PIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGE 16578

Query: 1085  DQWRGLNE-AAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKE 1143
               W        I    ++V  L E   Y FR+ AIN+AGVG+ +D+ GP++ E +    +
Sbjct: 16579 --WTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPD 16636

Query: 1144  V--------VVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKM 1195
             +        ++N+   G + L F   K  P  E  W K      D+  ++V S  + T +
Sbjct: 16637 IDLDLELRKIINIRAGGSLRL-FVPIKGRPTPEVKWGKVDGEIRDAAIIDVTS--SFTSL 16693

Query: 1196  TFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEIL 1255
                ++   D G Y+  + ++ G  S+++       R+L        P+ PV   L V  +
Sbjct: 16694 VLDNVNRYDSGKYTLTLENSSGTKSAFV-----TVRVL------DTPSPPV--NLKVTEI 16740

Query: 1256  EKGQVRFWMQAEKLSGNAKV-NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEG 1314
              K  V    +   L G +K+ NYI  ++E     K    +  N       +++LQ   EG
Sbjct: 16741 TKDSVSITWEPPLLDGGSKIKNYIVEKREATR--KSYAAVVTNCHKNSWKIDQLQ---EG 16795

Query: 1315  -TYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECN 1373
              +Y F++    A N   + L       + K AE           P     ++ +     +
Sbjct: 16796 CSYYFRV---TAENEYGIGLPAQTADPI-KVAEV----------PQPPGKITVDDVTRNS 16841

Query: 1374  VLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTL--LITEFSKKDAGIYEVILK 1431
             V L          + I+ Y  E +    EK      + +L  +IT  ++ +  ++ V+  
Sbjct: 16842 VSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVITNLTQGEEYLFRVVAV 16901

Query: 1432  DDRGKDKSRLKLVDEAFKELMMEVCKKIALSA------TDLKIQSTAEGIQLYSFVTYYV 1485
             +++G+   R   V    K+L++E   K A S+       DLKI+    G    +      
Sbjct: 16902 NEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPT------ 16955

Query: 1486  EDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKY 1529
                 + W+ +G  ++ + R+    + +   L I E   +D G+Y
Sbjct: 16956 ----ITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQY 16995



 Score =  233 bits (595), Expect = 9e-61
 Identities = 261/1020 (25%), Positives = 403/1020 (39%), Gaps = 115/1020 (11%)

Query: 237   EKKSRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKL 296
             E+K R  ++  K  +  +  T  + +     +  +  ++A   +   ++    E    + 
Sbjct: 17155 ERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARD 17214

Query: 297   HCSIAGWPEPRVTWYKNQVPIN----VHANPGK---YIIESRYGMHTLEINGCDFEDTAQ 349
              C   G PEP +   +N++ +     V+        YI+E R           D  D   
Sbjct: 17215 PCDPPGTPEP-IMVKRNEITLQWTKPVYDGGSMITGYIVEKR-----------DLPDGRW 17262

Query: 350   YRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFE---IH 406
              +AS  NV  E     S + +  + EF     +A  +    S    P       E   I 
Sbjct: 17263 MKASFTNVI-ETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRIS 17321

Query: 407   FDDKF-DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERA 465
              D KF D      GET  L   V   P      P I+W R    +  S   +   +  +A
Sbjct: 17322 MDPKFRDTIVVNAGETFRLEADVHGKP-----LPTIEWLRGDKEIEESARCEIKNTDFKA 17376

Query: 466   TLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDY 525
              L      + D G Y +R       + +   V V D      G P  P+ V  + + K  
Sbjct: 17377 LLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRP----GPPEGPVQVTGVTSEK-- 17430

Query: 526   IIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVR 585
               ++W  P  DGGS I  Y ++K E    +W+      V  +   VT L+EG  Y+FR+ 
Sbjct: 17431 CSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNS-LKVTKLLEGNEYVFRIM 17489

Query: 586   AVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLS 645
             AVNK G+G P   S PV   +P                            ++PGPP  L 
Sbjct: 17490 AVNKYGVGEPLE-SAPVLMKNPF---------------------------VLPGPPKSLE 17521

Query: 646   VTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAE 704
             VT   +  + + W +P    G E I Y VEK +     W + N    +   R  +  L E
Sbjct: 17522 VTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRR-ITDLRLRVTGLTE 17580

Query: 705   GKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES-- 762
                Y FRV   N+AGVGEPS AT      D +  P  P        T  S+ ++W +   
Sbjct: 17581 DHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIY 17640

Query: 763   KDAKELVGYYIEASVAGSGKWEPCN-NNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSE 821
                 E++GY +E   A   +W+       ++ +RF    L   Q Y  RV A+N  GL E
Sbjct: 17641 DGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGE 17700

Query: 822   YSQDSEAIEVKAAIGGGVSPD---VCPAL---SDEPGGLTASRG---RVH---EASP-PT 868
                         ++ G V P+     P L   S+   G+    G   R+H   +  P P 
Sbjct: 17701 ----------ATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPE 17750

Query: 869   FQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKK 928
                    G   +K  +    + +  T++S +    + +      K      SKS  +  K
Sbjct: 17751 ITWSREEGEFTDKVQI---EKGVNYTQLS-IDNCDRNDAGKYILKLENSSGSKSAFVTVK 17806

Query: 929   TDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANV 988
                  P PP ++   E  +DS  L W+ P   GGA++  Y ++ RE       +   ANV
Sbjct: 17807 V-LDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRE-----STRKAYANV 17860

Query: 989   KA-VSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKC 1047
              +  S+ ++K+ NL E  +Y F+V A N  G+G P    +  K  E     P PP  +  
Sbjct: 17861 SSKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAE----PPSPPGKVTL 17916

Query: 1048  SEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKE 1107
             ++V + S  L W+ P H G + V GY V+++      ++W  + E+ + N    V GL  
Sbjct: 17917 TDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGT--EKWSIVAESKVCNAV--VTGLSS 17972

Query: 1108  GVSYVFRVRAINQAGVGKPSDLAGPVVAE---TRPGTKEVVVNVDDDGVISLNFECDKM- 1163
             G  Y FRV+A N+ G   P  L  PV+A+    +P  K             L  E   + 
Sbjct: 17973 GQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIG 18032

Query: 1164  TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1223
              P+   SW KD    + + R+ VE     T +  K+   DD G Y+   T++ G A+  L
Sbjct: 18033 RPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENL 18092



 Score =  233 bits (594), Expect = 1e-60
 Identities = 253/971 (26%), Positives = 389/971 (40%), Gaps = 143/971 (14%)

Query: 290   EKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQ 349
             E  N +L   I G P P V+W K + P+   A   +  +ES     TL +  C   D  +
Sbjct: 13691 ENSNFRLKIPIKGKPAPSVSWKKGEDPL---ATDTRVSVESSAVNTTLIVYDCQKSDAGK 13747

Query: 350   YRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFG-VTPYGYASRFEIHFD 408
             Y  +  NV G      S+ V              G  T P+ F  VT      ++    D
Sbjct: 13748 YTITLKNVAGTKEGTISIKVVG----------KPGIPTGPIKFDEVTAEAMTLKWAPPKD 13797

Query: 409   DKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLT 468
             D      G E           IT  I   +  +           +KWV    + ++ T  
Sbjct: 13798 DG-----GSE-----------ITNYILEKRDSVN----------NKWVTCASAVQKTTFR 13831

Query: 469   FSHLNKEDEGLYTIRVRMGEYY---EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDY 525
              + L++  E  YT RV     Y   E   +   V     ++  AP  P     ++   D 
Sbjct: 13832 VTRLHEGME--YTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPP---NIVDVRHDS 13886

Query: 526   IIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVR 585
             + ++W  P   GGSPI GY ++  E  +  W + N TP++   F VTGL EG  Y FRV 
Sbjct: 13887 VSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVM 13946

Query: 586   AVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLS 645
             A+N  G+G PS  SEPV ALDP +                              PP    
Sbjct: 13947 AINLAGVGKPSLPSEPVVALDPID------------------------------PPGKPE 13976

Query: 646   VTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAE 704
             V   TR+ V L W +P    GH+   Y VEK +  +++W + N  + V    F + DL E
Sbjct: 13977 VINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKAN-HVNVPECAFTVTDLVE 14035

Query: 705   GKSYCFRVRCSNSAG-VGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESK 763
             G  Y FR+R  N+AG +  PSE+TE  +  D+ +   AP  ++     D   +    ++ 
Sbjct: 14036 GGKYEFRIRAKNTAGAISAPSESTETIICKDEYE---APTIVLDPTIKDGLTI----KAG 14088

Query: 764   DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYS 823
             D   L    I         W     + ++ S  T     T  S +  ++        EY+
Sbjct: 14089 DTIVLNAISILGKPLPKSSWSKAGKD-IRPSDIT-QITSTPTSSMLTIKYATRKDAGEYT 14146

Query: 824   QDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPS 883
                  I      G  V   V   + D PG      G V E S  + +K  L  + P +  
Sbjct: 14147 -----ITATNPFGTKVE-HVKVTVLDVPG----PPGPV-EISNVSAEKATLTWTPPLEDG 14195

Query: 884   -LPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQ-----------------GKSK---S 922
               P  S  L + E S++  TV  E     +  A +                 GK +   S
Sbjct: 14196 GSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQS 14255

Query: 923   DPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGK 982
             +P+K      PP PP         +++  + WK+P   GG+EITGY+V  RE       +
Sbjct: 14256 EPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSL---R 14312

Query: 983   WREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPP 1042
             W  A    VS+   K++ L+E   Y+F+V+A N AG+G PS  S+    ++     PGPP
Sbjct: 14313 WVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKD-AAYPPGPP 14371

Query: 1043  HSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQW-RGLNEAAIKNVYLK 1101
              +   ++  K S  L W  P + G   +TGY V+    K  ++ W +     A++     
Sbjct: 14372 SNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVE--HQKVGDEAWIKDTTGTALRITQFV 14429

Query: 1102  VRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPG---------TKEVVVNVDDDG 1152
             V  L+    Y FR+ AIN AGVG+P+ +    + E              + +VV     G
Sbjct: 14430 VPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRA---G 14486

Query: 1153  VISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDV 1212
             +    F   K  P  E +W+KD ++ ++  R  +E+  + T +   +    D G +   +
Sbjct: 14487 LSIRIFVPIKGRPAPEVTWTKDNINLKN--RANIENTESFTLLIIPECNRYDTGKFVMTI 14544

Query: 1213  TDTDGIASSYL 1223
              +  G  S ++
Sbjct: 14545 ENPAGKKSGFV 14555



 Score =  233 bits (593), Expect = 2e-60
 Identities = 236/910 (25%), Positives = 381/910 (41%), Gaps = 117/910 (12%)

Query: 404   EIHFDDKF-DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSG 462
             +I  D KF D    + GE   L   V   P      P ++W ++G  L  +  ++   + 
Sbjct: 15155 KIKVDVKFKDTVILKAGEAFRLEADVSGRPP-----PTMEWSKDGKELEGTAKLEIKIAD 15209

Query: 463   ERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEAN 522
                 L      + D G YT+       + ++   V V D      G P  PL V   E  
Sbjct: 15210 FSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRP----GPPEGPLAVT--EVT 15263

Query: 523   KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIF 582
              +  ++SW  P  DGG+ I  Y + K E    +W+    + V+  +  VT L++G  YIF
Sbjct: 15264 SEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVA-SEVQVTKLKVTKLLKGNEYIF 15322

Query: 583   RVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPT 642
             RV AVNK G+G P   SEPV A++P                              P PP 
Sbjct: 15323 RVMAVNKYGVGEPLE-SEPVLAVNPYGP---------------------------PDPPK 15354

Query: 643   DLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFD 701
             +  VT  T+  +V+ W  P    G E I Y VE+ +   + W + N +  +   R+ +  
Sbjct: 15355 NPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKT-LTDLRYKVSG 15413

Query: 702   LAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEE 761
             L EG  Y FR+   N+AG+  PS  +      D +  P  PG       + +S+ ++W +
Sbjct: 15414 LTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNK 15473

Query: 762   S--KDAKELVGYYIEASVAGSGKWEPCNNNP-VKGSRFTCHGLVTGQSYIFRVRAVNAAG 818
                    E+ GY +E ++    +W+       +K + +T  GL   Q Y  R+ A+N+ G
Sbjct: 15474 PIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEG 15533

Query: 819   LSE--------YSQDS---EAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPP 867
             L E         ++D      IE+ A +   V+   C  L          +GR   A   
Sbjct: 15534 LGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRL----FVPIKGR--PAPEV 15587

Query: 868   TFQKDALLGSKPNKPSLPSSSQ-------NLGQTEVSKVSETVQEELTPPPQKAAPQGKS 920
              + +D   G   +K S+ S+S        N+ + +  K   TV+               S
Sbjct: 15588 KWARDH--GESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENS-----------SGS 15634

Query: 921   KSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVP 980
             KS  +  +     P PP D+   E  + S+ L W  P   GG++I  Y V  RE      
Sbjct: 15635 KSAFVNVRV-LDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTR--- 15690

Query: 981   GKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPG 1040
              K          + ++K+  L+E   Y F+V A N  G+G P+  +E  K  E     P 
Sbjct: 15691 -KAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASER----PL 15745

Query: 1041  PPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYL 1100
             PP  +   +V ++S+ L W+ P H G + + GY V+++   +  D+W     A +K    
Sbjct: 15746 PPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGS--DKWATC--ATVKVTEA 15801

Query: 1101  KVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETR--PGTKEVVVNV-----DDDGV 1153
              + GL +G  Y FRV A N+ G+  P  L+ PV+A+    P   +++ N       +D  
Sbjct: 15802 TITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLK 15861

Query: 1154  ISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVT 1213
             + + F   + TP    +W KD V  + + R+  ES  N + +T KD   +D+G Y   +T
Sbjct: 15862 VDVPF-IGRPTPA--VTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLT 15918

Query: 1214  DTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNA 1273
             ++ G A        E   ++ L      PT PVK +   E+        W   +   G++
Sbjct: 15919 NSAGEAI-------ETLNVIVLDKPGP-PTGPVKMD---EVTADSITLSWGPPKYDGGSS 15967

Query: 1274  KVNYIFNEKE 1283
               NYI  +++
Sbjct: 15968 INNYIVEKRD 15977



 Score =  232 bits (592), Expect = 2e-60
 Identities = 212/734 (28%), Positives = 309/734 (42%), Gaps = 93/734 (12%)

Query: 439  PEIQWYRNGVPLS-PSKWVQTLW-----SGERATLTFSHLNKEDEGLYTIRV--RMGEYY 490
            P+I+W +N   +  P+  +Q        S  +  L+     +ED+G YT+    R+G  +
Sbjct: 9123 PKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVF 9182

Query: 491  EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCE 550
                     R+   E+   P+ P ++   +   +   ++W  P  +GGS I  Y IDK +
Sbjct: 9183 ---------RNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRD 9233

Query: 551  VGTD--SWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPA 608
                   W +  +T V+  R+ +  LI    Y FRVRAVNK GI    + S+ V   DP 
Sbjct: 9234 ASRKKAEWEEVTNTAVE-KRYGIWKLIPNGQYEFRVRAVNKYGISDECK-SDKVVIQDPY 9291

Query: 609  EKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEG 668
                                        +PGPP    V   T+  +++SW PP   G   
Sbjct: 9292 R---------------------------LPGPPGKPKVLARTKGSMLVSWTPPLDNGGSP 9324

Query: 669  IM-YFVEKCEAGTENWQRVN----TELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEP 723
            I  Y++EK E G+  W RV+    T++ +K   F +  L EG  Y FR    N+AG+G P
Sbjct: 9325 ITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPP 9384

Query: 724  SEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE-ESKD-AKELVGYYIEASVAGSG 781
            SE ++  V GD +  P  P        T +S+ + W+  +KD    + GY +E    G+ 
Sbjct: 9385 SEPSDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTT 9444

Query: 782  KWEPCNNNPVKGSRFTCHGLVTG----QSYIFRVRAVNAAGLSEYSQDSEAI-------E 830
             W+   N P K    TC  +V      + Y FRV+AVN AG SE S  +  I       E
Sbjct: 9445 DWKRV-NEPDK-LITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEE 9502

Query: 831  VKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQN 890
             +  I  G    +      +       +GR    S   F   A    K     +P  +Q 
Sbjct: 9503 PEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQ- 9561

Query: 891  LGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAP---------PSPPCDIT 941
            L   E S V       +  P  K +  GK       K   +           P PP D+ 
Sbjct: 9562 LETAENSSV-------IIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLK 9614

Query: 942  CLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNL 1001
              +  R S  L WK PD  GG  I GY +  R  IDG    W + N    S   + + +L
Sbjct: 9615 VSDITRGSCRLSWKMPDDDGGDRIKGYVIEKR-TIDG--KAWTKVNPDCGS-TTFVVPDL 9670

Query: 1002 KENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKP 1061
                 Y F+V A N  G+G P    +     +  I  P PP  LK   + K+++ L WKP
Sbjct: 9671 LSEQQYFFRVRAENRFGIGPPVETIQRTTARD-PIYPPDPPIKLKIGLITKNTVHLSWKP 9729

Query: 1062 PVHSGRTPVTGYFVDL---KEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAI 1118
            P + G +PVT Y V+         K++ WR  N+  ++ +   V  L EG  Y FRV+A+
Sbjct: 9730 PKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAV 9789

Query: 1119 NQAGVGKPSDLAGP 1132
            N AGV KPS   GP
Sbjct: 9790 NAAGVSKPSATVGP 9803



 Score =  228 bits (582), Expect = 3e-59
 Identities = 213/797 (26%), Positives = 332/797 (41%), Gaps = 96/797 (12%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVR--MGEYYEQYSAY 496
             P+  W + G  + PS   Q   +   + LT  +  ++D G YTI      G   E     
Sbjct: 14104 PKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVT 14163

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
             V       ++ G P  P+++  + A K    ++W  P  DGGSPI  Y ++K E     W
Sbjct: 14164 VL------DVPGPPG-PVEISNVSAEK--ATLTWTPPLEDGGSPIKSYILEKRETSRLLW 14214

Query: 557   SQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSR 616
             +  ++  ++  R   T LI+G  YIFRV AVN  G G P + SEPV  +D       +  
Sbjct: 14215 TVVSED-IQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQ-SEPVKMVD-------RFG 14265

Query: 617   PSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEK 675
             P                    PGPP    V+  T++   +SWK P   G   I  Y VE+
Sbjct: 14266 P--------------------PGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVER 14305

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
              E  +  W R   + PV   R  +  L EG +Y FRV   N AG+G PSEA++  ++ D 
Sbjct: 14306 REKKSLRWVRA-IKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDA 14364

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEESK--DAKELVGYYIEASVAGSGKW-EPCNNNPVK 792
                P  P     +  T  S  ++W +       E+ GY +E    G   W +      ++
Sbjct: 14365 AYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALR 14424

Query: 793   GSRFTCHGLVTGQSYIFRVRAVNAAGLSEYS--QDSEAIEVKAAIGGGVSPDVCPALSDE 850
              ++F    L T + Y FR+ A+N AG+ E +   D E +E + A    +  ++   L   
Sbjct: 14425 ITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVR 14484

Query: 851   PGG----LTASRGRVHEASPPTFQKDAL-LGSKPNKPSLPSSS----QNLGQTEVSKVSE 901
              G         +GR   A   T+ KD + L ++ N  +  S +        + +  K   
Sbjct: 14485 AGLSIRIFVPIKGR--PAPEVTWTKDNINLKNRANIENTESFTLLIIPECNRYDTGKFVM 14542

Query: 902   TVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIG 961
             T++           P GK       +  D   P P  ++   +  +DS+ L W  P   G
Sbjct: 14543 TIEN----------PAGKKSGFVNVRVLDT--PGPVLNLRPTDITKDSVTLHWDLPLIDG 14590

Query: 962   GAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGA 1021
             G+ IT Y V  RE        +  A  K   +  YK++ L E   Y F+V A N  G+G 
Sbjct: 14591 GSRITNYIVEKREA---TRKSYSTATTKC-HKCTYKVTGLSEGCEYFFRVMAENEYGIGE 14646

Query: 1022  PSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAK 1081
             P+  +E  K  E     P PP SL   ++ K ++ L W  P H G + +TGY ++ +  +
Sbjct: 14647 PTETTEPVKASE----APSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQ--R 14700

Query: 1082  AKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGT 1141
                DQW  +    +K +   VR L EG  Y F+V A+N AG   P + + PV+ + +   
Sbjct: 14701 KGSDQWTHI--TTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRE-SRPVIVKEQTML 14757

Query: 1142  KE----------VVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGN 1191
              E          V+    D+  + +        PK   +W K     + + R+  E+   
Sbjct: 14758 PELDLRGIYQKLVIAKAGDNIKVEIPV---LGRPKPTVTWKKGDQILKQTQRVNFETTAT 14814

Query: 1192  KTKMTFKDLGMDDLGIY 1208
              T +   +    D G Y
Sbjct: 14815 STILNINECVRSDSGPY 14831



 Score =  227 bits (579), Expect = 6e-59
 Identities = 229/893 (25%), Positives = 362/893 (40%), Gaps = 102/893 (11%)

Query: 425   GCRVVITPEIKHFQ-PEIQWYR-------NGVPLSPSKWVQTLWSGERATLTFSHLNKED 476
             G  V I  +IK    P + W++       N  P+     V  L   +  TL      + D
Sbjct: 9826  GTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSD 9885

Query: 477   EGLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPA 534
              GLYTI     +G   ++    V  R       G P  P+  + + A  D + +SW  P 
Sbjct: 9886  TGLYTITAVNNLGTASKEMRLNVLGRP------GPPVGPIKFESVSA--DQMTLSWFPPK 9937

Query: 535   VDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGF 594
              DGGS I  Y I+K E    +W   +  P K   + +  L+EG  Y+FR+ A NK GIG 
Sbjct: 9938  DDGGSKITNYVIEKREANRKTWVHVSSEP-KECTYTIPKLLEGHEYVFRIMAQNKYGIGE 9996

Query: 595   PSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYV 654
             P         LD           S P T + + +        VPG P   +V+  TR+ +
Sbjct: 9997  P---------LD-----------SEPETARNLFS--------VPGAPDKPTVSSVTRNSM 10028

Query: 655   VLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPR----FALFDLAEGKSYC 709
              ++W+ P   G   +  Y++E  +  ++ W+RVN + P+K+      + +  L EG  Y 
Sbjct: 10029 TVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRD-PIKAMTLGVSYKVTGLIEGSDYQ 10087

Query: 710   FRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES-KDA-KE 767
             FRV   N+AGVG  S  ++     D +  P  P   +    T +S  + W    KD   +
Sbjct: 10088 FRVYAINAAGVGPASLPSDPATARDPIAPPGPPFPKVTDW-TKSSADLEWSPPLKDGGSK 10146

Query: 768   LVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSE 827
             + GY +E    G  +WE   +  V+G++    GL  G  Y FRVRAVN AG+ E  + ++
Sbjct: 10147 VTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTD 10206

Query: 828   AIEVKAAIGGGVSPD------VCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNK 881
              IE+K  +   VSPD      V   +    GG+      V    PPT   +    + P +
Sbjct: 10207 VIEMKDRL---VSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQE 10263

Query: 882   PSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDIT 941
              ++ +++  +  + V K  +   + +     K     + K+  +       P   P    
Sbjct: 10264 ATIETTA--ISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTP--FL 10319

Query: 942   CLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNL 1001
                   +S  L W  P+  GG+ IT Y +  RE        W         + A  +  L
Sbjct: 10320 AHNLTNESCKLTWFSPEDDGGSPITNYVIEKRE---SDRRAWTPVTYTVTRQNA-TVQGL 10375

Query: 1002  KENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKP 1061
              +   Y F++AA N  G+G     SE     E  I VP  P  L+  EV K+++ L W P
Sbjct: 10376 IQGKAYFFRIAAENSIGMGPFVETSEALVIRE-PITVPERPEDLEVKEVTKNTVTLTWNP 10434

Query: 1062  PVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQA 1121
             P + G + +  Y ++       E   +  N+  +   Y  V+GLKEG +Y +RV A+N  
Sbjct: 10435 PKYDGGSEIINYVLE-SRLIGTEKFHKVTNDNLLSRKY-TVKGLKEGDTYEYRVSAVNIV 10492

Query: 1122  GVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMT------PKSEFSWSKDY 1175
             G GKPS    P+  +       + ++  D   I +  E   +T      PK + SW KD 
Sbjct: 10493 GQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIRVG-EAFALTGRYSGKPKPKVSWFKDE 10551

Query: 1176  VSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSY----LIDEEELKR 1231
                 +  R  +++      +        D G Y   V ++ G    +    ++D      
Sbjct: 10552 ADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDR----- 10606

Query: 1232  LLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEI 1284
                       P  PV      E+ +   V  W       G+   NYI  +KE+
Sbjct: 10607 ----------PGPPVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEV 10649



 Score =  225 bits (574), Expect = 2e-58
 Identities = 218/877 (24%), Positives = 354/877 (40%), Gaps = 106/877 (12%)

Query: 367   VVVKRYKGEFDETRFHAGASTM-----PLSFGVTPYGYASRFEIHFDDKFDVSFGREGET 421
             V+ +   G F E     GA T      P    + P  Y     +H  + F V     G+ 
Sbjct: 16208 VIARNAAGVFSEPSESTGAITARDEVDPPRISMDPK-YKDTIVVHAGESFKVDADIYGKP 16266

Query: 422   MSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYT 481
             +                P IQW +    LS +  ++   +    +L+     + D G Y 
Sbjct: 16267 I----------------PTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYI 16310

Query: 482   IRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPI 541
             ++ +        +  V V D      G P  P+ +  + A K    ++WK P  DGGS I
Sbjct: 16311 LKAKNVAGERSVTVNVKVLDRP----GPPEGPVVISGVTAEK--CTLAWKPPLQDGGSDI 16364

Query: 542   LGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEP 601
             + Y +++ E     W+   D  V+     VT L+EG  Y FR+ AVNK G+G P   SEP
Sbjct: 16365 INYIVERRETSRLVWTVV-DANVQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLE-SEP 16422

Query: 602   VAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPP 661
             V A +P                            +VP  P    VT  T+  +++ W+ P
Sbjct: 16423 VVAKNPF---------------------------VVPDAPKAPEVTTVTKDSMIVVWERP 16455

Query: 662   GQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGV 720
                G   I+ Y +EK +     W R +  L +   R  +  L E   Y FRV   N+AG+
Sbjct: 16456 ASDGGSEILGYVLEKRDKEGIRWTRCHKRL-IGELRLRVTGLIENHDYEFRVSAENAAGL 16514

Query: 721   GEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVA 778
              EPS  +      D +  P  P        T +SV +SW +       E+ GY +E    
Sbjct: 16515 SEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDV 16574

Query: 779   GSGKWEPCNN-NPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGG 837
               G+W  C     +  +      L+    Y FR+ A+N AG+ E++     I V+  +  
Sbjct: 16575 SVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEA 16634

Query: 838   ---GVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQ----- 889
                 +  ++   ++   GG       +     P  +   + G   +   +  +S      
Sbjct: 16635 PDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTSLV 16694

Query: 890   --NLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFR 947
               N+ + +  K + T++             G   +    +  D   PSPP ++   E  +
Sbjct: 16695 LDNVNRYDSGKYTLTLENS----------SGTKSAFVTVRVLDT--PSPPVNLKVTEITK 16742

Query: 948   DSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVY 1007
             DS+ + W+ P   GG++I  Y V  RE       K   A V    + ++KI  L+E   Y
Sbjct: 16743 DSVSITWEPPLLDGGSKIKNYIVEKREATR----KSYAAVVTNCHKNSWKIDQLQEGCSY 16798

Query: 1008  QFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGR 1067
              F+V A N  G+G P+  ++  K  E    VP PP  +   +V ++S+ L W  P H G 
Sbjct: 16799 YFRVTAENEYGIGLPAQTADPIKVAE----VPQPPGKITVDDVTRNSVSLSWTKPEHDGG 16854

Query: 1068  TPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPS 1127
             + +  Y V++ +AK  E +W     A +K++   +  L +G  Y+FRV A+N+ G   P 
Sbjct: 16855 SKIIQYIVEM-QAKHSE-KWSEC--ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPR 16910

Query: 1128  DLAGPVVA-------ETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTED 1180
              LA P+VA       + +P      V V  D  I +        PK   +W+KD +  + 
Sbjct: 16911 SLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISG---RPKPTITWTKDGLPLKQ 16967

Query: 1181  SPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
             + R+ V    + T ++ K+   DD G Y   V +  G
Sbjct: 16968 TTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVG 17004



 Score =  224 bits (572), Expect = 4e-58
 Identities = 288/1312 (21%), Positives = 517/1312 (39%), Gaps = 206/1312 (15%)

Query: 276   APEFIIKP------RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIE 329
             A + +I+P       S++V   +++K+   I+G P+P +TW K+ +P+       +  + 
Sbjct: 16918 AKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLK---QTTRINVT 16974

Query: 330   SRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRY----KG--EFDETRFHA 383
                 + TL I     +D  QY  +  NV G+ +A   +V        KG  +FD+     
Sbjct: 16975 DSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDV---- 17030

Query: 384   GASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQW 443
              A ++ LS+    Y    +   +   K D +                             
Sbjct: 17031 SAESITLSWNPPLYTGGCQITNYIVQKRDTT----------------------------- 17061

Query: 444   YRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV---FVR 500
                      + W     +  R TL  + L    E  Y  R+     Y Q  A      V 
Sbjct: 17062 --------TTVWDVVSATVARTTLKVTKLKTGTE--YQFRIFAENRYGQSFALESDPIVA 17111

Query: 501   DADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCN 560
                 +  G P  P        +KD ++I W +P  +GGSP++GY +++ E  +  W++ N
Sbjct: 17112 QYPYKEPGPPGTPF---ATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVN 17168

Query: 561   DTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAP 620
              T +   +F    L EG  Y FRV A N +G+G  S+ SE   A DP +           
Sbjct: 17169 KTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDP---------- 17218

Query: 621   WTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAG 679
                              PG P  + V    R+ + L W  P   G   I  Y VEK +  
Sbjct: 17219 -----------------PGTPEPIMVK---RNEITLQWTKPVYDGGSMITGYIVEKRDLP 17258

Query: 680   TENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAG-VGEPSEATEVTVVGDKLDI 738
                W + +    +++ +F +  L E + Y FRV   N+AG + +PS++T      D++++
Sbjct: 17259 DGRWMKASFTNVIET-QFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVEL 17317

Query: 739   PKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEAS--VAGSGKWEPCNNNPVKGSRF 796
             P+     +  +  DT VV + E  +   ++ G  +     + G  + E      +K + F
Sbjct: 17318 PRIS---MDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDF 17374

Query: 797   TCHGLVT------GQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGG-----GVSPDVC- 844
                 +V       G  YI  +RA N AG   +  + + ++      G     GV+ + C 
Sbjct: 17375 KALLIVKDAIRIDGGQYI--LRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCS 17432

Query: 845   ----PALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVS 900
                 P L D  GG   S   V +          ++ S+    SL  +    G   V ++ 
Sbjct: 17433 LTWSPPLQD--GGSDISHYVVEKRETSRLAW-TVVASEVVTNSLKVTKLLEGNEYVFRIM 17489

Query: 901   ETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKI 960
                +  +  P + A         P+  K     P PP  +      +DSM + W +PD  
Sbjct: 17490 AVNKYGVGEPLESA---------PVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSD 17540

Query: 961   GGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLG 1020
             GG+EI GY V  R+   G+  +W + N + +++   +++ L E+  Y+F+V+A N AG+G
Sbjct: 17541 GGSEIIGYIVEKRD-RSGI--RWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVG 17597

Query: 1021  APSAVSECFK-CEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE 1079
              PS  +  +K C+   +  PGPP +    +  K+S+ L W  P++ G + + GY V++  
Sbjct: 17598 EPSPATVYYKACD--PVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEI-- 17653

Query: 1080  AKAKEDQWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETR 1138
              KA E++W+ +  +  ++    ++  L E   Y  RV A+N+ G+G+ + + G V  E +
Sbjct: 17654 CKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDK 17713

Query: 1139  PGTKE----------VVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVES 1188
                 E          +VV       I + F   K  P  E +WS++    E + ++++E 
Sbjct: 17714 LEAPELDLDSELRKGIVVRAGGSARIHIPF---KGRPTPEITWSRE--EGEFTDKVQIEK 17768

Query: 1189  KGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKS 1248
               N T+++  +   +D G Y   + ++ G  S+++  +                T     
Sbjct: 17769 GVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVK-------------VLDTPGPPQ 17815

Query: 1249  ELAVEILEKGQVRFWMQAEKLSGNAKV-NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEK 1307
              LAV+ + K       +   + G AKV NY+ +++E     K   ++          +E 
Sbjct: 17816 NLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRE--STRKAYANVSSKCSKTSFKVEN 17873

Query: 1308  LQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWE 1367
             L   +   Y F++           V   D  K  +               P     ++  
Sbjct: 17874 L--TEGAIYYFRVMAENEFGVGVPVETVDAVKAAEP--------------PSPPGKVTLT 17917

Query: 1368  VTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDF--KDGICTLLITEFSKKDAGI 1425
                + +  L  +       + ++ Y  E +    EK     +  +C  ++T  S      
Sbjct: 17918 DVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVTGLSSGQEYQ 17977

Query: 1426  YEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIAL------SATDLKIQSTAEGIQLYS 1479
             + V   +++GK   R+  V    K+L ++   K+        +  DLKI+    G    +
Sbjct: 17978 FRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPN 18037

Query: 1480  FVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVM 1531
                       ++W  +G  ++ + RV    T     L I E   +D GKY +
Sbjct: 18038 ----------ISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTV 18079



 Score =  219 bits (558), Expect = 2e-56
 Identities = 202/716 (28%), Positives = 292/716 (40%), Gaps = 101/716 (14%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTP-VKFAR 568
             P  P + + L+ ++  I I+W +P  DGGS I GY ++      D W        +K   
Sbjct: 15451 PGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATS 15510

Query: 569   FPVTGLIEGRSYIFRVRAVNKMGIGFPS----------RVSEPVAALD------------ 606
             + +TGL E + Y  R+ A+N  G+G P+          R+  P   LD            
Sbjct: 15511 YTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRAC 15570

Query: 607   ------------PA-------------EKARLKSRPSAPW----------TGQIIVTEEE 631
                         PA             +KA ++S  S             +G+ I+T E 
Sbjct: 15571 CTLRLFVPIKGRPAPEVKWARDHGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVEN 15630

Query: 632   PSEGI----------VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGT 680
              S              PGPP DL V E T++ V L+W PP   G   I  Y VEK E+  
Sbjct: 15631 SSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTR 15690

Query: 681   ENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPK 740
             + +  V T     S  + +  L EG SY FRV   N  G+G P+E  E     ++   P 
Sbjct: 15691 KAYSTVATNCHKTS--WKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASER---PL 15745

Query: 741   APGKIIPSRNTDTSVVVSWE--ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTC 798
              PGKI     T  SV +SWE  E      ++GY +E    GS KW  C    VK +  T 
Sbjct: 15746 PPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATCAT--VKVTEATI 15803

Query: 799   HGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASR 858
              GL+ G+ Y FRV A N  G+S+  Q S  +  K  +       + PA        T   
Sbjct: 15804 TGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLV-------IPPAFKLLFNTFTVLA 15856

Query: 859   GRVHEASPPTFQK--DALLGSKPNKPSLPSSSQNLGQTE---VSKVSETVQEELTPPPQK 913
             G   +   P   +   A+   K N P   ++  N   TE   +  + +  +E++     K
Sbjct: 15857 GEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVK 15916

Query: 914   AAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYR 973
                      + L       P  P   +   E   DS+ L W  P   GG+ I  Y V  R
Sbjct: 15917 LTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKR 15976

Query: 974   EVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEE 1033
                D     W+  +   V+    K   LK    YQF++AA N    G  + ++      +
Sbjct: 15977 ---DTSTTTWQIVSA-TVARTTIKACRLKTGCEYQFRIAAENR--YGKSTYLNSEPTVAQ 16030

Query: 1034  WTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEA 1093
             +   VPGPP +   +   +DS+ +QW  P+  G + V GY ++ KE  +    W  LN+ 
Sbjct: 16031 YPFKVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNS--ILWVKLNKT 16088

Query: 1094  AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAE---TRPGTKEVVV 1146
              I     K  GL+EGV Y FRV A N  G+GKPS ++   VA      PG  E ++
Sbjct: 16089 PIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAII 16144



 Score =  219 bits (557), Expect = 2e-56
 Identities = 204/808 (25%), Positives = 322/808 (39%), Gaps = 89/808 (11%)

Query: 439   PEIQWYRN--GVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAY 496
             PE+ W ++     L+ S  V+     + +  + +   + D G Y +           +A 
Sbjct: 11926 PEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATN-------TAG 11978

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
              FV  A   +   P    ++K ++ + D   + W  P  DGG  I  Y ++KCE     W
Sbjct: 11979 SFVAYATVNVLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVW 12038

Query: 557   SQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSR 616
             S  + T V      VT LIEG  YIFRVRA NK+G G P+  S+PV A    +K      
Sbjct: 12039 STYSAT-VLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTE-SKPVIAKTKYDK------ 12090

Query: 617   PSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEK 675
                                  PG P    VT+ ++  + + W PP   G + I  YF+EK
Sbjct: 12091 ---------------------PGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEK 12129

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
              E  +  W  VN +  +   R  + +L     Y FRV+  N  G+GEPS  +   V  D 
Sbjct: 12130 KEKHSTRWVPVN-KSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDP 12188

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIE-----ASVAGSGKWEPCN- 787
             ++ P  P        T  S+ + W +        ++GY +E     A  +    W+ CN 
Sbjct: 12189 IEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNA 12248

Query: 788   NNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPAL 847
                +    FT   L   Q Y FRV A N  G+   ++  EAI+ K  +     P++    
Sbjct: 12249 AAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEIL---EPPEI---- 12301

Query: 848   SDEPGGLTASRGR--VHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSET--- 902
                   L AS  +  +  A  P      L      +P+   + + +G   V +  +    
Sbjct: 12302 -----DLDASMRKLVIVRAGCPI----RLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLV 12352

Query: 903   -VQEELTPPPQKAAPQGKSKSDPLKKKTDRA---------PPSPPCDITCLESFRDSMVL 952
                  L  P       GK     +    ++A          P P  D+   +  + S  +
Sbjct: 12353 DTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHV 12412

Query: 953   GWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVA 1012
              W  P+  GG+++T Y V  RE       K        V + ++ ++NL     Y F+V 
Sbjct: 12413 SWAPPENDGGSQVTHYIVEKRE----ADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVT 12468

Query: 1013  AMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTG 1072
             A+N  G G P+ V +     +  ++ P PP  L+ +E+ K+S  L W PP+  G   + G
Sbjct: 12469 AVNEYGPGVPTDVPKPVLASD-PLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDG 12527

Query: 1073  YFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGP 1132
             Y    +E +   D+W     + +K++ L V GLKEG  Y FRV A N  GV  P +  G 
Sbjct: 12528 YITSYREEEQPADRW--TEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGV 12585

Query: 1133  VVAETRPGTKEVVV--NVDDDGVISLNFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESK 1189
               A+ +    ++++   +       L  E      P     W K       S  L V   
Sbjct: 12586 YEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKA 12645

Query: 1190  GNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
              + + +  KD+   D G YS    ++ G
Sbjct: 12646 DSSSILIIKDVTRKDSGYYSLTAENSSG 12673



 Score =  216 bits (551), Expect = 1e-55
 Identities = 206/784 (26%), Positives = 323/784 (41%), Gaps = 104/784 (13%)

Query: 475   EDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPA 534
             ED G+Y++ V      +  S  V V D        P  P D++  E  KD   ++WK+P 
Sbjct: 10977 EDGGIYSLTVENPAGSKTVSVKVLVLDK-------PGPPRDLEVSEIRKDSCYLTWKEPL 11029

Query: 535   VDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGF 594
              DGGS I  Y +++ +V +  WS  + T  K + F    L EG  Y+FRV A N+ G G 
Sbjct: 11030 DDGGSVITNYVVERRDVASAQWSPLSATSKKKSHF-AKHLNEGNQYLFRVAAENQYGRGP 11088

Query: 595   PSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYV 654
                  +P+ ALDP                              PGPP DL   +  ++ V
Sbjct: 11089 FVETPKPIKALDPLHP---------------------------PGPPKDLHHVDVDKTEV 11121

Query: 655   VLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVR 713
              L W  P + G   I  Y VE  E GT++W +  T   V +    +  L +GK+Y FRV+
Sbjct: 11122 SLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKT---VTNLECVVTGLQQGKTYRFRVK 11178

Query: 714   CSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYI 773
               N  G+G P   T + +   +  +P       PS   D  ++                I
Sbjct: 11179 AENIVGLGLPD--TTIPIECQEKLVP-------PSVELDVKLIEGLVVKAGTTVRFPAII 11229

Query: 774   EASVAGSGKWEPCNNNPVKGSRFT--------------CHGLVTGQSYIFRVRAVNAAGL 819
                   + KW    +       +T              C    TG+   +++   NAAG 
Sbjct: 11230 RGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGE---YQITVSNAAGS 11286

Query: 820   SEYSQDSEAIEVKAAIGGGVSP-DVCP---ALSDEP----GGLTASRGRVHEASPPTFQK 871
                +     ++V     G ++  DV P    +S +P    GG       V +      +K
Sbjct: 11287 KTVAVHLTVLDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDT---RK 11343

Query: 872   DA--LLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKT 929
             D   ++ S  +K  L       G   V +V    +  + PP           S P   K 
Sbjct: 11344 DTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENKIGVGPPLD---------STPTVAKH 11394

Query: 930   DRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVK 989
               +PPSPP      +   ++  + W  P   GG+ ITGYY+  RE    V GKW   N  
Sbjct: 11395 KFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERRE----VTGKWVRVNKT 11450

Query: 990   AVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFK-CEEWTIAVPGPPHSLKCS 1048
              +++  ++++ L E   Y+F+V A N+AGL  PS  S+  K C    I  PGPP + K  
Sbjct: 11451 PIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACR--PIKPPGPPINPKLK 11508

Query: 1049  EVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN-EAAIKNVYLKVRGLKE 1107
             +  +++  L W  P+  G +P+ GY V+ +  K    QW  +N +  I+    +V GL E
Sbjct: 11509 DKSRETADLVWTKPLSDGGSPILGYVVECQ--KPGTAQWNRINKDELIRQCAFRVPGLIE 11566

Query: 1108  GVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLN-------FEC 1160
             G  Y FR++A N  G G+P +LA  V+A+      EV ++V    VI++           
Sbjct: 11567 GNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILAR 11626

Query: 1161  DKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIAS 1220
              K  P+ + +W+K+        R+++     + ++  K+    D G Y     ++ G A 
Sbjct: 11627 VKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQ 11686

Query: 1221  SYLI 1224
                I
Sbjct: 11687 GSAI 11690



 Score =  216 bits (550), Expect = 1e-55
 Identities = 215/827 (25%), Positives = 330/827 (39%), Gaps = 99/827 (11%)

Query: 417   REGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKED 476
             R G TM L   V   P      P+I W +  V L     +    +     L   ++NK D
Sbjct: 13401 RAGVTMRLYVPVKGRPP-----PKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYD 13455

Query: 477   EGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVD 536
              G Y + +      ++Y+  V V D        P  P++V   E +KD   ++W+ P +D
Sbjct: 13456 AGKYILTLENSCGKKEYTIVVKVLDT-------PGPPVNVTVKEISKDSAYVTWEPPIID 13508

Query: 537   GGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPS 596
             GGSPI+ Y + K +    SWS    T      F V  L EG+SY FRV A N+ GIG P 
Sbjct: 13509 GGSPIINYVVQKRDAERKSWSTVT-TECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPG 13567

Query: 597   RVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVL 656
                + V A                                 PGP  DL V   ++S   +
Sbjct: 13568 ETRDAVKASQ------------------------------TPGPVVDLKVRSVSKSSCSI 13597

Query: 657   SWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSN 716
              WK P   G   I+ +V         WQRV   L   S +++  DL EGK Y FRV   N
Sbjct: 13598 GWKKPHSDGGSRIIGYVVDFLTEENKWQRVMKSL---SLQYSAKDLTEGKEYTFRVSAEN 13654

Query: 717   SAGVGEPSEATEVT---VVGDKLDIPKAPGKIIPSRNTDT-----------SVVVSWEES 762
               G G PSE T V    VV   LD+   P     ++               +  VSW++ 
Sbjct: 13655 ENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKG 13714

Query: 763   KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEY 822
             +D        +      S +    N   +    + C     G+   + +   N AG  E 
Sbjct: 13715 EDP-------LATDTRVSVESSAVNTTLIV---YDCQKSDAGK---YTITLKNVAGTKE- 13760

Query: 823   SQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKP 882
                + +I+V    G    P     ++ E   L  +  +    S  T        S  NK 
Sbjct: 13761 --GTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKW 13818

Query: 883   SLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKS-KSDPLKKKTDRAPPSPPCDIT 941
                +S+       V+++ E ++       +     G+  KS+P+  +     P  P    
Sbjct: 13819 VTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPN 13878

Query: 942   CLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNL 1001
              ++   DS+ L W  P K GG+ ITGY++ ++E    +   W+ AN   +    +K++ L
Sbjct: 13879 IVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLL---WKRANKTPIRMRDFKVTGL 13935

Query: 1002  KENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKP 1061
              E + Y+F+V A+N+AG+G PS  SE     +  I  PG P  +    + ++S+ L W  
Sbjct: 13936 TEGLEYEFRVMAINLAGVGKPSLPSEPVVALD-PIDPPGKPEVI---NITRNSVTLIWTE 13991

Query: 1062  PVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQA 1121
             P + G   +TGY V+ ++  +K   W   N   +      V  L EG  Y FR+RA N A
Sbjct: 13992 PKYDGGHKLTGYIVEKRDLPSK--SWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTA 14049

Query: 1122  G-VGKPSDLAGPVVAETR---------PGTKE-VVVNVDDDGVISLNFECDKMTPKSEFS 1170
             G +  PS+    ++ +           P  K+ + +   D  V++      K  PKS  S
Sbjct: 14050 GAISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKS--S 14107

Query: 1171  WSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
             WSK       S   ++ S    + +T K     D G Y+   T+  G
Sbjct: 14108 WSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFG 14154



 Score =  216 bits (550), Expect = 1e-55
 Identities = 203/835 (24%), Positives = 345/835 (41%), Gaps = 98/835 (11%)

Query: 411   FDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFS 470
             FD    + GE++ +   V   P      P + W+++GV +     ++        +L   
Sbjct: 21660 FDGLIIKSGESLRIKALVQGRPV-----PRVTWFKDGVEIEKRMNMEITDVLGSTSLFVR 21714

Query: 471   HLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISW 530
                ++  G+YT+  +      +    V V+D   ++ G       ++      + + + W
Sbjct: 21715 DATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGP------IRFTNITGEKMTLWW 21768

Query: 531   KQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKM 590
               P  DG +PI  Y I+K E    +W+   D   +   +    LI G  Y FRV AVNK 
Sbjct: 21769 DAPLNDGCAPITHYIIEKRETSRLAWALIEDK-CEAQSYTAIKLINGNEYQFRVSAVNKF 21827

Query: 591   GIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEAT 650
             G+G P   S+PV A                   QI  T        VP  P     +  T
Sbjct: 21828 GVGRPLD-SDPVVA-------------------QIQYT--------VPDAPGIPEPSNIT 21859

Query: 651   RSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYC 709
              + + L+W +P    G E   Y +E+ E  +  W +V ++ P+   RF +  L EG  Y 
Sbjct: 21860 GNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYE 21919

Query: 710   FRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKE 767
             F V   N+AGVG  S  + +    + ++ P  P  +  +  + T+V + W +       E
Sbjct: 21920 FHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGME 21979

Query: 768   LVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSE 827
             ++GY IE   A  G W   N      +R+T   L  G+ Y FRV A+N AG  +  + + 
Sbjct: 21980 IIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTG 22039

Query: 828   AIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRV-----HEASP-PT---FQKDALLGSK 878
              I+   A+    +P++    + +   +  +   +     ++  P PT    + D+ L  +
Sbjct: 22040 TIK---AVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLR 22096

Query: 879   PNKPSLPSSS----QNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPP 934
              +  +  S S    +N  + +  K + TV+               SKS     K     P
Sbjct: 22097 ADIHTTDSFSTLTVENCNRNDAGKYTLTVEN-----------NSGSKSITFTVKV-LDTP 22144

Query: 935   SPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEE 994
              PP  IT  +  R S  L W  P   GGA I  Y V  RE        W+  + K  + +
Sbjct: 22145 GPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKRE---ASRRSWQVISEKC-TRQ 22200

Query: 995   AYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDS 1054
              +K+++L E + Y F+V+A+N  G+G P  + E     E     P PP  L   +  K S
Sbjct: 22201 IFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATE----QPAPPRRLDVVDTSKSS 22256

Query: 1055  LVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFR 1114
              VL W  P H G + +TGY +++++  +  D W  +     K +   V  L E   Y FR
Sbjct: 22257 AVLAWLKPDHDGGSRITGYLLEMRQKGS--DFW--VEAGHTKQLTFTVERLVEKTEYEFR 22312

Query: 1115  VRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMT---------- 1164
             V+A N AG  +P +    V+ +      ++    D  G+ +    C   +          
Sbjct: 22313 VKAKNDAGYSEPREAFSSVIIK----EPQIEPTADLTGITNQLITCKAGSPFTIDVPISG 22368

Query: 1165  -PKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGI 1218
              P  + +W  + +  +++ R+ + +  ++T +T KD    D G Y   + +T G+
Sbjct: 22369 RPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGV 22423



 Score =  209 bits (533), Expect = 1e-53
 Identities = 206/802 (25%), Positives = 328/802 (40%), Gaps = 99/802 (12%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVR--MGEYYEQYSAY 496
             P I+WY++   L  +  V    + + A++     ++ + G Y +++R  MG      SA 
Sbjct: 20597 PTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMG------SAS 20650

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
               +R    +  G P  P++ K + A K  I + W+ PA DGG+ I  Y ++K E     W
Sbjct: 20651 ATIRVQILDKPGPPGGPIEFKTVTAEK--ITLLWRPPADDGGAKITHYIVEKRETSRVVW 20708

Query: 557   SQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSR 616
             S  ++  ++      T +I+G  YIFRVRAVNK GIG P      VA             
Sbjct: 20709 SMVSE-HLEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVA------------- 20754

Query: 617   PSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEK 675
                             +  + PGPP    VT+ T++ + + W  P   G   I  YF+EK
Sbjct: 20755 ---------------KNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEK 20799

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
              +  +  W +V  E  ++  R  +  L E   Y +RV   N+AG G  SE +E     D 
Sbjct: 20800 RDKKSLGWFKVLKE-TIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADP 20858

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCN-NNPVK 792
             +D P  P KI  + +T +S+ + W +        + GY +E       +W   +    V+
Sbjct: 20859 IDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVR 20918

Query: 793   GSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPG 852
              + +    L  G +Y FRV AVN AG  E  + +E ++ K  +    +P++   ++    
Sbjct: 20919 TTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDIL---EAPEIDLDVALRTS 20975

Query: 853   GLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQ 912
              +  +   V    P         G  P   +     +NLG      +  T    L   PQ
Sbjct: 20976 VIAKAGEDVQVLIP-------FKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQ 21028

Query: 913   KAAPQ------------GKSKSDPLKKKTDRAPPSPPCD-ITCLESFRDSMVLGWKQPDK 959
                              G+ KS  +  K    P +  C  +      R ++ L W  P  
Sbjct: 21029 VTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAA--CQKLQVKHVSRGTVTLLWDPPLI 21086

Query: 960   IGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 1019
              GG+ I  Y +  R   D     W   + K  S  ++K+ +L E   + F+V A N  G+
Sbjct: 21087 DGGSPIINYVIEKR---DATKRTWSVVSHKC-SSTSFKLIDLSEKTPFFFRVLAENEIGI 21142

Query: 1020  GAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE 1079
             G P   +E  K  E    VP P   L   +  K S++L W  P   G + +T Y V   E
Sbjct: 21143 GEPCETTEPVKAAE----VPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVV---E 21195

Query: 1080  AKAKEDQ-WRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETR 1138
              K K +Q W   +    K   ++V  LKE     FRV A N+ G+  P  + GP+  +  
Sbjct: 21196 RKGKGEQTWS--HAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTI-GPITVKEL 21252

Query: 1139  -----------PGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVE 1187
                        PG  +V V +  +  + L +   K  PK   SW KD +  ++S  +   
Sbjct: 21253 IITPEVDLSDIPGA-QVTVRIGHNVHLELPY---KGKPKPSISWLKDGLPLKESEFVRFS 21308

Query: 1188  SKGNKTKMTFKDLGMDDLGIYS 1209
                NK  ++ K+   +  G Y+
Sbjct: 21309 KTENKITLSIKNAKKEHGGKYT 21330



 Score =  206 bits (525), Expect = 1e-52
 Identities = 199/815 (24%), Positives = 338/815 (41%), Gaps = 110/815 (13%)

Query: 438   QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
             +PE++W +    L+    ++   +     L   ++ + D G Y + +      +  +A+V
Sbjct: 18831 EPEVKWEKAEGILTDRAQIEV--TSSFTMLVIDNVTRFDSGRYNLTLENNSGSK--TAFV 18886

Query: 498   FVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
              VR  D+     P+AP+++   E  KD + +SW+ P +DGG+ I  Y ++K E    +++
Sbjct: 18887 NVRVLDS-----PSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYA 18941

Query: 558   QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRP 617
                +   K   F +  L EG SY FRV A N+ GIG P+  +EPV   +P          
Sbjct: 18942 TITNNCTK-TTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEP---------- 18990

Query: 618   SAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKC 676
                                 P PP  +++ + TR+   + W+ P   G   I  Y VE  
Sbjct: 18991 --------------------PLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQ 19030

Query: 677   EAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKL 736
               G+E W   +T   VK+    +  L  G+ Y FRV   N  G  +P +   V V+   +
Sbjct: 19031 TKGSEKW---STCTQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLG-VPVIARDI 19086

Query: 737   DIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRF 796
             +I   P   +P     T  V + E+ K     +    +     +  W        + +R 
Sbjct: 19087 EIK--PSVELPFH---TFNVKAREQLK-----IDVPFKGRPQATVNWRKDGQTLKETTRV 19136

Query: 797   TCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTA 856
                   T  S   +  +    G  E    + A        G ++  +   + D PG    
Sbjct: 19137 NVSSSKTVTSLSIKEASKEDVGTYELCVSNSA--------GSITVPITIIVLDRPG--PP 19186

Query: 857   SRGRVHEAS---------PPTFQKDALLGSKPNKPSLPSS------SQNLGQTEVSKVSE 901
                R+ E S         PP +     + +   +    +S      SQ + +T +  V  
Sbjct: 19187 GPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSIKIVRL 19246

Query: 902   TVQEELTPPPQKAAPQGKS---KSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPD 958
             T   E           GKS   +S  +  +   +PP PP     + + + +M++ W+ P 
Sbjct: 19247 TTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPV 19306

Query: 959   KIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAG 1018
               GG+ + GY++ Y+E    +   W +AN   +++   K+S L E ++Y+++V A N+AG
Sbjct: 19307 NDGGSRVIGYHLEYKERSSIL---WSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAG 19363

Query: 1019  LGAPSAVSECFKCEEWTIAVPG-----PPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGY 1073
             +G         KC +    VP      PP   + + + + S+ L+W  P + G   +TGY
Sbjct: 19364 IG---------KCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGY 19414

Query: 1074  FVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQA-GVGKPSDLAGP 1132
              V+ +E    + +W   N   I+  Y +V  L E   Y FRV A N A  V +PS+  GP
Sbjct: 19415 IVERRELP--DGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGP 19472

Query: 1133  VVAETRPGTKEVVVNVDDDGVISLNF-ECDKMT------PKSEFSWSKDYVSTEDSPRLE 1185
             ++ +       V+++V    VI +   E  K+       P    SW+KD +  E+  R E
Sbjct: 19473 IIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTE 19532

Query: 1186  VESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIAS 1220
             + S  N T +T KD    D G Y   + +  G  S
Sbjct: 19533 IISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRS 19567



 Score =  206 bits (523), Expect = 2e-52
 Identities = 199/804 (24%), Positives = 355/804 (44%), Gaps = 75/804 (9%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P  +W  +G  +   +          + LT  +  + D G Y I V      +  + ++ 
Sbjct: 11235 PTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLT 11294

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V D    + G P  P+++  L+   +++ ISW+ P  DGGSP++ Y ++K +   D+W  
Sbjct: 11295 VLD----VPGPPTGPINI--LDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGV 11348

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
              +    K  +  +  L +G  Y+FRVRA NK+G+G P   +  V        A+ K  P 
Sbjct: 11349 VSSGSSK-TKLKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPTV--------AKHKFSPP 11399

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
             +P                 PG P    VT+ T +   +SW  P   G   I  Y++E+ E
Sbjct: 11400 SP-----------------PGKPV---VTDITENAATVSWTLPKSDGGSPITGYYMERRE 11439

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
               T  W RVN + P+   +F +  L EG +Y FRV   N AG+ +PS +++       + 
Sbjct: 11440 V-TGKWVRVN-KTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIK 11497

Query: 738   IPKAP-GKIIPSRNTDTSVVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNP-VKG 793
              P  P    +  ++ +T+ +V W +  S     ++GY +E    G+ +W   N +  ++ 
Sbjct: 11498 PPGPPINPKLKDKSRETADLV-WTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQ 11556

Query: 794   SRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAI-GGGVSPDVC--PALSDE 850
               F   GL+ G  Y FR++A N  G  E  + +E++  K  +    V  DV     ++  
Sbjct: 11557 CAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVR 11616

Query: 851   PGGLTASRGRVHEASPP--TFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELT 908
              G       RV     P  T+ K+  +  +  +  L    Q+L + E+ ++ E V+ +  
Sbjct: 11617 VGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDL---IQDLPRVEL-QIKEAVRADHG 11672

Query: 909   PPPQKAA-PQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITG 967
                  A    G ++   +    DR  P P  ++      +++  + W+ P   GG+EIT 
Sbjct: 11673 KYIISAKNSSGHAQGSAIVNVLDR--PGPCQNLKVTNVTKENCTISWENPLDNGGSEITN 11730

Query: 968   YYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSE 1027
             + V YR+     P +   + V +   +    +NL  N  Y F+V A N  G+G P+  ++
Sbjct: 11731 FIVEYRK-----PNQKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVG-PTIETK 11784

Query: 1028  CFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQW 1087
                     I  PG P +L  ++  K  + L+W+ P + G +P   Y V+ +  K  +D W
Sbjct: 11785 TPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVE-RRLKGSDD-W 11842

Query: 1088  RGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVN 1147
               +++ +IK  +  V    E   Y FRV+  N+ G    SD         +   ++ V++
Sbjct: 11843 ERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGG---ESDWVKTEEVVVKEDLQKPVLD 11899

Query: 1148  VDDDGVI------SLNFECD-KMTPKSEFSWSKDYVSTE--DSPRLEVESKGNKTKMTFK 1198
             +   GV+      ++  E   +  P  E +W+KD  +T+   SPR++++++ + +K +  
Sbjct: 11900 LKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLT 11959

Query: 1199  DLGMDDLGIYSCDVTDTDGIASSY 1222
                  D G Y    T+T G   +Y
Sbjct: 11960 KAKRSDGGKYVVTATNTAGSFVAY 11983



 Score =  204 bits (519), Expect = 6e-52
 Identities = 197/777 (25%), Positives = 323/777 (41%), Gaps = 98/777 (12%)

Query: 474  KEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQP 533
            + D GLY I+V       +    V V D        P  P++    +  K  ++  W+ P
Sbjct: 8468 RPDHGLYMIKVENDHGIAKAPCTVSVLDT-------PGPPINFVFEDIRKTSVLCKWEPP 8520

Query: 534  AVDGGSPILGYFIDKCE-VGTDS-WSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMG 591
              DGGS I+ Y ++K +    DS W     T ++  ++ VT LIEG+ Y+FRVRA N+ G
Sbjct: 8521 LDDGGSEIINYTLEKKDKTKPDSEWIVVTST-LRHCKYSVTKLIEGKEYLFRVRAENRFG 8579

Query: 592  IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATR 651
             G P  VS+P+ A DP                              P  P    V + T 
Sbjct: 8580 PG-PPCVSKPLVAKDPFGP---------------------------PDAPDKPIVEDVTS 8611

Query: 652  SYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFR 711
            + +++ W  P   G   + Y++EK E  + +W RVN  L + + +  +  L EG +Y FR
Sbjct: 8612 NSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSL-LNALKANVDGLLEGLTYVFR 8670

Query: 712  VRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTS---VVVSWEES--KDAK 766
            V   N+AG G+ S  ++     D +  P  P   IP R TDTS   + + WE        
Sbjct: 8671 VCAENAAGPGKFSPPSDPKTAHDPISPPGPP---IP-RVTDTSSTTIELEWEPPAFNGGG 8726

Query: 767  ELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDS 826
            E+VGY+++  + G+ +W  C    +K  ++T   +  G  Y  RV AVNAAG     +  
Sbjct: 8727 EIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGETQ 8786

Query: 827  EAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPS 886
                 +      V  DV        GG+    G+       T +  A++  +P    + +
Sbjct: 8787 PVTVAEPQEPPAVELDV-----SVKGGIQIMAGK-------TLRIPAVVTGRPVPTKVWT 8834

Query: 887  SSQ-----------NLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPS 935
              +           N+G      + + ++++       A     SK    + +     P 
Sbjct: 8835 KEEGELDKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDV-PG 8893

Query: 936  PPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEA 995
            P  D+  + + R   +L W  P+  GG+EITG+ +  +   D     WR+     +  E 
Sbjct: 8894 PVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERK---DAKMHTWRQ----PIETER 8946

Query: 996  YK--ISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKD 1053
             K  I+ L E   Y+F+V A N  G G P  +      +   +  P  P  L  +E  K 
Sbjct: 8947 SKCDITGLLEGQEYKFRVIAKNKFGCGPPVEIGPILAVD--PLGPPTSPERLTYTERTKS 9004

Query: 1054 SLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVF 1113
            ++ L WK P  +G +P+ GY ++ K    K D +  +N+         V  L E   Y F
Sbjct: 9005 TITLDWKEPRSNGGSPIQGYIIE-KRRHDKPD-FERVNKRLCPTTSFLVENLDEHQMYEF 9062

Query: 1114 RVRAINQAGVGKPSDLAGPVVAETR-PGTKEVVVNVDDDGV-----ISLNFECDKM-TPK 1166
            RV+A+N+ G  +PS     V+ +   P T ++ ++V  D +       ++   D    P 
Sbjct: 9063 RVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPM 9122

Query: 1167 SEFSWSKDYVSTE------DSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
             +  WSK+    E         + EV     KT+++      +D G Y+   ++  G
Sbjct: 9123 PKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLG 9179



 Score =  202 bits (515), Expect = 2e-51
 Identities = 243/1051 (23%), Positives = 411/1051 (39%), Gaps = 156/1051 (14%)

Query: 274   LHAPEFIIKP-RSHTVWEK--ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIES 330
             L  PE  +K   SHTV+ +   N+K+   I+G P P+VT  ++ VP+         I   
Sbjct: 20166 LEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAE 20225

Query: 331   RYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPL 390
                  T+ +      D  +Y  +A N  G   A+ ++VV              G  T P+
Sbjct: 20226 NL---TINLKESVTADAGRYEITAANSSGTTKAFINIVVLD----------RPGPPTGPV 20272

Query: 391   SFG-VTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVP 449
                 +T      ++E     K+D            G +V     +K              
Sbjct: 20273 VISDITEESVTLKWE---PPKYDG-----------GSQVTNYILLKR------------E 20306

Query: 450   LSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRV--RMGEYYEQYSAYVFVRDADAEIE 507
              S + W +   +  R  +    L   +E  + I+   R G      SA V V+       
Sbjct: 20307 TSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVK-LPYTTP 20365

Query: 508   GAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFA 567
             G P+ P         ++ I + W +P  +GGS ++GY ++  +  +  W + N   ++  
Sbjct: 20366 GPPSTPW---VTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTT 20422

Query: 568   RFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIV 627
              F VT +  G  Y FRV A N  G+G PS  SEPV A+D  E                  
Sbjct: 20423 HFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACE------------------ 20464

Query: 628   TEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRV 686
                         PP ++ +T+ +++ V LSW+ P   G   I  Y VE+ +     W + 
Sbjct: 20465 ------------PPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKA 20512

Query: 687   NTELPVKSPRFALFDLAEGKSYCFRVRCSNSAG-VGEPSEATEVTVVGDKLDIPKAPGKI 745
             +    V   +F +  L +   Y FRV   N+ G +  PSE     VVG    I    G +
Sbjct: 20513 SFT-NVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSE-----VVGPITCIDSYGGPV 20566

Query: 746   IPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQ 805
             I      T VV         K   G  ++     SGK  P             + LV  +
Sbjct: 20567 IDLPLEYTEVV---------KYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVE 20617

Query: 806   SYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEAS 865
             +    + ++        +     ++++ A+G   S  +   + D+PG      G   E  
Sbjct: 20618 NTT-DLASILIKDADRLNSGCYELKLRNAMGSA-SATIRVQILDKPG----PPGGPIEFK 20671

Query: 866   PPTFQKDALLGSKPNKPSLPS------SSQNLGQTEVSKVSETVQEELTPPPQ------- 912
               T +K  LL   P               +   +   S VSE ++E +    +       
Sbjct: 20672 TVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECIITTTKIIKGNEY 20731

Query: 913   --------KAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAE 964
                     K       +SD +  K     P PP      +  ++SM + W +P   GG++
Sbjct: 20732 IFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSD 20791

Query: 965   ITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSA 1024
             I+GY++  R   D     W +   + + +   K++ L EN  YQ++V A+N AG G  S 
Sbjct: 20792 ISGYFLEKR---DKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSE 20848

Query: 1025  VSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKE 1084
              SE +K  +  I  PGPP  ++ ++  K S+ L W  PV+ G + VTGY V++++   +E
Sbjct: 20849 PSEFYKAAD-PIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQ--GEE 20905

Query: 1085  DQWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKE 1143
             ++W  ++ +  ++     V  LK GV+Y FRV A+N AG G+P ++  PV A+      E
Sbjct: 20906 EEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPE 20965

Query: 1144  ----------VVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKT 1193
                       V+    +D  + + F   K  P    +W KD  +     R  +E+  + +
Sbjct: 20966 IDLDVALRTSVIAKAGEDVQVLIPF---KGRPPPTVTWRKDEKNLGSDARYSIENTDSSS 21022

Query: 1194  KMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVE 1253
              +T   +  +D G Y   + +  G   S  +  + L             T     +L V+
Sbjct: 21023 LLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVL------------DTPAACQKLQVK 21070

Query: 1254  ILEKGQVRFWMQAEKLSGNAK-VNYIFNEKE 1283
              + +G V        + G +  +NY+  +++
Sbjct: 21071 HVSRGTVTLLWDPPLIDGGSPIINYVIEKRD 21101



 Score =  202 bits (513), Expect = 3e-51
 Identities = 201/738 (27%), Positives = 302/738 (40%), Gaps = 66/738 (8%)

Query: 438   QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
             +P I W ++G+PL  S++V+   +  + TL+  +  KE  G YT+ +            V
Sbjct: 21287 KPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITV 21346

Query: 498   FVRDADAEIEGAPAAPLD-VKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
                       G P+ P   ++  E   D +I+SW  P  +GG  I  Y I+K E    +W
Sbjct: 21347 ITL-------GPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNW 21399

Query: 557   SQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSR 616
                  +  +   F V  L++   Y FRVRA N+ G+                        
Sbjct: 21400 KMVCSSVAR-TTFKVPNLVKDAEYQFRVRAENRYGV------------------------ 21434

Query: 617   PSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYF-VEK 675
              S P    IIV + +     +PGPP    +   T   + L+W  P   G   +  F VEK
Sbjct: 21435 -SQPLVSSIIVAKHQFR---IPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEK 21490

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
              E  +  WQ+VNT  P+    +    L EG  Y FRV   NSAG+  PS+ ++ T+    
Sbjct: 21491 KERNSILWQKVNTS-PISGREYRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSP 21549

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKG 793
             +D P  P  I  +R T   + + W         ++VGY IE    G+ +W  CN   V  
Sbjct: 21550 VDPPGTPDYIDVTRET---ITLKWNPPLRDGGSKIVGYSIEKR-QGNERWVRCNFTDVSE 21605

Query: 794   SRFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIGGGV---SPDVCPALSD 849
              ++T  GL  G  Y FR+ A NA G +S  SQ S  I  +      +    P+    L  
Sbjct: 21606 CQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLII 21665

Query: 850   EPGGLTASRGRVHEASPP--TFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEEL 907
             + G     +  V     P  T+ KD   G +  K      +  LG T +     T     
Sbjct: 21666 KSGESLRIKALVQGRPVPRVTWFKD---GVEIEKRMNMEITDVLGSTSLFVRDATRDHRG 21722

Query: 908   TPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITG 967
                 +     G +K++ +K K    P      I       + M L W  P   G A IT 
Sbjct: 21723 VYTVEAKNASGSAKAE-IKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITH 21781

Query: 968   YYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSE 1027
             Y +  RE    +     E   +A S  A K+ N  E   YQF+V+A+N  G+G P     
Sbjct: 21782 YIIEKRET-SRLAWALIEDKCEAQSYTAIKLINGNE---YQFRVSAVNKFGVGRPLDSDP 21837

Query: 1028  CFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQW 1087
                  ++T  VP  P   + S +  +S+ L W  P   G + +  Y ++ +E K+   +W
Sbjct: 21838 VVAQIQYT--VPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKKS--TRW 21893

Query: 1088  -RGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAE--TRPGTKEV 1144
              + +++  I     KV GL EG  Y F V A N AGVG  S ++  +       P     
Sbjct: 21894 VKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPT 21953

Query: 1145  VVNVDDDGVISLNFECDK 1162
             VV V D    +++ E  K
Sbjct: 21954 VVKVTDTSKTTVSLEWSK 21971



 Score =  201 bits (510), Expect = 6e-51
 Identities = 194/718 (27%), Positives = 295/718 (41%), Gaps = 94/718 (13%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P++ W    + L  +  V    + +R TLT     + D G Y + +      + +S  V 
Sbjct: 22372 PKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVV 22431

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V      + G    P++V  + A     ++SW +P   GG+ I  Y ++K E GT +W  
Sbjct: 22432 VIGRPGPVTG----PIEVSSVSAES--CVLSWGEPKDGGGTEITNYIVEKRESGTTAWQL 22485

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
              N + VK  +  VT L +   Y FRV + N+ G+  P   S P+ A  P           
Sbjct: 22486 VNSS-VKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE-SAPIIAEHPF---------- 22533

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                              + P  PT   V   + + + + W+ P   G   I+ Y+VEK E
Sbjct: 22534 -----------------VPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKE 22576

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
               T  W + N ++P     + +  L EG  Y FR    N+AGV + SEA+   +  + +D
Sbjct: 22577 RNTILWVKEN-KVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVD 22635

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIE---ASVAGSGKWEPCNNNPVKGS 794
              P  P     +R+T  S++ S        ++VGY IE    S  G G+W  CN   V  +
Sbjct: 22636 APGRPEVTDVTRST-VSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDN 22694

Query: 795   RFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGG 853
              FT   L  G +Y FRV A NAAG +S+ S+ +  +  +         +  P  ++    
Sbjct: 22695 FFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCR--------DEYAPPKAELDAR 22746

Query: 854   LTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQK 913
             L      +   S      DA +G KP     P      G  E+  + E V  + T     
Sbjct: 22747 LHGDLVTIRAGSDLVL--DAAVGGKPE----PKIIWTKGDKELD-LCEKVSLQYTGKRAT 22799

Query: 914   AAPQGKSKSDPLK------------------KKTDRAPPSPPCDITCLESFRDSMVLGWK 955
             A  +   +SD  K                  K  D   P P   +T     ++   L W 
Sbjct: 22800 AVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLD--SPGPCGKLTVSRVTQEKCTLAWS 22857

Query: 956   QPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEE----AYKISNLKENMVYQFQV 1011
              P + GGAEIT Y V  RE            N   V  E    +Y ++ L +N  Y F+V
Sbjct: 22858 LPQEDGGAEITHYIVERRET--------SRLNWVIVEGECPTLSYVVTRLIKNNEYIFRV 22909

Query: 1012  AAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVT 1071
              A+N  G G P           +TI  P PP   +     K+ +++QW  P   G   ++
Sbjct: 22910 RAVNKYGPGVPVESEPIVARNSFTI--PSPPGIPEEVGTGKEHIIIQWTKPESDGGNEIS 22967

Query: 1072  GYFVDLKEAKAKEDQWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSD 1128
              Y VD +E K+   +W  +N +  + +  LKV  L EG  Y FRV A+N AG  +PS+
Sbjct: 22968 NYLVDKREKKSL--RWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSE 23023



 Score =  191 bits (486), Expect = 4e-48
 Identities = 191/741 (25%), Positives = 302/741 (40%), Gaps = 88/741 (11%)

Query: 412   DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSH 471
             DV   R G+T+ +  RV   PE     P+I W + G  L   K V  +    R  L    
Sbjct: 11611 DVITVRVGQTIRILARVKGRPE-----PDITWTKEGKVLVREKRVDLIQDLPRVELQIKE 11665

Query: 472   LNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWK 531
               + D G Y I  +    + Q SA V V D        P    ++K     K+   ISW+
Sbjct: 11666 AVRADHGKYIISAKNSSGHAQGSAIVNVLDR-------PGPCQNLKVTNVTKENCTISWE 11718

Query: 532   QPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMG 591
              P  +GGS I  + ++  +     WS       K  R     L+    Y FRV A NK+G
Sbjct: 11719 NPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTK--RLIKANLLANNEYYFRVCAENKVG 11776

Query: 592   IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATR 651
             +G       P+ A++P ++                           PG P +L + +  +
Sbjct: 11777 VGPTIETKTPILAINPIDR---------------------------PGEPENLHIADKGK 11809

Query: 652   SYVVLSWKPPG-QRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCF 710
             ++V L W+ P    G   + Y VE+   G+++W+RV+ +  +K   + +    E + Y F
Sbjct: 11810 TFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVH-KGSIKETHYMVDRCVENQIYEF 11868

Query: 711   RVRCSNSAGVGEPSEATEVTVVGD----KLDIPKAPGKIIPSRNT---DTSV------VV 757
             RV+  N  G  +  +  EV V  D     LD+  +    + + +T   +  V       V
Sbjct: 11869 RVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEV 11928

Query: 758   SWEESKDAKELV---GYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAV 814
             +W + KDA +L       I+   A S K+         G ++      T  S++     V
Sbjct: 11929 AWTKDKDATDLTRSPRVKIDTR-ADSSKFSLTKAKRSDGGKYVVTATNTAGSFV-AYATV 11986

Query: 815   NAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEP--GGLTASRGRVHEASPPTFQKD 872
             N        ++ + ++        VS D C    D P   G    +  + E         
Sbjct: 11987 NVLDKPGPVRNLKIVD--------VSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVW 12038

Query: 873   ALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRA 932
             +   +    P    +    G   + +V    +    PP +      K+K D    K  R 
Sbjct: 12039 STYSATVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYD----KPGR- 12093

Query: 933   PPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVS 992
              P PP ++T +   ++ M + W  P+  GG  ITGY++  +E       +W   N  A+ 
Sbjct: 12094 -PDPP-EVTKVS--KEEMTVVWNPPEYDGGKSITGYFLEKKEKHS---TRWVPVNKSAIP 12146

Query: 993   EEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRK 1052
             E   K+ NL  +  YQF+V A N  G+G PS  S     ++  I  PGPP + +  +  K
Sbjct: 12147 ERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKD-PIEPPGPPTNFRVVDTTK 12205

Query: 1053  DSLVLQWKPPVHSGRTPVTGYFVDL--KEAKAKEDQ-WRGLNEAA-IKNVYLKVRGLKEG 1108
              S+ L W  PV+ G  P+ GY V++  K A A  D+ W+  N AA +      V  L E 
Sbjct: 12206 HSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDEN 12265

Query: 1109  VSYVFRVRAINQAGVGKPSDL 1129
               Y FRV A NQ G+G+P++L
Sbjct: 12266 QEYEFRVCAQNQVGIGRPAEL 12286



 Score =  191 bits (484), Expect = 7e-48
 Identities = 185/740 (25%), Positives = 303/740 (40%), Gaps = 88/740 (11%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P+ P +V  L+  K  + +SW +P  DGGS + GY+I++ E  TD W + N T +    +
Sbjct: 24027 PSNPPEV--LDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMY 24084

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              VTGL+    Y FR+ A N +G+   S  SEPV   DP +K                   
Sbjct: 24085 TVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDK------------------- 24125

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNT 688
                     P  P +L +   ++  V L W KP    G E + Y+VE  ++G   W++ N 
Sbjct: 24126 --------PSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNK 24177

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPS 748
             E  +K  +F +  L E   Y FRV   N  G+  P        +  KL   +APG     
Sbjct: 24178 ER-IKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTA--MSIKTKLTSGEAPGIRKEM 24234

Query: 749   RNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYI 808
             ++  T +    E ++ + ++VG  +        KW       ++  ++       G+++ 
Sbjct: 24235 KDVTTKL---GEAAQLSCQIVGRPLPDI-----KWYRFGKELIQSRKYKMSS--DGRTHT 24284

Query: 809   FRVRAVNAAGLSEYS----QDSEAIEVKAAIGGGVSPDVCPA--LSDEPGGLTASRGRVH 862
               V          Y+     +   +E  + +    +P   P   L ++  G   S  R+H
Sbjct: 24285 LTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLH 24344

Query: 863   EA--SPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKS 920
                   P        G K     L  +S+N+        +  V + +    Q+    GK 
Sbjct: 24345 VMYIGRPVPAMTWFHGQK-----LLQNSENITIENTEHYTHLVMKNV----QRKTHAGKY 24395

Query: 921   KSDP----------LKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYV 970
             K             L  +    P  P   I      ++S V+ WK P   GG+ IT Y V
Sbjct: 24396 KVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVV 24455

Query: 971   NYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFK 1030
                E  +G   +W+  +  A+S    +I NL EN  Y F+V+A N  G+  P  VS    
Sbjct: 24456 EKCEAKEGA--EWQLVS-SAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVI 24512

Query: 1031  CEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGL 1090
              +      PG P     + V KDS V+ WKPP   G   +  Y+++ +E   K+++W  +
Sbjct: 24513 IKS-PFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKRE--KKQNKWISV 24569

Query: 1091  NEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAET-----RPGTKEVV 1145
                 I+     V+ L EG+ Y FRV+  N  G  + S+++ P+  ++      P  KE +
Sbjct: 24570 TTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEEL 24629

Query: 1146  VNVDDDGVISLNFECDKMT--PKSEFSW---SKDYVSTEDSPRLEVESKGNKTKMTFKDL 1200
              N++     +    C K+T  PK    W    K+ ++     R++ E KG   ++    +
Sbjct: 24630 RNLNVRYQSNATLVC-KVTGHPKPIVKWYRQGKEIIADGLKYRIQ-EFKGGYHQLIIASV 24687

Query: 1201  GMDDLGIYSCDVTDTDGIAS 1220
               DD  +Y    T+  G  S
Sbjct: 24688 TDDDATVYQVRATNQGGSVS 24707



 Score =  189 bits (481), Expect = 1e-47
 Identities = 201/817 (24%), Positives = 331/817 (40%), Gaps = 114/817 (13%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             PEI W R     +    VQ         L+  + ++ D G Y +++      +  SA+V 
Sbjct: 17749 PEITWSREEGEFTDK--VQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSK--SAFVT 17804

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V+  D      P  P ++   E  KD   + W+ P +DGG+ +  Y IDK E    +++ 
Sbjct: 17805 VKVLDT-----PGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYAN 17859

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
              +    K + F V  L EG  Y FRV A N+ G+G P    + V A +P           
Sbjct: 17860 VSSKCSKTS-FKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEP----------- 17907

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                                P PP  +++T+ +++   L W+ P   G   ++ Y VE   
Sbjct: 17908 -------------------PSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQP 17948

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
              GTE W  V      K     +  L+ G+ Y FRV+  N  G  +P     V V+   L 
Sbjct: 17949 KGTEKWSIVAES---KVCNAVVTGLSSGQEYQFRVKAYNEKGKSDP-RVLGVPVIAKDLT 18004

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGK----WEPCNNNPVKG 793
             I   P   +P          S +  +D K      IE  V G  +    W   +  P+K 
Sbjct: 18005 IQ--PSLKLPFNT------YSIQAGEDLK------IEIPVIGRPRPNISWVK-DGEPLKQ 18049

Query: 794   SRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGG 853
             +    +   T  S +  ++  N     +Y+       V A    G + +    +  E  G
Sbjct: 18050 TT-RVNVEETATSTVLHIKEGNKDDFGKYT-------VTATNSAGTATENLSVIVLEKPG 18101

Query: 854   LTASRGRVHEAS---------PPTFQKDALLGSK-PNKPSLPSSSQNLGQTEVSKVSETV 903
                   R  E S         PP +     + +    K    +++ ++    V++ +  +
Sbjct: 18102 PPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKI 18161

Query: 904   QEELTPPPQKA---APQGKSKSDPLKKKT-----DRAPPSPPCDITCLESFRDSMVLGWK 955
              +  T    +    A     KS PL  K          P PP         +D M++ W 
Sbjct: 18162 TKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQWH 18221

Query: 956   QPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMN 1015
             +P   GG +I GY++  +E    +   W + N   + +  +K + L E + Y+F+V+A N
Sbjct: 18222 EPVNDGGTKIIGYHLEQKEKNSIL---WVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAEN 18278

Query: 1016  MAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFV 1075
             + G+G PS VSECF   +     PG P ++    + ++++ L+WK P + G + +TGY V
Sbjct: 18279 IVGIGKPSKVSECFVARD-PCDPPGRPEAI---VITRNNVTLKWKKPAYDGGSKITGYIV 18334

Query: 1076  DLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG-VGKPSDLAGPVV 1134
             + K+    + +W   +   +      V GL E   Y FRV A N AG   +PSD +G + 
Sbjct: 18335 EKKD--LPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAIT 18392

Query: 1135  AETR---------PGTKEV-VVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTED-SPR 1183
             A            P  K+V VV+  +  V+  +    +  P  +  WSKD    E+ + R
Sbjct: 18393 ARDEIDAPNASLDPKYKDVIVVHAGETFVLEADI---RGKPIPDVVWSKDGKELEETAAR 18449

Query: 1184  LEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIAS 1220
             +E++S   KT +  KD    D G Y   +++  G  S
Sbjct: 18450 MEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKS 18486



 Score =  188 bits (477), Expect = 4e-47
 Identities = 155/528 (29%), Positives = 237/528 (44%), Gaps = 49/528 (9%)

Query: 638   PGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPR 696
             P PP +L VTE T+  V ++W+PP   G   I  Y VEK EA  +++  V T     S  
Sbjct: 16729 PSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNS-- 16786

Query: 697   FALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVV 756
             + +  L EG SY FRV   N  G+G P++  +   V +   +P+ PGKI     T  SV 
Sbjct: 16787 WKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAE---VPQPPGKITVDDVTRNSVS 16843

Query: 757   VSWE--ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAV 814
             +SW   E     +++ Y +E     S KW  C    VK  +     L  G+ Y+FRV AV
Sbjct: 16844 LSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECAR--VKSLQAVITNLTQGEEYLFRVVAV 16901

Query: 815   NAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDAL 874
             N  G S+    +  I  K  +   + PDV PA S      +   G+  +   P       
Sbjct: 16902 NEKGRSDPRSLAVPIVAKDLV---IEPDVKPAFSS----YSVQVGQDLKIEVP------- 16947

Query: 875   LGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKS-------------K 921
             +  +P KP++  +   L   + ++++ T   +LT    K   +                K
Sbjct: 16948 ISGRP-KPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQK 17006

Query: 922   SDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPG 981
             +  ++  T   P  P   +   +   +S+ L W  P   GG +IT Y V  R+    V  
Sbjct: 17007 TASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTV-- 17064

Query: 982   KWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGP 1041
              W   +   V+    K++ LK    YQF++ A N    G   A+       ++    PGP
Sbjct: 17065 -WDVVSA-TVARTTLKVTKLKTGTEYQFRIFAENR--YGQSFALESDPIVAQYPYKEPGP 17120

Query: 1042  PHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLK 1101
             P +   + + KDS+V+QW  PV++G +PV GY ++ KE  +    W  +N+  I +   K
Sbjct: 17121 PGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNS--ILWTKVNKTIIHDTQFK 17178

Query: 1102  VRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAE---TRPGTKEVVV 1146
              + L+EG+ Y FRV A N  GVGK S  +   VA      PGT E ++
Sbjct: 17179 AQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEPIM 17226



 Score =  179 bits (455), Expect = 2e-44
 Identities = 211/823 (25%), Positives = 315/823 (38%), Gaps = 119/823 (14%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRV--RMGEYYEQYSAY 496
             P++ W + G+     K    L     A L   +  ++D G Y++ +    GE     + +
Sbjct: 12331 PKVTWRKVGIDNVVRKGQVDLVD-TMAFLVIPNSTRDDSGKYSLTLVNPAGEK----AVF 12385

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
             V VR  D      P    D+K  +  K    +SW  P  DGGS +  Y ++K E    +W
Sbjct: 12386 VNVRVLDT-----PGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTW 12440

Query: 557   SQCNDTP-VKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKS 615
             S    TP VK   F VT L+ G  Y FRV AVN+ G G P+ V +PV A DP  +     
Sbjct: 12441 STV--TPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPLSE----- 12493

Query: 616   RPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEK 675
                                   P PP  L VTE T++   L+W PP + G   I  ++  
Sbjct: 12494 ----------------------PDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITS 12531

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
                  +   R      VK     +  L EGK Y FRV   N+ GV  P EA  V    ++
Sbjct: 12532 YREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQ 12591

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSG----KWEPCNNNPV 791
             L  PK    ++P + T           K  K+L    IEA V G      KW+   +  V
Sbjct: 12592 LLPPKI---LMPEQIT----------IKAGKKL---RIEAHVYGKPHPTCKWKKGEDEVV 12635

Query: 792   KGSRFTCHGLVTGQSYIFRVRAVNAAGL----SEYSQDSEAIEVKAAIGGGVSPDVCPA- 846
               S    H   +    I +      +G     +E S  ++  ++K  +     P   P  
Sbjct: 12636 TSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFD 12695

Query: 847   LSD--------------EPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLG 892
             +SD              E GG   +   V +           L S   K S        G
Sbjct: 12696 ISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASV-TKTSCRVGKLIPG 12754

Query: 893   QTEVSKVSET----VQEELTPPPQKAA-PQGKSKSDPLKKKTDRAPPSPPCDITCLESFR 947
             Q  + +V       + E LT P   A  P G               PS P +    +  +
Sbjct: 12755 QEYIFRVRAENRFGISEPLTSPKMVAQFPFGV--------------PSEPKNARVTKVNK 12800

Query: 948   DSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVY 1007
             D + + W +PD  GG+ I GY +  +E    +   W +AN   V    Y  + L E + Y
Sbjct: 12801 DCIFVAWDRPDSDGGSPIIGYLIERKERNSLL---WVKANDTLVRSTEYPCAGLVEGLEY 12857

Query: 1008  QFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGR 1067
              F++ A+N AG   PS  +E +      +  PG P  +   +V K ++ L W  P H G 
Sbjct: 12858 SFRIYALNKAGSSPPSKPTE-YVTARMPVDPPGKPEVI---DVTKSTVSLIWARPKHDGG 12913

Query: 1068  TPVTGYFVDLKEAKAKEDQWRGLNEAA--IKNVYLKVRGLKEGVSYVFRVRAINQAGVGK 1125
             + + GYFV+    K   D+W   N A   I        GL+E   Y FR  A     +  
Sbjct: 12914 SKIIGYFVEA--CKLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISP 12971

Query: 1126  PSDLAGPV--VAETRPGTKEVVVNVDDDGVISLNFE-CDKMT----PKSEFSWSKDYVST 1178
             PS+ + PV  +AE  P   ++ V +     +      C   T    P    SW KD    
Sbjct: 12972 PSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLL 13031

Query: 1179  EDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1221
             + +  +++  + N   +    +   D G Y+    ++ G  S+
Sbjct: 13032 KPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSA 13074



 Score =  177 bits (450), Expect = 6e-44
 Identities = 186/778 (23%), Positives = 306/778 (39%), Gaps = 86/778 (11%)

Query: 465   ATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKD 524
             +TLT  + N+ D G YT+ V      +  +  V V D        P  P+  K  +  + 
Sbjct: 22106 STLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPG-----PPGPITFK--DVTRG 22158

Query: 525   YIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRV 584
                + W  P +DGG+ I  Y ++K E    SW   ++   +   F V  L EG  Y FRV
Sbjct: 22159 SATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISEKCTRQI-FKVNDLAEGVPYYFRV 22217

Query: 585   RAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDL 644
              AVN+ G+G P  + EP+ A                       TE+       P PP  L
Sbjct: 22218 SAVNEYGVGEPYEMPEPIVA-----------------------TEQ-------PAPPRRL 22247

Query: 645   SVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLA 703
              V + ++S  VL+W  P   G   I  Y +E  + G++ W         K   F +  L 
Sbjct: 22248 DVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGH---TKQLTFTVERLV 22304

Query: 704   EGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK-----LDIPKAPGKIIPSRNTDTSVVVS 758
             E   Y FRV+  N AG  EP EA    ++ +       D+     ++I  +      +  
Sbjct: 22305 EKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDV 22364

Query: 759   WEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAG 818
                 + A ++     E  +  + +           +  T    + G S  + +   N AG
Sbjct: 22365 PISGRPAPKVTWKLEEMRLKETDRVSITTTKD--RTTLTVKDSMRGDSGRYFLTLENTAG 22422

Query: 819   LSEYSQDSEAIEVKAAIGG-----GVSPDVCPALSDEP--GGLTASRGRVHEASPPTFQK 871
             +  +S     I     + G      VS + C     EP  GG T     + E        
Sbjct: 22423 VKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGGGTEITNYIVEKRE----- 22477

Query: 872   DALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKS-KSDPLKKKTD 930
                  S      L +SS    Q +V+ +++ ++       +      K  +S P+  +  
Sbjct: 22478 -----SGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESAPIIAEHP 22532

Query: 931   RAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKA 990
               PPS P          ++M + W++P   GG++I GY+V  +E    +   W + N   
Sbjct: 22533 FVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTIL---WVKENKVP 22589

Query: 991   VSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEV 1050
               E  YK++ L E + YQF+  A+N AG+   S  S     +   +  PG P   + ++V
Sbjct: 22590 CLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQN-PVDAPGRP---EVTDV 22645

Query: 1051  RKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKED-QWRGLNEAAIKNVYLKVRGLKEGV 1109
              + ++ L W  P + G + V GY ++ K      D +W   N   + + +  V  L EG 
Sbjct: 22646 TRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGD 22705

Query: 1110  SYVFRVRAINQAGV-GKPSDLAGPVVA--ETRPGTKEVVVNVDDDGVISLNFECDKM--- 1163
             +Y FRV A N AGV  K S+  GPV    E  P   E+   +  D ++++    D +   
Sbjct: 22706 TYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGD-LVTIRAGSDLVLDA 22764

Query: 1164  ----TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
                  P+ +  W+K     +   ++ ++  G +     K     D G Y+  V +  G
Sbjct: 22765 AVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASG 22822



 Score =  167 bits (422), Expect = 1e-40
 Identities = 156/528 (29%), Positives = 237/528 (44%), Gaps = 54/528 (10%)

Query: 637  VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFV-EKCEAGTENWQRVNTELPVKSP 695
            VPGP  DL      R   +L+W  P   G   I  F+ E+ +A    W++     P+++ 
Sbjct: 8891 VPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQ-----PIETE 8945

Query: 696  RFA--LFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDT 753
            R    +  L EG+ Y FRV   N  G G P E   +  V D L  P +P ++  +  T +
Sbjct: 8946 RSKCDITGLLEGQEYKFRVIAKNKFGCGPPVEIGPILAV-DPLGPPTSPERLTYTERTKS 9004

Query: 754  SVVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRV 811
            ++ + W+E  S     + GY IE        +E  N      + F    L   Q Y FRV
Sbjct: 9005 TITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRV 9064

Query: 812  RAVNAAGLSEYS-------QDSEA---IEVKAAIGGGVSPDVCPALSDEPGGLTASRGRV 861
            +AVN  G SE S       QD E    I+++ ++ G    D     + EP  + A    V
Sbjct: 9065 KAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRG----DTIKVKAGEPVHIPAD---V 9117

Query: 862  HEASPPTFQ--KDALLGSKPNKP---SLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAP 916
                 P  +  K+  +  KP      +    S++  +TE+S      +++ T     +  
Sbjct: 9118 TGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNR 9177

Query: 917  QGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVI 976
             G    +   +  DR  PSPP ++   +   +S  L W  P   GG+EIT Y ++ R+  
Sbjct: 9178 LGSVFRNVHVEVYDR--PSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDA- 9234

Query: 977  DGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTI 1036
                 +W E    AV E+ Y I  L  N  Y+F+V A+N  G+       EC K ++  I
Sbjct: 9235 SRKKAEWEEVTNTAV-EKRYGIWKLIPNGQYEFRVRAVNKYGIS-----DEC-KSDKVVI 9287

Query: 1037 A----VPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNE 1092
                 +PGPP   K     K S+++ W PP+ +G +P+TGY+++ +E  +    W  ++ 
Sbjct: 9288 QDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSP--YWSRVSR 9345

Query: 1093 AAIKNVYLK-----VRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA 1135
            A I  V LK     V  L EGV Y FR  AIN AG+G PS+ + P VA
Sbjct: 9346 APITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVA 9393



 Score =  157 bits (397), Expect = 8e-38
 Identities = 201/762 (26%), Positives = 300/762 (39%), Gaps = 125/762 (16%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESR-YGM------HTLEINGCDF 344
             E  +L C I G P P + WY+           GK +I+SR Y M      HTL +   + 
Sbjct: 24243 EAAQLSCQIVGRPLPDIKWYRF----------GKELIQSRKYKMSSDGRTHTLTVMTEEQ 24292

Query: 345   EDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFE 404
             ED   Y   A N  GE+   + ++++         +FH G    PL              
Sbjct: 24293 EDEGVYTCIATNEVGEVETSSKLLLQA------TPQFHPG---YPLK------------- 24330

Query: 405   IHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGER 464
                 +K+   +G  G T+ L    +  P      P + W+     L  S+ + T+ + E 
Sbjct: 24331 ----EKY---YGAVGSTLRLHVMYIGRPV-----PAMTWFHGQKLLQNSENI-TIENTEH 24377

Query: 465   AT-LTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDA--DAEIEGAPAAPLDVKCLEA 521
              T L   ++ +        +   G+Y  Q S      DA  D EI+  P  P     +EA
Sbjct: 24378 YTHLVMKNVQR--------KTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEA 24429

Query: 522   N-KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSY 580
               K+  +ISWK PA DGGS I  Y ++KCE    +  Q   + +      +  L E   Y
Sbjct: 24430 LLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGY 24489

Query: 581   IFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGP 640
              FRV A N  GI  P  VS  V    P EK                           PG 
Sbjct: 24490 YFRVSAQNTFGISDPLEVSSVVIIKSPFEK---------------------------PGA 24522

Query: 641   PTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFAL 699
             P   ++T  T+   V++WKPP   G   I  Y++EK E     W  V TE  ++   F++
Sbjct: 24523 PGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTE-EIRETVFSV 24581

Query: 700   FDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIP-KAPGKIIPSRNTD----TS 754
              +L EG  Y FRV+C N  G  E SE +E   +  K D+P +AP      RN +    ++
Sbjct: 24582 KNLIEGLEYEFRVKCENLGGESEWSEISE--PITPKSDVPIQAPHFKEELRNLNVRYQSN 24639

Query: 755   VVVSWEESKDAKELVGYYIEAS--VAGSGKWEPCNNNPVKGS--RFTCHGLVTGQSYIFR 810
               +  + +   K +V +Y +    +A   K+        KG   +     +    + +++
Sbjct: 24640 ATLVCKVTGHPKPIVKWYRQGKEIIADGLKY---RIQEFKGGYHQLIIASVTDDDATVYQ 24696

Query: 811   VRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQ 870
             VRA N  G S     S  +EV A I         P   +  G + A RG V     P   
Sbjct: 24697 VRATNQGG-SVSGTASLEVEVPAKIH-------LPKTLEGMGAVHALRGEVVSIKIPFSG 24748

Query: 871   K-DALLGSKPNKPSLPSSSQN---LGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLK 926
             K D ++  +  +  + ++      + ++  S V     E           + +   D   
Sbjct: 24749 KPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKT 24808

Query: 927   KKTDRAP-PSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWRE 985
              + D A  P PP  +   +  RDS+ L W +P   GG++IT Y V   E       +W  
Sbjct: 24809 VELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIV---EKCATTAERW-- 24863

Query: 986   ANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSE 1027
               V    E  Y + NL     YQF+V A N  GL  PS  SE
Sbjct: 24864 LRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSE 24905



 Score =  153 bits (387), Expect = 1e-36
 Identities = 143/539 (26%), Positives = 230/539 (42%), Gaps = 61/539 (11%)

Query: 637  VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFV-EKCEAGTENWQRVNTELPVKSP 695
            +PGP  D+  ++ T+S   L+W+PP   G   I+++V E+ EAG        T +PV S 
Sbjct: 8174 LPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRR------TYIPVMSG 8227

Query: 696  R----FALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNT 751
                 + + DL     Y FRV+  N  G GE  E     +  D    P  P  +     T
Sbjct: 8228 ENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPT 8287

Query: 752  DTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIF 809
              ++ ++W+        +++GY IE    G  +W+ CN + V    +T  GL  G+ Y F
Sbjct: 8288 AEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQF 8347

Query: 810  RVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVC--PALSDEPGGLTASRGRVHEASPP 867
            RVRA NAAG+SE    S A     A+    +P V    +L  + G   A    +  +  P
Sbjct: 8348 RVRAENAAGISE---PSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYP 8404

Query: 868  TFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEE---LTPPPQKAAPQGKSKSDP 924
            T     +   K     +P   +      V +    VQEE   + P  Q+ +     K + 
Sbjct: 8405 T-----ITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGES 8459

Query: 925  ----------------LKKKTDRAPPSPPCDITCLES--------FRD----SMVLGWKQ 956
                            +K + D      PC ++ L++        F D    S++  W+ 
Sbjct: 8460 QLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFVFEDIRKTSVLCKWEP 8519

Query: 957  PDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNM 1016
            P   GG+EI  Y +  ++     P          +    Y ++ L E   Y F+V A N 
Sbjct: 8520 PLDDGGSEIINYTLEKKDKTK--PDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENR 8577

Query: 1017 AGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVD 1076
             G G P  VS+    ++     P  P      +V  +S++++W  P  +G +P+ GY+++
Sbjct: 8578 FGPG-PPCVSKPLVAKD-PFGPPDAPDKPIVEDVTSNSMLVKWNEPKDNG-SPILGYWLE 8634

Query: 1077 LKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA 1135
             +E  +    W  +N++ +  +   V GL EG++YVFRV A N AG GK S  + P  A
Sbjct: 8635 KREVNS--THWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTA 8691



 Score =  153 bits (386), Expect = 2e-36
 Identities = 113/372 (30%), Positives = 180/372 (48%), Gaps = 30/372 (8%)

Query: 921   KSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVP 980
             +S P+       PP PP         +DSMV+ W +P   GG EI GY +  R+  +GV 
Sbjct: 18584 ESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDK-EGV- 18641

Query: 981   GKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPG 1040
              +W + N K +++   +++ L E   Y+F+VAA N AG+G PS  S  ++  +  +  PG
Sbjct: 18642 -RWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACD-ALYPPG 18699

Query: 1041  PPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN-EAAIKNVY 1099
             PP + K ++  + S+ L W  P++ G  PV GY V++KEA A  D+W        ++   
Sbjct: 18700 PPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAA--DEWTTCTPPTGLQGKQ 18757

Query: 1100  LKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLN-- 1157
               V  LKE   Y FR+ AIN  GVG+P+ L G VVA+ R    E+ ++ D   V+ L   
Sbjct: 18758 FTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRAS 18817

Query: 1158  -----FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDV 1212
                  F   K  P+ E  W K      D  ++EV S  + T +   ++   D G Y+  +
Sbjct: 18818 ATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTS--SFTMLVIDNVTRFDSGRYNLTL 18875

Query: 1213  TDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGN 1272
              +  G  ++++       R+L        P+ PV   L +  ++K  V    +   + G 
Sbjct: 18876 ENNSGSKTAFV-----NVRVL------DSPSAPV--NLTIREVKKDSVTLSWEPPLIDGG 18922

Query: 1273  AKV-NYIFNEKE 1283
             AK+ NYI  ++E
Sbjct: 18923 AKITNYIVEKRE 18934



 Score =  152 bits (385), Expect = 2e-36
 Identities = 165/617 (26%), Positives = 249/617 (40%), Gaps = 104/617 (16%)

Query: 478  GLYTIRVRMGEYY----EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQP 533
            G Y  RVR    Y    E  S  V ++D    + G P  P   K L   K  +++SW  P
Sbjct: 9262 GQYEFRVRAVNKYGISDECKSDKVVIQDP-YRLPGPPGKP---KVLARTKGSMLVSWTPP 9317

Query: 534  AVDGGSPILGYFIDKCEVGTDSWSQCNDTPV-----KFARFPVTGLIEGRSYIFRVRAVN 588
              +GGSPI GY+++K E G+  WS+ +  P+     K   F V  L+EG  Y FR  A+N
Sbjct: 9318 LDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAIN 9377

Query: 589  KMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTE 648
              GIG PS  S+P  A DP                              PGPP+   V +
Sbjct: 9378 AAGIGPPSEPSDPEVAGDPI---------------------------FPPGPPSCPEVKD 9410

Query: 649  ATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNT-ELPVKSPRFALFDLAEGK 706
             T+S + L WKPP + G   I  Y VE  E GT +W+RVN  +  + +    + +L E +
Sbjct: 9411 KTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCECVVPNLKELR 9470

Query: 707  SYCFRVRCSNSAGVGEPSEATE-----------------------VTVVGDKLDIPKAPG 743
             Y FRV+  N AG  EPS+ T                        V   G ++ IP    
Sbjct: 9471 KYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPA--- 9527

Query: 744  KIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVT 803
             +I  R T  S   SWE    AK+ +   +   +    + E   N+ V      C    T
Sbjct: 9528 -VIKGRPTPKS---SWEFDGKAKKAMKDGVH-DIPEDAQLETAENSSVIIIP-ECKRSHT 9581

Query: 804  GQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHE 863
            G+   + + A N AG     Q +    VK     G   D+   +SD    +T    R+  
Sbjct: 9582 GK---YSITAKNKAG-----QKTANCRVKVMDVPGPPKDL--KVSD----ITRGSCRLSW 9627

Query: 864  ASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKS- 922
              P     D + G    K ++   +      +    +  V + L+        + +++  
Sbjct: 9628 KMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFG 9687

Query: 923  -----DPLKKKTDRAP---PSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYR- 973
                 + +++ T R P   P PP  +      ++++ L WK P   GG+ +T Y V    
Sbjct: 9688 IGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLA 9747

Query: 974  -EVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCE 1032
             +        WR+ N + V E  + + +L E   Y+F+V A+N AG+  PSA      C+
Sbjct: 9748 WDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQ 9807

Query: 1033 EWTIAVPGPPHSLKCSE 1049
                  P  P S+   E
Sbjct: 9808 R-----PDMPPSIDLKE 9819



 Score =  150 bits (380), Expect = 8e-36
 Identities = 169/756 (22%), Positives = 290/756 (38%), Gaps = 92/756 (12%)

Query: 287   TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
             T+    +++L  S++G P P +TW K  + +   A     II++      L ++  +  D
Sbjct: 23152 TIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRA-----IIDTTESYSLLIVDKVNRYD 23206

Query: 347   TAQYRASAMNVKGELSAYASVVVKRYKGEFDETRF-HAGASTMPLSFGVTPYGYASRFEI 405
               +Y   A N  G+ SA   V V    G     +       ++ +++ +      +    
Sbjct: 23207 AGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNN 23266

Query: 406   HFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERA 465
             +  +K + +  R  +T++  C   +             YR          +  L  G   
Sbjct: 23267 YIVEKREAAM-RAFKTVTTKCSKTL-------------YR----------ISGLVEG--- 23299

Query: 466   TLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDY 525
               T  +     E +Y I    GE  E   A +        +   P  P  ++ ++  K  
Sbjct: 23300 --TMYYFRVLPENIYGI----GEPCETSDAVL--------VSEVPLVPAKLEVVDVTKST 23345

Query: 526   IIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVR 585
             + ++W++P  DGGS + GY ++ C+ GT+ W +            VT L EG  Y+FR+R
Sbjct: 23346 VTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIR 23405

Query: 586   AVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLS 645
             A N+ G+  P      V   D      L+  P+       + T  + +  +  G P +L 
Sbjct: 23406 AQNEKGVSEPRETVTAVTVQD------LRVLPTID-----LSTMPQKTIHVPAGRPVELV 23454

Query: 646   VTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEG 705
             +  A R     SW   G +  E                +RV  E   K  +  + +    
Sbjct: 23455 IPIAGRPPPAASWFFAGSKLRES---------------ERVTVETHTKVAKLTIRETTIR 23499

Query: 706   KSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE--ESK 763
              +  + +   N  G    SE  +V ++ DK   P  P KI       TS+ +SWE  E  
Sbjct: 23500 DTGEYTLELKNVTGT--TSETIKVIIL-DKPGPPTGPIKI--DEIDATSITISWEPPELD 23554

Query: 764   DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYS 823
                 L GY +E   A    W P + + V  S F    L  G  Y+FRV A N  G+  Y 
Sbjct: 23555 GGAPLSGYVVEQRDAHRPGWLPVSES-VTRSTFKFTRLTEGNEYVFRVAATNRFGIGSYL 23613

Query: 824   QDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTAS------RGRVHEASPPTFQKDALLGS 877
             Q SE IE +++I     P+          G+T +       G          +K+     
Sbjct: 23614 Q-SEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADR 23672

Query: 878   KPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPP 937
                   +P +      T +++  E  +  +T    + + +    S P+      APP  P
Sbjct: 23673 WVRVNKVPVTMTRYRSTGLTEGLE-YEHRVTAINARGSGKPSRPSKPIVAMDPIAPPGKP 23731

Query: 938   CDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYK 997
              +    ++ R S+ L W  P+  GG+++TGY +  ++V      +W + N        Y 
Sbjct: 23732 QNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQ---HEWTKCNTTPTKIREYT 23788

Query: 998   ISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEE 1033
             +++L +   Y+F+V A N  G G P+ V    K  E
Sbjct: 23789 LTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTE 23824



 Score =  145 bits (366), Expect = 3e-34
 Identities = 132/461 (28%), Positives = 195/461 (42%), Gaps = 55/461 (11%)

Query: 367   VVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKF-DVSFGREGETMSLG 425
             V+ +   G F E    +GA        +T            D K+ DV     GET  L 
Sbjct: 18372 VIARNAAGNFSEPSDSSGA--------ITARDEIDAPNASLDPKYKDVIVVHAGETFVLE 18423

Query: 426   CRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSG-ERATLTFSHLNKEDEGLYTIRV 484
               +   P      P++ W ++G  L  +     + S  ++ TL      + D G Y +++
Sbjct: 18424 ADIRGKPI-----PDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKL 18478

Query: 485   RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGY 544
                   +     V V D      G P  PL V  + A K Y+  +W  P  DGG+ I  Y
Sbjct: 18479 SNVGGTKSIPITVKVLDRP----GPPEGPLKVTGVTAEKCYL--AWNPPLQDGGANISHY 18532

Query: 545   FIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAA 604
              I+K E    SW+Q + T V+   + VT L+ G  YIFRV AVNK GIG P   S PV A
Sbjct: 18533 IIEKRETSRLSWTQVS-TEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLE-SGPVTA 18590

Query: 605   LDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQ 663
              +P +                            PGPP+   V+  T+  +V++W +P   
Sbjct: 18591 CNPYKP---------------------------PGPPSTPEVSAITKDSMVVTWARPVDD 18623

Query: 664   RGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEP 723
              G E   Y +EK +     W + N +  +   R  +  L EG SY FRV   N+AGVGEP
Sbjct: 18624 GGTEIEGYILEKRDKEGVRWTKCNKKT-LTDLRLRVTGLTEGHSYEFRVAAENAAGVGEP 18682

Query: 724   SEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSG 781
             SE +      D L  P  P     +  + +SV ++W +        + GY +E   A + 
Sbjct: 18683 SEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAAD 18742

Query: 782   KWEPCN-NNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSE 821
             +W  C     ++G +FT   L     Y FR+ A+N+ G+ E
Sbjct: 18743 EWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGE 18783



 Score =  145 bits (365), Expect = 4e-34
 Identities = 179/719 (24%), Positives = 290/719 (40%), Gaps = 83/719 (11%)

Query: 638  PGPPTDLSVTEATRSYVVLSWKPP-GQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPR 696
            PGPP +    +  ++ V+  W+PP    G E I Y +EK +    + + +     ++  +
Sbjct: 8497 PGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCK 8556

Query: 697  FALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVV 756
            +++  L EGK Y FRVR  N  G G P   ++  V  D    P AP K I    T  S++
Sbjct: 8557 YSVTKLIEGKEYLFRVRAENRFGPGPPC-VSKPLVAKDPFGPPDAPDKPIVEDVTSNSML 8615

Query: 757  VSWEESKD-AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVN 815
            V W E KD    ++GY++E     S  W   N + +   +    GL+ G +Y+FRV A N
Sbjct: 8616 VKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAEN 8675

Query: 816  AAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDA-L 874
            AAG  ++S  S+       I     P   P ++D     T+S     E  PP F     +
Sbjct: 8676 AAGPGKFSPPSDPKTAHDPISPPGPP--IPRVTD-----TSSTTIELEWEPPAFNGGGEI 8728

Query: 875  LGSKPNKPSLPSSSQN--------LGQTEVSKVSETVQEELTPPPQKAAPQGK-SKSDPL 925
            +G   +K  + ++  +        + Q  V ++ E    +L      AA +G   ++ P+
Sbjct: 8729 VGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGETQPV 8788

Query: 926  KKKTDRAPPSPPCDITCLESFR---------DSMVLGWKQPDKIGGAEITGYYVNYREVI 976
                 + PP+   D++     +          ++V G   P K+   E  G     R VI
Sbjct: 8789 TVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKE-EGELDKDRVVI 8847

Query: 977  DGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTI 1036
            D         NV   SE   K +  K++  Y   + A N  G    +A  E F       
Sbjct: 8848 D---------NVGTKSELIIKDALRKDHGRYV--ITATNSCGSKFAAARVEVFD------ 8890

Query: 1037 AVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIK 1096
             VPGP   LK     +   +L W  P   G + +TG+ ++ K+AK     WR   E   +
Sbjct: 8891 -VPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKM--HTWRQPIET--E 8945

Query: 1097 NVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPG----TKEVVVNVDDDG 1152
                 + GL EG  Y FRV A N+ G G P ++ GP++A    G     + +        
Sbjct: 8946 RSKCDITGLLEGQEYKFRVIAKNKFGCGPPVEI-GPILAVDPLGPPTSPERLTYTERTKS 9004

Query: 1153 VISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDV 1212
             I+L+++  +    S            D P  E  +K      +F    +D+  +Y   V
Sbjct: 9005 TITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRV 9064

Query: 1213 TDTDGIASS-------YLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQ 1265
               + I  S        +I ++E+   + L    +  T+ VK+   V I           
Sbjct: 9065 KAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHI----------- 9113

Query: 1266 AEKLSG--NAKVNYIFNEKEIFEGPK-----YKMHIDRNTGIIEMFMEKLQDEDEGTYT 1317
               ++G    K+ +  NE  + E P       K  + R+    E+ + K   ED+GTYT
Sbjct: 9114 PADVTGLPMPKIEWSKNE-TVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYT 9171



 Score =  139 bits (351), Expect = 2e-32
 Identities = 139/561 (24%), Positives = 228/561 (40%), Gaps = 59/561 (10%)

Query: 510  PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
            P  P+DV+      + + I+WK P  DGGS I+GY I+K   G + W +CN+  V    +
Sbjct: 8275 PDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTY 8334

Query: 570  PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
               GL EG+ Y FRVRA N  GI  PSR + P  A+DP +  ++  R S     ++   +
Sbjct: 8335 TAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSL----EVKRGD 8390

Query: 630  EEPSEGIVPGPP-------TDLSV---TEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAG 679
            E   +  + G P        D +V    E  +    L  +  G+   E            
Sbjct: 8391 EIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLS 8450

Query: 680  TENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIP 739
             +N ++  ++L V+       D        + ++  N  G+ +      V      LD P
Sbjct: 8451 IDNSKKGESQLRVR-------DSLRPDHGLYMIKVENDHGIAKAPCTVSV------LDTP 8497

Query: 740  KAPGKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEA--SVAGSGKWEPCNNNPVKGSR 795
              P   +      TSV+  WE   D    E++ Y +E         +W    +  ++  +
Sbjct: 8498 GPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTST-LRHCK 8556

Query: 796  FTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLT 855
            ++   L+ G+ Y+FRVRA N  G       S+ +  K   G   +PD  P + D      
Sbjct: 8557 YSVTKLIEGKEYLFRVRAENRFGPGPPCV-SKPLVAKDPFGPPDAPDK-PIVED-----V 8609

Query: 856  ASRGRVHEASPPTFQKDALLGSKPNKPSLPS--------SSQNLGQTEVSKVSETVQEEL 907
             S   + + + P      +LG    K  + S        S  N  +  V  + E +    
Sbjct: 8610 TSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVF 8669

Query: 908  TPPPQKAAPQGK--SKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEI 965
                + AA  GK    SDP       +PP PP      ++   ++ L W+ P   GG EI
Sbjct: 8670 RVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIP-RVTDTSSTTIELEWEPPAFNGGGEI 8728

Query: 966  TGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAV 1025
             GY+V+ + V      +W     K +    Y +  ++E   Y+ +V+A+N AG G P   
Sbjct: 8729 VGYFVDKQLV---GTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPG-- 8783

Query: 1026 SECFKCEEWTIAVPGPPHSLK 1046
                + +  T+A P  P +++
Sbjct: 8784 ----ETQPVTVAEPQEPPAVE 8800



 Score =  134 bits (337), Expect = 7e-31
 Identities = 227/973 (23%), Positives = 378/973 (38%), Gaps = 127/973 (13%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFI-----DKCEVGTDSWSQCNDTPV 564
             P  P+ +K     K+ + +SWK P  DGGSP+  Y +     D      ++W QCN   V
Sbjct: 9707  PDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDV 9766

Query: 565   KFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQ 624
             +  +F V  L+EG  Y FRV+AVN  G      VS+P A + P +  R    PS     +
Sbjct: 9767  EELQFTVEDLVEGGEYEFRVKAVNAAG------VSKPSATVGPCDCQRPDMPPSID-LKE 9819

Query: 625   IIVTEEEPSEGIV---PGPPTDLSVTEATRSYVVLSW-KPPGQR--GHEGIMYFVEKCEA 678
              +  EE  +  IV    G P           +  L+W K P ++    E ++Y       
Sbjct: 9820  FMEVEEGTNVNIVAKIKGVP-----------FPTLTWFKAPPKKPDNKEPVLYDT----- 9863

Query: 679   GTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDI 738
                    VN  +   +    +       +  + +   N+  +G  S+   + V+G +   
Sbjct: 9864  ------HVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNN--LGTASKEMRLNVLG-RPGP 9914

Query: 739   PKAPGKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRF 796
             P  P K   S + D  + +SW   KD    ++  Y IE   A    W   ++ P K   +
Sbjct: 9915  PVGPIK-FESVSAD-QMTLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSEP-KECTY 9971

Query: 797   TCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTA 856
             T   L+ G  Y+FR+ A N  G+ E   DSE    +       +PD     S     +T 
Sbjct: 9972  TIPKLLEGHEYVFRIMAQNKYGIGE-PLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTV 10030

Query: 857   S--RGRVHEASPPT----FQKDALLGSKPNKPSLPSSSQNLGQT-EVSKVSETVQEELTP 909
             +         SP T      KD            P  +  LG + +V+ + E    +   
Sbjct: 10031 NWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRV 10090

Query: 910   PPQKAAPQGKSK--SDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITG 967
                 AA  G +   SDP   +   APP PP      +  + S  L W  P K GG+++TG
Sbjct: 10091 YAINAAGVGPASLPSDPATARDPIAPPGPPFP-KVTDWTKSSADLEWSPPLKDGGSKVTG 10149

Query: 968   YYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSE 1027
             Y V Y+E  +G   +W +   K V      ++ LKE   Y+F+V A+N+AG+G P  V++
Sbjct: 10150 YIVEYKE--EG-KEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTD 10206

Query: 1028  CFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVH-----SGRTPVTGYFVDLKEAKA 1082
               + ++  ++   P   L  S   +D +V+     +      SG+ P T   V     + 
Sbjct: 10207 VIEMKDRLVS---PDLQLDASV--RDRIVVHAGGVIRIIAYVSGKPPPT---VTWNMNER 10258

Query: 1083  KEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPS------DLAGPVVAE 1136
                Q   +   AI +  + ++  +     V+ + A N+AG  K +      D+ GPV   
Sbjct: 10259 TLPQEATIETTAISS-SMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPV--- 10314

Query: 1137  TRPGTKEVVVNVDDDGVISLNF--ECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTK 1194
                GT  +  N+ ++      F  E D  +P + +   K     E   R         T+
Sbjct: 10315 ---GTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEK----RESDRRAWTPVTYTVTR 10367

Query: 1195  MTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEI 1254
                   G+     Y   +   + I     ++  E    L +      P  P   +L V+ 
Sbjct: 10368 QNATVQGLIQGKAYFFRIAAENSIGMGPFVETSE---ALVIREPITVPERP--EDLEVKE 10422

Query: 1255  LEKGQVRFWMQAEKLSGNAK-VNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDE 1313
             + K  V       K  G ++ +NY+   + I      K H   N  ++         ++ 
Sbjct: 10423 VTKNTVTLTWNPPKYDGGSEIINYVLESRLI---GTEKFHKVTNDNLLSRKYTVKGLKEG 10479

Query: 1314  GTYTFQLQ------DGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWE 1367
              TY +++        GK +  +  +   D         +F+ +  IR  G  F       
Sbjct: 10480 DTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIR-VGEAFA------ 10532

Query: 1368  VTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKK--DAGI 1425
             +TG  +   K KV+         W+KDE ++  D++   K    TL + +   K  D+G 
Sbjct: 10533 LTGRYSGKPKPKVS---------WFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGK 10583

Query: 1426  YEVILKDDRGKDK 1438
             Y V++++  G  K
Sbjct: 10584 YCVVVENSTGSRK 10596



 Score =  131 bits (330), Expect = 5e-30
 Identities = 219/1039 (21%), Positives = 387/1039 (37%), Gaps = 164/1039 (15%)

Query: 287   TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
             T+    ++ L  ++ G PEP++ W K    +++     K  ++      T  I  CD  D
Sbjct: 22753 TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCE---KVSLQYTGKRATAVIKFCDRSD 22809

Query: 347   TAQYRASAMNVKGELSAYASVVVKRYK-----GEFDETRFHAGASTMPLSFGVTPYGYAS 401
             + +Y  +  N  G  +   SV+VK        G+   +R      T+  S      G   
Sbjct: 22810 SGKYTLTVKNASG--TKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGG--- 22864

Query: 402   RFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWS 461
                                            EI H+  E +        S   WV  +  
Sbjct: 22865 ------------------------------AEITHYIVERR------ETSRLNWV--IVE 22886

Query: 462   GERATLTF--SHLNKEDEGLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVK 517
             GE  TL++  + L K +E ++ +R   + G      S  +  R++   I   P  P +V 
Sbjct: 22887 GECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNS-FTIPSPPGIPEEV- 22944

Query: 518   CLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCN-DTPVKFARFPVTGLIE 576
                  K++III W +P  DGG+ I  Y +DK E  +  W++ N D  V   R  VT L+E
Sbjct: 22945 --GTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLME 23002

Query: 577   GRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGI 636
             G  Y FRV AVN  G   PS  S  ++  +P+                            
Sbjct: 23003 GCDYQFRVTAVNAAGNSEPSEASNFISCREPS---------------------------Y 23035

Query: 637   VPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSP 695
              PGPP+   V + T+  + L+W KP    G + + Y +E  E  T+ W RV+T   +++ 
Sbjct: 23036 TPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNT 23095

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSV 755
              F + DL  G+ Y FRV   N  G+ E SE+       ++++IP                
Sbjct: 23096 EFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIP---------------- 23139

Query: 756   VVSWEESKDAKELV----GYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLV-TGQSY-IF 809
                 E + D K+ V    G  +   V+ SG+  P      +G       ++ T +SY + 
Sbjct: 23140 --DLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSLL 23197

Query: 810   RVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGR--VHEASPP 867
              V  VN     +Y+ ++E         G  S  V   + D PG   + + +    ++   
Sbjct: 23198 IVDKVNRYDAGKYTIEAE------NQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTI 23251

Query: 868   TFQKDALLGSKPNKPSL---PSSSQNLGQTEVSKVSETVQE-----ELTPPPQKAAPQGK 919
             T++   + G  P    +     ++    +T  +K S+T+       E T    +  P+  
Sbjct: 23252 TWEIPTIDGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENI 23311

Query: 920   SKSDPLKKKTDRA----PPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREV 975
                    + +D       P  P  +  ++  + ++ L W++P   GG+ +TGY +   E 
Sbjct: 23312 YGIGEPCETSDAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVL---EA 23368

Query: 976   IDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWT 1035
                   +W +      +   + +++L E   Y F++ A N  G+  P         ++  
Sbjct: 23369 CKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLR 23428

Query: 1036  I-----AVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGL 1090
             +         P  ++     R   LV+    P+     P   +F     +K +E + R  
Sbjct: 23429 VLPTIDLSTMPQKTIHVPAGRPVELVI----PIAGRPPPAASWF--FAGSKLRESE-RVT 23481

Query: 1091  NEAAIKNVYLKVR--GLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNV 1148
              E   K   L +R   +++   Y   ++ +     G  S+    ++ + +PG     + +
Sbjct: 23482 VETHTKVAKLTIRETTIRDTGEYTLELKNV----TGTTSETIKVIILD-KPGPPTGPIKI 23536

Query: 1149  DDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPR---LEVESKGNKTKMTFKDLGMDDL 1205
             D+    S+    +          S   V   D+ R   L V     ++   F  L   + 
Sbjct: 23537 DEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNE 23596

Query: 1206  GIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQ 1265
              ++    T+  GI  SYL  E     ++      + P  P   ++  ++   G    W  
Sbjct: 23597 YVFRVAATNRFGI-GSYLQSE-----VIECRSSIRIPGPPETLQI-FDVSRDGMTLTWYP 23649

Query: 1266  AEKLSGNAKVNYIFNEKEI 1284
              E   G+    YI   KE+
Sbjct: 23650 PEDDGGSQVTGYIVERKEV 23668



 Score =  131 bits (329), Expect = 6e-30
 Identities = 97/326 (29%), Positives = 140/326 (42%), Gaps = 46/326 (14%)

Query: 418  EGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDE 477
            EGE +S+       P      P + W+++G  +  S  +        A L      + D 
Sbjct: 8095 EGEKLSIPVPFRAVPV-----PTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADA 8149

Query: 478  GLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAV 535
            G+YTI +  ++G               + ++ G P    D+K  +  K    ++W+ P  
Sbjct: 8150 GIYTITLENKLGSA---------TASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEF 8200

Query: 536  DGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFP 595
            DGG+PIL Y +++ E G  ++        K + + V  LI    Y FRV+AVNK+G G  
Sbjct: 8201 DGGTPILHYVLERREAGRRTYIPVMSGENKLS-WTVKDLIPNGEYFFRVKAVNKVGGGEY 8259

Query: 596  SRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVV 655
              +  PV A DP +                            P PP D+ V   T   + 
Sbjct: 8260 IELKNPVIAQDPKQP---------------------------PDPPVDVEVHNPTAEAMT 8292

Query: 656  LSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRC 714
            ++WKPP   G   IM Y +EK   G E W+R N  L V    +    L EGK Y FRVR 
Sbjct: 8293 ITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHL-VPILTYTAKGLEEGKEYQFRVRA 8351

Query: 715  SNSAGVGEPSEATEVTVVGDKLDIPK 740
             N+AG+ EPS AT  T   D +D PK
Sbjct: 8352 ENAAGISEPSRATPPTKAVDPIDAPK 8377



 Score =  129 bits (323), Expect = 3e-29
 Identities = 129/471 (27%), Positives = 187/471 (39%), Gaps = 95/471 (20%)

Query: 288   VWEKENVKLHCSIAGWPEPRVTWYK-------NQVPINVHANPGKYIIESRYGMHTLEIN 340
             V E  NV +   I G P P +TW+K       N+ P+    +  K +++      TL I 
Sbjct: 9823  VEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTC---TLVIP 9879

Query: 341   GCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYA 400
                  DT  Y  +A+N  G  S               E R +      P      P G  
Sbjct: 9880  QSRRSDTGLYTITAVNNLGTAS--------------KEMRLNVLGRPGP------PVG-P 9918

Query: 401   SRFEIHFDDKFDVS-FGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTL 459
              +FE    D+  +S F  + +  S     VI                    +   WV   
Sbjct: 9919  IKFESVSADQMTLSWFPPKDDGGSKITNYVIEKR---------------EANRKTWVHVS 9963

Query: 460   WSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGA------PAAP 513
                +  T T   L +  E ++ I  +        + Y      D+E E A      P AP
Sbjct: 9964  SEPKECTYTIPKLLEGHEYVFRIMAQ--------NKYGIGEPLDSEPETARNLFSVPGAP 10015

Query: 514   LDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKF----ARF 569
                      ++ + ++W++P  DGGSP+ GY+++  +  +  W + N  P+K       +
Sbjct: 10016 DKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSY 10075

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              VTGLIEG  Y FRV A+N  G+G  S  S+P  A DP           AP         
Sbjct: 10076 KVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPI----------AP--------- 10116

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNT 688
                     PGPP    VT+ T+S   L W PP + G   +  Y VE  E G E W++   
Sbjct: 10117 --------PGPPFP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEK-GK 10166

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIP 739
             +  V+  +  +  L EG  Y FRVR  N AG+GEP E T+V  + D+L  P
Sbjct: 10167 DKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSP 10217



 Score =  125 bits (313), Expect = 5e-28
 Identities = 183/774 (23%), Positives = 298/774 (38%), Gaps = 129/774 (16%)

Query: 274   LHAPEFIIKP---RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIES 330
             L APE  I     ++H V    +++L  +  G P P   W K    +++ A+     I +
Sbjct: 22047 LTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRAD-----IHT 22101

Query: 331   RYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPL 390
                  TL +  C+  D  +Y  +  N  G  S   +V V    G              P+
Sbjct: 22102 TDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGP-----------PGPI 22150

Query: 391   SFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPL 450
             +F     G A+                +   +  G R      I H+  E +        
Sbjct: 22151 TFKDVTRGSATLMW-------------DAPLLDGGAR------IHHYVVEKR------EA 22185

Query: 451   SPSKWVQTLWSGERATLTFSHLNKEDEGL-YTIRVRMGEYYEQYSAYVFVRDADAEIEGA 509
             S   W Q +   E+ T     +N   EG+ Y  RV     Y     Y       A  + A
Sbjct: 22186 SRRSW-QVI--SEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPA 22242

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P   LDV  ++ +K   +++W +P  DGGS I GY ++  + G+D W +   T  K   F
Sbjct: 22243 PPRRLDV--VDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHT--KQLTF 22298

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTG---QII 626
              V  L+E   Y FRV+A N  G   P      V   +P      +  P+A  TG   Q+I
Sbjct: 22299 TVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEP------QIEPTADLTGITNQLI 22352

Query: 627   VTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRV 686
               +         G P  + V  + R    ++WK    R        +++ +  +    + 
Sbjct: 22353 TCK--------AGSPFTIDVPISGRPAPKVTWKLEEMR--------LKETDRVSITTTKD 22396

Query: 687   NTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKII 746
              T L VK       D   G S  + +   N+AGV   + +  V V+G    +    G I 
Sbjct: 22397 RTTLTVK-------DSMRGDSGRYFLTLENTAGV--KTFSVTVVVIGRPGPV---TGPIE 22444

Query: 747   PSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTG 804
              S  +  S V+SW E KD    E+  Y +E   +G+  W+  N++ VK ++     L   
Sbjct: 22445 VSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSS-VKRTQIKVTHLTKY 22503

Query: 805   QSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRV--- 861
               Y FRV + N  G+S+  + +  I           P V P+    P     S   +   
Sbjct: 22504 MEYSFRVSSENRFGVSKPLESAPII--------AEHPFVPPSAPTRPEVYHVSANAMSIR 22555

Query: 862   -----HEASPPTF-------QKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTP 909
                  H+             +++ +L  K NK  +P    N    +V+ + E ++ +   
Sbjct: 22556 WEEPYHDGGSKIIGYWVEKKERNTILWVKENK--VPCLECNY---KVTGLVEGLEYQFRT 22610

Query: 910   PPQKAAPQGKSK--SDPLKKKTDRAPPSPP--CDITCLESFRDSMVLGWKQPDKIGGAEI 965
                 AA   K+   S P+  +     P  P   D+T     R ++ L W  P   GG+++
Sbjct: 22611 YALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVT-----RSTVSLIWSAPAYDGGSKV 22665

Query: 966   TGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 1019
              GY +  + V +   G+W + N   VS+  + ++ L E   Y+F+V A N AG+
Sbjct: 22666 VGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGV 22719



 Score =  122 bits (307), Expect = 2e-27
 Identities = 234/997 (23%), Positives = 368/997 (36%), Gaps = 139/997 (13%)

Query: 508  GAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFA 567
            G P +P  +   E  K  I + WK+P  +GGSPI GY I+K       + + N       
Sbjct: 8988 GPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTT 9047

Query: 568  RFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALD---PAEKARLKSRPSAPWTGQ 624
             F V  L E + Y FRV+AVN++G   PS     V   D   P  K RL  R        
Sbjct: 9048 SFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDT----- 9102

Query: 625  IIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQ 684
            I V   EP    +P   T L + +       + W     +    I    +  +   E   
Sbjct: 9103 IKVKAGEPVH--IPADVTGLPMPK-------IEWS----KNETVIEKPTDALQITKEEVS 9149

Query: 685  RVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGK 744
            R   +  +  P+    D        + V  SN  G    +   EV       D P  P  
Sbjct: 9150 RSEAKTELSIPKAVREDKGT-----YTVTASNRLGSVFRNVHVEV------YDRPSPPRN 9198

Query: 745  IIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGK--WEPCNNNPVKGSRFTCHG 800
            +  +     S  ++W+   D    E+  Y I+   A   K  WE   N  V+  R+    
Sbjct: 9199 LAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVE-KRYGIWK 9257

Query: 801  LVTGQSYIFRVRAVNAAGLSEYSQDSEAI--------------EVKAAIGGGVSPDVCPA 846
            L+    Y FRVRAVN  G+S+  +  + +              +V A   G +     P 
Sbjct: 9258 LIPNGQYEFRVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPP 9317

Query: 847  LSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEE 906
            L +    +T       E   P +       S+ ++  +        +  V ++ E V+ +
Sbjct: 9318 LDNGGSPITGYWLEKREEGSPYW-------SRVSRAPITKVGLKGVEFNVPRLLEGVKYQ 9370

Query: 907  LTPPPQKAAPQG--KSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAE 964
                   AA  G     SDP        PP PP      +  + S+ LGWK P K GG+ 
Sbjct: 9371 FRAMAINAAGIGPPSEPSDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSP 9430

Query: 965  ITGYYVNYREVIDGVPGKWREANV--KAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAP 1022
            I GY V  +E  +G    W+  N   K ++     + NLKE   Y+F+V A+N AG   P
Sbjct: 9431 IKGYIVEMQE--EGTTD-WKRVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEP 9487

Query: 1023 SAVSECFKC----EEWTIAVP-GPPHSLKCSEVRKDSLVLQWKPPVHSGR-TPVTGYFVD 1076
            S  +         EE  + +  G    L C    +  +     P V  GR TP + +  D
Sbjct: 9488 SDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRI-----PAVIKGRPTPKSSWEFD 9542

Query: 1077 LKEAKAKEDQWRGLNE-----AAIKNVYLKVRGLKEGVSYVFRVRAINQAGVG------K 1125
             K  KA +D    + E      A  +  + +   K   +  + + A N+AG        K
Sbjct: 9543 GKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVK 9602

Query: 1126 PSDLAGP-----VVAETRPGTKEVVVNVDDDGVISLN-FECDKMTPKSEFSWSKDYVSTE 1179
              D+ GP     V   TR   +      DDDG   +  +  +K T   + +W+K      
Sbjct: 9603 VMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGK-AWTK------ 9655

Query: 1180 DSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEH 1239
                  V      T     DL  +    +     +  GI        E ++R  A    +
Sbjct: 9656 ------VNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPV----ETIQRTTARDPIY 9705

Query: 1240 KFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFE--GPKYKMHIDRN 1297
              P  P+K  L + ++ K  V    +  K  G + V +   E   ++  G K +     N
Sbjct: 9706 P-PDPPIK--LKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCN 9762

Query: 1298 TGIIEMFMEKLQDEDEG-TYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQ 1356
               +E     ++D  EG  Y F++   KA N + V          +  A     +  R  
Sbjct: 9763 KRDVEELQFTVEDLVEGGEYEFRV---KAVNAAGVS---------KPSATVGPCDCQRPD 9810

Query: 1357 GPHFVEYLSW-EVTGECNVLLKCKVANIKKETHIVWYK------DEREISVDEKHDFK-- 1407
             P  ++   + EV    NV +  K+  +   T + W+K      D +E  + + H  K  
Sbjct: 9811 MPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPT-LTWFKAPPKKPDNKEPVLYDTHVNKLV 9869

Query: 1408 -DGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKL 1443
             D  CTL+I +  + D G+Y +   ++ G     ++L
Sbjct: 9870 VDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRL 9906



 Score =  121 bits (304), Expect = 5e-27
 Identities = 115/467 (24%), Positives = 177/467 (37%), Gaps = 86/467 (18%)

Query: 287   TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
             TV   + ++L   + G P P V W K++   ++  +P +  I++R       +      D
Sbjct: 11907 TVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSP-RVKIDTRADSSKFSLTKAKRSD 11965

Query: 347   TAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIH 406
               +Y  +A N  G   AYA+V V    G     +                          
Sbjct: 11966 GGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKI------------------------- 12000

Query: 407   FDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERAT 466
                  DVS  R        C V   P       EIQ Y     L   +  + +WS   AT
Sbjct: 12001 ----VDVSSDR--------CTVCWDPPEDDGGCEIQNY----ILEKCETKRMVWSTYSAT 12044

Query: 467   L-----TFSHLNKEDEGLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCL 519
             +     T + L + +E ++ +R   ++G      S  V  +         P  P   +  
Sbjct: 12045 VLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTK----YDKPGRPDPPEVT 12100

Query: 520   EANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRS 579
             + +K+ + + W  P  DGG  I GYF++K E  +  W   N + +   R  V  L+    
Sbjct: 12101 KVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHE 12160

Query: 580   YIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPG 639
             Y FRV+A N++GIG PS  S PV A DP E                            PG
Sbjct: 12161 YQFRVKAENEIGIGEPSLPSRPVVAKDPIEP---------------------------PG 12193

Query: 640   PPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCE------AGTENWQRVNTELPVK 693
             PPT+  V + T+  + L W  P   G   I+ +V +        +  E W+R N    + 
Sbjct: 12194 PPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLV 12253

Query: 694   SPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPK 740
                F +  L E + Y FRV   N  G+G P+E  E     + L+ P+
Sbjct: 12254 RKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPE 12300



 Score =  120 bits (300), Expect = 1e-26
 Identities = 118/471 (25%), Positives = 184/471 (39%), Gaps = 81/471 (17%)

Query: 277   PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
             P   +   ++++   E++K+   + G P P ++W K+  P+       +  +E       
Sbjct: 18007 PSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLK---QTTRVNVEETATSTV 18063

Query: 337   LEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTP 396
             L I   + +D  +Y  +A N  G  +   SV+V    G                     P
Sbjct: 18064 LHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPG--------------------PP 18103

Query: 397   YGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWV 456
              G     E+  D    V    E    + GC++      K       W+     ++     
Sbjct: 18104 VGPVRFDEVSAD---FVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVA----- 18155

Query: 457   QTLWSGERATLTFSHLNKEDEGLYTIRV----RMGEYYEQYSAYVFVRDADAEIEGAPAA 512
                    R T+  + L    E  Y  R+    R G+     S  V V+    E  G P  
Sbjct: 18156 -------RTTIKITKLKTGTE--YQFRIFAENRYGKSAPLDSKAVIVQYPFKE-PGPPGT 18205

Query: 513   PLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVT 572
             P        +KD +++ W +P  DGG+ I+GY +++ E  +  W + N TP++  +F  T
Sbjct: 18206 PF---VTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTT 18262

Query: 573   GLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEP 632
             GL EG  Y F+V A N +GIG PS+VSE   A DP +                       
Sbjct: 18263 GLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDP---------------------- 18300

Query: 633   SEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELP 691
                  PG P  + +   TR+ V L WK P   G   I  Y VEK +     W + +    
Sbjct: 18301 -----PGRPEAIVI---TRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASF-TN 18351

Query: 692   VKSPRFALFDLAEGKSYCFRVRCSNSAG-VGEPSEATEVTVVGDKLDIPKA 741
             V    F +  L E + Y FRV   N+AG   EPS+++      D++D P A
Sbjct: 18352 VLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNA 18402



 Score =  117 bits (293), Expect = 9e-26
 Identities = 95/316 (30%), Positives = 144/316 (45%), Gaps = 39/316 (12%)

Query: 510  PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
            P+ PLD+   +A + +I I+WK P  +GGSPI+GY ++ C VGT+ W + N  P+K  +F
Sbjct: 7980 PSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKF 8039

Query: 570  PV-TGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVT 628
             V  G++  + Y+ RVRAVN +G+  PS +SE V A DP  K  +        T  IIV 
Sbjct: 8040 KVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLE-----THDIIVI 8094

Query: 629  EEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNT 688
            E E     +P P   + V         +SW   G+         V+  +  T     ++ 
Sbjct: 8095 EGEKLS--IPVPFRAVPVP-------TVSWHKDGKE--------VKASDRLTMKNDHISA 8137

Query: 689  ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPS 748
             L V  P+    D        + +   N   +G  + +  V V+G    +P     I  S
Sbjct: 8138 HLEV--PKSVRADAG-----IYTITLENK--LGSATASINVKVIG----LPGPCKDIKAS 8184

Query: 749  RNTDTSVVVSWE--ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQS 806
              T +S  ++WE  E      ++ Y +E   AG   + P  +   K S +T   L+    
Sbjct: 8185 DITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLS-WTVKDLIPNGE 8243

Query: 807  YIFRVRAVNAAGLSEY 822
            Y FRV+AVN  G  EY
Sbjct: 8244 YFFRVKAVNKVGGGEY 8259



 Score =  117 bits (292), Expect = 1e-25
 Identities = 89/308 (28%), Positives = 141/308 (45%), Gaps = 18/308 (5%)

Query: 922   SDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPG 981
             SDP+  +     P  P          +S+ L W +P+  GG+EI  Y +  RE       
Sbjct: 21835 SDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKKST--- 21891

Query: 982   KW-REANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPG 1040
             +W +  + + +SE  +K++ L E   Y+F V A N AG+G  S +S   KC E  +  PG
Sbjct: 21892 RWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCRE-PVNPPG 21950

Query: 1041  PPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN-EAAIKNVY 1099
             PP  +K ++  K ++ L+W  PV  G   + GY +++   KA    W  +N EA +K  Y
Sbjct: 21951 PPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEM--CKADLGDWHKVNAEACVKTRY 22008

Query: 1100  LKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVV-------NVDDDG 1152
               V  L+ G  Y FRV AIN AG G   ++ G + A  R    E+ +       +V   G
Sbjct: 22009 -TVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAG 22067

Query: 1153  VISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDV 1212
                  F   +  P     WSK    +  S R ++ +  + + +T ++   +D G Y+  V
Sbjct: 22068 ASIRLFIAYQGRPTPTAVWSKP--DSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTV 22125

Query: 1213  TDTDGIAS 1220
              +  G  S
Sbjct: 22126 ENNSGSKS 22133



 Score =  116 bits (290), Expect = 2e-25
 Identities = 133/548 (24%), Positives = 220/548 (40%), Gaps = 61/548 (11%)

Query: 638   PGPPTD-LSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSP 695
             PGPP   +   E +  +VV+SW+PP   G   I  Y VEK +  T  W  V+    V   
Sbjct: 18100 PGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSAT--VART 18157

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSV 755
                +  L  G  Y FR+   N  G   P ++  V +V      P  PG    +  +   +
Sbjct: 18158 TIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAV-IVQYPFKEPGPPGTPFVTSISKDQM 18216

Query: 756   VVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRA 813
             +V W E  +    +++GY++E     S  W   N  P++ ++F   GL  G  Y F+V A
Sbjct: 18217 LVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSA 18276

Query: 814   VNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGG-----LTASRGRVHEASPPT 868
              N  G+ + S+ SE           V+ D C    D PG      +T +   +    P  
Sbjct: 18277 ENIVGIGKPSKVSECF---------VARDPC----DPPGRPEAIVITRNNVTLKWKKPAY 18323

Query: 869   FQKDALLGSKPNKPSLP------SSSQNLGQTE--VSKVSETVQEELTPPPQKAAPQGKS 920
                  + G    K  LP      +S  N+ +TE  VS + E  + E     + AA     
Sbjct: 18324 DGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSE 18383

Query: 921   KSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVP 980
              SD     T R     P + +    ++D +V+        G   +    +  + + D V 
Sbjct: 18384 PSDSSGAITARDEIDAP-NASLDPKYKDVIVV------HAGETFVLEADIRGKPIPDVVW 18436

Query: 981   GKWREANVKAVSEEAYKISNLKENMVYQFQVAA------MNMAGLGAPSAVSECFKCEEW 1034
              K  +   +  +    K +  K  +V +  +        + ++ +G   ++    K    
Sbjct: 18437 SKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVK---- 18492

Query: 1035  TIAVPGPPHS-LKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEA 1093
              +  PGPP   LK + V  +   L W PP+  G   ++ Y ++ +E       W  ++  
Sbjct: 18493 VLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLS--WTQVS-T 18549

Query: 1094  AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA------ETRPGTKEVVVN 1147
              ++ +  KV  L  G  Y+FRV A+N+ G+G+P + +GPV A         P T EV   
Sbjct: 18550 EVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLE-SGPVTACNPYKPPGPPSTPEVSAI 18608

Query: 1148  VDDDGVIS 1155
               D  V++
Sbjct: 18609 TKDSMVVT 18616



 Score =  115 bits (289), Expect = 3e-25
 Identities = 166/757 (21%), Positives = 275/757 (36%), Gaps = 129/757 (17%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYR 351
             E +K++  IAG P P ++W K+ + I   A   +  I S      L +  C   DT QY 
Sbjct: 19500 EVLKINADIAGRPLPVISWAKDGIEIEERA---RTEIISTDNHTLLTVKDCIRRDTGQYV 19556

Query: 352   ASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF-GVTPYGYASRFEIHFDDK 410
              +  NV G  S   +  V       D+    AG    PL   G+T             +K
Sbjct: 19557 LTLKNVAGTRSVAVNCKV------LDKPGPPAG----PLEINGLTA------------EK 19594

Query: 411   FDVSFGREGET--MSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGE--RAT 466
               +S+GR  E     +   +V   E  H    + W              T+  GE    +
Sbjct: 19595 CSLSWGRPQEDGGADIDYYIVEKRETSH----LAW--------------TICEGELQMTS 19636

Query: 467   LTFSHLNKEDEGLYTI----RVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEAN 522
                + L K +E ++ +    +  +GE  E     V ++  D      P+ P  ++     
Sbjct: 19637 CKVTKLLKGNEYIFRVTGVNKYGVGEPLES----VAIKALDPFT--VPSPPTSLEITSVT 19690

Query: 523   KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIF 582
             K+ + + W +P  DGGS I GY I++ E  +  W + N  PV   R   TGL EG  Y +
Sbjct: 19691 KESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEY 19750

Query: 583   RVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPT 642
             RV A N  G+  PS  S  + A DP                             +P PP+
Sbjct: 19751 RVYAENAAGLSLPSETSPLIRAEDPV---------------------------FLPSPPS 19783

Query: 643   DLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFD 701
                + ++ ++ + ++W KP    G     Y VE  ++   +W+     L  +   + +  
Sbjct: 19784 KPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTSIQSL--RGTEYTISG 19841

Query: 702   LAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK-------LDIPKAPGKIIPSRNTDTS 754
             L  G  Y FRV+  N  G  +PS++++  +  ++       +D       I+ +  + T 
Sbjct: 19842 LTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASFTM 19901

Query: 755   VV---------VSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQ 805
              V         V W +         Y        S   E  N N       T   +++  
Sbjct: 19902 TVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAA 19961

Query: 806   SYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEAS 865
             S    V+ ++  G        +  +  A +   V         +  GG       + +  
Sbjct: 19962 SLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDV--------PENDGGAPVKNYHIEKRE 20013

Query: 866   PPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPL 925
                  K A +    N   L     NL +  +     + + E          +G       
Sbjct: 20014 A---SKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEG------- 20063

Query: 926   KKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWRE 985
              K T++  P     +T +   +DS+ L W +P+  GG+ I  Y V   E ++     W +
Sbjct: 20064 VKITEKPSPPEKLGVTSIS--KDSVSLTWLKPEHDGGSRIVHYVV---EALEKGQKNWVK 20118

Query: 986   ANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAP 1022
               V       + +S L+EN  Y F+V A N AGL  P
Sbjct: 20119 CAV--AKSTHHVVSGLRENSEYFFRVFAENQAGLSDP 20153



 Score =  113 bits (282), Expect = 2e-24
 Identities = 82/300 (27%), Positives = 136/300 (45%), Gaps = 26/300 (8%)

Query: 934   PSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSE 993
             P PP          D M L W  P   GG+E+TG++V  +E    +   W++ N   +S 
Sbjct: 21452 PGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSIL---WQKVNTSPISG 21508

Query: 994   EAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVP--GPPHSLKCSEVR 1051
               Y+ + L E + YQF+V A N AGL +PS  S+      +T+AV    PP +    +V 
Sbjct: 21509 REYRATGLVEGLDYQFRVYAENSAGLSSPSDPSK------FTLAVSPVDPPGTPDYIDVT 21562

Query: 1052  KDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSY 1111
             ++++ L+W PP+  G + + GY ++ ++     ++W   N   +      V GL  G  Y
Sbjct: 21563 RETITLKWNPPLRDGGSKIVGYSIEKRQGN---ERWVRCNFTDVSECQYTVTGLSPGDRY 21619

Query: 1112  VFRVRAINQAG-VGKPSDLAGPVVAETRPGTKEVVVNVDD---DGVISLNFECDKMT--- 1164
              FR+ A N  G +  PS  +G ++  TR      +V       DG+I  + E  ++    
Sbjct: 21620 EFRIIARNAVGTISPPSQSSGIIM--TRDENVPPIVEFGPEYFDGLIIKSGESLRIKALV 21677

Query: 1165  ---PKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1221
                P    +W KD V  E    +E+      T +  +D   D  G+Y+ +  +  G A +
Sbjct: 21678 QGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKA 21737



 Score =  112 bits (279), Expect = 4e-24
 Identities = 71/232 (30%), Positives = 103/232 (44%), Gaps = 28/232 (12%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P  P   +     KD ++++W +P  DGG+ I GY ++K +     W++CN   +   R 
Sbjct: 18597 PGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWTKCNKKTLTDLRL 18656

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              VTGL EG SY FRV A N  G+G PS  S    A D                       
Sbjct: 18657 RVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDAL--------------------- 18695

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNT 688
                     PGPP++  VT+ +RS V L+W  P   G   +  Y VE  EA  + W     
Sbjct: 18696 ------YPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTP 18749

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPK 740
                ++  +F +  L E   Y FR+   NS GVGEP+      V  ++++ P+
Sbjct: 18750 PTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPE 18801



 Score =  108 bits (269), Expect = 6e-23
 Identities = 127/511 (24%), Positives = 214/511 (41%), Gaps = 52/511 (10%)

Query: 638   PGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPR 696
             PGPP  + + E +   + +SW PP   G   I  Y VEK E  +  W  V+  +   S +
Sbjct: 19183 PGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSIK 19242

Query: 697   FALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVV 756
               +  L  G  Y FRV   N  G    SE++ V V       P  PG       T ++++
Sbjct: 19243 --IVRLTTGSEYQFRVCAENRYGKSSYSESSAV-VAEYPFSPPGPPGTPKVVHATKSTML 19299

Query: 757   VSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAV 814
             V+W+   +     ++GY++E     S  W   N   +  ++    GL  G  Y +RV A 
Sbjct: 19300 VTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAE 19359

Query: 815   NAAGLSEYSQDSEAIEVKAAIGGGVSPDVC-PALSDEPGGLTASRGRVHEASPPTFQKDA 873
             N AG+ + S+  E +  +         D C P    E   +T     +  + P       
Sbjct: 19360 NIAGIGKCSKSCEPVPAR---------DPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAK 19410

Query: 874   LLGSKPNKPSLPS------SSQNLGQT--EVSKVSETVQEELTPPPQKAAPQGKSKSD-- 923
             + G    +  LP       +  N+ +T  EV++++E  + E     + AA      S+  
Sbjct: 19411 ITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSEST 19470

Query: 924   -PLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGY---YVNYREVIDGV 979
              P+  K D  PP    D+     FRD +V+   +  KI  A+I G     +++ +  DG+
Sbjct: 19471 GPIIVKDDVEPPRVMMDV----KFRDVIVVKAGEVLKI-NADIAGRPLPVISWAK--DGI 19523

Query: 980   PGKWREANVKAVSEEAYKISNLKENM---VYQFQVAAMNMAGLGAPSAVSECFKCEEWTI 1036
               + R A  + +S + + +  +K+ +     Q+ +   N+AG       S    C+   +
Sbjct: 19524 EIEER-ARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAG-----TRSVAVNCK--VL 19575

Query: 1037  AVPGPPHS-LKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAI 1095
               PGPP   L+ + +  +   L W  P   G   +  Y V+ +E       W  + E  +
Sbjct: 19576 DKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRE--TSHLAWT-ICEGEL 19632

Query: 1096  KNVYLKVRGLKEGVSYVFRVRAINQAGVGKP 1126
             +    KV  L +G  Y+FRV  +N+ GVG+P
Sbjct: 19633 QMTSCKVTKLLKGNEYIFRVTGVNKYGVGEP 19663



 Score =  107 bits (267), Expect = 1e-22
 Identities = 81/279 (29%), Positives = 125/279 (44%), Gaps = 45/279 (16%)

Query: 462  GERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEA 521
            G ++ L      ++D G Y I         +++A      A  E+   P   LD+K +  
Sbjct: 8851 GTKSELIIKDALRKDHGRYVITAT-NSCGSKFAA------ARVEVFDVPGPVLDLKPVVT 8903

Query: 522  NKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYI 581
            N+   +++W  P  DGGS I G+ I++ +    +W Q  +T  + ++  +TGL+EG+ Y 
Sbjct: 8904 NRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIET--ERSKCDITGLLEGQEYK 8961

Query: 582  FRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPP 641
            FRV A NK G G P  +  P+ A+DP                               GPP
Sbjct: 8962 FRVIAKNKFGCGPPVEIG-PILAVDPL------------------------------GPP 8990

Query: 642  TD---LSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRF 697
            T    L+ TE T+S + L WK P   G   I  Y +EK      +++RVN  L   +  F
Sbjct: 8991 TSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRL-CPTTSF 9049

Query: 698  ALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKL 736
             + +L E + Y FRV+  N  G  EPS    V +  D++
Sbjct: 9050 LVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEV 9088



 Score =  103 bits (256), Expect = 2e-21
 Identities = 71/193 (36%), Positives = 91/193 (47%), Gaps = 7/193 (3%)

Query: 638   PGPPTD-LSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSP 695
             PGPP   L VT  T     L+W PP Q G   I  Y +EK E    +W +V+TE  V++ 
Sbjct: 18497 PGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTE--VQAL 18554

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSV 755
              + +  L  G  Y FRV   N  G+GEP E+  VT   +    P  P     S  T  S+
Sbjct: 18555 NYKVTKLLPGNEYIFRVMAVNKYGIGEPLESGPVTAC-NPYKPPGPPSTPEVSAITKDSM 18613

Query: 756   VVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRA 813
             VV+W    D    E+ GY +E       +W  CN   +   R    GL  G SY FRV A
Sbjct: 18614 VVTWARPVDDGGTEIEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAA 18673

Query: 814   VNAAGLSEYSQDS 826
              NAAG+ E S+ S
Sbjct: 18674 ENAAGVGEPSEPS 18686



 Score = 95.1 bits (235), Expect = 5e-19
 Identities = 161/728 (22%), Positives = 271/728 (37%), Gaps = 135/728 (18%)

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
             VF R  DA     P  P + K  + ++  + ++W +P  DGG+P+ GY ++  E   D W
Sbjct: 18687 VFYRACDALYP--PGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEW 18744

Query: 557   SQCND-TPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKS 615
             + C   T ++  +F VT L E   Y FR+ A+N  G+G P+ +   V A +  E   ++ 
Sbjct: 18745 TTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIEL 18804

Query: 616   RPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQ---RGHEGIMYF 672
                     +++V                L  +   R +V +  +P  +      EGI+  
Sbjct: 18805 DAD---LRKVVV----------------LRASATLRLFVTIKGRPEPEVKWEKAEGIL-- 18843

Query: 673   VEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVV 732
                         R   E+        + ++    S  + +   N++G    S+   V V 
Sbjct: 18844 ----------TDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSG----SKTAFVNV- 18888

Query: 733   GDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCNNNP 790
                LD P AP  +        SV +SWE        ++  Y +E        +    NN 
Sbjct: 18889 -RVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNC 18947

Query: 791   VKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDE 850
              K + F    L  G SY FRV A N  G+   ++ +E ++V             P L   
Sbjct: 18948 TK-TTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSE-----------PPL--P 18993

Query: 851   PGGLTASRGRVHEASPPTFQKDALLGSKPN----KPSLPSSSQNLGQTEVSKVSETVQEE 906
             PG +T      + A+    + ++  GSK      +     S +    T+V  +  T+   
Sbjct: 18994 PGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATI-SG 19052

Query: 907   LTPPPQ----KAAPQGKSKSDP-----------LKKKTDRAPPSPPCDITCLESF----- 946
             LT   +     AA   K +SDP           ++ K     P    ++   E       
Sbjct: 19053 LTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKIDVP 19112

Query: 947   ---RDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKE 1003
                R    + W++ D     E T   V+  + +  +  K  EA+ + V      +SN   
Sbjct: 19113 FKGRPQATVNWRK-DGQTLKETTRVNVSSSKTVTSLSIK--EASKEDVGTYELCVSNSAG 19169

Query: 1004  NMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPV 1063
             ++     +  ++  G   P  + E   C+  TI+                     W PP 
Sbjct: 19170 SITVPITIIVLDRPGPPGPIRIDE-VSCDSITIS---------------------WNPPE 19207

Query: 1064  HSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGV 1123
             + G   ++ Y V+ KE  +    W  +++ A+    +K+  L  G  Y FRV A N+ G 
Sbjct: 19208 YDGGCQISNYIVEKKETTS--TTWHIVSQ-AVARTSIKIVRLTTGSEYQFRVCAENRYGK 19264

Query: 1124  GKPSDLAGPVVAE------TRPGTKEVV------------VNVDDDGVISLNFECDKMTP 1165
                S+ +  VVAE        PGT +VV            V V+D G   + +  +    
Sbjct: 19265 SSYSE-SSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLE-YKE 19322

Query: 1166  KSEFSWSK 1173
             +S   WSK
Sbjct: 19323 RSSILWSK 19330



 Score = 94.0 bits (232), Expect = 1e-18
 Identities = 84/340 (24%), Positives = 135/340 (39%), Gaps = 45/340 (13%)

Query: 274   LHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYII-ESRY 332
             + AP F  + R+  V  + N  L C + G P+P V WY+    I   A+  KY I E + 
Sbjct: 24620 IQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEII--ADGLKYRIQEFKG 24677

Query: 333   GMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF 392
             G H L I     +D   Y+  A N  G +S  AS+ V+         + H   +   +  
Sbjct: 24678 GYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEV------PAKIHLPKTLEGMGA 24731

Query: 393   GVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSP 452
                  G     +I F  K D                          P I W +    +  
Sbjct: 24732 VHALRGEVVSIKIPFSGKPD--------------------------PVITWQKGQDLIDN 24765

Query: 453   SKWVQTLWSGERATLTFSH-LNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPA 511
             +   Q + +    +L F + + ++D G Y +  +     +Q       +  + ++   P 
Sbjct: 24766 NGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQ-------KTVELDVADVPD 24818

Query: 512   APLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPV 571
              P  VK  + ++D + ++W +PA DGGS I  Y ++KC    + W +      +  R+ V
Sbjct: 24819 PPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQ--ARETRYTV 24876

Query: 572   TGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKA 611
               L    SY FRV A NK G+  PS  SEP    +   +A
Sbjct: 24877 INLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRA 24916



 Score = 77.8 bits (190), Expect = 8e-14
 Identities = 58/224 (25%), Positives = 109/224 (48%), Gaps = 17/224 (7%)

Query: 157   ERIKEAAAYIAQRNLLASEEGITTSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTA 216
             E +K++AA   +++++  E  IT + Q++   +T A  ++ +++ S    Q    + + A
Sbjct: 26701 EEVKKSAATSLEKSIVHEE--ITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIA 26758

Query: 217   SRQSVV----SKQATSALQQEETSEKKSRKVVIREKAER-----LSLRKTLEETET--YH 265
                 V       + T++ +         + + I++ + R       + KT E      Y 
Sbjct: 26759 GATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYD 26818

Query: 266   AKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGK 325
               L+++ L  AP FI +PRS  + E +NV   C I+G P P + W+KN +PI++ +N   
Sbjct: 26819 LTLSKE-LSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVS- 26876

Query: 326   YIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVV 369
               I     +++LEI      D+ +Y   A N +G+ SA AS++V
Sbjct: 26877 --ISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV 26918



 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 104/533 (19%), Positives = 203/533 (38%), Gaps = 97/533 (18%)

Query: 1158 FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
            F C+  T  ++  W ++  +  DS +  +  K     +  +D  +DD   Y+  +T+  G
Sbjct: 6354 FNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRG 6413

Query: 1218 ----IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNA 1273
                 A++ +++EE+L+ +            P+K    +E +EK  V FW +  +L  N 
Sbjct: 6414 ENVKSAANLIVEEEDLRIV-----------EPLKD---IETMEKKSVTFWCKVNRL--NV 6457

Query: 1274 KVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVL 1333
             + +  N +E+    +    +D+   ++ +  +     DEG Y       K+     ++ 
Sbjct: 6458 TLKWTKNGEEVPFDNRVSYRVDKYKHMLTI--KDCGFPDEGEYIVTAGQDKSVAELLII- 6514

Query: 1334 VGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECN-VLLKCKVANIKKETHIVWY 1392
                                 +    FVE+L  +   E +  +  C+++  +++ ++ WY
Sbjct: 6515 ---------------------EAPTEFVEHLEDQTVTEFDDAVFSCQLS--REKANVKWY 6551

Query: 1393 KDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKE-- 1450
            ++ REI   +K+ F+             KD  I+ +I+KD R  D+       E  K   
Sbjct: 6552 RNGREIKEGKKYKFE-------------KDGSIHRLIIKDCRLDDECEYACGVEDRKSRA 6598

Query: 1451 --LMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTG 1508
               + E+  +I     D+     A G  +        + ++V W  N   +   D+ +  
Sbjct: 6599 RLFVEEIPVEIIRPPQDIL---EAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMM 6655

Query: 1509 VTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAE 1568
              G+   LQI +  P D+G+Y     D                 EA A+ +      I  
Sbjct: 6656 SEGKIHRLQICDIKPRDQGEYRFIAKD----------------KEARAKLELAAAPKIKT 6699

Query: 1569 KNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRT 1628
             ++  V         +  GK L +       P  E  W K  + L++     +   A +T
Sbjct: 6700 ADQDLV---------VDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTK---TIDTTAEQT 6747

Query: 1629 AYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVF-IPEEEARMAALESLKG 1680
            + F I      D G+Y +V++NK+G       + V  +P     +   E+  G
Sbjct: 6748 S-FRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDG 6799



 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 67/296 (22%), Positives = 117/296 (39%), Gaps = 27/296 (9%)

Query: 1378  CKVANIKKETHIVWYKDEREISVDEKHD--FKDGICTLLITEFSKKDAGIYEVILKDDRG 1435
             CK+ N  + T + WY   R++   EK++  ++DG+  L + + +K D G Y   + +D G
Sbjct: 25284 CKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYG 25343

Query: 1436  KDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHN 1495
             +D S  +L  +  +E+    C++     T  KI+   + ++L      +   L    ++ 
Sbjct: 25344 EDSSYAELFVKGVREVYDYYCRR-----TMKKIKRRTDTMRLLERPPEFTLPLYNKTAYV 25398

Query: 1496  GSAIRYSDRVKTGVTGEQIWLQINE---PTPNDKGKYVMELFDGKTGHQKTVDLSGQAYD 1552
             G  +R+   +         W +  +   P  NDK KY  E    K  +Q T++      D
Sbjct: 25399 GENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDK-KYTFE--SDKGLYQLTINSVTTDDD 25455

Query: 1553  EAYAEFQRLKQAAIAEKNRARVLGGLPDV--------------VTIQEGKALNLTCNVWG 1598
               Y    R K    + K +  V    P                   QEG+++     V G
Sbjct: 25456 AEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSG 25515

Query: 1599  DPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGS 1654
              PPP + W K+ + L+   +  +  E        I      D+G Y +   N  GS
Sbjct: 25516 IPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGS 25571



 Score = 69.7 bits (169), Expect = 2e-11
 Identities = 102/489 (20%), Positives = 180/489 (36%), Gaps = 79/489 (16%)

Query: 1165 PKSEFSWSKDYVSTEDSPRLE-VESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1223
            P  E  W K+ V  E S R+     + N  ++  +D+  +D         +  G  SS+ 
Sbjct: 2059 PDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHA 2118

Query: 1224 IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1283
                + K+L+  + E +      K  +A             + E      KV +  +  E
Sbjct: 2119 FLLVQAKQLITFTQELQDVVAKEKDTMAT-----------FECETSEPFVKVKWYKDGME 2167

Query: 1284 IFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQK 1343
            + EG KY+MH DR    + +      D ++ +    ++D      + +++ G V + +++
Sbjct: 2168 VHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVL-VEDENVKTTAKLIVEGAVVEFVKE 2226

Query: 1344 EAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVA--NIKKETHIVWYKDEREISVD 1401
              + +  E                 +GE    L+C V+  NI+ +    WY ++ E+  +
Sbjct: 2227 LQDIEVPE---------------SYSGE----LECIVSPENIEGK----WYHNDVELKSN 2263

Query: 1402 EKHDF--KDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKI 1459
             K+    + G   L + + +K+D G Y  ++  D  K   +LK+       L        
Sbjct: 2264 GKYTITSRRGRQNLTVKDVTKEDQGEYSFVI--DGKKTTCKLKMKPRPIAILQ------- 2314

Query: 1460 ALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQIN 1519
                  L  Q   EG  +   V   +E ++  W  +G  ++ SDRV   +  +   L I 
Sbjct: 2315 -----GLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIE 2369

Query: 1520 EPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLP 1579
            + T  D G Y   +          + LS       Y+                 V+  L 
Sbjct: 2370 DMTKEDAGNYSFTI--------PALGLSTSGRVSVYS---------------VDVITPLK 2406

Query: 1580 DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
            DV  I+  KA+ L C V       V W  N++ +  DD        G      IN    +
Sbjct: 2407 DVNVIEGTKAV-LECKVSVPDVTSVKWYLNDEQIKPDDRVQ-AIVKGTKQRLVINRTHAS 2464

Query: 1640 DSGKYGLVV 1648
            D G Y L+V
Sbjct: 2465 DEGPYKLIV 2473



 Score = 69.7 bits (169), Expect = 2e-11
 Identities = 121/559 (21%), Positives = 206/559 (36%), Gaps = 117/559 (20%)

Query: 1168  EFSWSKDYVSTEDSPRLEVESKGNKT-KMTFKDLGMDDLGIYSCDVTDTDGIASSYL--- 1223
             E +W KD    +++   +     + T ++   +L   D G Y C+++   G + + L   
Sbjct: 26443 EVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFM 26502

Query: 1224  -------------------IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWM 1264
                                 D++  +  +    E K P       + V  L+   V    
Sbjct: 26503 GQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDS 26562

Query: 1265  QAE---KLSGNAKVNYIFNE--KEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQ 1319
              A+   K +G  +   I+ +  K I +G KYK+  D+    +E+   K    D G YT  
Sbjct: 26563 VAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEI--HKTDTSDSGLYTCT 26620

Query: 1320  LQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCK 1379
             +++   +  S+  L      K  K+ E Q+              +S + T E   +   K
Sbjct: 26621 VKNSAGSVSSSCKLT----IKAIKDTEAQK--------------VSTQKTSE---ITPQK 26659

Query: 1380  VANIKKETHIVWYKDER----EISVDEKHDFKDGICTLLITEFSKKDAG-------IYEV 1428
              A +++E      + E     E    EK   K+    +LI+E  KK A        ++E 
Sbjct: 26660 KAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEE 26719

Query: 1429  ILKDDRGKDKSRLKLVDEAFKELMME------VCKKIALSATDLKIQSTAEGIQLYSFVT 1482
             I K  +  ++ R     +AF   M        V K     ATD+K               
Sbjct: 26720 ITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGATDVK--------------- 26764

Query: 1483  YYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKG--KYVMELFDGKTGH 1540
                      W  NG  +  S+  + GV+G    L I + +  D+G    + +  +G    
Sbjct: 26765 ---------WVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKC 26815

Query: 1541  QKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDP 1600
             Q  + LS +  D           A I++          P    I EG+ +  TC + G+P
Sbjct: 26816 QYDLTLSKELSDAP---------AFISQ----------PRSQNINEGQNVLFTCEISGEP 26856

Query: 1601  PPEVSWLKNEKALASDDHCNLKFEAGRTAY-FTINGVSTADSGKYGLVVKNKYGSETSDF 1659
              PE+ W KN   ++     N+     R  Y   I   S +DSGKY +  KN  G  ++  
Sbjct: 26857 SPEIEWFKNNLPISISS--NVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATA 26914

Query: 1660  TVSVF-IPEEEARMAALES 1677
             ++ V  + EE +R   L +
Sbjct: 26915 SLMVLPLVEEPSREVVLRT 26933



 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 91/360 (25%), Positives = 148/360 (41%), Gaps = 39/360 (10%)

Query: 175  EEGITTSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEE 234
            E  I  S  +T  K+ +A+  S+A K + + K  T     T  R               +
Sbjct: 785  EASIAGSAIATLQKELSAT--SSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPD 842

Query: 235  TSEKKSRKVVIREKAERLSLRKTLEET-ETYH---AKLNEDHLLHAP-EFIIKP------ 283
            T + ++   V +E    ++     EE  E  H   AK+ E   + AP E  + P      
Sbjct: 843  TYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSG 902

Query: 284  -RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGC 342
             ++ TV E E+V L C I+G+P P VTWY+    I    +   + I  + G+  L I   
Sbjct: 903  LKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSID---FQITFQSGIARLMIREA 959

Query: 343  DFEDTAQYRASAMNVKGEL--SAYASVVVKR----------YKGEFDETRFHAGASTMPL 390
              ED+ ++  SA+N  G +  S Y +V V             K   +E RF      +  
Sbjct: 960  FAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMT 1019

Query: 391  SFGVT--PYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGV 448
               +T    G       +F  K  V    EG ++  GC+V   P     +P + W ++GV
Sbjct: 1020 DTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNP-----KPHVYWKKSGV 1074

Query: 449  PLSPSKWVQTLWSGE--RATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEI 506
            PL+     +  ++ +     L  S    +D G YTI VR  ++ E  ++   + +AD E+
Sbjct: 1075 PLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVR-NKHGETSASASLLEEADYEL 1133



 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 63/303 (20%), Positives = 130/303 (42%), Gaps = 23/303 (7%)

Query: 1039  PGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNV 1098
             P  P +L   EV+KDS+ L W+PP+  G   +T Y V+ +E   K   +  +     K  
Sbjct: 18894 PSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRK--AYATITNNCTKTT 18951

Query: 1099  YLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVD-DDGVISLN 1157
             + ++  L+EG SY FRV A N+ G+G P++   PV     P     V  VD      ++ 
Sbjct: 18952 F-RIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIK 19010

Query: 1158  FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
             +E  +    S+ +     + T+ S +    ++    + T   L   +  ++     +  G
Sbjct: 19011 WEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATISGLTAGEEYVFRVAAVNEKG 19070

Query: 1218  IASSYLIDEEELKRLLALSHEHKFP----TVPVKSELAVEILEKGQVRFWMQAEKLSGNA 1273
              +    +    + R + +    + P     V  + +L +++  KG+ +           A
Sbjct: 19071 RSDPRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKIDVPFKGRPQ-----------A 19119

Query: 1274  KVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQD--GKATNHSTV 1331
              VN+  + + + E    ++++  +  +  + +++   ED GTY   + +  G  T   T+
Sbjct: 19120 TVNWRKDGQTLKE--TTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITI 19177

Query: 1332  VLV 1334
             +++
Sbjct: 19178 IVL 19180



 Score = 67.4 bits (163), Expect = 1e-10
 Identities = 62/233 (26%), Positives = 93/233 (39%), Gaps = 35/233 (15%)

Query: 251   RLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTW 310
             R +++K    T+T         L   PEF +   + T +  ENV+   +I   PEP VTW
Sbjct: 25365 RRTMKKIKRRTDTMRL------LERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTW 25418

Query: 311   YKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
             YK+   I    N  KY  ES  G++ L IN    +D A+Y   A N  GE S  A + V 
Sbjct: 25419 YKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVT 25478

Query: 371   RYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVI 430
              +    D T         P+                F      +  +EG+++    RV  
Sbjct: 25479 LHPPPTDST-------LRPM----------------FKRLLANAECQEGQSVCFEIRVSG 25515

Query: 431   TPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSG-ERATLTFSHLNKEDEGLYTI 482
              P      P ++W ++G PLS    ++ +  G +   L       ED G Y +
Sbjct: 25516 IP-----PPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRV 25563



 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 110/549 (20%), Positives = 203/549 (36%), Gaps = 91/549 (16%)

Query: 1132 PVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGN 1191
            P V  T+P   + V    ++G  ++  EC+     ++  W K+      S + E+ + G 
Sbjct: 5978 PPVEFTKPLEDQTV----EEGATAV-LECEVSRENAKVKWFKNGTEILKSKKYEIVADGR 6032

Query: 1192 KTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELA 1251
              K+   D   +D+  Y+CD  D     +  ++                 P V     L 
Sbjct: 6033 VRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVP----------------PHVEFLRPLT 6076

Query: 1252 -VEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQD 1310
             +++ EK   RF  + E    NAKV +  +  EI +G KY   I     +  + + K   
Sbjct: 6077 DLQVREKEMARF--ECELSRENAKVKWFKDGAEIKKGKKY--DIISKGAVRILVINKCLL 6132

Query: 1311 EDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTG 1370
            +DE  Y+ +++  + +   TV         L++EA F +               + EV+ 
Sbjct: 6133 DDEAEYSCEVRTARTSGMLTV---------LEEEAVFTK------------NLANIEVSE 6171

Query: 1371 ECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVIL 1430
               + L C+V+  K    ++WYK + EI    +++        ++TE  K+   I    L
Sbjct: 6172 TDTIKLVCEVS--KPGAEVIWYKGDEEIIETGRYE--------ILTEGRKRILVIQNAHL 6221

Query: 1431 KDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKV 1490
             +D G    RL       K  + E+  +      +L+I    EG +     +   E   V
Sbjct: 6222 -EDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEI---LEGEKAEFVCSISKESFPV 6277

Query: 1491 NWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQA 1550
             W  +   +   D+      G++  L + + T  D G YV+ +   +     TV      
Sbjct: 6278 QWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTV------ 6331

Query: 1551 YDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNE 1610
                                + R++  L D   ++E + +   C V      +  W +NE
Sbjct: 6332 ------------------IEKLRIVVPLKD-TRVKEQQEVVFNCEV-NTEGAKAKWFRNE 6371

Query: 1611 KALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEA 1670
            +A+  D    +  +        I      D   Y + + N  G E      ++ + EE+ 
Sbjct: 6372 EAI-FDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRG-ENVKSAANLIVEEEDL 6429

Query: 1671 RMAALESLK 1679
            R+  +E LK
Sbjct: 6430 RI--VEPLK 6436



 Score = 65.5 bits (158), Expect = 4e-10
 Identities = 62/235 (26%), Positives = 100/235 (42%), Gaps = 13/235 (5%)

Query: 142   SGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITTSKQSTASKQTTASKQSTASKQ 201
             S RQ+ V+ IT+ EEE   E + + AQR   +S   +   ++S +       +  +   +
Sbjct: 25930 SRRQREVTEITEIEEEY--EISKH-AQRESSSSASRLLRRRRSLSPTYIELMRPVSELIR 25986

Query: 202   STAS-----KQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKVVIREKAERLSLRK 256
             S        +  T  R  T  R    S    S+ +     E+ +R  +        +  K
Sbjct: 25987 SRPQPAEEYEDDTERRSPTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALK 26046

Query: 257   TLEETETYHAKLNEDH--LLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQ 314
             T + +E  +  L++    L HAP   ++ RSH V   +N +   ++   P   V WY N 
Sbjct: 26047 TQKTSERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNG 26106

Query: 315   VPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVV 369
             V +       K    +  G+ TLEI  C  +D+  YRA   N KGE S YA++ V
Sbjct: 26107 VELQ---ESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDV 26158



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 105/531 (19%), Positives = 200/531 (37%), Gaps = 98/531 (18%)

Query: 1147 NVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLG 1206
            N++     + +FEC+         W K+ V  E S + ++  +G   ++   +   +D  
Sbjct: 2844 NIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSA 2903

Query: 1207 IYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQA 1266
             Y+  V   D ++++  +    +  +L   +  +  T+  +    V +  +G    W++ 
Sbjct: 2904 EYTF-VCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFE----VTVNYEGISYKWLK- 2957

Query: 1267 EKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKAT 1326
                         N  EI    K +M   + T  + +    +   D   YTF    GKAT
Sbjct: 2958 -------------NGVEIKSTDKCQMRTKKLTHSLNI--RNVHFGDAADYTFVA--GKAT 3000

Query: 1327 NHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKE 1386
            + +T+ +         +  EF++         H  +    +V  +   + +C+V+  + +
Sbjct: 3001 STATLYVEA-------RHIEFRK---------HIKDI---KVLEKKRAMFECEVS--EPD 3039

Query: 1387 THIVWYKDEREISVDEKHDFKDG--ICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLV 1444
              + W KD++E+ + ++   +    +  LLI      DAG Y V+     G + S  KL 
Sbjct: 3040 ITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVA----GGNVSTAKLF 3095

Query: 1445 DEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVE------DLKVNWSHNGSA 1498
             E                  D++I+S  + +Q+       VE      D+  +W  +G  
Sbjct: 3096 VEG----------------RDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIE 3139

Query: 1499 IRYS--DRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYA 1556
            I +   +R K  V      + I+E   +D G+Y      G+     T+ ++     +   
Sbjct: 3140 INFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA--GRNRSSVTLYVNAPEPPQVLQ 3197

Query: 1557 EFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASD 1616
            E Q                      VT+Q GK       + G P P++SW K E+ L++ 
Sbjct: 3198 ELQP---------------------VTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTG 3236

Query: 1617 DHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPE 1667
              C    +        I      D+  Y    KN YG  T+  ++SV +PE
Sbjct: 3237 FKCKFLHDGQEYTLLLIEAF-PEDAAVYTCEAKNDYGVATTSASLSVEVPE 3286



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 46/149 (30%), Positives = 67/149 (44%), Gaps = 9/149 (6%)

Query: 637   VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSP 695
             VP PP  + V++ +R  V L+W  P   G   I  Y VEKC    E W RV      +  
Sbjct: 24816 VPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQ---ARET 24872

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVV-GDKLDIPKAPGKIIPSRNTDTS 754
             R+ + +L    SY FRV   N  G+ +PSE +E T+   DK        ++  +R     
Sbjct: 24873 RYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDETR----E 24928

Query: 755   VVVSWEESKDAKELVGYYIEASVAGSGKW 783
             V ++       KEL   Y+ A   G G++
Sbjct: 24929 VSMTKASHSSTKELYEKYMIAEDLGRGEF 24957



 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 101/468 (21%), Positives = 186/468 (39%), Gaps = 77/468 (16%)

Query: 1073 YFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGP 1132
            +F D  E K K  ++  +++ A++ + +    L +   Y   VR    +G+         
Sbjct: 6101 WFKDGAEIK-KGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLT------- 6152

Query: 1133 VVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNK 1192
            V+ E    TK +  N++     ++   C+   P +E  W K      ++ R E+ ++G K
Sbjct: 6153 VLEEEAVFTKNLA-NIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRK 6211

Query: 1193 TKMTFKDLGMDDLGIYSCDVTD--TDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSEL 1250
              +  ++  ++D G Y+C +    TDG    + +  E + +   L               
Sbjct: 6212 RILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNL--------------- 6256

Query: 1251 AVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQD 1310
              EILE  +  F     K S    V +  ++K +  G KY +  D    ++ +    LQD
Sbjct: 6257 --EILEGEKAEFVCSISKES--FPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQD 6312

Query: 1311 EDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTG 1370
               GTY   +   +A  H TV+    +   L+     ++QE                   
Sbjct: 6313 M--GTYVVMVGAARAAAHLTVIEKLRIVVPLKDTRVKEQQE------------------- 6351

Query: 1371 ECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDF--KDGICTLLITEFSKKDAGIYEV 1428
               V+  C+V    +     W+++E  I    K+    KD + TL I +    D   Y V
Sbjct: 6352 ---VVFNCEVNT--EGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNV 6406

Query: 1429 ILKDDRGKD-KSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVED 1487
             L + RG++ KS   L+ E     ++E  K I             E ++  S VT++ + 
Sbjct: 6407 SLTNHRGENVKSAANLIVEEEDLRIVEPLKDI-------------ETMEKKS-VTFWCKV 6452

Query: 1488 LKVN----WSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVM 1531
             ++N    W+ NG  + + +RV   V   +  L I +    D+G+Y++
Sbjct: 6453 NRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIV 6500



 Score = 60.8 bits (146), Expect = 1e-08
 Identities = 47/165 (28%), Positives = 74/165 (44%), Gaps = 14/165 (8%)

Query: 1038  VPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKN 1097
             VP PP  +K S+V +DS+ L W  P   G + +T Y V+  +     ++W  + +A  + 
Sbjct: 24816 VPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVE--KCATTAERWLRVGQA--RE 24871

Query: 1098  VYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLN 1157
                 V  L    SY FRV A N+ G+ KPS+ + P + +     K   +N D++   +  
Sbjct: 24872 TRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKE---DKTRAMNYDEEVDETRE 24928

Query: 1158  FECDKMTPKSEFSWSKDYVSTEDSPRLE-------VESKGNKTKM 1195
                 K +  S     + Y+  ED  R E       VE+   KT M
Sbjct: 24929 VSMTKASHSSTKELYEKYMIAEDLGRGEFGIVHRCVETSSKKTYM 24973



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 92/403 (22%), Positives = 156/403 (38%), Gaps = 48/403 (11%)

Query: 1158 FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
            FEC+   P     W KD    + + R++++ +    ++      M D G Y+  V     
Sbjct: 3031 FECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYT--VVAGGN 3088

Query: 1218 IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQ--VRFWMQAEKLSGNAKV 1275
            ++++ L  E    R+ ++  E             V+++EK +  V F +  + +  +   
Sbjct: 3089 VSTAKLFVEGRDVRIRSIKKE-------------VQVIEKQRAVVEFEVNEDDVDAHWYK 3135

Query: 1276 NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVG 1335
            + I    ++ E  KY   ++R   I  MF+ + +  D G YTF        N S+V L  
Sbjct: 3136 DGIEINFQVQERHKYV--VERR--IHRMFISETRQSDAGEYTFVA----GRNRSSVTLYV 3187

Query: 1336 DVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDE 1395
            +  +  Q   E Q       +   F                 C V + + +  I WYK+E
Sbjct: 3188 NAPEPPQVLQELQPVTVQSGKPARF-----------------CAVISGRPQPKISWYKEE 3230

Query: 1396 REISVDEKHDF-KDGI-CTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMM 1453
            + +S   K  F  DG   TLL+ E   +DA +Y    K+D G   +   L  E  + +  
Sbjct: 3231 QLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSP 3290

Query: 1454 EVCKKIALSA--TDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTG 1511
            +    +   A  T L+   T+EG            DLKV+W      I+ S   +     
Sbjct: 3291 DQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFE 3350

Query: 1512 EQIWLQINEPTPNDKGKYVMELFD--GKTGHQKTVDLSGQAYD 1552
            +   L+I E  P D+G Y     +  G+      + L  QA D
Sbjct: 3351 DTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEVQALD 3393



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 36/116 (31%), Positives = 59/116 (50%), Gaps = 7/116 (6%)

Query: 1036 IAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKE--DQWRGLNEA 1093
            I +PGP   +K S++ K S  L W+PP   G TP+  Y ++ +EA  +       G N+ 
Sbjct: 8172 IGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKL 8231

Query: 1094 AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVD 1149
            +       V+ L     Y FRV+A+N+ G G+  +L  PV+A+      +  V+V+
Sbjct: 8232 S-----WTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVE 8282



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 63/288 (21%), Positives = 114/288 (39%), Gaps = 96/288 (33%)

Query: 1489  KVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKY--VMELFDGKTGHQKTVDL 1546
             +V W HNG  ++ S ++    T   + L+I +   +D G Y  V   + G+     T+D+
Sbjct: 26099 EVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDV 26158

Query: 1547  SGQAYD----------------------EAYA--EFQR---------------------- 1560
             +G  Y                       EAYA   F++                      
Sbjct: 26159 TGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRE 26218

Query: 1561  ------------LKQAAIAEKN--------------RARVLGGLPDVVTIQEGKALNLTC 1594
                         +K AA+ EK+               AR+L   P  +T+ EG++   +C
Sbjct: 26219 SLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTK-PRSMTVYEGESARFSC 26277

Query: 1595  NVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAY---FTINGVSTADSGKYGLVVKNK 1651
             +  G+P P V+WL+  + L++    + + +   T Y   F I+ V  +D G Y +VV+N 
Sbjct: 26278 DTDGEPVPTVTWLRKGQVLST----SARHQVTTTKYKSTFEISSVQASDEGNYSVVVENS 26333

Query: 1652  YGSETSDFTVSV--------------FIPEEEARMAALESLKGGKKAK 1685
              G + ++FT+++               +   E R+ + E++K  K+ K
Sbjct: 26334 EGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVK 26381



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 57/235 (24%), Positives = 100/235 (42%), Gaps = 27/235 (11%)

Query: 1466  LKIQSTAEGIQLYSFVTYYVEDLK-VNWSHNGSAIRYSDRVKTGVTGEQIW-LQINEPTP 1523
             LK +++ E  +L   V   V   K V W  +G  ++ +   +   + +  + L+IN  T 
Sbjct: 26419 LKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTE 26478

Query: 1524  NDKGKYVMELFDGKTGHQKT-VDLSGQAY----------DEAYAEFQRLKQAAIAEKNRA 1572
             +D+G+YV E+  G+ G  KT +   GQA+           E     Q+  ++ +  K   
Sbjct: 26479 SDQGEYVCEI-SGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEP 26537

Query: 1573  R----------VLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLK 1622
             +          ++ GL D  T+             G+P P   W K+ KA+       L 
Sbjct: 26538 KAPEPISSKPVIVTGLQD-TTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLS 26596

Query: 1623  FEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV-FIPEEEARMAALE 1676
              + G   +  I+   T+DSG Y   VKN  GS +S   +++  I + EA+  + +
Sbjct: 26597 EDKG-GFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQ 26650



 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 93/428 (21%), Positives = 159/428 (37%), Gaps = 58/428 (13%)

Query: 1039  PGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNV 1098
             PGP   L  S V ++   L W  P   G   +T Y V+ +E       W  +        
Sbjct: 22836 PGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLN--WVIVEGECPTLS 22893

Query: 1099  YLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA--------------ETRPGTKEV 1144
             Y+  R +K    Y+FRVRA+N+ G G P + + P+VA              E   G + +
Sbjct: 22894 YVVTRLIKNN-EYIFRVRAVNKYGPGVPVE-SEPIVARNSFTIPSPPGIPEEVGTGKEHI 22951

Query: 1145  VVN----VDDDGVISLNFECDKMTPKSEFSWS---KDYVSTEDSPRLEVESKGNKTKMTF 1197
             ++       D G    N+  DK   KS   W+   KDYV  +            + K+T 
Sbjct: 22952 IIQWTKPESDGGNEISNYLVDKREKKS-LRWTRVNKDYVVYD-----------TRLKVTS 22999

Query: 1198  KDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEK 1257
                G D    Y   VT  +   +S   +  E    ++   E  +   P  +   V+  + 
Sbjct: 23000 LMEGCD----YQFRVTAVNAAGNS---EPSEASNFISC-REPSYTPGPPSAPRVVDTTKH 23051

Query: 1258  GQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYT 1317
                  W +     G   V Y+   +E      Y++H +      E  +  L+   +  Y+
Sbjct: 23052 SISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQK--YS 23109

Query: 1318  FQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLK 1377
             F++           V V  + +  +  AE +  E I        + L   VT      L+
Sbjct: 23110 FRV---------AAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGASLR 23160

Query: 1378  CKVANIKKETHIV-WYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGK 1436
               V+   +   ++ W K   +++     D  +    L++ + ++ DAG Y +  ++  GK
Sbjct: 23161 LMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGK 23220

Query: 1437  DKSRLKLV 1444
              KS   LV
Sbjct: 23221 -KSATVLV 23227



 Score = 54.7 bits (130), Expect = 8e-07
 Identities = 100/495 (20%), Positives = 186/495 (37%), Gaps = 92/495 (18%)

Query: 1158 FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
            FEC+     ++  W KD    +   + ++ SKG    +      +DD   YSC+V     
Sbjct: 6088 FECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTART 6147

Query: 1218 IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNY 1277
                 +++EE                V  K+   +E+ E   ++   +  K    A+V +
Sbjct: 6148 SGMLTVLEEE---------------AVFTKNLANIEVSETDTIKLVCEVSK--PGAEVIW 6190

Query: 1278 IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQL----QDGKATNHSTVVL 1333
               ++EI E  +Y++  +    I  + ++    ED G Y  +L     DGK   H     
Sbjct: 6191 YKGDEEIIETGRYEILTEGRKRI--LVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAA- 6247

Query: 1334 VGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYK 1393
                             E+I K  P  +E L  E          C ++  K+   + W +
Sbjct: 6248 -----------------EFISK--PQNLEILEGE-----KAEFVCSIS--KESFPVQWKR 6281

Query: 1394 DEREISVDEKHD-FKDG-ICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKEL 1451
            D++ +   +K+D   DG    L++ + + +D G Y V++   R    + L ++++     
Sbjct: 6282 DDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARA--AAHLTVIEKL---- 6335

Query: 1452 MMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTG 1511
                  +I +   D +++   E +      T   E  K  W  N  AI  S +       
Sbjct: 6336 ------RIVVPLKDTRVKEQQEVVFNCEVNT---EGAKAKWFRNEEAIFDSSKYIILQKD 6386

Query: 1512 EQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAA--IAEK 1569
                L+I +   +D+  Y + L    T H+                 + +K AA  I E+
Sbjct: 6387 LVYTLRIRDAHLDDQANYNVSL----TNHRG----------------ENVKSAANLIVEE 6426

Query: 1570 NRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTA 1629
               R++  L D+ T+ E K++   C V       + W KN + +  D+  + + +  +  
Sbjct: 6427 EDLRIVEPLKDIETM-EKKSVTFWCKV-NRLNVTLKWTKNGEEVPFDNRVSYRVDKYK-H 6483

Query: 1630 YFTINGVSTADSGKY 1644
              TI      D G+Y
Sbjct: 6484 MLTIKDCGFPDEGEY 6498



 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1637
             +P+ +TI+ GK L +  +V+G P P   W K E  + +  H  +  +A  ++   I  V+
Sbjct: 12599 MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAV-HKADSSSILIIKDVT 12657

Query: 1638  TADSGKYGLVVKNKYGSETSDFTVSV 1663
               DSG Y L  +N  G++T    V V
Sbjct: 12658 RKDSGYYSLTAENSSGTDTQKIKVVV 12683



 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 44/192 (22%), Positives = 83/192 (43%), Gaps = 30/192 (15%)

Query: 180   TSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKK 239
             T   + +S + T+  ++++S +   S Q T +R+S +S +   S +  SA  +E++ E  
Sbjct: 26186 TEAYAVSSFKKTSEMEASSSVREVKS-QMTETRESLSSYEHSASAEMKSAALEEKSLE-- 26242

Query: 240   SRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCS 299
                    EK+    ++ TL                 A   + KPRS TV+E E+ +  C 
Sbjct: 26243 -------EKSTTRKIKTTL-----------------AARILTKPRSMTVYEGESARFSCD 26278

Query: 300   IAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKG 359
               G P P VTW +    ++  A   ++ + +     T EI+     D   Y     N +G
Sbjct: 26279 TDGEPVPTVTWLRKGQVLSTSA---RHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEG 26335

Query: 360   ELSAYASVVVKR 371
             +  A  ++ +++
Sbjct: 26336 KQEAEFTLTIQK 26347



 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 1/84 (1%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             D +TI+ G+A  LT    G P P+VSW K+E  +  DD  ++K      A   I     +
Sbjct: 10521 DKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIK-AKRS 10579

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
             DSGKY +VV+N  GS      V+V
Sbjct: 10580 DSGKYCVVVENSTGSRKGFCQVNV 10603



 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 47/166 (28%), Positives = 72/166 (43%), Gaps = 9/166 (5%)

Query: 1503  DRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQ--- 1559
             +R      G+  WL+ N    +D    V  L +G T   + +  +        +E     
Sbjct: 22671 ERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPV 22730

Query: 1560  --RLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDD 1617
               R + A    +  AR+ G   D+VTI+ G  L L   V G P P++ W K +K L   +
Sbjct: 22731 TCRDEYAPPKAELDARLHG---DLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCE 22787

Query: 1618  HCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
               +L++  G+ A   I     +DSGKY L VKN  G++     V V
Sbjct: 22788 KVSLQY-TGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKV 22832



 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 78/375 (20%), Positives = 132/375 (35%), Gaps = 84/375 (22%)

Query: 184  STASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKV 243
            +T +K+    K++         ++S   R     R      +A +A++ +   + +S + 
Sbjct: 1924 TTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEE 1983

Query: 244  VIREKAERLSLRKTLEETETYHAKLNEDHLL----------------HAPEFIIKPRSHT 287
            ++R+  + L L  T E TE     L E+  +                 AP+   + +S T
Sbjct: 1984 LLRKTKDEL-LHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQT 2042

Query: 288  VWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDT 347
            V +  +      + G P+P   WYKN V I        Y  E    +  L I     ED+
Sbjct: 2043 VGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPED--NVCELVIRDVTAEDS 2100

Query: 348  AQYRASAMNVKGELSAYASVVVKRYK-------------GEFDETRFHAGASTMPLSFGV 394
            A     A+N+ GE S++A ++V+  +              E D        ++ P    V
Sbjct: 2101 ASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPF---V 2157

Query: 395  TPYGYASRFEIHFDDKFDVSFGR-----------------------EGETMSLGCRVVIT 431
                Y    E+H  DK+ +   R                       E E +    ++++ 
Sbjct: 2158 KVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVE 2217

Query: 432  PEIKHFQPEIQ------------------------WYRNGVPL-SPSKWVQTLWSGERAT 466
              +  F  E+Q                        WY N V L S  K+  T   G R  
Sbjct: 2218 GAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRG-RQN 2276

Query: 467  LTFSHLNKEDEGLYT 481
            LT   + KED+G Y+
Sbjct: 2277 LTVKDVTKEDQGEYS 2291



 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 59/299 (19%), Positives = 114/299 (38%), Gaps = 36/299 (12%)

Query: 1373  NVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDG--ICTLLITEFSKKDAGIYEVIL 1430
             NVL  C+++  +    I W+K+   IS+           + +L I   S  D+G Y +  
Sbjct: 26845 NVLFTCEISG-EPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKA 26903

Query: 1431  KDDRGKDKSR-----LKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYV 1485
             K+ RG+  +      L LV+E  +E+++          T L+   +++ +Q+ +      
Sbjct: 26904 KNFRGQCSATASLMVLPLVEEPSREVVLRTS-----GDTSLQGSFSSQSVQMSAS----- 26953

Query: 1486  EDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVD 1545
                        S   +S    + +T  +      +   + +  +V        G      
Sbjct: 26954 -------KQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQ 27006

Query: 1546  LSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVS 1605
             L             ++ +A I  +     +  LP  ++I EGK L + C   G+P PEV+
Sbjct: 27007 LESST--------SKMLKAGI--RGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVT 27056

Query: 1606  WLKNEKALASDDHCNLKFE-AGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
             W    + + S +      E         I  V   D G Y L + N++GS+++   + +
Sbjct: 27057 WSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 27115



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 42/157 (26%), Positives = 69/157 (43%), Gaps = 20/157 (12%)

Query: 217  SRQS-VVSKQATSALQQEETSEK---KSRKVVIREKAERLSLRKTLEETETYHAKLNEDH 272
            SR S +++ +AT+    + TS     K  K ++ E+++    RK L+  E      +E  
Sbjct: 1723 SRDSGIITCRATNKYGTDHTSATLIVKDEKSLV-EESQLPEGRKGLQRIEELERMAHEGA 1781

Query: 273  LL---------HAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANP 323
            L            P+ ++ P    V E E  +  C + G+P+P+V WY N   I      
Sbjct: 1782 LTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKR- 1840

Query: 324  GKYIIESRY-GMHTLEINGCDFEDTAQYRASAMNVKG 359
                   RY G+H L+I  C   DT + + +A N +G
Sbjct: 1841 ----FRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEG 1873



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 93/463 (20%), Positives = 166/463 (35%), Gaps = 72/463 (15%)

Query: 1114 RVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSK 1173
            RV A+  +   K + L G        G  +    V+ D VI    +C+     +   W K
Sbjct: 5694 RVEAMGMSSEAKLTVLEGDPYFT---GKLQDYTGVEKDEVI---LQCEISKADAPVKWFK 5747

Query: 1174 DYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLL 1233
            D    + S    +++ G K  +  K     D+G Y+CD   TD  +    I++ E+K + 
Sbjct: 5748 DGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCD-CGTDKTSGKLDIEDREIKLVR 5806

Query: 1234 ALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMH 1293
             L               +VE++E    RF  + E    +   N+    + + + P     
Sbjct: 5807 PLH--------------SVEVMETETARF--ETEISEDDIHANWKLKGEALLQTP--DCE 5848

Query: 1294 IDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTV-VLVGDVFKKLQKEAEFQRQEW 1352
            I     I  + +   + +  G   FQ  + K++ H  V   V  + + L+          
Sbjct: 5849 IKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVT------- 5901

Query: 1353 IRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICT 1412
                           VT        C+++   ++  + WY   +++   +K         
Sbjct: 5902 ---------------VTAGETATFDCELS--YEDIPVEWYLKGKKLEPSDK--------- 5935

Query: 1413 LLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSAT-DLKIQST 1471
                   + +  ++ + L+D + +D   ++L  + FK       K+  +  T  L+ Q+ 
Sbjct: 5936 ----VVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKPLEDQTV 5991

Query: 1472 AEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVM 1531
             EG           E+ KV W  NG+ I  S + +    G    L I++ TP D   Y  
Sbjct: 5992 EEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTC 6051

Query: 1532 ELFDGKTGHQKTVDLSGQAYDEAYAEFQR-LKQAAIAEKNRAR 1573
            +  D KT     V          + EF R L    + EK  AR
Sbjct: 6052 DAKDFKTSCNLNV-------VPPHVEFLRPLTDLQVREKEMAR 6087



 Score = 49.3 bits (116), Expect = 3e-05
 Identities = 96/436 (22%), Positives = 168/436 (38%), Gaps = 62/436 (14%)

Query: 1100 LKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFE 1159
            L +R +    S    V+AIN AG             +    T+E+   V  +      FE
Sbjct: 2090 LVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFE 2149

Query: 1160 CDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIA 1219
            C+   P  +  W KD +   +  +  + S      ++   +   D   YSC + + + + 
Sbjct: 2150 CETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVK 2209

Query: 1220 SSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILE--KGQVRFWMQAEKLSGNAKVNY 1277
            ++         +L+      +F    VK    +E+ E   G++   +  E + G     +
Sbjct: 2210 TT--------AKLIVEGAVVEF----VKELQDIEVPESYSGELECIVSPENIEG----KW 2253

Query: 1278 IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDV 1337
              N+ E+    KY   I    G   + ++ +  ED+G Y+F + DGK T           
Sbjct: 2254 YHNDVELKSNGKYT--ITSRRGRQNLTVKDVTKEDQGEYSFVI-DGKKTT---------- 2300

Query: 1338 FKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVL-LKCKVANIKKETHIVWYKDER 1396
              KL+          ++ +    ++ LS +   E +++ L+ KV+   +    VW KD +
Sbjct: 2301 -CKLK----------MKPRPIAILQGLSDQKVCEGDIVQLEVKVS--LESVEGVWMKDGQ 2347

Query: 1397 EIS-VDEKHDFKDGIC-TLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMME 1454
            E+   D  H   D     LLI + +K+DAG Y   +         R+ +         ++
Sbjct: 2348 EVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYS-------VD 2400

Query: 1455 VCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDL-KVNWSHNGSAIRYSDRVKTGVTGEQ 1513
            V        T LK  +  EG +        V D+  V W  N   I+  DRV+  V G +
Sbjct: 2401 V-------ITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTK 2453

Query: 1514 IWLQINEPTPNDKGKY 1529
              L IN    +D+G Y
Sbjct: 2454 QRLVINRTHASDEGPY 2469



 Score = 48.9 bits (115), Expect = 4e-05
 Identities = 115/564 (20%), Positives = 203/564 (35%), Gaps = 88/564 (15%)

Query: 1090 LNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVD 1149
            L E   + + ++   L++  +Y  R+ +    G  K  +LA   ++  +P   E++    
Sbjct: 6206 LTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFIS--KPQNLEILEGEK 6263

Query: 1150 DDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYS 1209
             + V S++ E   +       W +D  + E   + +V + G K  +  KD  + D+G Y 
Sbjct: 6264 AEFVCSISKESFPV------QWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYV 6317

Query: 1210 CDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKL 1269
              V      A   +I++  +              VP+K      + E+ +V F    E  
Sbjct: 6318 VMVGAARAAAHLTVIEKLRI-------------VVPLKD---TRVKEQQEVVF--NCEVN 6359

Query: 1270 SGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHS 1329
            +  AK  +  NE+ IF+  KY   I +   +  + +     +D+  Y   L + +  N  
Sbjct: 6360 TEGAKAKWFRNEEAIFDSSKYI--ILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVK 6417

Query: 1330 TVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHI 1389
            +   +    + L+     +  E + K+   F     W      NV LK            
Sbjct: 6418 SAANLIVEEEDLRIVEPLKDIETMEKKSVTF-----WCKVNRLNVTLK------------ 6460

Query: 1390 VWYKDEREISVDEKHDFKDGICTLLIT--EFSKKDAGIYEVILKDDRGKDKSRLKLVDEA 1447
             W K+  E+  D +  ++      ++T  +    D G Y V      G+DKS  +L    
Sbjct: 6461 -WTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTA----GQDKSVAEL---- 6511

Query: 1448 FKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKT 1507
               L++E   +      D   Q+  E            E   V W  NG  I+   + K 
Sbjct: 6512 ---LIIEAPTEFVEHLED---QTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKF 6565

Query: 1508 GVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIA 1567
               G    L I +   +D+ +Y   + D K+  +  V       +E   E  R  Q  + 
Sbjct: 6566 EKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFV-------EEIPVEIIRPPQDILE 6618

Query: 1568 EKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGR 1627
                        DVV + E   LN           EV WL+N   +   D   +  E G+
Sbjct: 6619 APG--------ADVVFLAE---LN-------KDKVEVQWLRNNMVVVQGDKHQMMSE-GK 6659

Query: 1628 TAYFTINGVSTADSGKYGLVVKNK 1651
                 I  +   D G+Y  + K+K
Sbjct: 6660 IHRLQICDIKPRDQGEYRFIAKDK 6683



 Score = 48.9 bits (115), Expect = 4e-05
 Identities = 44/200 (22%), Positives = 83/200 (41%), Gaps = 11/200 (5%)

Query: 1484  YVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKT 1543
             Y +  +V W      +  S++ +         L + + T  D G Y  ++ +        
Sbjct: 25289 YDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSY 25348

Query: 1544  VDLSGQAYDEAYAEFQRLKQAAIAEK-NRARVLGGLPDVV------TIQEGKALNLTCNV 1596
              +L  +   E Y  + R     I  + +  R+L   P+        T   G+ +     +
Sbjct: 25349 AELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTI 25408

Query: 1597  WGDPPPEVSWLKN-EKALASDDHCNLKFEAGRTAY-FTINGVSTADSGKYGLVVKNKYGS 1654
                P P V+W K+ +K    D+     FE+ +  Y  TIN V+T D  +Y +V +NKYG 
Sbjct: 25409 TVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGE 25468

Query: 1655  ET--SDFTVSVFIPEEEARM 1672
             ++  +  TV++  P  ++ +
Sbjct: 25469 DSCKAKLTVTLHPPPTDSTL 25488



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 49/207 (23%), Positives = 79/207 (38%), Gaps = 35/207 (16%)

Query: 276 APEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMH 335
           AP F    +S  V E         I+G+P P V+W+++   I+    PG  I  S  G  
Sbjct: 5   APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD-GRA 63

Query: 336 TLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVT 395
            L I      ++ +Y   A N  G+ ++ A ++VK              A T P      
Sbjct: 64  KLTIPAVTKANSGRYSLKATNGSGQATSTAELLVK--------------AETAP------ 103

Query: 396 PYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKW 455
                     +F  +      R+G  + L  RV   P      P +++YR+G  +  S  
Sbjct: 104 ---------PNFVQRLQSMTVRQGSQVRLQVRVTGIP-----TPVVKFYRDGAEIQSSLD 149

Query: 456 VQTLWSGERATLTFSHLNKEDEGLYTI 482
            Q    G+  +L  +    ED G Y++
Sbjct: 150 FQISQEGDLYSLLIAEAYPEDSGTYSV 176



 Score = 48.1 bits (113), Expect = 7e-05
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query: 1575  LGGLPDVVTI-QEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTI 1633
             L GLPD+  + +E     L   + G P P VSW K E  LA+D   +++  A  T    +
Sbjct: 13679 LKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTT-LIV 13737

Query: 1634  NGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
                  +D+GKY + +KN  G++    ++ V
Sbjct: 13738 YDCQKSDAGKYTITLKNVAGTKEGTISIKV 13767



 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 112/499 (22%), Positives = 178/499 (35%), Gaps = 92/499 (18%)

Query: 1158 FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
            FEC+       F W K         R E+   G K  M  K    +D   Y  +  D   
Sbjct: 5554 FECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKH- 5612

Query: 1218 IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNY 1277
             +   +I+   LK L            P+K    V   EK    F    E    N +V +
Sbjct: 5613 TSGKLIIEGIRLKFL-----------TPLKD---VTAKEKESAVF--TVELSHDNIRVKW 5656

Query: 1278 IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDV 1337
              N++ +       M  +  T  I    + L  +D      +   G ++     VL GD 
Sbjct: 5657 FKNDQRLHTTRSVSMQDEGKTHSIT--FKDLSIDDTSQIRVEAM-GMSSEAKLTVLEGDP 5713

Query: 1338 F--KKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDE 1395
            +   KLQ     ++ E                      V+L+C+++  K +  + W+KD 
Sbjct: 5714 YFTGKLQDYTGVEKDE----------------------VILQCEIS--KADAPVKWFKDG 5749

Query: 1396 REISVDEKHDFK-DGICTLLITEFS-KKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMM 1453
            +EI   +    K DG   +LI + + K D G Y      D G DK+  KL D   +E+  
Sbjct: 5750 KEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC----DCGTDKTSGKL-DIEDREI-- 5802

Query: 1454 EVCKKIALSATDLKIQSTAEGIQLYSFVTYYVE-DLKVNWSHNGSAIRYSDRVKTGVTGE 1512
                K+      +++  T    +   F T   E D+  NW   G A+             
Sbjct: 5803 ----KLVRPLHSVEVMET----ETARFETEISEDDIHANWKLKGEAL------------- 5841

Query: 1513 QIWLQINEPTPNDKGK-YVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNR 1571
               LQ  +    ++GK + + L + +      VD   QA +   +   R+K   I     
Sbjct: 5842 ---LQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDF--QAANVKSSAHLRVKPRVIG---- 5892

Query: 1572 ARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYF 1631
              +L  L D VT+  G+     C +  +  P V W    K L   D    + E G+    
Sbjct: 5893 --LLRPLKD-VTVTAGETATFDCELSYEDIP-VEWYLKGKKLEPSDKVVPRSE-GKVHTL 5947

Query: 1632 TINGVSTADSGKYGLVVKN 1650
            T+  V   D+G+  L  K+
Sbjct: 5948 TLRDVKLEDAGEVQLTAKD 5966



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 2/95 (2%)

Query: 1582  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADS 1641
             V  + G+ + +     G PPP V+W K+EK L SD   +++     ++  TI  V+  D+
Sbjct: 20976 VIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIE-NTDSSSLLTIPQVTRNDT 21034

Query: 1642  GKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALE 1676
             GKY L ++N  G E    TVSV + +  A    L+
Sbjct: 21035 GKYILTIENGVG-EPKSSTVSVKVLDTPAACQKLQ 21068



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 7/122 (5%)

Query: 1544  VDLSGQA-YDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPP 1602
             V++ G + Y E+ AE + +++  I +   A     L   VTI+ G +L L  +V G PPP
Sbjct: 23115 VNVKGMSEYSESIAEIEPVERIEIPDLELA---DDLKKTVTIRAGASLRLMVSVSGRPPP 23171

Query: 1603  EVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVS 1662
              ++W K    LAS    +        +   ++ V+  D+GKY +  +N+ G +++   V 
Sbjct: 23172 VITWSKQGIDLASRAIID---TTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVK 23228

Query: 1663  VF 1664
             V+
Sbjct: 23229 VY 23230



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 152/790 (19%), Positives = 286/790 (36%), Gaps = 153/790 (19%)

Query: 997  KISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLV 1056
            KIS  K    Y+  +A   +A L     +S     ++ T +V  P  ++K SE R     
Sbjct: 774  KISVPKTEHGYEASIAGSAIATL--QKELSATSSAQKITKSVKAP--TVKPSETR----- 824

Query: 1057 LQWKPPVHSGRTPVTGY-FVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRV 1115
                  V +  TP+  + F D  +    E       E  +      VR  +  V +    
Sbjct: 825  ------VRAEPTPLPQFPFADTPDTYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREA 878

Query: 1116 RAINQAGVGKPSDLAGPVVAETR-PGTKEVVVNVDDDGVISLNFECD-KMTPKSEFSWSK 1173
            +    A V  P ++  PV   T   G K V V   +    S+  EC     P    +W +
Sbjct: 879  KVTETARVPAPVEI--PVTPPTLVSGLKNVTVIEGE----SVTLECHISGYPSPTVTWYR 932

Query: 1174 DYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS--YL---IDEE- 1227
            +    E S   ++  +    ++  ++   +D G ++C   +  G  S+  YL   + EE 
Sbjct: 933  EDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEF 992

Query: 1228 -------------ELKRLL----------ALSHEHKFPTVP-----VKSELAVEILEKGQ 1259
                         E KR +          +L+ E   P  P     +   +  +++E G 
Sbjct: 993  EKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGS 1052

Query: 1260 VRFWMQAEKLSGNAKVNYIFNEKEI--FEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYT 1317
            V F  Q   + GN K +  + +  +    G +YK+  ++ TG  ++ +     +D G YT
Sbjct: 1053 VVFGCQ---VGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYT 1109

Query: 1318 FQLQDGKATNHSTVVLVGD----VFKKLQKEAEFQRQEWIRKQGPHFVE------YLSWE 1367
              +++      ++  L+ +    +  K Q+E  +Q Q     Q P   E      Y  +E
Sbjct: 1110 IVVRNKHGETSASASLLEEADYELLMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYE 1169

Query: 1368 VTGECN-VLLKCKVANIKKETHIV-WYKDEREISVDEKHDFKDGICTLLITEFSKKDAGI 1425
               E    L++ K+A   K+T +V  Y +++E  +     F++ +   +     K     
Sbjct: 1170 KEYEKEQALIRKKMA---KDTVVVRTYVEDQEFHISS---FEERLIKEIEYRIIKTTL-- 1221

Query: 1426 YEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQS----TAEGIQLYSFV 1481
             E +L++D G++K  + + +    E           S  D +I++       G+  +  +
Sbjct: 1222 -EELLEED-GEEKMAVDISESEAVE-----------SGFDSRIKNYRILEGMGVTFHCKM 1268

Query: 1482 TYYVEDLKVNWSHNGSAIRYSDRVKTGVTGE-QIWLQINEPTPNDKGKYVM--------E 1532
            + Y    K+ W  +G  I++ +R +     + +  L+I    P D+G Y           
Sbjct: 1269 SGYPLP-KIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNA 1327

Query: 1533 LFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNR--------------------- 1571
            +  GK   +    L    Y        R++  +    +R                     
Sbjct: 1328 ICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMS 1387

Query: 1572 -ARVLGGL---------------------PDVVTIQEGKALNLTCNVWGDPPPEVSWLKN 1609
             AR+  G                      P      EG+       V G P PE  W  +
Sbjct: 1388 PARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHD 1447

Query: 1610 EKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEE 1669
             + + +D    +  +   T    I   + +DSG++ +V +N+ G  +    ++V   E +
Sbjct: 1448 GQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQ 1507

Query: 1670 ARMAALESLK 1679
             +   +E LK
Sbjct: 1508 VKPMFVEKLK 1517



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 41/205 (20%), Positives = 77/205 (37%), Gaps = 33/205 (16%)

Query: 1358  PHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFK---DGICTLL 1414
             P   ++L  E + E   L     +++ +   + WYKD +++  +    F    DG   L 
Sbjct: 26413 PKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELK 26472

Query: 1415  ITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTA-- 1472
             I   ++ D G Y   +  + G  K+ L+ + +AFK +  +V K      +D K   +   
Sbjct: 26473 INNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVT 26532

Query: 1473  --------EGIQLYSFVTYYVEDLKVN--------------------WSHNGSAIRYSDR 1504
                     E I     +   ++D  V+                    W+ +G AI    +
Sbjct: 26533 RKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGK 26592

Query: 1505  VKTGVTGEQIWLQINEPTPNDKGKY 1529
              K        +L+I++   +D G Y
Sbjct: 26593 YKLSEDKGGFFLEIHKTDTSDSGLY 26617



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 64/306 (20%), Positives = 122/306 (39%), Gaps = 34/306 (11%)

Query: 184   STASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKV 243
             S++ K T  + + T +++ +  K S  + Q  A  Q  +S++A  + + + +  K   K+
Sbjct: 26629 SSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKL 26688

Query: 244   VIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGW 303
              ++E+A ++ +    EE +   A   E  ++H  E I K    T    E V+ H  I   
Sbjct: 26689 ALKEEASKVLIS---EEVKKSAATSLEKSIVH--EEITK----TSQASEEVRTHAEIKA- 26738

Query: 304   PEPRVTWYKNQVPINVHANPGKYIIESRYGMHT---LEINGCDFEDTAQYRASAMNVKGE 360
                    +  Q+ IN      + ++++     T     +NG +  ++ +YR         
Sbjct: 26739 -------FSTQMSIN---EGQRLVLKANIAGATDVKWVLNGVELTNSEEYRYG------- 26781

Query: 361   LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGE 420
             +S     +  +     DE      + T     G+    Y         D          +
Sbjct: 26782 VSGSDQTLTIKQASHRDEGILTCISKTKE---GIVKCQYDLTLSKELSDAPAFISQPRSQ 26838

Query: 421   TMSLGCRVVITPEIK-HFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGL 479
              ++ G  V+ T EI     PEI+W++N +P+S S  V    S    +L   + +  D G 
Sbjct: 26839 NINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGK 26898

Query: 480   YTIRVR 485
             YTI+ +
Sbjct: 26899 YTIKAK 26904



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 46/190 (24%), Positives = 78/190 (41%), Gaps = 28/190 (14%)

Query: 1492 WSHNGSAI--RYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQ 1549
            W H+G  I   Y+ +V     G Q  L I   TP+D G++ +   +       +V L+ +
Sbjct: 1444 WFHDGQQIVNDYTHKVVIKEDGTQS-LIIVPATPSDSGEWTVVAQNRAGRSSISVILTVE 1502

Query: 1550 AYDEAYAEF--QRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWL 1607
            A +        ++LK                   V I+EG  L +     G+P P++ WL
Sbjct: 1503 AVEHQVKPMFVEKLKN------------------VNIKEGSRLEMKVRATGNPNPDIVWL 1544

Query: 1608 KNEKALASDDHCNLKFEAGR-TAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFI- 1665
            KN   +    +  ++ E  +  A   I+   + DS  Y     NK G +T+   V+V + 
Sbjct: 1545 KNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVE 1604

Query: 1666 ---PEEEARM 1672
               PE E ++
Sbjct: 1605 FAEPEPERKL 1614



 Score = 44.7 bits (104), Expect = 8e-04
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 5/91 (5%)

Query: 1582 VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASD--DHCNLKFEAGRTAYFTINGVSTA 1639
            V + EG       ++ G P PEVSW ++ + +++       + F  GR A  TI  V+ A
Sbjct: 15   VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR-AKLTIPAVTKA 73

Query: 1640 DSGKYGLVVKNKYGSETSDFTVSVFIPEEEA 1670
            +SG+Y L   N  G  TS  T  + +  E A
Sbjct: 74   NSGRYSLKATNGSGQATS--TAELLVKAETA 102



 Score = 44.7 bits (104), Expect = 8e-04
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             DV+T++ G+ + +   V G P P+++W K  K L  +   +L  +  R     I     A
Sbjct: 11611 DVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVE-LQIKEAVRA 11669

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
             D GKY +  KN  G       V+V
Sbjct: 11670 DHGKYIISAKNSSGHAQGSAIVNV 11693



 Score = 44.7 bits (104), Expect = 8e-04
 Identities = 29/86 (33%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1637
             L  VV ++    L L   + G P PEV W K E  L   D   ++  +  T    I+ V+
Sbjct: 18808 LRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT--DRAQIEVTSSFTM-LVIDNVT 18864

Query: 1638  TADSGKYGLVVKNKYGSETSDFTVSV 1663
               DSG+Y L ++N  GS+T+   V V
Sbjct: 18865 RFDSGRYNLTLENNSGSKTAFVNVRV 18890



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 56/255 (21%), Positives = 97/255 (38%), Gaps = 41/255 (16%)

Query: 238  KKSRKVVIREKAERLSLRKTLEETE---TYHAKLNEDHLL------HAPEFIIKPRSHTV 288
            ++  K V+  +  R+ + +T +      T+ A  N   +         P+ + + +  TV
Sbjct: 3145 QERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTV 3204

Query: 289  WEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTA 348
               +  +    I+G P+P+++WYK +  ++      K++ + +   +TL +     ED A
Sbjct: 3205 QSGKPARFCAVISGRPQPKISWYKEEQLLST-GFKCKFLHDGQ--EYTLLLIEAFPEDAA 3261

Query: 349  QYRASAMNVKG--ELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIH 406
             Y   A N  G    SA  SV V        E   +  A   PL   VT  G  +RF+  
Sbjct: 3262 VYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQ-- 3319

Query: 407  FDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERAT 466
                               CRV  T        ++ WY     + PS++ +     +   
Sbjct: 3320 -------------------CRVSGT------DLKVSWYSKDKKIKPSRFFRMTQFEDTYQ 3354

Query: 467  LTFSHLNKEDEGLYT 481
            L  +    EDEG YT
Sbjct: 3355 LEIAEAYPEDEGTYT 3369



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 83/367 (22%), Positives = 145/367 (39%), Gaps = 60/367 (16%)

Query: 1181 SPRLEVESKGNKTKMTFKDLGMDDLG--IYSCDVTDTDGIASSYLIDEEELKRLLALSHE 1238
            SP  E++++G K  +T   + +D  G  +Y      T  I +   + E EL         
Sbjct: 5134 SPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILT---VKEIELDF------- 5183

Query: 1239 HKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNT 1298
                 VP+K    V + E+ Q RF      L+  A V +      I    K+ +  D   
Sbjct: 5184 ----AVPLKD---VTVPERRQARFECV---LTREANVIWSKGPDIIKSSDKFDIIADGKK 5233

Query: 1299 GIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGP 1358
             I+   +   Q +DEG YT +++ GK T  S  + V  +  K     E Q  +       
Sbjct: 5234 HIL--VINDSQFDDEGVYTAEVE-GKKT--SARLFVTGIRLKFMSPLEDQTVK------- 5281

Query: 1359 HFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEF 1418
                       GE    + C++++ K   H+VW+K++ ++             T+LI+  
Sbjct: 5282 ----------EGETATFV-CELSHEKM--HVVWFKNDAKLHTSR---------TVLISSE 5319

Query: 1419 SKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLY 1478
             K      + +  DD  + K+++K +    +  ++E      +   D K     + I L 
Sbjct: 5320 GKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHD-KTAVEKDEITLK 5378

Query: 1479 SFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKT 1538
              V+   +D+ V W  +G  I  S +      G +  L+I +    DKG+YV +    KT
Sbjct: 5379 CEVS---KDVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKT 5435

Query: 1539 GHQKTVD 1545
                TV+
Sbjct: 5436 KANVTVE 5442



 Score = 43.5 bits (101), Expect = 0.002
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEA-GRTAYFTINGV 1636
             L  V+T++ G  + L   V G P PEV+W K++ A        +K +    ++ F++   
Sbjct: 11902 LSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKA 11961

Query: 1637  STADSGKYGLVVKNKYGSETSDFTVSV 1663
               +D GKY +   N  GS  +  TV+V
Sbjct: 11962 KRSDGGKYVVTATNTAGSFVAYATVNV 11988



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 30/116 (25%), Positives = 51/116 (43%), Gaps = 5/116 (4%)

Query: 1552  DEAYAEFQRLKQAAIAEKNR----ARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWL 1607
             D  Y+E +    + I ++ +    A + G    ++T + G    +   + G P P+V+W 
Sbjct: 22318 DAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWK 22377

Query: 1608  KNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
               E  L   D  ++     RT   T+      DSG+Y L ++N  G +T   TV V
Sbjct: 22378 LEEMRLKETDRVSITTTKDRTT-LTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVV 22432



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 22/84 (26%), Positives = 35/84 (41%), Gaps = 1/84 (1%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             D + +  G+   L  +V G P P + WL+ +K +     C +K      A   +      
Sbjct: 17328 DTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIK-NTDFKALLIVKDAIRI 17386

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
             D G+Y L   N  GS++    V V
Sbjct: 17387 DGGQYILRASNVAGSKSFPVNVKV 17410



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 1/94 (1%)

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
            P F+ K ++  + E   +++     G P P + W KN   I  H  P K  IE   G   
Sbjct: 1510 PMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYP-KIRIEGTKGEAA 1568

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
            L+I+    +D+A Y A+A+N  G  +    V V+
Sbjct: 1569 LKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVE 1602



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 66/302 (21%), Positives = 111/302 (36%), Gaps = 30/302 (9%)

Query: 224  KQATSALQQEETSEKKSRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKP 283
            K+ +S+    E     S ++ + +  E L L   L E+  Y  K + +     P FI + 
Sbjct: 3599 KEFSSSFLSAEEEGLHSAELQLSKINETLEL---LSESPVYPTKFDSEKEGTGPIFIKEV 3655

Query: 284  RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCD 343
             +  +   +   L  ++ G P+P++ W+ N V +   A+  K++ +     H+L I    
Sbjct: 3656 SNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSAD-YKFVFDG--DDHSLIILFTK 3712

Query: 344  FEDTAQYRASAMNVKGE--LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYAS 401
             ED  +Y   A N  G+   SAY  +  K    +  ET      S   L     P     
Sbjct: 3713 LEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPP----- 3767

Query: 402  RFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWS 461
                HF  +       +G        VV  P      P + W++    L  S +   + +
Sbjct: 3768 ----HFLKELKPIRCAQGLPAIFEYTVVGEP-----APTVTWFKENKQLCTSVYYTIIHN 3818

Query: 462  -GERATLTFSHLNKEDEGLYTIRVR--MGEYYEQYSAYVFVRDAD-----AEIEGAPAAP 513
                 T   +   +ED GLY  +    +GE        V + D D      + +  P AP
Sbjct: 3819 PNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLLEDTDMTDTPCKAKSTPEAP 3878

Query: 514  LD 515
             D
Sbjct: 3879 ED 3880



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 43/211 (20%), Positives = 77/211 (36%), Gaps = 25/211 (11%)

Query: 1468 IQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPND-K 1526
            + + +E   +    T      +VNW      +   ++ K         L I++    D +
Sbjct: 4442 VDTVSEEGDIVHLTTSITNAKEVNWYFENKLVPSDEKFKCLQDQNTYTLVIDKVNTEDHQ 4501

Query: 1527 GKYVMELFD--GKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTI 1584
            G+YV E  +  GKT                 A+   +K+AA   K +   L        +
Sbjct: 4502 GEYVCEALNDSGKTATS--------------AKLTVVKRAAPVIKRKIEPL-------EV 4540

Query: 1585 QEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKY 1644
              G     TC +   P     W K  + +   D C+++  +   +   I      D G+Y
Sbjct: 4541 ALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIR-SSKYISSLEILRTQVVDCGEY 4599

Query: 1645 GLVVKNKYGSETSDFTVSVFIPEEEARMAAL 1675
                 N+YGS +   T++V +P  E ++  L
Sbjct: 4600 TCKASNEYGSVSCTATLTVTVPGGEKKVRKL 4630



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 72/365 (19%), Positives = 133/365 (36%), Gaps = 62/365 (16%)

Query: 124  LSGEEKENLPSDYMVPIFSGRQKHVSGITDTEEERIKE----AAAYIAQRNLLASEEGIT 179
            L G++ E  PSD +VP   G+  H   + D + E   E    A  +    NL   E  + 
Sbjct: 5925 LKGKKLE--PSDKVVPRSEGKV-HTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVE 5981

Query: 180  TSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKK 239
             +K           +  T  + +TA  +   SR++   +      +   + + E  ++ +
Sbjct: 5982 FTKPL---------EDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGR 6032

Query: 240  SRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCS 299
             RK+VI +      ++    + + +    N + +    EF+       V EKE  +  C 
Sbjct: 6033 VRKLVIHDCTPE-DIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFECE 6091

Query: 300  IAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKG 359
            ++     +V W+K+   I       KY I S+  +  L IN C  +D A+Y       + 
Sbjct: 6092 LSR-ENAKVKWFKDGAEIK---KGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTAR- 6146

Query: 360  ELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREG 419
              S   +V+        +E  F    + + +S                          E 
Sbjct: 6147 -TSGMLTVLE-------EEAVFTKNLANIEVS--------------------------ET 6172

Query: 420  ETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGL 479
            +T+ L C      E+     E+ WY+    +  +   + L  G +  L   + + ED G 
Sbjct: 6173 DTIKLVC------EVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGN 6226

Query: 480  YTIRV 484
            Y  R+
Sbjct: 6227 YNCRL 6231



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 26/84 (30%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 1580 DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
            D++ I EG+ L++       P P VSW K+ K + + D   +K +   +A+  +     A
Sbjct: 8090 DIIVI-EGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKND-HISAHLEVPKSVRA 8147

Query: 1640 DSGKYGLVVKNKYGSETSDFTVSV 1663
            D+G Y + ++NK GS T+   V V
Sbjct: 8148 DAGIYTITLENKLGSATASINVKV 8171



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 50/209 (23%), Positives = 82/209 (39%), Gaps = 25/209 (11%)

Query: 286   HTVWEKE-NVKLHCSIAGWPEP-RVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCD 343
             H V E+  +VK  C I  + +  +VTWY     +    N  KY I    G+  L +    
Sbjct: 25271 HAVGEEGGHVKYVCKIENYDQSTQVTWYFG---VRQLENSEKYEITYEDGVAILYVKDIT 25327

Query: 344   FEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASR- 402
               D   YR   +N  GE S+YA + VK  +  +D   ++   +   +           R 
Sbjct: 25328 KLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYD---YYCRRTMKKIKRRTDTMRLLERP 25384

Query: 403   --FEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSP----SKWV 456
               F +   +K        GE +  G  + + PE     P + WY++G  + P     K+ 
Sbjct: 25385 PEFTLPLYNK----TAYVGENVRFGVTITVHPE-----PHVTWYKSGQKIKPGDNDKKYT 25435

Query: 457   QTLWSGERATLTFSHLNKEDEGLYTIRVR 485
                  G    LT + +  +D+  YT+  R
Sbjct: 25436 FESDKG-LYQLTINSVTTDDDAEYTVVAR 25463



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             D + +  G++  +  +++G P P + W+K ++ L++     +K     T+  ++      
Sbjct: 16246 DTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATS-LSVKDAVRV 16304

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
             DSG Y L  KN  G  +    V V
Sbjct: 16305 DSGNYILKAKNVAGERSVTVNVKV 16328



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 29/96 (30%), Positives = 42/96 (43%), Gaps = 5/96 (5%)

Query: 290   EKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQ 349
             E ++V     ++G P P + W K+  P+++   P   II      + L I     EDT  
Sbjct: 25503 EGQSVCFEIRVSGIPPPTLKWEKDGQPLSL--GPNIEIIHEGLDYYALHIRDTLPEDTGY 25560

Query: 350   YRASAMNVKGELSAYASVVVKRY---KGEFDETRFH 382
             YR +A N  G  S  A + V+R    K EF     H
Sbjct: 25561 YRVTATNTAGSTSCQAHLQVERLRYKKQEFKSKEEH 25596



 Score = 41.2 bits (95), Expect = 0.009
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 1/81 (1%)

Query: 1583  TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSG 1642
             +IQ G+ L +   V G P P +SW+K+ + L      N++  A  T      G +  D G
Sbjct: 18017 SIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEG-NKDDFG 18075

Query: 1643  KYGLVVKNKYGSETSDFTVSV 1663
             KY +   N  G+ T + +V V
Sbjct: 18076 KYTVTATNSAGTATENLSVIV 18096



 Score = 40.8 bits (94), Expect = 0.011
 Identities = 40/166 (24%), Positives = 64/166 (38%), Gaps = 21/166 (12%)

Query: 1492 WSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAY 1551
            W  +GS IR S + +    G+   L I +   +D G+Y   L  G      T  L     
Sbjct: 4846 WMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKL----- 4900

Query: 1552 DEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEK 1611
                          + E+   R +  L + VT+ +G+ L L+C +  +   +V W K+ K
Sbjct: 4901 --------------VVEELPVRFVKTLEEEVTVVKGQPLYLSCEL--NKERDVVWRKDGK 4944

Query: 1612 ALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETS 1657
             +       +    G     TIN     D+G Y + V+N    E S
Sbjct: 4945 IVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECS 4990



 Score = 40.8 bits (94), Expect = 0.011
 Identities = 61/309 (19%), Positives = 119/309 (38%), Gaps = 50/309 (16%)

Query: 1143 EVVVNVDDDGVISLN---FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKD 1199
            E V +++D  V   +   F C     K+   W ++    ++  + + E  G+  ++  KD
Sbjct: 6519 EFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKD 6578

Query: 1200 LGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVK-SELAVEILEKG 1258
              +DD   Y+C V D    A  ++ +                  +PV+      +ILE  
Sbjct: 6579 CRLDDECEYACGVEDRKSRARLFVEE------------------IPVEIIRPPQDILEAP 6620

Query: 1259 QVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTF 1318
                   AE      +V ++ N   + +G K++M  +    I  + +  ++  D+G Y F
Sbjct: 6621 GADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGK--IHRLQICDIKPRDQGEYRF 6678

Query: 1319 QLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKC 1378
              +D +A     +     +     K A+   Q+ +   G      + ++           
Sbjct: 6679 IAKDKEARAKLELAAAPKI-----KTAD---QDLVVDVGKPLTMVVPYD----------- 6719

Query: 1379 KVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDK 1438
              A  K E    W+K+   +S  +  D      +  I E  K D G Y+++L++  GK +
Sbjct: 6720 --AYPKAEAE--WFKENEPLST-KTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAE 6774

Query: 1439 S--RLKLVD 1445
                LK++D
Sbjct: 6775 GFINLKVID 6783



 Score = 40.4 bits (93), Expect = 0.015
 Identities = 29/85 (34%), Positives = 37/85 (43%), Gaps = 3/85 (3%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVST- 1638
             D V ++ G+A  L  +V G PPP + W K+ K L       +K     T    +N  ST 
Sbjct: 15164 DTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTN--LVNKDSTR 15221

Query: 1639  ADSGKYGLVVKNKYGSETSDFTVSV 1663
              DSG Y L   N  G     F V V
Sbjct: 15222 RDSGAYTLTATNPGGFAKHIFNVKV 15246



 Score = 40.4 bits (93), Expect = 0.015
 Identities = 36/155 (23%), Positives = 63/155 (40%), Gaps = 16/155 (10%)

Query: 1510  TGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEK 1569
             +G+  W + N+    DK   +  L +         +   + + E      R ++ A++ K
Sbjct: 24167 SGDSAWKKSNKERIKDKQFTIGGLLEA-------TEYEFRVFAENETGLSRPRRTAMSIK 24219

Query: 1570  NRARVLGGLPDV------VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKF 1623
              +    G  P +      VT + G+A  L+C + G P P++ W +  K L       +  
Sbjct: 24220 TKL-TSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSS 24278

Query: 1624  EAGRTAYFTINGVSTADSGKYGLVVKNKYGS-ETS 1657
             + GRT   T+      D G Y  +  N+ G  ETS
Sbjct: 24279 D-GRTHTLTVMTEEQEDEGVYTCIATNEVGEVETS 24312



 Score = 40.0 bits (92), Expect = 0.019
 Identities = 112/546 (20%), Positives = 188/546 (34%), Gaps = 108/546 (19%)

Query: 1110 SYVFRVRAINQAGVGKPSDLAGPVVAETRP-----GTKEVVVNVDDDGVISLNFECDKMT 1164
            +Y F + A+  +  G+ S  +  V+   +      GTK V+             EC    
Sbjct: 2378 NYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVL-------------ECKVSV 2424

Query: 1165 PK-SEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1223
            P  +   W  +    +   R++   KG K ++        D G Y   V     + ++  
Sbjct: 2425 PDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIV---GRVETNCN 2481

Query: 1224 IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1283
            +  E++K +  L       T  V  E  VE+   G    W               F +KE
Sbjct: 2482 LSVEKIKIIRGLRDLTCTETQNVVFE--VELSHSGIDVLWN--------------FKDKE 2525

Query: 1284 IFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQK 1343
            I    KYK  I+ +  I ++ +  +  +DEG YTF   +   +   TV   G + K L  
Sbjct: 2526 IKPSSKYK--IEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVA-GGAISKPLTD 2582

Query: 1344 EAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEK 1403
            +   + QE                       + +C+VAN   ++   W +D + + +   
Sbjct: 2583 QTVAESQE----------------------AVFECEVAN--PDSKGEWLRDGKHLPLTNN 2618

Query: 1404 -HDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALS 1462
                 DG    LI   +K D  I E   K    K  ++LK+  EA          KI  +
Sbjct: 2619 IRSESDGHKRRLIIAATKLD-DIGEYTYKVATSKTSAKLKV--EAV---------KIKKT 2666

Query: 1463 ATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPT 1522
              +L +  T + +         V+   V W  NG  +  +++    V G    L+I    
Sbjct: 2667 LKNLTVTETQDAVFTVELTHPNVKG--VQWIKNGVVLESNEKYAISVKGTIYSLRIKNCA 2724

Query: 1523 PNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVV 1582
              D+  Y   L  G+ G    +                ++   I +K         P  V
Sbjct: 2725 IVDESVYGFRL--GRLGASARL---------------HVETVKIIKK---------PKDV 2758

Query: 1583 TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSG 1642
            T  E   +    +V  D  P V W      +   D   L  E  +     +  +S +D+G
Sbjct: 2759 TALENATVAFEVSVSHDTVP-VKWFHKSVEIKPSDKHRLVSER-KVHKLMLQNISPSDAG 2816

Query: 1643 KYGLVV 1648
            +Y  VV
Sbjct: 2817 EYTAVV 2822



 Score = 40.0 bits (92), Expect = 0.019
 Identities = 29/86 (33%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1637
             L  VVTI+    L L   + G P PEV W ++     S D  +++  +  T    +  V+
Sbjct: 15561 LRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGE--SLDKASIESTSSYTLLI-VGNVN 15617

Query: 1638  TADSGKYGLVVKNKYGSETSDFTVSV 1663
               DSGKY L V+N  GS+++   V V
Sbjct: 15618 RFDSGKYILTVENSSGSKSAFVNVRV 15643



 Score = 40.0 bits (92), Expect = 0.019
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1637
             L  ++ I+ G +L L   + G P PEV W K +  +   D   +   +  T+   ++ V+
Sbjct: 16643 LRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIR--DAAIIDVTSSFTS-LVLDNVN 16699

Query: 1638  TADSGKYGLVVKNKYGSETSDFTVSV 1663
               DSGKY L ++N  G++++  TV V
Sbjct: 16700 RYDSGKYTLTLENSSGTKSAFVTVRV 16725



 Score = 40.0 bits (92), Expect = 0.019
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 7/82 (8%)

Query: 1584  IQEGKALNLTCNVWGDPPPEVSWLKNEK--ALASDDHCNLKFEAGRTAYFTINGVSTADS 1641
             ++ G ++ L     G P P   W K +   +L +D H    F        T+   +  D+
Sbjct: 22064 VRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTTDSFST-----LTVENCNRNDA 22118

Query: 1642  GKYGLVVKNKYGSETSDFTVSV 1663
             GKY L V+N  GS++  FTV V
Sbjct: 22119 GKYTLTVENNSGSKSITFTVKV 22140



 Score = 40.0 bits (92), Expect = 0.019
 Identities = 27/78 (34%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1356  QGPHFVEYL-SWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVD----EKHDFKDGI 1410
             Q PHF E L +  V  + N  L CKV    K   + WY+  +EI  D       +FK G 
Sbjct: 24621 QAPHFKEELRNLNVRYQSNATLVCKVTGHPKPI-VKWYRQGKEIIADGLKYRIQEFKGGY 24679

Query: 1411  CTLLITEFSKKDAGIYEV 1428
               L+I   +  DA +Y+V
Sbjct: 24680 HQLIIASVTDDDATVYQV 24697



 Score = 39.7 bits (91), Expect = 0.025
 Identities = 34/135 (25%), Positives = 52/135 (38%), Gaps = 9/135 (6%)

Query: 245   IREKAERLSL-----RKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENV-KLHC 298
             I EK  ++S      +KT E T T   +      + +   I+     T    ++V K   
Sbjct: 26509 IHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAV 26568

Query: 299   SIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVK 358
                G P P   W K+   I      GKY +    G   LEI+  D  D+  Y  +  N  
Sbjct: 26569 KATGEPRPTAIWTKDGKAIT---QGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSA 26625

Query: 359   GELSAYASVVVKRYK 373
             G +S+   + +K  K
Sbjct: 26626 GSVSSSCKLTIKAIK 26640



 Score = 39.3 bits (90), Expect = 0.033
 Identities = 36/157 (22%), Positives = 63/157 (40%), Gaps = 10/157 (6%)

Query: 1511 GEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKN 1570
            G   W+   EP    K + V  L +GK    +   L+ Q   +     + ++     E  
Sbjct: 7325 GSDKWVACGEPVAETKME-VTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAP 7383

Query: 1571 R----ARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAG 1626
                  ++L GL    T++ G  + L   V G P P+++W K +  L  D    ++    
Sbjct: 7384 EIFLDVKLLAGL----TVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIE-NVP 7438

Query: 1627 RTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
            + +  TI     +D+G Y +   N  G  T+   V+V
Sbjct: 7439 KKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 7475



 Score = 39.3 bits (90), Expect = 0.033
 Identities = 46/191 (24%), Positives = 78/191 (40%), Gaps = 11/191 (5%)

Query: 180   TSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKK 239
             TS Q + S Q   S Q +ASKQ  +    ++S  S+ +     S  A S    +E+  + 
Sbjct: 26937 TSLQGSFSSQ---SVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEM 26993

Query: 240   SRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCS 299
             S    +      +S    LE + +   K     +   P+    P   ++ E + + + C+
Sbjct: 26994 SSSSFMG-----ISNMTQLESSTSKMLKAGIRGI--PPKIEALPSDISIDEGKVLTVACA 27046

Query: 300   IAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKG 359
               G P P VTW      I+     G++ IE+   + TL I     +D   Y  S  N  G
Sbjct: 27047 FTGEPTPEVTWSCGGRKIH-SQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFG 27105

Query: 360   ELSAYASVVVK 370
               SA  ++ ++
Sbjct: 27106 SDSATVNIHIR 27116



 Score = 38.9 bits (89), Expect = 0.043
 Identities = 54/228 (23%), Positives = 97/228 (42%), Gaps = 27/228 (11%)

Query: 144  RQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITTSKQSTASKQT-----TASKQSTA 198
            R KH  G T      ++EA   +    L+ S++ +    Q TA  Q      TA     +
Sbjct: 1113 RNKH--GETSASASLLEEADYEL----LMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYS 1166

Query: 199  SKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKVVIREKAERLSLRKTL 258
              +    K+    R+  A    VV     + ++ +E       + +I+E   R+ ++ TL
Sbjct: 1167 EYEKEYEKEQALIRKKMAKDTVVVR----TYVEDQEFHISSFEERLIKEIEYRI-IKTTL 1221

Query: 259  EET------ETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYK 312
            EE       E     ++E   + +  F  + +++ + E   V  HC ++G+P P++ WYK
Sbjct: 1222 EELLEEDGEEKMAVDISESEAVESG-FDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYK 1280

Query: 313  NQVPINVHANPGKYIIE-SRYGMHTLEINGCDFEDTAQYRASAMNVKG 359
            +   I    +  +Y ++  + G  +L I     ED   Y A A N+KG
Sbjct: 1281 DGKRIK---HGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKG 1325



 Score = 38.9 bits (89), Expect = 0.043
 Identities = 63/315 (20%), Positives = 110/315 (34%), Gaps = 43/315 (13%)

Query: 171  LLASEEGITTSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSA- 229
            +L  +EGI T+  S        S +      +     +        SR   +S ++ S  
Sbjct: 1308 VLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRS 1367

Query: 230  -LQQEETSEKKSRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTV 288
             ++        +R    R    R+S  + LEET+      ++   L+ P F++KP S   
Sbjct: 1368 PIRMSPARMSPARMSPARMSPARMSPGRRLEETDE-----SQLERLYKPVFVLKPVSFKC 1422

Query: 289  WEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTA 348
             E +  +    + G P P   W+ +   I V+    K +I+   G  +L I      D+ 
Sbjct: 1423 LEGQTARFDLKVVGRPMPETFWFHDGQQI-VNDYTHKVVIKED-GTQSLIIVPATPSDSG 1480

Query: 349  QYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFD 408
            ++   A N  G  S    + V+  + +                  V P          F 
Sbjct: 1481 EWTVVAQNRAGRSSISVILTVEAVEHQ------------------VKPM---------FV 1513

Query: 409  DKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGER--AT 466
            +K      +EG  + +  R    P      P+I W +N   + P K+ +    G +  A 
Sbjct: 1514 EKLKNVNIKEGSRLEMKVRATGNP-----NPDIVWLKNSDIIVPHKYPKIRIEGTKGEAA 1568

Query: 467  LTFSHLNKEDEGLYT 481
            L       +D   YT
Sbjct: 1569 LKIDSTVSQDSAWYT 1583



 Score = 38.5 bits (88), Expect = 0.056
 Identities = 76/371 (20%), Positives = 137/371 (36%), Gaps = 83/371 (22%)

Query: 231  QQEETSEKKSRKVVIREKAERLSLRK--TLEETETYHAKLNEDH------LLHAPEFIIK 282
            + ++T E   +  VI +  +R+ + K  TL++  TY   +          ++     ++ 
Sbjct: 6281 RDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIVVP 6340

Query: 283  PRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGC 342
             +   V E++ V  +C +      +  W++N+  I    +  KYII  +  ++TL I   
Sbjct: 6341 LKDTRVKEQQEVVFNCEV-NTEGAKAKWFRNEEAI---FDSSKYIILQKDLVYTLRIRDA 6396

Query: 343  DFEDTAQYRASAMNVKGE-LSAYASVVVKR------------YKGEFDETRFHAGASTMP 389
              +D A Y  S  N +GE + + A+++V+                E     F    + + 
Sbjct: 6397 HLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLN 6456

Query: 390  LSFGVTPYGYASRFEIHFD-------DKF-------DVSFGREGETM-------SLGCRV 428
            ++   T  G     E+ FD       DK+       D  F  EGE +       S+   +
Sbjct: 6457 VTLKWTKNGE----EVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELL 6512

Query: 429  VI---TPEIKHFQPE--------------------IQWYRNGVPLSPSKWVQTLWSGERA 465
            +I   T  ++H + +                    ++WYRNG  +   K  +    G   
Sbjct: 6513 IIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIH 6572

Query: 466  TLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLD------VKCL 519
             L       +DE  Y      G    +  A +FV +   EI   P   L+      V   
Sbjct: 6573 RLIIKDCRLDDECEYA----CGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLA 6628

Query: 520  EANKDYIIISW 530
            E NKD + + W
Sbjct: 6629 ELNKDKVEVQW 6639



 Score = 38.5 bits (88), Expect = 0.056
 Identities = 27/105 (25%), Positives = 47/105 (44%), Gaps = 5/105 (4%)

Query: 1580 DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKAL--ASDDHCNLKFEAGRTAYFTINGVS 1637
            D + ++ G+ +++  +V G P P++ W KNE  +   +D     K E  R+   T   + 
Sbjct: 9101 DTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIP 9160

Query: 1638 TA---DSGKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALESLK 1679
             A   D G Y +   N+ GS   +  V V+      R  A+  +K
Sbjct: 9161 KAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIK 9205



 Score = 38.1 bits (87), Expect = 0.073
 Identities = 27/122 (22%), Positives = 55/122 (45%), Gaps = 7/122 (5%)

Query: 1532 ELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALN 1591
            +L +G+ G Q+  +L   A++ A       ++    EK +  ++   P+ V + EG+   
Sbjct: 1759 QLPEGRKGLQRIEELERMAHEGALTGVTTDQK----EKQKPDIVL-YPEPVRVLEGETAR 1813

Query: 1592 LTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNK 1651
              C V G P P+V+W  N + +       ++++     Y  I    + D+G+  +  +N 
Sbjct: 1814 FRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG--IHYLDIVDCKSYDTGEVKVTAENP 1871

Query: 1652 YG 1653
             G
Sbjct: 1872 EG 1873



 Score = 38.1 bits (87), Expect = 0.073
 Identities = 36/174 (20%), Positives = 69/174 (39%), Gaps = 20/174 (11%)

Query: 1158 FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
            F C+    K    W K+      S  + + S+G   K+  K++ +DD+      V +   
Sbjct: 5288 FVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSS 5347

Query: 1218 IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNY 1277
             A   +++ +             + TV +  + AV   EK ++    +  K   +  V +
Sbjct: 5348 TAQLKVLEAD------------PYFTVKLHDKTAV---EKDEITLKCEVSK---DVPVKW 5389

Query: 1278 IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTV 1331
              + +EI   PKY +  D    I++  ++K   +D+G Y       K   + TV
Sbjct: 5390 FKDGEEIVPSPKYSIKADGLRRILK--IKKADLKDKGEYVCDCGTDKTKANVTV 5441



 Score = 37.7 bits (86), Expect = 0.095
 Identities = 44/193 (22%), Positives = 74/193 (38%), Gaps = 20/193 (10%)

Query: 1489 KVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFD--GKT--GHQKTV 1544
            K+ W  NG  +  S   K    G+   L I      D+G+Y     +  GKT       +
Sbjct: 3679 KIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKI 3738

Query: 1545 DLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGG------LPDVVTIQ--EGKALNLTCNV 1596
            +  G+ + +   E      +A+A+      LGG      L ++  I+  +G        V
Sbjct: 3739 NSKGEGHKDTETE------SAVAKS--LEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTV 3790

Query: 1597 WGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSET 1656
             G+P P V+W K  K L +  +  +      +  F +N     DSG Y    +N  G  T
Sbjct: 3791 VGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGEST 3850

Query: 1657 SDFTVSVFIPEEE 1669
                + V + + +
Sbjct: 3851 CAAELLVLLEDTD 3863



 Score = 37.7 bits (86), Expect = 0.095
 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 1/83 (1%)

Query: 1581  VVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTAD 1640
             +V  + G  + +   V G P P V+W K ++ L      N +  A  T    IN    +D
Sbjct: 14769 LVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATST-ILNINECVRSD 14827

Query: 1641  SGKYGLVVKNKYGSETSDFTVSV 1663
             SG Y L  +N  G      T+ V
Sbjct: 14828 SGPYPLTARNIVGEVGDVITIQV 14850



 Score = 37.7 bits (86), Expect = 0.095
 Identities = 18/77 (23%), Positives = 36/77 (46%)

Query: 1587  GKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGL 1646
             G+ +++     G P P ++W K +  + ++ H  +      T+    NGV   D+G Y +
Sbjct: 24737 GEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVV 24796

Query: 1647  VVKNKYGSETSDFTVSV 1663
               KN++G +     + V
Sbjct: 24797 CAKNRFGIDQKTVELDV 24813



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 21/84 (25%), Positives = 33/84 (39%), Gaps = 3/84 (3%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             D + +  G  + +   V G PPP V+W  NE+ L  +           ++   I     +
Sbjct: 10227 DRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIE---TTAISSSMVIKNCQRS 10283

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
               G Y L+ KN+ G       V V
Sbjct: 10284 HQGVYSLLAKNEAGERKKTIIVDV 10307



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1637
             +  ++T++ G  + L   V+G P P VSW K+   L   +   +  +        +  V+
Sbjct: 12996 MKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQR-NLCTLELFSVN 13054

Query: 1638  TADSGKYGLVVKNKYGSETSDFTVSV 1663
               DSG Y +  +N  GS+++   + V
Sbjct: 13055 RKDSGDYTITAENSSGSKSATIKLKV 13080



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 20/79 (25%), Positives = 35/79 (44%), Gaps = 1/79 (1%)

Query: 1583  TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSG 1642
             ++Q G+ L +   + G P P ++W K+   L      N+      T   +I      D G
Sbjct: 16935 SVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTT-LSIKETHKDDGG 16993

Query: 1643  KYGLVVKNKYGSETSDFTV 1661
             +YG+ V N  G +T+   +
Sbjct: 16994 QYGITVANVVGQKTASIEI 17012



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 3/84 (3%)

Query: 1582  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADS 1641
             + +  G+ + L   + G PPP  SW      L   +   ++    + A  TI   +  D+
Sbjct: 23443 IHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHT-KVAKLTIRETTIRDT 23501

Query: 1642  GKYGLVVKNKYGSETSDFTVSVFI 1665
             G+Y L +KN  G  T+  T+ V I
Sbjct: 23502 GEYTLELKNVTG--TTSETIKVII 23523



 Score = 37.0 bits (84), Expect = 0.16
 Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 8/93 (8%)

Query: 1578 LPDVVTIQEGKALNLTCNVWGDPPPEVSWLK-------NEKALASDDHCNLKFEAGRTAY 1630
            L + + ++EG  +N+   + G P P ++W K       N++ +  D H N K     T  
Sbjct: 9817 LKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVN-KLVVDDTCT 9875

Query: 1631 FTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
              I     +D+G Y +   N  G+ + +  ++V
Sbjct: 9876 LVIPQSRRSDTGLYTITAVNNLGTASKEMRLNV 9908



 Score = 37.0 bits (84), Expect = 0.16
 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 19/86 (22%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKN-----EKA----LASDDHCNLKFEAGRTAY 1630
             DV+ ++ G+ L +  ++ G P P +SW K+     E+A    +++D+H  L         
Sbjct: 19492 DVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLL--------- 19542

Query: 1631  FTINGVSTADSGKYGLVVKNKYGSET 1656
              T+      D+G+Y L +KN  G+ +
Sbjct: 19543 -TVKDCIRRDTGQYVLTLKNVAGTRS 19567



 Score = 36.6 bits (83), Expect = 0.21
 Identities = 99/530 (18%), Positives = 188/530 (35%), Gaps = 110/530 (20%)

Query: 1142 KEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLG 1201
            K++++   +    S  FEC      +  +W KD  +  +SP+    + G   K+   D+ 
Sbjct: 4817 KDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQ 4876

Query: 1202 MDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVP-VKSELAVEILEKGQV 1260
            + D G Y+C                     +L L ++ K  T   V  EL V  ++  + 
Sbjct: 4877 LSDAGEYTC---------------------VLRLGNKEKTSTAKLVVEELPVRFVKTLEE 4915

Query: 1261 RFW-MQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGII--------EMFMEKLQDE 1311
                ++ + L  + ++N    E+++      K+ +++   I+         + +    D 
Sbjct: 4916 EVTVVKGQPLYLSCELN---KERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDT 4972

Query: 1312 DEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGE 1371
            D GTYT  +++      S+ V V +V +           +W+ K            V  +
Sbjct: 4973 DAGTYTVTVENANNLECSSCVKVVEVIR-----------DWLVK------PIRDQHVKPK 5015

Query: 1372 CNVLLKCKVANIKKETHIVWYKDEREISV---DEKHDFKDG-ICTLLITEFSKKDAGIYE 1427
               +  C +A  K   +I W+K   EI     D+    +DG    L I     +D   Y 
Sbjct: 5016 GTAIFACDIA--KDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYA 5073

Query: 1428 VILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLY-----SFVT 1482
            V ++  R                       K+ L   ++++    E + +Y     SF  
Sbjct: 5074 VEIEGKR--------------------YPAKLTLGEREVELLKPIEDVTIYEKESASFDA 5113

Query: 1483 YYVE-DLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQ 1541
               E D+   W   G  +R S   +    G + +L +++   +  G+ + +  +  T   
Sbjct: 5114 EISEADIPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAIT--- 5170

Query: 1542 KTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPP 1601
             T  L+ +  +  +A    LK   + E+ +AR      + V  +E               
Sbjct: 5171 -TAILTVKEIELDFA--VPLKDVTVPERRQARF-----ECVLTREA-------------- 5208

Query: 1602 PEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNK 1651
              V W K    + S D  ++    G+     IN     D G Y   V+ K
Sbjct: 5209 -NVIWSKGPDIIKSSDKFDI-IADGKKHILVINDSQFDDEGVYTAEVEGK 5256



 Score = 36.2 bits (82), Expect = 0.28
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 293   NVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRA 352
             ++++   I G P P VTW K+ + +   AN     IE+      L I  C+  DT ++  
Sbjct: 14488 SIRIFVPIKGRPAPEVTWTKDNINLKNRAN-----IENTESFTLLIIPECNRYDTGKFVM 14542

Query: 353   SAMNVKGELSAYASVVV 369
             +  N  G+ S + +V V
Sbjct: 14543 TIENPAGKKSGFVNVRV 14559



 Score = 36.2 bits (82), Expect = 0.28
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 2/85 (2%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKAL-ASDDHCNLKFEAGRTAYFTINGVST 1638
             DV+ +  G+   L  ++ G P P+V W K+ K L  +     +K    +T     + + T
Sbjct: 18410 DVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRT 18469

Query: 1639  ADSGKYGLVVKNKYGSETSDFTVSV 1663
              D G+Y L + N  G+++   TV V
Sbjct: 18470 -DGGQYILKLSNVGGTKSIPITVKV 18493



 Score = 35.8 bits (81), Expect = 0.36
 Identities = 24/94 (25%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 277 PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
           P F+ + +S TV +   V+L   + G P P V +Y++   I    +   + I     +++
Sbjct: 104 PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLD---FQISQEGDLYS 160

Query: 337 LEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
           L I     ED+  Y  +A N  G  ++ A ++V+
Sbjct: 161 LLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 35.8 bits (81), Expect = 0.36
 Identities = 38/153 (24%), Positives = 61/153 (39%), Gaps = 11/153 (7%)

Query: 221  VVSKQATSALQQEETSEKKSRKVVIREKA-ERLSLRKTLEETETYHAKLNEDHLLHAPEF 279
            V   +  +  + E T  ++ +    R KA  R    K    TE   A   ++    APE 
Sbjct: 7330 VACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQE----APEI 7385

Query: 280  IIKPR---SHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
             +  +     TV     ++L  ++ G PEP++TW K  +   +     +  IE+     T
Sbjct: 7386 FLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADM---ILKQDKRITIENVPKKST 7442

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVV 369
            + I      DT  Y   A+NV G  +A   V V
Sbjct: 7443 VTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 7475



 Score = 35.8 bits (81), Expect = 0.36
 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             +VV  + G ++ L   + G P P + W K++K L ++    ++      A   I      
Sbjct: 20575 EVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVE-NTTDLASILIKDADRL 20633

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
             +SG Y L ++N  GS ++   V +
Sbjct: 20634 NSGCYELKLRNAMGSASATIRVQI 20657



 Score = 35.4 bits (80), Expect = 0.47
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             D + I+ G++L +   V G P P V+W K+   +    +  +    G T+ F +   +  
Sbjct: 21661 DGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLF-VRDATRD 21719

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
               G Y +  KN  GS  ++  V V
Sbjct: 21720 HRGVYTVEAKNASGSAKAEIKVKV 21743



 Score = 35.0 bits (79), Expect = 0.62
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 439 PEIQWYRNGVPLSPS--KWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAY 496
           PE+ W+R+G  +S S    VQ  +S  RA LT   + K + G Y+++   G      +A 
Sbjct: 35  PEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAE 94

Query: 497 VFVR 500
           + V+
Sbjct: 95  LLVK 98



 Score = 35.0 bits (79), Expect = 0.62
 Identities = 17/75 (22%), Positives = 35/75 (46%), Gaps = 1/75 (1%)

Query: 1582  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADS 1641
             + ++ G  +     + G P P   W  +   + +D+H  ++ +   ++  TI      D+
Sbjct: 11215 LVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETD-NFSSVLTIKNCLRRDT 11273

Query: 1642  GKYGLVVKNKYGSET 1656
             G+Y + V N  GS+T
Sbjct: 11274 GEYQITVSNAAGSKT 11288



 Score = 35.0 bits (79), Expect = 0.62
 Identities = 23/84 (27%), Positives = 35/84 (41%), Gaps = 3/84 (3%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYR 351
             E++++   + G P PRVTW+K+ V I    N     I    G  +L +     +    Y 
Sbjct: 21669 ESLRIKALVQGRPVPRVTWFKDGVEIEKRMN---MEITDVLGSTSLFVRDATRDHRGVYT 21725

Query: 352   ASAMNVKGELSAYASVVVKRYKGE 375
               A N  G   A   V V+   G+
Sbjct: 21726 VEAKNASGSAKAEIKVKVQDTPGK 21749



 Score = 34.7 bits (78), Expect = 0.80
 Identities = 83/448 (18%), Positives = 160/448 (35%), Gaps = 90/448 (20%)

Query: 1168 EFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG---------- 1217
            + +W+ +    E+S RL+    GN   +T  ++ + D G+YSC V +  G          
Sbjct: 3519 DVTWTHEGAKIEESERLKQSQNGNIQFLTICNVQLVDQGLYSCIVHNDCGERTTSAVLSV 3578

Query: 1218 ----------------------IASSYLIDEEE-----------LKRLLALSHEHKFPTV 1244
                                   +SS+L  EEE           +   L L  E   P  
Sbjct: 3579 EGAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSES--PVY 3636

Query: 1245 PVKSELAVEILEKGQVRFWMQAEKLSGNA-------------KVNYIFNEKEIFEGPKYK 1291
            P K +   E      ++    A+   G+              K+ + FN   +     YK
Sbjct: 3637 PTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYK 3696

Query: 1292 MHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGK--ATNHSTVVLVGDVFKKLQKEAEFQR 1349
               D +   + +   KL+DE E T       GK   + +  +   G+  K  + E+   +
Sbjct: 3697 FVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAK 3756

Query: 1350 QEWIRKQG----PHFVEYLS-WEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKH 1404
               + K G    PHF++ L           + +  V      T + W+K+ +++     +
Sbjct: 3757 S--LEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPT-VTWFKENKQLCTSVYY 3813

Query: 1405 DF---KDGICTLLITEFSKKDAGIY-----------------EVILKD-DRGKDKSRLKL 1443
                  +G  T ++ +  ++D+G+Y                  V+L+D D      + K 
Sbjct: 3814 TIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLLEDTDMTDTPCKAKS 3873

Query: 1444 VDEAFKELMMEVCKKIALSATDLKIQ-STAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYS 1502
              EA ++      K  A+ A D + + +T     +        E+ ++++ H   A   S
Sbjct: 3874 TPEAPEDFPQTPLKGPAVEALDSEQEIATFVKDTILKAALITEENQQLSYEHIAKANELS 3933

Query: 1503 DRVKTGVTGEQIWLQINEPTPNDKGKYV 1530
             ++  G    Q  L+ ++ TP    +++
Sbjct: 3934 SQLPLGAQELQSILEQDKLTPESTREFL 3961



 Score = 34.7 bits (78), Expect = 0.80
 Identities = 22/86 (25%), Positives = 37/86 (43%), Gaps = 1/86 (1%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1637
             L   + ++ G  + L   V G PPP+++W K    L      ++K       +     V+
Sbjct: 13394 LRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIK-STDFDTFLRCENVN 13452

Query: 1638  TADSGKYGLVVKNKYGSETSDFTVSV 1663
               D+GKY L ++N  G +     V V
Sbjct: 13453 KYDAGKYILTLENSCGKKEYTIVVKV 13478



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 41/195 (21%), Positives = 77/195 (39%), Gaps = 19/195 (9%)

Query: 1389 IVWYKDEREISVDE----KHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLV 1444
            + W++D + IS       +  F DG   L I   +K ++G Y +   +  G+  S  +L+
Sbjct: 37   VSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELL 96

Query: 1445 ---DEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRY 1501
               + A    +  +        + +++Q    GI     V +Y          +G+ I+ 
Sbjct: 97   VKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPT-PVVKFY---------RDGAEIQS 146

Query: 1502 SDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQR- 1560
            S   +    G+   L I E  P D G Y +   +       T +L  Q  +E  A+  + 
Sbjct: 147  SLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKT 206

Query: 1561 -LKQAAIAEKNRARV 1574
             +  A I+E  + R+
Sbjct: 207  IVSTAQISESRQTRI 221



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 25/94 (26%), Positives = 43/94 (45%), Gaps = 7/94 (7%)

Query: 1577 GLPDVVTIQEGKALNLTCNVWGDPPPEVSWL---KNEKALASDDHC---NLKFE-AGRTA 1629
            G  D +  + G  + +   + G P P+ SW    K +KA+    H    + + E A  ++
Sbjct: 9510 GAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSS 9569

Query: 1630 YFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
               I     + +GKY +  KNK G +T++  V V
Sbjct: 9570 VIIIPECKRSHTGKYSITAKNKAGQKTANCRVKV 9603



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 21/83 (25%), Positives = 39/83 (46%), Gaps = 5/83 (6%)

Query: 1582  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAG-RTAYFTINGVSTAD 1640
             + ++ G +  +     G P PE++W + E          ++ E G      +I+     D
Sbjct: 17729 IVVRAGGSARIHIPFKGRPTPEITWSREEGEFTD----KVQIEKGVNYTQLSIDNCDRND 17784

Query: 1641  SGKYGLVVKNKYGSETSDFTVSV 1663
             +GKY L ++N  GS+++  TV V
Sbjct: 17785 AGKYILKLENSSGSKSAFVTVKV 17807



 Score = 33.9 bits (76), Expect = 1.4
 Identities = 26/87 (29%), Positives = 33/87 (37%), Gaps = 10/87 (11%)

Query: 1582 VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASD----DHCNLKFEAGRTAYFTINGVS 1637
            + I  GK L +   V G P P   W K E  L  D    D+   K E        I    
Sbjct: 8809 IQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSE------LIIKDAL 8862

Query: 1638 TADSGKYGLVVKNKYGSETSDFTVSVF 1664
              D G+Y +   N  GS+ +   V VF
Sbjct: 8863 RKDHGRYVITATNSCGSKFAAARVEVF 8889



 Score = 33.5 bits (75), Expect = 1.8
 Identities = 31/109 (28%), Positives = 54/109 (49%), Gaps = 4/109 (3%)

Query: 1358 PHFVEYL-SWEVTGECNVLLKCKVANIKKETHIVWYKDEREI--SVDEKHDFKDGICTLL 1414
            P+FV+ L S  V     V L+ +V  I     + +Y+D  EI  S+D +   +  + +LL
Sbjct: 104  PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPV-VKFYRDGAEIQSSLDFQISQEGDLYSLL 162

Query: 1415 ITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSA 1463
            I E   +D+G Y V   +  G+  S  +L+ +  +E+  +  K I  +A
Sbjct: 163  IAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIVSTA 211



 Score = 33.5 bits (75), Expect = 1.8
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 5/67 (7%)

Query: 418  EGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDE 477
            EG    L C+V + P++      ++WY N   + P   VQ +  G +  L  +  +  DE
Sbjct: 2412 EGTKAVLECKVSV-PDVT----SVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDE 2466

Query: 478  GLYTIRV 484
            G Y + V
Sbjct: 2467 GPYKLIV 2473



 Score = 33.1 bits (74), Expect = 2.3
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 3/80 (3%)

Query: 1584  IQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGK 1643
             I+ G  L L+  + G P P+V+W K ++   +    ++     +     I   +  D G 
Sbjct: 10925 IKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGSK---LEIRNAAHEDGGI 10981

Query: 1644  YGLVVKNKYGSETSDFTVSV 1663
             Y L V+N  GS+T    V V
Sbjct: 10982 YSLTVENPAGSKTVSVKVLV 11001



 Score = 33.1 bits (74), Expect = 2.3
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 13/87 (14%)

Query: 1582  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAG--RTAYFT---INGV 1636
             + ++ G ++ +   + G P PEV+W K        D+ NLK  A    T  FT   I   
Sbjct: 14481 LVVRAGLSIRIFVPIKGRPAPEVTWTK--------DNINLKNRANIENTESFTLLIIPEC 14532

Query: 1637  STADSGKYGLVVKNKYGSETSDFTVSV 1663
             +  D+GK+ + ++N  G ++    V V
Sbjct: 14533 NRYDTGKFVMTIENPAGKKSGFVNVRV 14559



 Score = 32.7 bits (73), Expect = 3.1
 Identities = 38/176 (21%), Positives = 75/176 (42%), Gaps = 16/176 (9%)

Query: 1165 PKSEFSWSKD--YVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSY 1222
            P  E SW +D   +ST   P +++     + K+T   +   + G YS   T+  G A+S 
Sbjct: 33   PVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATS- 91

Query: 1223 LIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEK 1282
                 EL     L      P   V+   ++ + +  QVR  ++   +     V +  +  
Sbjct: 92   ---TAEL-----LVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIP-TPVVKFYRDGA 142

Query: 1283 EIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQD--GKATNHSTVVLVGD 1336
            EI     ++  I +   +  + + +   ED GTY+    +  G+AT+ + +++ G+
Sbjct: 143  EIQSSLDFQ--ISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGE 196



 Score = 32.7 bits (73), Expect = 3.1
 Identities = 43/204 (21%), Positives = 67/204 (32%), Gaps = 47/204 (23%)

Query: 278  EFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTL 337
            + I KP+  T  E   V    S++    P V W+   V I       K+ + S   +H L
Sbjct: 2750 KIIKKPKDVTALENATVAFEVSVSHDTVP-VKWFHKSVEIKPS---DKHRLVSERKVHKL 2805

Query: 338  EINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPY 397
             +      D  +Y A    V G+L   A + V+                           
Sbjct: 2806 MLQNISPSDAGEYTA----VVGQLECKAKLFVET-------------------------- 2835

Query: 398  GYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQ 457
                   +H           E +T S  C      E+ HF     W +NGV +  S+  +
Sbjct: 2836 -------LHITKTMKNIEVPETKTASFEC------EVSHFNVPSMWLKNGVEIEMSEKFK 2882

Query: 458  TLWSGERATLTFSHLNKEDEGLYT 481
             +  G+   L   + + ED   YT
Sbjct: 2883 IVVQGKLHQLIIMNTSTEDSAEYT 2906



 Score = 32.3 bits (72), Expect = 4.0
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 3/80 (3%)

Query: 1584  IQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGK 1643
             ++ G +  +T    G P P V W K +  L +  + +      RT+  TI   +  DSGK
Sbjct: 19893 VKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDT--TDSRTS-LTIENANRNDSGK 19949

Query: 1644  YGLVVKNKYGSETSDFTVSV 1663
             Y L ++N   + +    V V
Sbjct: 19950 YTLTIQNVLSAASLTLVVKV 19969



 Score = 32.0 bits (71), Expect = 5.2
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 5/45 (11%)

Query: 418  EGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSG 462
            EGET    CRV   P     QP++ WY NG  +  SK  +  + G
Sbjct: 1808 EGETARFRCRVTGYP-----QPKVNWYLNGQLIRKSKRFRVRYDG 1847



 Score = 32.0 bits (71), Expect = 5.2
 Identities = 23/89 (25%), Positives = 36/89 (40%), Gaps = 17/89 (19%)

Query: 1582  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALA-------SDDHCNLKFEAGRTAYFTIN 1634
             + +++G  + LT  + G P P   W K  + ++       S+ H  L           I 
Sbjct: 23841 IFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTEL----------VIK 23890

Query: 1635  GVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
                  DSG Y LV++NK G +     V V
Sbjct: 23891 EADRGDSGTYDLVLENKCGKKAVYIKVRV 23919



 Score = 31.6 bits (70), Expect = 6.8
 Identities = 44/203 (21%), Positives = 71/203 (34%), Gaps = 46/203 (22%)

Query: 278  EFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTL 337
            +F+      TV E E     C ++   +  V W+KN   ++        +I S    H L
Sbjct: 5270 KFMSPLEDQTVKEGETATFVCELSH-EKMHVVWFKNDAKLHTSRT---VLISSEGKTHKL 5325

Query: 338  EINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPY 397
            E+     +D +Q +A       ELS+ A + V                          PY
Sbjct: 5326 EMKEVTLDDISQIKAQVK----ELSSTAQLKVLE----------------------ADPY 5359

Query: 398  GYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQ 457
                 F +   DK  V    E + ++L C V     +K       W+++G  + PS    
Sbjct: 5360 -----FTVKLHDKTAV----EKDEITLKCEVSKDVPVK-------WFKDGEEIVPSPKYS 5403

Query: 458  TLWSGERATLTFSHLNKEDEGLY 480
                G R  L     + +D+G Y
Sbjct: 5404 IKADGLRRILKIKKADLKDKGEY 5426



 Score = 31.2 bits (69), Expect = 8.9
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 8/88 (9%)

Query: 1598 GDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTIN-GVS-TADSGKYGLVVKNKYGSE 1655
            GDP   V WL + K L + +   +  E G   Y +++ GV+ + DSG       NKYG  
Sbjct: 1684 GDPTMVVEWLHDGKPLEAANRLRMINEFG---YCSLDYGVAYSRDSGIITCRATNKYG-- 1738

Query: 1656 TSDFTVSVFIPEEEARMAALESLKGGKK 1683
             +D T +  I ++E  +     L  G+K
Sbjct: 1739 -TDHTSATLIVKDEKSLVEESQLPEGRK 1765



 Score = 31.2 bits (69), Expect = 8.9
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 6/60 (10%)

Query: 419  GETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEG 478
            GET +  C      E+ +    ++WY  G  L PS  V     G+  TLT   +  ED G
Sbjct: 5905 GETATFDC------ELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAG 5958



 Score = 31.2 bits (69), Expect = 8.9
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 6/88 (6%)

Query: 1598 GDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETS 1657
            G P P  +W   +K L + D   +K      A   I+    +D G Y L ++N+  + + 
Sbjct: 7115 GYPRPTATWCFGDKVLETGDRVKMK-TLSAYAELVISPSERSDKGIYTLKLENRVKTISG 7173

Query: 1658 DFTVSVFIPEEEARMAALESLKGGKKAK 1685
            +  V+V      AR +A + LK G   K
Sbjct: 7174 EIDVNVI-----ARPSAPKELKFGDITK 7196



 Score = 31.2 bits (69), Expect = 8.9
 Identities = 24/91 (26%), Positives = 38/91 (41%), Gaps = 7/91 (7%)

Query: 1592  LTCNVWGDPPPEVSWLKNEKALASDDHCNLKFE----AGRTAYFTINGVSTADSGKYGLV 1647
             L C V G P P V W +  K + +D    LK+      G      I  V+  D+  Y + 
Sbjct: 24642 LVCKVTGHPKPIVKWYRQGKEIIAD---GLKYRIQEFKGGYHQLIIASVTDDDATVYQVR 24698

Query: 1648  VKNKYGSETSDFTVSVFIPEEEARMAALESL 1678
               N+ GS +   ++ V +P +      LE +
Sbjct: 24699 ATNQGGSVSGTASLEVEVPAKIHLPKTLEGM 24729


>gi|110349713 titin isoform novex-1 [Homo sapiens]
          Length = 27051

 Score =  257 bits (656), Expect = 8e-68
 Identities = 233/902 (25%), Positives = 381/902 (42%), Gaps = 102/902 (11%)

Query: 405   IHFDDKF-DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGE 463
             +  D KF DV   + GE + +   +   P      P I W ++G+ +      + + +  
Sbjct: 19417 VMMDVKFRDVIVVKAGEVLKINADIAGRP-----LPVISWAKDGIEIEERARTEIISTDN 19471

Query: 464   RATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANK 523
                LT     + D G Y + ++        +    V D      G PA PL++  L A K
Sbjct: 19472 HTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKP----GPPAGPLEINGLTAEK 19527

Query: 524   DYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFR 583
                 +SW +P  DGG+ I  Y ++K E    +W+ C +  ++     VT L++G  YIFR
Sbjct: 19528 --CSLSWGRPQEDGGADIDYYIVEKRETSHLAWTIC-EGELQMTSCKVTKLLKGNEYIFR 19584

Query: 584   VRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTD 643
             V  VNK G+G P   S  + ALDP                             VP PPT 
Sbjct: 19585 VTGVNKYGVGEPLE-SVAIKALDPFT---------------------------VPSPPTS 19616

Query: 644   LSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDL 702
             L +T  T+  + L W +P    G E   Y +E+ E  +  W RVN + PV   R     L
Sbjct: 19617 LEITSVTKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKK-PVYDLRVKSTGL 19675

Query: 703   AEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES 762
              EG  Y +RV   N+AG+  PSE + +    D + +P  P K     +  T++ ++W + 
Sbjct: 19676 REGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKP 19735

Query: 763   --KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLS 820
                    + GY +E   +    W+    + ++G+ +T  GL TG  Y+FRV++VN  G S
Sbjct: 19736 LFDGGAPITGYTVEYKKSDDTDWKTSIQS-LRGTEYTISGLTTGAEYVFRVKSVNKVGAS 19794

Query: 821   EYSQDSE---AIEVKAAIGGGVSPDVCPALSDEPGG----LTASRGR----VHEASPPT- 868
             + S  S+   A E +      +  ++   L  + G         RGR    V  + P T 
Sbjct: 19795 DPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTD 19854

Query: 869   FQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKK 928
              +  A + +  ++ SL  + +N  + +  K + T+Q  L+           +    + K 
Sbjct: 19855 LRTRAYVDTTDSRTSL--TIENANRNDSGKYTLTIQNVLS----------AASLTLVVKV 19902

Query: 929   TDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANV 988
              D   P PP +IT  +  ++S VL W  P+  GGA +  Y++  RE       K   +  
Sbjct: 19903 LD--TPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKRE----ASKKAWVSVT 19956

Query: 989   KAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCS 1048
                +  +YK++NL+E  +Y F+V+  N  G+G P+   E  K  E     P PP  L  +
Sbjct: 19957 NNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVKITE----KPSPPEKLGVT 20012

Query: 1049  EVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEG 1108
              + KDS+ L W  P H G + +  Y V+  E   K   W  +  A  K+ +  V GL+E 
Sbjct: 20013 SISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQK--NW--VKCAVAKSTHHVVSGLREN 20068

Query: 1109  VSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISL----NFECD--- 1161
               Y FRV A NQAG+  P +L  PV+ + +    E+ +       + +    N + D   
Sbjct: 20069 SEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPI 20128

Query: 1162  KMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1221
                P  + + S+D V  + + R   E       +  K+    D G Y     ++ G   +
Sbjct: 20129 SGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKA 20188

Query: 1222  YLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNE 1281
             ++        ++ L      P  P    +  +I E+     W   +   G+   NYI  +
Sbjct: 20189 FI-------NIVVLDR----PGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLK 20237

Query: 1282  KE 1283
             +E
Sbjct: 20238 RE 20239



 Score =  248 bits (632), Expect = 5e-65
 Identities = 214/828 (25%), Positives = 356/828 (42%), Gaps = 107/828 (12%)

Query: 429  VITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGE 488
            ++ P   + + E +W++   PLS +K + T  + E+ +       K D+G Y I ++   
Sbjct: 6647 MVVPYDAYPKAEAEWFKENEPLS-TKTIDT--TAEQTSFRILEAKKGDKGRYKIVLQ--N 6701

Query: 489  YYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDK 548
             + +   ++ ++  D      P    +++  E     + ++W++P  DGGS I+GY +++
Sbjct: 6702 KHGKAEGFINLKVIDV-----PGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVER 6756

Query: 549  CEVGTDSWSQCNDTPVKFARFPVTGLIEGR-SYIFRVRAVNKMGIGFPSRVSEPVAALDP 607
             ++   +W    D   +   F VTGL +G   Y+FRV A N++G G P     PV     
Sbjct: 6757 RDIKRKTWVLATDR-AESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPV----- 6810

Query: 608  AEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHE 667
                                  E  S+  VPGPP ++++T+  R  V L+W+PP   G  
Sbjct: 6811 ----------------------EARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGA 6848

Query: 668  GIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEA 726
             I  Y +E  +  +  W    T +  +     + D+ EG+ Y FRVR  N  GVG+PS A
Sbjct: 6849 EITNYVIELRDKTSIRWDTAMT-VRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAA 6907

Query: 727  TEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES-KD-AKELVGYYIEASVAGSGKWE 784
            T    V D ++ P  P  +  S  T +SV + WE   KD    ++GY IE    G   W 
Sbjct: 6908 TPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWI 6967

Query: 785  PCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVC 844
             CN   V    +   GL  G  Y++RV A N AG+S+ S+                    
Sbjct: 6968 RCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEIL------------------ 7009

Query: 845  PALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVS-----KV 899
                   G LTA    V      +  KD L    PN  ++   S    +   +     KV
Sbjct: 7010 -------GPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKV 7062

Query: 900  SET----------VQEELTPPPQKAAPQG------KSKSDPLKKKTD---RAPPSPPCDI 940
             ET             EL   P + + +G      +++   +  + D    A PS P ++
Sbjct: 7063 LETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKEL 7122

Query: 941  TCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISN 1000
               +  +DS+ L W+ PD  GG+ +TGY V  REV       W +  +  V++  + + +
Sbjct: 7123 KFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKT---WTKV-MDFVTDLEFTVPD 7178

Query: 1001 LKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWK 1060
            L +   Y F+V A N  G G P+ V E          VP PP ++K  +   +S+ L W 
Sbjct: 7179 LVQGKEYLFKVCARNKCGPGEPAYVDEPVNMST-PATVPDPPENVKWRDRTANSIFLTWD 7237

Query: 1061 PPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQ 1120
            PP + G + + GY V+        D+W    E  +    ++V GL+EG  Y +RV+A+N+
Sbjct: 7238 PPKNDGGSRIKGYIVE--RCPRGSDKWVACGE-PVAETKMEVTGLEEGKWYAYRVKALNR 7294

Query: 1121 AGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISL----NFECDKMT---PKSEFSWSK 1173
             G  KPS     + A       E+ ++V     +++      E        P+ + +W+K
Sbjct: 7295 QGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTK 7354

Query: 1174 DYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1221
              +  +   R+ +E+   K+ +T  D    D G Y  +  +  G A++
Sbjct: 7355 ADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATA 7402



 Score =  247 bits (631), Expect = 6e-65
 Identities = 233/877 (26%), Positives = 353/877 (40%), Gaps = 116/877 (13%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P + W ++G  L P++ ++        TL    +N++D G YTI        +  +  + 
Sbjct: 12953 PTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLK 13012

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V D        P  P  VK  +   D  ++SW+ P  DGGS I  Y +DK E    +W+Q
Sbjct: 13013 VLDK-------PGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQ 13065

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
              + T V      V  LIEG  Y FR+ A NK G+G P   +EP  A +P +         
Sbjct: 13066 VSAT-VPITSCSVEKLIEGHEYQFRICAENKYGVGDPV-FTEPAIAKNPYDP-------- 13115

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                                PG      ++  T+ ++ +SWKPP   G   I  Y +EK E
Sbjct: 13116 -------------------PGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRE 13156

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
                 NW +VN + P+         L EG  Y FRV   N AG G+PS+A++     D   
Sbjct: 13157 TQAVNWTKVNRK-PIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQY 13215

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCN-NNPVKGS 794
              P  P        T +SV +SW +        ++GY +E   A S  W  CN    ++ +
Sbjct: 13216 PPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKT 13275

Query: 795   RFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAI---GGGVSPDVCPALSDEP 851
             RF   GL+    Y FRV AVN  G S+ S   +    K  +    G +  D+   L    
Sbjct: 13276 RFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRA 13335

Query: 852   GGLTASRGRVHEASPPTFQKDALLGSKPN-----KPSLPSSS---------QNLGQTEVS 897
             G        V    PP      +  SKPN     +  L   S         +N+ + +  
Sbjct: 13336 GVTMRLYVPVKGRPPP-----KITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAG 13390

Query: 898   KVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQP 957
             K   T++             GK +   + K  D   P PP ++T  E  +DS  + W+ P
Sbjct: 13391 KYILTLENSC----------GKKEYTIVVKVLD--TPGPPVNVTVKEISKDSAYVTWEPP 13438

Query: 958   DKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMA 1017
                GG+ I  Y V  R   D     W     +  S+ +++++NL+E   Y F+V A N  
Sbjct: 13439 IIDGGSPIINYVVQKR---DAERKSWSTVTTEC-SKTSFRVANLEEGKSYFFRVFAENEY 13494

Query: 1018  GLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDL 1077
             G+G P    +  K  +     PGP   LK   V K S  + WK P   G + + GY VD 
Sbjct: 13495 GIGDPGETRDAVKASQ----TPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDF 13550

Query: 1078  KEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAET 1137
                  +E++W+ + ++   ++    + L EG  Y FRV A N+ G G PS++   VVA  
Sbjct: 13551 ---LTEENKWQRVMKSL--SLQYSAKDLTEGKEYTFRVSAENENGEGTPSEIT--VVAR- 13602

Query: 1138  RPGTKEVVVNVDDDGVISL--------NFECD---KMTPKSEFSWSKDYVSTEDSPRLEV 1186
                   V  ++D  G+  L        NF      K  P    SW K         R+ V
Sbjct: 13603 ---DDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSV 13659

Query: 1187  ESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPV 1246
             ES    T +   D    D G Y+  + +  G     +         + +  +   PT P+
Sbjct: 13660 ESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTI--------SIKVVGKPGIPTGPI 13711

Query: 1247  KSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1283
             K +   E+  +     W   +   G+   NYI  +++
Sbjct: 13712 KFD---EVTAEAMTLKWAPPKDDGGSEITNYILEKRD 13745



 Score =  247 bits (630), Expect = 8e-65
 Identities = 216/807 (26%), Positives = 347/807 (42%), Gaps = 78/807 (9%)

Query: 438  QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
            +P+I W +  + L   K +      +++T+T     + D G Y I         + +A V
Sbjct: 7347 EPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAV--NVCGRATAVV 7404

Query: 498  FVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
             V   D      P  P      +   +  +++W  P  DGGS I  Y +++    ++ W 
Sbjct: 7405 EVNVLDK-----PGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWH 7459

Query: 558  QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAA---LDPAEKARLK 614
            + + T VK   F  T LI  + YIFRV A N  G+G P + S P+ A    DP       
Sbjct: 7460 KLSST-VKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQAS-PITAKYQFDP------- 7510

Query: 615  SRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFV 673
                                   PGPPT L  ++ T+  V L+W  P   G   I  Y+V
Sbjct: 7511 -----------------------PGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWV 7547

Query: 674  EKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVG 733
            E+ +  T+ W R N ++PVK   + +  L   K Y FRV   N AG G+PS++TE  ++ 
Sbjct: 7548 ERLDPDTDKWVRCN-KMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIK 7606

Query: 734  DKLDIPKAPGKIIPSRNTDTSVVVSW--EESKDAKELVGYYIEASVAGSGKWEPCNNNPV 791
            D +D P  PGK        TSV ++W   E     ++  Y IE    G+ +W       V
Sbjct: 7607 DPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEG-V 7665

Query: 792  KGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEP 851
              ++    GL+ GQ Y FRVRAVN AG SE S+ S+ +  +  +     P     ++   
Sbjct: 7666 PTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVIN--- 7722

Query: 852  GGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETV---QEELT 908
              +T +   +    P       +      K  +         T V     TV    E   
Sbjct: 7723 --ITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSL 7780

Query: 909  PPPQKAAPQGKSKS------DPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGG 962
               + AA     +S      D +  K     P PP  +  ++  +  + L W+ P   GG
Sbjct: 7781 YVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGG 7840

Query: 963  AEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAP 1022
              I  Y +  +E +     +W +A   A  +  ++++++ E    QFQV A N AG+G P
Sbjct: 7841 RPIQRYVIEKKERLG---TRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHP 7897

Query: 1023 SAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKA 1082
            S  +E    E+ T + P PP  L  ++  +  + + WKPP  +G +P+ GY V++     
Sbjct: 7898 SEPTEILSIEDPT-SPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEM--CPV 7954

Query: 1083 KEDQWRGLNEAAIKNVYLKV-RGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA---ETR 1138
              ++W  +N   IK++  KV  G+     YV RVRA+N  GV +PS+++  VVA   + +
Sbjct: 7955 GTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCK 8014

Query: 1139 P----GTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTK 1194
            P     T +++V   +   I + F   +  P    SW KD    + S RL +++      
Sbjct: 8015 PTIDLETHDIIVIEGEKLSIPVPF---RAVPVPTVSWHKDGKEVKASDRLTMKNDHISAH 8071

Query: 1195 MTFKDLGMDDLGIYSCDVTDTDGIASS 1221
            +        D GIY+  + +  G A++
Sbjct: 8072 LEVPKSVRADAGIYTITLENKLGSATA 8098



 Score =  244 bits (623), Expect = 5e-64
 Identities = 210/715 (29%), Positives = 320/715 (44%), Gaps = 77/715 (10%)

Query: 432   PEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHL---NKEDEGLYTIRVR--M 486
             P I   +P I W ++G PL  +  V      E AT T  H+   NK+D G YT+      
Sbjct: 17962 PVIGRPRPNISWVKDGEPLKQTTRVNV---EETATSTVLHIKEGNKDDFGKYTVTATNSA 18018

Query: 487   GEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFI 546
             G   E  S  V       E  G P  P  V+  E + D+++ISW+ PA  GG  I  Y +
Sbjct: 18019 GTATENLSVIVL------EKPGPPVGP--VRFDEVSADFVVISWEPPAYTGGCQISNYIV 18070

Query: 547   DKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALD 606
             +K +  T +W   + T  +     +T L  G  Y FR+ A N+ G               
Sbjct: 18071 EKRDTTTTTWHMVSATVAR-TTIKITKLKTGTEYQFRIFAENRYG--------------- 18114

Query: 607   PAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGH 666
                        SAP   + ++ +    E   PGPP    VT  ++  +++ W  P   G 
Sbjct: 18115 ----------KSAPLDSKAVIVQYPFKE---PGPPGTPFVTSISKDQMLVQWHEPVNDGG 18161

Query: 667   EGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSE 725
               I+ Y +E+ E  +  W ++N + P++  +F    L EG  Y F+V   N  G+G+PS+
Sbjct: 18162 TKIIGYHLEQKEKNSILWVKLN-KTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSK 18220

Query: 726   ATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKW 783
              +E  V  D  D P  P  I+ +RN   +V + W++       ++ GY +E      G+W
Sbjct: 18221 VSECFVARDPCDPPGRPEAIVITRN---NVTLKWKKPAYDGGSKITGYIVEKKDLPDGRW 18277

Query: 784   EPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAI---GGGV 839
                +   V  + FT  GLV  Q Y FRV A NAAG  SE S  S AI  +  I      +
Sbjct: 18278 MKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASL 18337

Query: 840   SP---DVCPALSDEPGGLTAS-RGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTE 895
              P   DV    + E   L A  RG+        + KD   G +  + +     ++  Q  
Sbjct: 18338 DPKYKDVIVVHAGETFVLEADIRGK--PIPDVVWSKD---GKELEETAARMEIKSTIQKT 18392

Query: 896   VSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKT-DR-APPSPPCDITCLESFRDSMVLG 953
                V + ++ +      K +  G +KS P+  K  DR  PP  P  +T + +  +   L 
Sbjct: 18393 TLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTA--EKCYLA 18450

Query: 954   WKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAA 1013
             W  P + GGA I+ Y +  RE        W + + + V    YK++ L     Y F+V A
Sbjct: 18451 WNPPLQDGGANISHYIIEKRET---SRLSWTQVSTE-VQALNYKVTKLLPGNEYIFRVMA 18506

Query: 1014  MNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGY 1073
             +N  G+G P        C  +    PGPP + + S + KDS+V+ W  PV  G T + GY
Sbjct: 18507 VNKYGIGEPLESGPVTACNPY--KPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGY 18564

Query: 1074  FVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSD 1128
              ++ ++ +    +W   N+  + ++ L+V GL EG SY FRV A N AGVG+PS+
Sbjct: 18565 ILEKRDKEGV--RWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSE 18617



 Score =  240 bits (612), Expect = 1e-62
 Identities = 232/891 (26%), Positives = 374/891 (41%), Gaps = 101/891 (11%)

Query: 417   REGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKED 476
             R G  + L   V   PE     P+I W +    L   + V   ++G+RAT      ++ D
Sbjct: 22688 RAGSDLVLDAAVGGKPE-----PKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSD 22742

Query: 477   EGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVD 536
              G YT+ V+     +  S  V V D+       P   L V  +   K    ++W  P  D
Sbjct: 22743 SGKYTLTVKNASGTKAVSVMVKVLDSPG-----PCGKLTVSRVTQEK--CTLAWSLPQED 22795

Query: 537   GGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPS 596
             GG+ I  Y +++ E    +W          + + VT LI+   YIFRVRAVNK G G P 
Sbjct: 22796 GGAEITHYIVERRETSRLNWVIVEGECPTLS-YVVTRLIKNNEYIFRVRAVNKYGPGVPV 22854

Query: 597   RVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVL 656
               SEP+ A +                              +P PP         + ++++
Sbjct: 22855 E-SEPIVARNSFT---------------------------IPSPPGIPEEVGTGKEHIII 22886

Query: 657   SW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCS 715
              W KP    G+E   Y V+K E  +  W RVN +  V   R  +  L EG  Y FRV   
Sbjct: 22887 QWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAV 22946

Query: 716   NSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYI 773
             N+AG  EPSEA+      +    P  P        T  S+ ++W +       ++VGY +
Sbjct: 22947 NAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVL 23006

Query: 774   EASVAGSGKWEPCNNN-PVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVK 832
             E     + +W   + N  ++ + FT   L  GQ Y FRV AVN  G+SEYS+    IE  
Sbjct: 23007 EMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPV 23066

Query: 833   AAI---GGGVSPDVCPALSDEPGGLTASRGRVHEASPP--TFQKDAL-LGSKPNKPSLPS 886
               I      ++ D+   ++   G        V    PP  T+ K  + L S+    ++  
Sbjct: 23067 ERIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASR----AIID 23122

Query: 887   SSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESF 946
             ++++     V KV+     + T   +  +  GK  +  L K  D   P P   +   E  
Sbjct: 23123 TTESYSLLIVDKVNRYDAGKYTIEAENQS--GKKSATVLVKVYDTPGPCP--SVKVKEVS 23178

Query: 947   RDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMV 1006
             RDS+ + W+ P   GGA +  Y V  RE        ++    K  S+  Y+IS L E  +
Sbjct: 23179 RDSVTITWEIPTIDGGAPVNNYIVEKRE---AAMRAFKTVTTKC-SKTLYRISGLVEGTM 23234

Query: 1007  YQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSG 1066
             Y F+V   N+ G+G P   S+     E    VP  P  L+  +V K ++ L W+ P++ G
Sbjct: 23235 YYFRVLPENIYGIGEPCETSDAVLVSE----VPLVPAKLEVVDVTKSTVTLAWEKPLYDG 23290

Query: 1067  RTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLK--VRGLKEGVSYVFRVRAINQAGVG 1124
              + +TGY   L+  KA  ++W  +    +K   L+  V  L EG  Y+FR+RA N+ GV 
Sbjct: 23291 GSRLTGYV--LEACKAGTERW--MKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVS 23346

Query: 1125  KPSDLAGPVVAE-----------TRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSK 1173
             +P +    V  +           T P   +  ++V     + L        P +  SW  
Sbjct: 23347 EPRETVTAVTVQDLRVLPTIDLSTMP---QKTIHVPAGRPVELVIPIAGRPPPAA-SWFF 23402

Query: 1174  DYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLL 1233
                   +S R+ VE+     K+T ++  + D G Y+ ++ +  G  S       E  +++
Sbjct: 23403 AGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTS-------ETIKVI 23455

Query: 1234  ALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVN-YIFNEKE 1283
              L      PT P+K    ++ ++   +    +  +L G A ++ Y+  +++
Sbjct: 23456 ILDKPGP-PTGPIK----IDEIDATSITISWEPPELDGGAPLSGYVVEQRD 23501



 Score =  239 bits (609), Expect = 2e-62
 Identities = 243/973 (24%), Positives = 389/973 (39%), Gaps = 133/973 (13%)

Query: 339   INGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYG 398
             + G    DT +YR SA+N+ G+            K E      H                
Sbjct: 10406 VKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLH---------------- 10449

Query: 399   YASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQT 458
                   + F DK  +   R GE  +L  R    P+     P++ W+++   +        
Sbjct: 10450 ------LDFRDKLTI---RVGEAFALTGRYSGKPK-----PKVSWFKDEADVLEDDRTHI 10495

Query: 459   LWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKC 518
               +     L      + D G Y + V       +    V V D      G P  P+    
Sbjct: 10496 KTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRP----GPPVGPVSFD- 10550

Query: 519   LEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGR 578
              E  KDY++ISWK P  DGGS I  Y I+K EVG D W        K     V+ L+EG+
Sbjct: 10551 -EVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAK-TTCKVSKLLEGK 10608

Query: 579   SYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVP 638
              YIFR+ A N  GI      S+P+ +     K R +                      VP
Sbjct: 10609 DYIFRIHAENLYGI------SDPLVSDSMKAKDRFR----------------------VP 10640

Query: 639   GPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFA 698
               P    VTE T+   +++W  P   G     Y +EK E  ++ W RV  +      +F 
Sbjct: 10641 DAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKRETMSKRWARVTKDPIHPYTKFR 10700

Query: 699   LFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVS 758
             + DL EG  Y FRV   N  G+G+PS  ++     D +  P  P        T  SV ++
Sbjct: 10701 VPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLT 10760

Query: 759   WEESK--DAKELVGYYIEASVAGSGKWEPCNNNP--VKGSRFTCHGLVTGQSYIFRVRAV 814
             W+  +     +++GY +E    G  +W   N+ P     +++   GL  GQ+Y FRV AV
Sbjct: 10761 WQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVLAV 10820

Query: 815   NAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGR-VHEASPPTFQKDA 873
             NAAG S+ +   E + VK  +     P++          L A+  R  H     T +  A
Sbjct: 10821 NAAGESDPAHVPEPVLVKDRL---EPPELI---------LDANMAREQHIKVGDTLRLSA 10868

Query: 874   LLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSD---------- 923
             ++   P  P +    ++      +++      ++TP   K   +  +  D          
Sbjct: 10869 IIKGVP-FPKVTWKKEDRDAPTKARI------DVTPVGSKLEIRNAAHEDGGIYSLTVEN 10921

Query: 924   PLKKKTDRA------PPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVID 977
             P   KT          P PP D+   E  +DS  L WK+P   GG+ IT Y V  R+V  
Sbjct: 10922 PAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDV-- 10979

Query: 978   GVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIA 1037
                 +W   +  +  ++++   +L E   Y F+VAA N  G G      +  K  +  + 
Sbjct: 10980 -ASAQWSPLSATS-KKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALD-PLH 11036

Query: 1038  VPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKN 1097
              PGPP  L   +V K  + L W  P   G +P+TGY V+ +E   ++  W  +    + N
Sbjct: 11037 PPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQD--W--IKFKTVTN 11092

Query: 1098  VYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETR--PGTKEVVVNVDDDGVI- 1154
             +   V GL++G +Y FRV+A N  G+G P D   P+  + +  P + E+ V + +  V+ 
Sbjct: 11093 LECVVTGLQQGKTYRFRVKAENIVGLGLP-DTTIPIECQEKLVPPSVELDVKLIEGLVVK 11151

Query: 1155  ---SLNFEC-DKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSC 1210
                ++ F    +  P     W+ D    +      VE+    + +T K+    D G Y  
Sbjct: 11152 AGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQI 11211

Query: 1211  DVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLS 1270
              V++  G         + +   L +      PT P+     +++  +     W   +   
Sbjct: 11212 TVSNAAG--------SKTVAVHLTVLDVPGPPTGPIN---ILDVTPEHMTISWQPPKDDG 11260

Query: 1271  GNAKVNYIFNEKE 1283
             G+  +NYI  +++
Sbjct: 11261 GSPVINYIVEKQD 11273



 Score =  238 bits (606), Expect = 5e-62
 Identities = 256/1027 (24%), Positives = 414/1027 (40%), Gaps = 150/1027 (14%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYR 351
             +N+K+   + G P+P VTW K      +     +   E+      L IN C   D+  Y 
Sbjct: 14709 DNIKVEIPVLGRPKPTVTWKKGD---QILKQTQRVNFETTATSTILNINECVRSDSGPYP 14765

Query: 352   ASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKF 411
              +A N+ GE+    ++ V    G            T P+ F      +            
Sbjct: 14766 LTARNIVGEVGDVITIQVHDIPGP----------PTGPIKFDEVSSDF------------ 14803

Query: 412   DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSH 471
              V+F  +      G        I ++  E++          + WV+   +  R T   + 
Sbjct: 14804 -VTFSWDPPENDGGV------PISNYVVEMR------QTDSTTWVELATTVIRTTYKATR 14850

Query: 472   LNKEDEGLYTIRVRMGEYY---EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIII 528
             L    E  Y  RV+    Y      ++   V +   ++ G P  P   +     KD + I
Sbjct: 14851 LTTGLE--YQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTP---QVTAVTKDSMTI 14905

Query: 529   SWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVN 588
             SW +P  DGGSPILGY +++ E     W   +   V    F  +GL +G +Y FRV A N
Sbjct: 14906 SWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAEN 14965

Query: 589   KMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTE 648
               G   PS+ SEP+ ALDP +                            PG P  L++T 
Sbjct: 14966 MAGKSKPSKPSEPMLALDPIDP---------------------------PGKPVPLNITR 14998

Query: 649   ATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKS 707
              T   V L W KP    G +   Y VEK +     W + N    +++  F +  L E  +
Sbjct: 14999 HT---VTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILEN-EFTVSGLTEDAA 15054

Query: 708   YCFRVRCSNSAG-VGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAK 766
             Y FRV   N+AG +  PSE ++     D ++ PK              V V ++++   K
Sbjct: 15055 YEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKI------------KVDVKFKDTVILK 15102

Query: 767   ELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDS 826
                 + +EA V  SG+  P       G        +  +   F    VN        +DS
Sbjct: 15103 AGEAFRLEADV--SGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNK---DSTRRDS 15157

Query: 827   EAIEVKAAIGGGVSPDVC-------PALSDEPGGLT--ASRGRVHEASPPTFQKDALLG- 876
              A  + A   GG +  +        P   + P  +T   S   V    PP     A +  
Sbjct: 15158 GAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDH 15217

Query: 877   --------SKPNKPSLPSSSQ--NLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLK 926
                     S+    ++ S  Q   L  T++ K +E +   +     K       +S+P+ 
Sbjct: 15218 YIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAV--NKYGVGEPLESEPVL 15275

Query: 927   KKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREA 986
                   PP PP +       +DSMV+ W  PD  GG+EI  Y V  R   D    +W + 
Sbjct: 15276 AVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERR---DKAGQRWIKC 15332

Query: 987   NVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFK-CEEWTIAVPGPPHSL 1045
             N K +++  YK+S L E   Y+F++ A N AG+ APS  S  +K C+  T+  PGPP + 
Sbjct: 15333 NKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACD--TVFKPGPPGNP 15390

Query: 1046  KCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN-EAAIKNVYLKVRG 1104
             +  +  + S+ + W  P++ G + +TGY V++  A  +ED+W+ +   A +K     + G
Sbjct: 15391 RVLDTSRSSISIAWNKPIYDGGSEITGYMVEI--ALPEEDEWQIVTPPAGLKATSYTITG 15448

Query: 1105  LKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECD--- 1161
             L E   Y  R+ A+N  G+G+P+ + G   AE R    E+ ++ D   V+++   C    
Sbjct: 15449 LTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRL 15508

Query: 1162  ----KMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
                 K  P  E  W++D+  + D  +  +ES  + T +   ++   D G Y   V ++ G
Sbjct: 15509 FVPIKGRPAPEVKWARDHGESLD--KASIESTSSYTLLIVGNVNRFDSGKYILTVENSSG 15566

Query: 1218  IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKV-N 1276
               S+++             +     T     +L V+ + K  V        L G +K+ N
Sbjct: 15567 SKSAFV-------------NVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKN 15613

Query: 1277  YIFNEKE 1283
             YI  ++E
Sbjct: 15614 YIVEKRE 15620



 Score =  236 bits (602), Expect = 1e-61
 Identities = 213/769 (27%), Positives = 319/769 (41%), Gaps = 97/769 (12%)

Query: 398   GYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPE-----------IQWYRN 446
             G   +F +   +   VS  RE E +      ++ P+I    PE           I+ +  
Sbjct: 12494 GKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKI--LMPEQITIKAGKKLRIEAHVY 12551

Query: 447   GVPLSPSKWVQTLWSGERATLTFSHL----------------NKEDEGLYTIRVRMGEYY 490
             G P    KW +    GE   +T SHL                 ++D G Y++        
Sbjct: 12552 GKPHPTCKWKK----GEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGT 12607

Query: 491   EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCE 550
             +     V V DA     G P  P D+  ++A  D   +SW  P  DGGS I  Y ++KC+
Sbjct: 12608 DTQKIKVVVMDAP----GPPQPPFDISDIDA--DACSLSWHIPLEDGGSNITNYIVEKCD 12661

Query: 551   VGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEK 610
             V    W     +  K +   V  LI G+ YIFRVRA N+ GI  P    + VA       
Sbjct: 12662 VSRGDWVTALASVTKTS-CRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMVAQFPFG-- 12718

Query: 611   ARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM 670
                                       VP  P +  VT+  +  + ++W  P   G   I+
Sbjct: 12719 --------------------------VPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPII 12752

Query: 671   -YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEV 729
              Y +E+ E  +  W + N  L V+S  +    L EG  Y FR+   N AG   PS+ TE 
Sbjct: 12753 GYLIERKERNSLLWVKANDTL-VRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEY 12811

Query: 730   TVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNN 789
                   +D P  P  I  +++T  S++ +  +     +++GY++EA      KW  CN  
Sbjct: 12812 VTARMPVDPPGKPEVIDVTKST-VSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTA 12870

Query: 790   P--VKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSP--DVCP 845
             P  +    +T  GL     Y FR  A  A  +S  S+ S+ + + A     V P  D+  
Sbjct: 12871 PHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAE---NVPPRIDLSV 12927

Query: 846   ALSD----EPGGLTASRGRVHEASPPT--FQKDALLGSKPNKPSLPSSSQNLGQTEVSKV 899
             A+      + G        V     PT  ++KD  L  KP +    +  +NL   E+  V
Sbjct: 12928 AMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTL-LKPAEGIKMAMQRNLCTLELFSV 12986

Query: 900   SETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDK 959
             +     + T   + ++    SKS  +K K     P PP  +   + + D  +L W+ P +
Sbjct: 12987 NRKDSGDYTITAENSSG---SKSATIKLKV-LDKPGPPASVKINKMYSDRAMLSWEPPLE 13042

Query: 960   IGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 1019
              GG+EIT Y V+ RE        W + +   V   +  +  L E   YQF++ A N  G+
Sbjct: 13043 DGGSEITNYIVDKRETSRP---NWAQVSA-TVPITSCSVEKLIEGHEYQFRICAENKYGV 13098

Query: 1020  GAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE 1079
             G P           +    PG       S + KD + + WKPP   G +P+TGY ++ +E
Sbjct: 13099 GDPVFTEPAIAKNPYD--PPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRE 13156

Query: 1080  AKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSD 1128
              +A    W  +N   I    LK  GL+EG  Y FRV AIN+AG GKPSD
Sbjct: 13157 TQAVN--WTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSD 13203



 Score =  235 bits (600), Expect = 2e-61
 Identities = 248/1071 (23%), Positives = 420/1071 (39%), Gaps = 153/1071 (14%)

Query: 294   VKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRAS 353
             V+L   IAG P P  +W+     +       +  +E+   +  L I      DT +Y   
Sbjct: 23384 VELVIPIAGRPPPAASWFFAGSKLR---ESERVTVETHTKVAKLTIRETTIRDTGEYTLE 23440

Query: 354   AMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDV 413
               NV G  S    V++    G                     P G     EI   D   +
Sbjct: 23441 LKNVTGTTSETIKVIILDKPGP--------------------PTGPIKIDEI---DATSI 23477

Query: 414   SFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLN 473
             +   E   +  G      P   +   +   +R G       W+    S  R+T  F+ L 
Sbjct: 23478 TISWEPPELDGGA-----PLSGYVVEQRDAHRPG-------WLPVSESVTRSTFKFTRLT 23525

Query: 474   KEDEGLYTI----RVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIIS 529
             + +E ++ +    R  +G Y +       V +  + I   P  P  ++  + ++D + ++
Sbjct: 23526 EGNEYVFRVAATNRFGIGSYLQSE-----VIECRSSIR-IPGPPETLQIFDVSRDGMTLT 23579

Query: 530   WKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNK 589
             W  P  DGGS + GY +++ EV  D W + N  PV   R+  TGL EG  Y  RV A+N 
Sbjct: 23580 WYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINA 23639

Query: 590   MGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEA 649
              G G PSR S+P+ A+DP           AP                 PG P +  VT+ 
Sbjct: 23640 RGSGKPSRPSKPIVAMDPI----------AP-----------------PGKPQNPRVTDT 23672

Query: 650   TRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSY 708
             TR+ V L+W  P   G   +  Y +E  +     W + NT  P K   + L  L +G  Y
Sbjct: 23673 TRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTT-PTKIREYTLTHLPQGAEY 23731

Query: 709   CFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKEL 768
              FRV   N+ G GEP+E      V + L+ P            D  +   ++E    ++ 
Sbjct: 23732 RFRVLACNAGGPGEPAEVPGTVKVTEMLEYP------------DYELDERYQEGIFVRQ- 23778

Query: 769   VGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLV-TGQSYIFRVRAVNAAGLS------- 820
              G  I  ++   GK  P      +G   +   ++ T +++   V      G S       
Sbjct: 23779 -GGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTELVIKEADRGDSGTYDLVL 23837

Query: 821   EYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPN 880
             E     +A+ +K  + G  +    P   D+   +     RV    P       +LG    
Sbjct: 23838 ENKCGKKAVYIKVRVIGSPNSPEGPLEYDD---IQVRSVRVSWRPPADDGGADILGYILE 23894

Query: 881   KPSLPSSSQNLGQTEVSKVSETVQE---------ELTPPPQKAAPQGKSKSDPLKKKTDR 931
             +  +P ++     + V   S  V+           ++   Q    +     +P+  KT  
Sbjct: 23895 RREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPL 23954

Query: 932   APPSPPCDIT-CLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKA 990
              PP PP +    L+  + S+ L W +P   GG+ +TGYY+  +E       KW   N   
Sbjct: 23955 NPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKET---STDKWVRHNKTQ 24011

Query: 991   VSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEV 1050
             ++   Y ++ L  +  YQF++ A N  GL   S  SE   C++     P  P  L+   +
Sbjct: 24012 ITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKD-PFDKPSQPGELEILSI 24070

Query: 1051  RKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVS 1110
              KDS+ LQW+ P   G   + GY+V+ ++  + +  W+  N+  IK+    + GL E   
Sbjct: 24071 SKDSVTLQWEKPECDGGKEILGYWVEYRQ--SGDSAWKKSNKERIKDKQFTIGGLLEATE 24128

Query: 1111  YVFRVRAINQAGVGKPSDLAGPV----VAETRPGTKEVVVNVDDDGVISLNFECDKM-TP 1165
             Y FRV A N+ G+ +P   A  +     +   PG ++ + +V      +    C  +  P
Sbjct: 24129 YEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRP 24188

Query: 1166  KSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLID 1225
               +  W +       S + ++ S G    +T      +D G+Y+C       IA++ + +
Sbjct: 24189 LPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTC-------IATNEVGE 24241

Query: 1226  EEELKRLLALSHEHKFPTVPVK--------SELAVEILEKGQ---VRFWMQAEKLSGNAK 1274
              E   +LL  +     P  P+K        S L + ++  G+      W   +KL  N++
Sbjct: 24242 VETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSE 24301

Query: 1275  VNYIFNEKEI-----------FEGPKYKMHIDRNTGIIEMFME-KLQDEDE 1313
                I N +                 KYK+ +    G ++  ++ ++QD+ +
Sbjct: 24302 NITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPD 24352



 Score =  234 bits (597), Expect = 5e-61
 Identities = 319/1304 (24%), Positives = 521/1304 (39%), Gaps = 194/1304 (14%)

Query: 273   LLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRY 332
             L+  P F +   + TV   E++K+     G P P VTW+K+ VP+       +   ES  
Sbjct: 15772 LVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLK---QTTRVNAESTE 15828

Query: 333   GMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKG------EFDETRFHAGAS 386
                 L I     ED   Y     N  GE     +V+V    G      + DE      A 
Sbjct: 15829 NNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVT----AD 15884

Query: 387   TMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRN 446
             ++ LS+G   Y   S    +  +K D S                                
Sbjct: 15885 SITLSWGPPKYDGGSSINNYIVEKRDTS-------------------------------- 15912

Query: 447   GVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAE- 505
                   + W     +  R T+    L    E  Y  R+     Y + S Y+      A+ 
Sbjct: 15913 -----TTTWQIVSATVARTTIKACRLKTGCE--YQFRIAAENRYGK-STYLNSEPTVAQY 15964

Query: 506   ---IEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDT 562
                + G P  P+      +++D + + W +P  DGGS ++GY +++ E  +  W + N T
Sbjct: 15965 PFKVPGPPGTPVVTL---SSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKT 16021

Query: 563   PVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWT 622
             P+   +F  TGL EG  Y FRV A N +GIG PS+VSE   A DP +             
Sbjct: 16022 PIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDP------------ 16069

Query: 623   GQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTE 681
                            PG P  + VT   R+ V L WK P   G   I  Y VEK E    
Sbjct: 16070 ---------------PGRPEAIIVT---RNSVTLQWKKPTYDGGSKITGYIVEKKELPEG 16111

Query: 682   NWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGV-GEPSEATEVTVVGDKLDIPK 740
              W + +    + +  F +  L E   Y FRV   N+AGV  EPSE+T      D++D P+
Sbjct: 16112 RWMKASFTNIIDT-HFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPR 16170

Query: 741   APGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNN--PVKGSRF-- 796
                  +  +  DT VV + E  K   ++ G  I       G  E  N     +K + F  
Sbjct: 16171 IS---MDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFAT 16227

Query: 797   --TCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGL 854
               +    V   S  + ++A N AG     + S  + VK     G  P   P +     G+
Sbjct: 16228 SLSVKDAVRVDSGNYILKAKNVAG-----ERSVTVNVKVLDRPG--PPEGPVVIS---GV 16277

Query: 855   TASRGRVHEASPPTFQKDA------LLGSKPNKPSLPSSSQNLGQTEVSKVSETVQ-EEL 907
             TA +  +  A  P  Q         ++  +     + +      QT   KV++ ++  E 
Sbjct: 16278 TAEKCTL--AWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEY 16335

Query: 908   TPPPQKAAPQGKSK---SDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAE 964
             T         G  +   S+P+  K     P  P         +DSM++ W++P   GG+E
Sbjct: 16336 TFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSE 16395

Query: 965   ITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSA 1024
             I GY +  R+  +G+  +W   + + + E   +++ L EN  Y+F+V+A N AGL  PS 
Sbjct: 16396 ILGYVLEKRDK-EGI--RWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSP 16452

Query: 1025  VSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKE 1084
              S   K  +  I  PGPP++ K  ++ + S+ L W  P++ G   + GY V+  +    E
Sbjct: 16453 PSAYQKACD-PIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGE 16511

Query: 1085  DQWRGLNE-AAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKE 1143
               W        I    ++V  L E   Y FR+ AIN+AGVG+ +D+ GP++ E +    +
Sbjct: 16512 --WTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPD 16569

Query: 1144  V--------VVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKM 1195
             +        ++N+   G + L F   K  P  E  W K      D+  ++V S  + T +
Sbjct: 16570 IDLDLELRKIINIRAGGSLRL-FVPIKGRPTPEVKWGKVDGEIRDAAIIDVTS--SFTSL 16626

Query: 1196  TFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEIL 1255
                ++   D G Y+  + ++ G  S+++       R+L        P+ PV   L V  +
Sbjct: 16627 VLDNVNRYDSGKYTLTLENSSGTKSAFV-----TVRVL------DTPSPPV--NLKVTEI 16673

Query: 1256  EKGQVRFWMQAEKLSGNAKV-NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEG 1314
              K  V    +   L G +K+ NYI  ++E     K    +  N       +++LQ   EG
Sbjct: 16674 TKDSVSITWEPPLLDGGSKIKNYIVEKREATR--KSYAAVVTNCHKNSWKIDQLQ---EG 16728

Query: 1315  -TYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECN 1373
              +Y F++    A N   + L       + K AE           P     ++ +     +
Sbjct: 16729 CSYYFRV---TAENEYGIGLPAQTADPI-KVAEV----------PQPPGKITVDDVTRNS 16774

Query: 1374  VLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTL--LITEFSKKDAGIYEVILK 1431
             V L          + I+ Y  E +    EK      + +L  +IT  ++ +  ++ V+  
Sbjct: 16775 VSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVITNLTQGEEYLFRVVAV 16834

Query: 1432  DDRGKDKSRLKLVDEAFKELMMEVCKKIALSA------TDLKIQSTAEGIQLYSFVTYYV 1485
             +++G+   R   V    K+L++E   K A S+       DLKI+    G    +      
Sbjct: 16835 NEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPT------ 16888

Query: 1486  EDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKY 1529
                 + W+ +G  ++ + R+    + +   L I E   +D G+Y
Sbjct: 16889 ----ITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQY 16928



 Score =  233 bits (595), Expect = 9e-61
 Identities = 261/1020 (25%), Positives = 403/1020 (39%), Gaps = 115/1020 (11%)

Query: 237   EKKSRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKL 296
             E+K R  ++  K  +  +  T  + +     +  +  ++A   +   ++    E    + 
Sbjct: 17088 ERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARD 17147

Query: 297   HCSIAGWPEPRVTWYKNQVPIN----VHANPGK---YIIESRYGMHTLEINGCDFEDTAQ 349
              C   G PEP +   +N++ +     V+        YI+E R           D  D   
Sbjct: 17148 PCDPPGTPEP-IMVKRNEITLQWTKPVYDGGSMITGYIVEKR-----------DLPDGRW 17195

Query: 350   YRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFE---IH 406
              +AS  NV  E     S + +  + EF     +A  +    S    P       E   I 
Sbjct: 17196 MKASFTNVI-ETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRIS 17254

Query: 407   FDDKF-DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERA 465
              D KF D      GET  L   V   P      P I+W R    +  S   +   +  +A
Sbjct: 17255 MDPKFRDTIVVNAGETFRLEADVHGKP-----LPTIEWLRGDKEIEESARCEIKNTDFKA 17309

Query: 466   TLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDY 525
              L      + D G Y +R       + +   V V D      G P  P+ V  + + K  
Sbjct: 17310 LLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRP----GPPEGPVQVTGVTSEK-- 17363

Query: 526   IIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVR 585
               ++W  P  DGGS I  Y ++K E    +W+      V  +   VT L+EG  Y+FR+ 
Sbjct: 17364 CSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNS-LKVTKLLEGNEYVFRIM 17422

Query: 586   AVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLS 645
             AVNK G+G P   S PV   +P                            ++PGPP  L 
Sbjct: 17423 AVNKYGVGEPLE-SAPVLMKNPF---------------------------VLPGPPKSLE 17454

Query: 646   VTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAE 704
             VT   +  + + W +P    G E I Y VEK +     W + N    +   R  +  L E
Sbjct: 17455 VTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRR-ITDLRLRVTGLTE 17513

Query: 705   GKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES-- 762
                Y FRV   N+AGVGEPS AT      D +  P  P        T  S+ ++W +   
Sbjct: 17514 DHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIY 17573

Query: 763   KDAKELVGYYIEASVAGSGKWEPCN-NNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSE 821
                 E++GY +E   A   +W+       ++ +RF    L   Q Y  RV A+N  GL E
Sbjct: 17574 DGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGE 17633

Query: 822   YSQDSEAIEVKAAIGGGVSPD---VCPAL---SDEPGGLTASRG---RVH---EASP-PT 868
                         ++ G V P+     P L   S+   G+    G   R+H   +  P P 
Sbjct: 17634 ----------ATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPE 17683

Query: 869   FQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKK 928
                    G   +K  +    + +  T++S +    + +      K      SKS  +  K
Sbjct: 17684 ITWSREEGEFTDKVQI---EKGVNYTQLS-IDNCDRNDAGKYILKLENSSGSKSAFVTVK 17739

Query: 929   TDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANV 988
                  P PP ++   E  +DS  L W+ P   GGA++  Y ++ RE       +   ANV
Sbjct: 17740 V-LDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRE-----STRKAYANV 17793

Query: 989   KA-VSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKC 1047
              +  S+ ++K+ NL E  +Y F+V A N  G+G P    +  K  E     P PP  +  
Sbjct: 17794 SSKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAE----PPSPPGKVTL 17849

Query: 1048  SEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKE 1107
             ++V + S  L W+ P H G + V GY V+++      ++W  + E+ + N    V GL  
Sbjct: 17850 TDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGT--EKWSIVAESKVCNAV--VTGLSS 17905

Query: 1108  GVSYVFRVRAINQAGVGKPSDLAGPVVAE---TRPGTKEVVVNVDDDGVISLNFECDKM- 1163
             G  Y FRV+A N+ G   P  L  PV+A+    +P  K             L  E   + 
Sbjct: 17906 GQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIG 17965

Query: 1164  TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1223
              P+   SW KD    + + R+ VE     T +  K+   DD G Y+   T++ G A+  L
Sbjct: 17966 RPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENL 18025



 Score =  233 bits (594), Expect = 1e-60
 Identities = 253/971 (26%), Positives = 389/971 (40%), Gaps = 143/971 (14%)

Query: 290   EKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQ 349
             E  N +L   I G P P V+W K + P+   A   +  +ES     TL +  C   D  +
Sbjct: 13624 ENSNFRLKIPIKGKPAPSVSWKKGEDPL---ATDTRVSVESSAVNTTLIVYDCQKSDAGK 13680

Query: 350   YRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFG-VTPYGYASRFEIHFD 408
             Y  +  NV G      S+ V              G  T P+ F  VT      ++    D
Sbjct: 13681 YTITLKNVAGTKEGTISIKVVG----------KPGIPTGPIKFDEVTAEAMTLKWAPPKD 13730

Query: 409   DKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLT 468
             D      G E           IT  I   +  +           +KWV    + ++ T  
Sbjct: 13731 DG-----GSE-----------ITNYILEKRDSVN----------NKWVTCASAVQKTTFR 13764

Query: 469   FSHLNKEDEGLYTIRVRMGEYY---EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDY 525
              + L++  E  YT RV     Y   E   +   V     ++  AP  P     ++   D 
Sbjct: 13765 VTRLHEGME--YTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPP---NIVDVRHDS 13819

Query: 526   IIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVR 585
             + ++W  P   GGSPI GY ++  E  +  W + N TP++   F VTGL EG  Y FRV 
Sbjct: 13820 VSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVM 13879

Query: 586   AVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLS 645
             A+N  G+G PS  SEPV ALDP +                              PP    
Sbjct: 13880 AINLAGVGKPSLPSEPVVALDPID------------------------------PPGKPE 13909

Query: 646   VTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAE 704
             V   TR+ V L W +P    GH+   Y VEK +  +++W + N  + V    F + DL E
Sbjct: 13910 VINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKAN-HVNVPECAFTVTDLVE 13968

Query: 705   GKSYCFRVRCSNSAG-VGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESK 763
             G  Y FR+R  N+AG +  PSE+TE  +  D+ +   AP  ++     D   +    ++ 
Sbjct: 13969 GGKYEFRIRAKNTAGAISAPSESTETIICKDEYE---APTIVLDPTIKDGLTI----KAG 14021

Query: 764   DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYS 823
             D   L    I         W     + ++ S  T     T  S +  ++        EY+
Sbjct: 14022 DTIVLNAISILGKPLPKSSWSKAGKD-IRPSDIT-QITSTPTSSMLTIKYATRKDAGEYT 14079

Query: 824   QDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPS 883
                  I      G  V   V   + D PG      G V E S  + +K  L  + P +  
Sbjct: 14080 -----ITATNPFGTKVE-HVKVTVLDVPG----PPGPV-EISNVSAEKATLTWTPPLEDG 14128

Query: 884   -LPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQ-----------------GKSK---S 922
               P  S  L + E S++  TV  E     +  A +                 GK +   S
Sbjct: 14129 GSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQS 14188

Query: 923   DPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGK 982
             +P+K      PP PP         +++  + WK+P   GG+EITGY+V  RE       +
Sbjct: 14189 EPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSL---R 14245

Query: 983   WREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPP 1042
             W  A    VS+   K++ L+E   Y+F+V+A N AG+G PS  S+    ++     PGPP
Sbjct: 14246 WVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKD-AAYPPGPP 14304

Query: 1043  HSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQW-RGLNEAAIKNVYLK 1101
              +   ++  K S  L W  P + G   +TGY V+    K  ++ W +     A++     
Sbjct: 14305 SNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVE--HQKVGDEAWIKDTTGTALRITQFV 14362

Query: 1102  VRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPG---------TKEVVVNVDDDG 1152
             V  L+    Y FR+ AIN AGVG+P+ +    + E              + +VV     G
Sbjct: 14363 VPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRA---G 14419

Query: 1153  VISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDV 1212
             +    F   K  P  E +W+KD ++ ++  R  +E+  + T +   +    D G +   +
Sbjct: 14420 LSIRIFVPIKGRPAPEVTWTKDNINLKN--RANIENTESFTLLIIPECNRYDTGKFVMTI 14477

Query: 1213  TDTDGIASSYL 1223
              +  G  S ++
Sbjct: 14478 ENPAGKKSGFV 14488



 Score =  233 bits (593), Expect = 2e-60
 Identities = 236/910 (25%), Positives = 381/910 (41%), Gaps = 117/910 (12%)

Query: 404   EIHFDDKF-DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSG 462
             +I  D KF D    + GE   L   V   P      P ++W ++G  L  +  ++   + 
Sbjct: 15088 KIKVDVKFKDTVILKAGEAFRLEADVSGRPP-----PTMEWSKDGKELEGTAKLEIKIAD 15142

Query: 463   ERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEAN 522
                 L      + D G YT+       + ++   V V D      G P  PL V   E  
Sbjct: 15143 FSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRP----GPPEGPLAVT--EVT 15196

Query: 523   KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIF 582
              +  ++SW  P  DGG+ I  Y + K E    +W+    + V+  +  VT L++G  YIF
Sbjct: 15197 SEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVA-SEVQVTKLKVTKLLKGNEYIF 15255

Query: 583   RVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPT 642
             RV AVNK G+G P   SEPV A++P                              P PP 
Sbjct: 15256 RVMAVNKYGVGEPLE-SEPVLAVNPYGP---------------------------PDPPK 15287

Query: 643   DLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFD 701
             +  VT  T+  +V+ W  P    G E I Y VE+ +   + W + N +  +   R+ +  
Sbjct: 15288 NPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKT-LTDLRYKVSG 15346

Query: 702   LAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEE 761
             L EG  Y FR+   N+AG+  PS  +      D +  P  PG       + +S+ ++W +
Sbjct: 15347 LTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNK 15406

Query: 762   S--KDAKELVGYYIEASVAGSGKWEPCNNNP-VKGSRFTCHGLVTGQSYIFRVRAVNAAG 818
                    E+ GY +E ++    +W+       +K + +T  GL   Q Y  R+ A+N+ G
Sbjct: 15407 PIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEG 15466

Query: 819   LSE--------YSQDS---EAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPP 867
             L E         ++D      IE+ A +   V+   C  L          +GR   A   
Sbjct: 15467 LGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRL----FVPIKGR--PAPEV 15520

Query: 868   TFQKDALLGSKPNKPSLPSSSQ-------NLGQTEVSKVSETVQEELTPPPQKAAPQGKS 920
              + +D   G   +K S+ S+S        N+ + +  K   TV+               S
Sbjct: 15521 KWARDH--GESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENS-----------SGS 15567

Query: 921   KSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVP 980
             KS  +  +     P PP D+   E  + S+ L W  P   GG++I  Y V  RE      
Sbjct: 15568 KSAFVNVRV-LDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTR--- 15623

Query: 981   GKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPG 1040
              K          + ++K+  L+E   Y F+V A N  G+G P+  +E  K  E     P 
Sbjct: 15624 -KAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASER----PL 15678

Query: 1041  PPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYL 1100
             PP  +   +V ++S+ L W+ P H G + + GY V+++   +  D+W     A +K    
Sbjct: 15679 PPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGS--DKWATC--ATVKVTEA 15734

Query: 1101  KVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETR--PGTKEVVVNV-----DDDGV 1153
              + GL +G  Y FRV A N+ G+  P  L+ PV+A+    P   +++ N       +D  
Sbjct: 15735 TITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLK 15794

Query: 1154  ISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVT 1213
             + + F   + TP    +W KD V  + + R+  ES  N + +T KD   +D+G Y   +T
Sbjct: 15795 VDVPF-IGRPTPA--VTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLT 15851

Query: 1214  DTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNA 1273
             ++ G A        E   ++ L      PT PVK +   E+        W   +   G++
Sbjct: 15852 NSAGEAI-------ETLNVIVLDKPGP-PTGPVKMD---EVTADSITLSWGPPKYDGGSS 15900

Query: 1274  KVNYIFNEKE 1283
               NYI  +++
Sbjct: 15901 INNYIVEKRD 15910



 Score =  232 bits (592), Expect = 2e-60
 Identities = 212/734 (28%), Positives = 309/734 (42%), Gaps = 93/734 (12%)

Query: 439  PEIQWYRNGVPLS-PSKWVQTLW-----SGERATLTFSHLNKEDEGLYTIRV--RMGEYY 490
            P+I+W +N   +  P+  +Q        S  +  L+     +ED+G YT+    R+G  +
Sbjct: 9056 PKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVF 9115

Query: 491  EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCE 550
                     R+   E+   P+ P ++   +   +   ++W  P  +GGS I  Y IDK +
Sbjct: 9116 ---------RNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRD 9166

Query: 551  VGTD--SWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPA 608
                   W +  +T V+  R+ +  LI    Y FRVRAVNK GI    + S+ V   DP 
Sbjct: 9167 ASRKKAEWEEVTNTAVE-KRYGIWKLIPNGQYEFRVRAVNKYGISDECK-SDKVVIQDPY 9224

Query: 609  EKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEG 668
                                        +PGPP    V   T+  +++SW PP   G   
Sbjct: 9225 R---------------------------LPGPPGKPKVLARTKGSMLVSWTPPLDNGGSP 9257

Query: 669  IM-YFVEKCEAGTENWQRVN----TELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEP 723
            I  Y++EK E G+  W RV+    T++ +K   F +  L EG  Y FR    N+AG+G P
Sbjct: 9258 ITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPP 9317

Query: 724  SEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE-ESKD-AKELVGYYIEASVAGSG 781
            SE ++  V GD +  P  P        T +S+ + W+  +KD    + GY +E    G+ 
Sbjct: 9318 SEPSDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTT 9377

Query: 782  KWEPCNNNPVKGSRFTCHGLVTG----QSYIFRVRAVNAAGLSEYSQDSEAI-------E 830
             W+   N P K    TC  +V      + Y FRV+AVN AG SE S  +  I       E
Sbjct: 9378 DWKRV-NEPDK-LITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEE 9435

Query: 831  VKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQN 890
             +  I  G    +      +       +GR    S   F   A    K     +P  +Q 
Sbjct: 9436 PEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQ- 9494

Query: 891  LGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAP---------PSPPCDIT 941
            L   E S V       +  P  K +  GK       K   +           P PP D+ 
Sbjct: 9495 LETAENSSV-------IIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLK 9547

Query: 942  CLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNL 1001
              +  R S  L WK PD  GG  I GY +  R  IDG    W + N    S   + + +L
Sbjct: 9548 VSDITRGSCRLSWKMPDDDGGDRIKGYVIEKR-TIDG--KAWTKVNPDCGS-TTFVVPDL 9603

Query: 1002 KENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKP 1061
                 Y F+V A N  G+G P    +     +  I  P PP  LK   + K+++ L WKP
Sbjct: 9604 LSEQQYFFRVRAENRFGIGPPVETIQRTTARD-PIYPPDPPIKLKIGLITKNTVHLSWKP 9662

Query: 1062 PVHSGRTPVTGYFVDL---KEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAI 1118
            P + G +PVT Y V+         K++ WR  N+  ++ +   V  L EG  Y FRV+A+
Sbjct: 9663 PKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAV 9722

Query: 1119 NQAGVGKPSDLAGP 1132
            N AGV KPS   GP
Sbjct: 9723 NAAGVSKPSATVGP 9736



 Score =  228 bits (582), Expect = 3e-59
 Identities = 213/797 (26%), Positives = 332/797 (41%), Gaps = 96/797 (12%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVR--MGEYYEQYSAY 496
             P+  W + G  + PS   Q   +   + LT  +  ++D G YTI      G   E     
Sbjct: 14037 PKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVT 14096

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
             V       ++ G P  P+++  + A K    ++W  P  DGGSPI  Y ++K E     W
Sbjct: 14097 VL------DVPGPPG-PVEISNVSAEK--ATLTWTPPLEDGGSPIKSYILEKRETSRLLW 14147

Query: 557   SQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSR 616
             +  ++  ++  R   T LI+G  YIFRV AVN  G G P + SEPV  +D       +  
Sbjct: 14148 TVVSED-IQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQ-SEPVKMVD-------RFG 14198

Query: 617   PSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEK 675
             P                    PGPP    V+  T++   +SWK P   G   I  Y VE+
Sbjct: 14199 P--------------------PGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVER 14238

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
              E  +  W R   + PV   R  +  L EG +Y FRV   N AG+G PSEA++  ++ D 
Sbjct: 14239 REKKSLRWVRA-IKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDA 14297

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEESK--DAKELVGYYIEASVAGSGKW-EPCNNNPVK 792
                P  P     +  T  S  ++W +       E+ GY +E    G   W +      ++
Sbjct: 14298 AYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALR 14357

Query: 793   GSRFTCHGLVTGQSYIFRVRAVNAAGLSEYS--QDSEAIEVKAAIGGGVSPDVCPALSDE 850
              ++F    L T + Y FR+ A+N AG+ E +   D E +E + A    +  ++   L   
Sbjct: 14358 ITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVR 14417

Query: 851   PGG----LTASRGRVHEASPPTFQKDAL-LGSKPNKPSLPSSS----QNLGQTEVSKVSE 901
              G         +GR   A   T+ KD + L ++ N  +  S +        + +  K   
Sbjct: 14418 AGLSIRIFVPIKGR--PAPEVTWTKDNINLKNRANIENTESFTLLIIPECNRYDTGKFVM 14475

Query: 902   TVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIG 961
             T++           P GK       +  D   P P  ++   +  +DS+ L W  P   G
Sbjct: 14476 TIEN----------PAGKKSGFVNVRVLDT--PGPVLNLRPTDITKDSVTLHWDLPLIDG 14523

Query: 962   GAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGA 1021
             G+ IT Y V  RE        +  A  K   +  YK++ L E   Y F+V A N  G+G 
Sbjct: 14524 GSRITNYIVEKREA---TRKSYSTATTKC-HKCTYKVTGLSEGCEYFFRVMAENEYGIGE 14579

Query: 1022  PSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAK 1081
             P+  +E  K  E     P PP SL   ++ K ++ L W  P H G + +TGY ++ +  +
Sbjct: 14580 PTETTEPVKASE----APSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQ--R 14633

Query: 1082  AKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGT 1141
                DQW  +    +K +   VR L EG  Y F+V A+N AG   P + + PV+ + +   
Sbjct: 14634 KGSDQWTHI--TTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRE-SRPVIVKEQTML 14690

Query: 1142  KE----------VVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGN 1191
              E          V+    D+  + +        PK   +W K     + + R+  E+   
Sbjct: 14691 PELDLRGIYQKLVIAKAGDNIKVEIPV---LGRPKPTVTWKKGDQILKQTQRVNFETTAT 14747

Query: 1192  KTKMTFKDLGMDDLGIY 1208
              T +   +    D G Y
Sbjct: 14748 STILNINECVRSDSGPY 14764



 Score =  227 bits (579), Expect = 6e-59
 Identities = 229/893 (25%), Positives = 362/893 (40%), Gaps = 102/893 (11%)

Query: 425   GCRVVITPEIKHFQ-PEIQWYR-------NGVPLSPSKWVQTLWSGERATLTFSHLNKED 476
             G  V I  +IK    P + W++       N  P+     V  L   +  TL      + D
Sbjct: 9759  GTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSD 9818

Query: 477   EGLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPA 534
              GLYTI     +G   ++    V  R       G P  P+  + + A  D + +SW  P 
Sbjct: 9819  TGLYTITAVNNLGTASKEMRLNVLGRP------GPPVGPIKFESVSA--DQMTLSWFPPK 9870

Query: 535   VDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGF 594
              DGGS I  Y I+K E    +W   +  P K   + +  L+EG  Y+FR+ A NK GIG 
Sbjct: 9871  DDGGSKITNYVIEKREANRKTWVHVSSEP-KECTYTIPKLLEGHEYVFRIMAQNKYGIGE 9929

Query: 595   PSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYV 654
             P         LD           S P T + + +        VPG P   +V+  TR+ +
Sbjct: 9930  P---------LD-----------SEPETARNLFS--------VPGAPDKPTVSSVTRNSM 9961

Query: 655   VLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPR----FALFDLAEGKSYC 709
              ++W+ P   G   +  Y++E  +  ++ W+RVN + P+K+      + +  L EG  Y 
Sbjct: 9962  TVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRD-PIKAMTLGVSYKVTGLIEGSDYQ 10020

Query: 710   FRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES-KDA-KE 767
             FRV   N+AGVG  S  ++     D +  P  P   +    T +S  + W    KD   +
Sbjct: 10021 FRVYAINAAGVGPASLPSDPATARDPIAPPGPPFPKVTDW-TKSSADLEWSPPLKDGGSK 10079

Query: 768   LVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSE 827
             + GY +E    G  +WE   +  V+G++    GL  G  Y FRVRAVN AG+ E  + ++
Sbjct: 10080 VTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTD 10139

Query: 828   AIEVKAAIGGGVSPD------VCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNK 881
              IE+K  +   VSPD      V   +    GG+      V    PPT   +    + P +
Sbjct: 10140 VIEMKDRL---VSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQE 10196

Query: 882   PSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDIT 941
              ++ +++  +  + V K  +   + +     K     + K+  +       P   P    
Sbjct: 10197 ATIETTA--ISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTP--FL 10252

Query: 942   CLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNL 1001
                   +S  L W  P+  GG+ IT Y +  RE        W         + A  +  L
Sbjct: 10253 AHNLTNESCKLTWFSPEDDGGSPITNYVIEKRE---SDRRAWTPVTYTVTRQNA-TVQGL 10308

Query: 1002  KENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKP 1061
              +   Y F++AA N  G+G     SE     E  I VP  P  L+  EV K+++ L W P
Sbjct: 10309 IQGKAYFFRIAAENSIGMGPFVETSEALVIRE-PITVPERPEDLEVKEVTKNTVTLTWNP 10367

Query: 1062  PVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQA 1121
             P + G + +  Y ++       E   +  N+  +   Y  V+GLKEG +Y +RV A+N  
Sbjct: 10368 PKYDGGSEIINYVLE-SRLIGTEKFHKVTNDNLLSRKY-TVKGLKEGDTYEYRVSAVNIV 10425

Query: 1122  GVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMT------PKSEFSWSKDY 1175
             G GKPS    P+  +       + ++  D   I +  E   +T      PK + SW KD 
Sbjct: 10426 GQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIRVG-EAFALTGRYSGKPKPKVSWFKDE 10484

Query: 1176  VSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSY----LIDEEELKR 1231
                 +  R  +++      +        D G Y   V ++ G    +    ++D      
Sbjct: 10485 ADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDR----- 10539

Query: 1232  LLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEI 1284
                       P  PV      E+ +   V  W       G+   NYI  +KE+
Sbjct: 10540 ----------PGPPVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEV 10582



 Score =  225 bits (574), Expect = 2e-58
 Identities = 218/877 (24%), Positives = 354/877 (40%), Gaps = 106/877 (12%)

Query: 367   VVVKRYKGEFDETRFHAGASTM-----PLSFGVTPYGYASRFEIHFDDKFDVSFGREGET 421
             V+ +   G F E     GA T      P    + P  Y     +H  + F V     G+ 
Sbjct: 16141 VIARNAAGVFSEPSESTGAITARDEVDPPRISMDPK-YKDTIVVHAGESFKVDADIYGKP 16199

Query: 422   MSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYT 481
             +                P IQW +    LS +  ++   +    +L+     + D G Y 
Sbjct: 16200 I----------------PTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYI 16243

Query: 482   IRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPI 541
             ++ +        +  V V D      G P  P+ +  + A K    ++WK P  DGGS I
Sbjct: 16244 LKAKNVAGERSVTVNVKVLDRP----GPPEGPVVISGVTAEK--CTLAWKPPLQDGGSDI 16297

Query: 542   LGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEP 601
             + Y +++ E     W+   D  V+     VT L+EG  Y FR+ AVNK G+G P   SEP
Sbjct: 16298 INYIVERRETSRLVWTVV-DANVQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLE-SEP 16355

Query: 602   VAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPP 661
             V A +P                            +VP  P    VT  T+  +++ W+ P
Sbjct: 16356 VVAKNPF---------------------------VVPDAPKAPEVTTVTKDSMIVVWERP 16388

Query: 662   GQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGV 720
                G   I+ Y +EK +     W R +  L +   R  +  L E   Y FRV   N+AG+
Sbjct: 16389 ASDGGSEILGYVLEKRDKEGIRWTRCHKRL-IGELRLRVTGLIENHDYEFRVSAENAAGL 16447

Query: 721   GEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVA 778
              EPS  +      D +  P  P        T +SV +SW +       E+ GY +E    
Sbjct: 16448 SEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDV 16507

Query: 779   GSGKWEPCNN-NPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGG 837
               G+W  C     +  +      L+    Y FR+ A+N AG+ E++     I V+  +  
Sbjct: 16508 SVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEA 16567

Query: 838   ---GVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQ----- 889
                 +  ++   ++   GG       +     P  +   + G   +   +  +S      
Sbjct: 16568 PDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTSLV 16627

Query: 890   --NLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFR 947
               N+ + +  K + T++             G   +    +  D   PSPP ++   E  +
Sbjct: 16628 LDNVNRYDSGKYTLTLENS----------SGTKSAFVTVRVLDT--PSPPVNLKVTEITK 16675

Query: 948   DSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVY 1007
             DS+ + W+ P   GG++I  Y V  RE       K   A V    + ++KI  L+E   Y
Sbjct: 16676 DSVSITWEPPLLDGGSKIKNYIVEKREATR----KSYAAVVTNCHKNSWKIDQLQEGCSY 16731

Query: 1008  QFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGR 1067
              F+V A N  G+G P+  ++  K  E    VP PP  +   +V ++S+ L W  P H G 
Sbjct: 16732 YFRVTAENEYGIGLPAQTADPIKVAE----VPQPPGKITVDDVTRNSVSLSWTKPEHDGG 16787

Query: 1068  TPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPS 1127
             + +  Y V++ +AK  E +W     A +K++   +  L +G  Y+FRV A+N+ G   P 
Sbjct: 16788 SKIIQYIVEM-QAKHSE-KWSEC--ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPR 16843

Query: 1128  DLAGPVVA-------ETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTED 1180
              LA P+VA       + +P      V V  D  I +        PK   +W+KD +  + 
Sbjct: 16844 SLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISG---RPKPTITWTKDGLPLKQ 16900

Query: 1181  SPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
             + R+ V    + T ++ K+   DD G Y   V +  G
Sbjct: 16901 TTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVG 16937



 Score =  224 bits (572), Expect = 4e-58
 Identities = 288/1312 (21%), Positives = 517/1312 (39%), Gaps = 206/1312 (15%)

Query: 276   APEFIIKP------RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIE 329
             A + +I+P       S++V   +++K+   I+G P+P +TW K+ +P+       +  + 
Sbjct: 16851 AKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLK---QTTRINVT 16907

Query: 330   SRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRY----KG--EFDETRFHA 383
                 + TL I     +D  QY  +  NV G+ +A   +V        KG  +FD+     
Sbjct: 16908 DSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDV---- 16963

Query: 384   GASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQW 443
              A ++ LS+    Y    +   +   K D +                             
Sbjct: 16964 SAESITLSWNPPLYTGGCQITNYIVQKRDTT----------------------------- 16994

Query: 444   YRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV---FVR 500
                      + W     +  R TL  + L    E  Y  R+     Y Q  A      V 
Sbjct: 16995 --------TTVWDVVSATVARTTLKVTKLKTGTE--YQFRIFAENRYGQSFALESDPIVA 17044

Query: 501   DADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCN 560
                 +  G P  P        +KD ++I W +P  +GGSP++GY +++ E  +  W++ N
Sbjct: 17045 QYPYKEPGPPGTPF---ATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVN 17101

Query: 561   DTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAP 620
              T +   +F    L EG  Y FRV A N +G+G  S+ SE   A DP +           
Sbjct: 17102 KTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDP---------- 17151

Query: 621   WTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAG 679
                              PG P  + V    R+ + L W  P   G   I  Y VEK +  
Sbjct: 17152 -----------------PGTPEPIMVK---RNEITLQWTKPVYDGGSMITGYIVEKRDLP 17191

Query: 680   TENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAG-VGEPSEATEVTVVGDKLDI 738
                W + +    +++ +F +  L E + Y FRV   N+AG + +PS++T      D++++
Sbjct: 17192 DGRWMKASFTNVIET-QFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVEL 17250

Query: 739   PKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEAS--VAGSGKWEPCNNNPVKGSRF 796
             P+     +  +  DT VV + E  +   ++ G  +     + G  + E      +K + F
Sbjct: 17251 PRIS---MDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDF 17307

Query: 797   TCHGLVT------GQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGG-----GVSPDVC- 844
                 +V       G  YI  +RA N AG   +  + + ++      G     GV+ + C 
Sbjct: 17308 KALLIVKDAIRIDGGQYI--LRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCS 17365

Query: 845   ----PALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVS 900
                 P L D  GG   S   V +          ++ S+    SL  +    G   V ++ 
Sbjct: 17366 LTWSPPLQD--GGSDISHYVVEKRETSRLAW-TVVASEVVTNSLKVTKLLEGNEYVFRIM 17422

Query: 901   ETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKI 960
                +  +  P + A         P+  K     P PP  +      +DSM + W +PD  
Sbjct: 17423 AVNKYGVGEPLESA---------PVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSD 17473

Query: 961   GGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLG 1020
             GG+EI GY V  R+   G+  +W + N + +++   +++ L E+  Y+F+V+A N AG+G
Sbjct: 17474 GGSEIIGYIVEKRD-RSGI--RWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVG 17530

Query: 1021  APSAVSECFK-CEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE 1079
              PS  +  +K C+   +  PGPP +    +  K+S+ L W  P++ G + + GY V++  
Sbjct: 17531 EPSPATVYYKACD--PVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEI-- 17586

Query: 1080  AKAKEDQWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETR 1138
              KA E++W+ +  +  ++    ++  L E   Y  RV A+N+ G+G+ + + G V  E +
Sbjct: 17587 CKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDK 17646

Query: 1139  PGTKE----------VVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVES 1188
                 E          +VV       I + F   K  P  E +WS++    E + ++++E 
Sbjct: 17647 LEAPELDLDSELRKGIVVRAGGSARIHIPF---KGRPTPEITWSRE--EGEFTDKVQIEK 17701

Query: 1189  KGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKS 1248
               N T+++  +   +D G Y   + ++ G  S+++  +                T     
Sbjct: 17702 GVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVK-------------VLDTPGPPQ 17748

Query: 1249  ELAVEILEKGQVRFWMQAEKLSGNAKV-NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEK 1307
              LAV+ + K       +   + G AKV NY+ +++E     K   ++          +E 
Sbjct: 17749 NLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRE--STRKAYANVSSKCSKTSFKVEN 17806

Query: 1308  LQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWE 1367
             L   +   Y F++           V   D  K  +               P     ++  
Sbjct: 17807 L--TEGAIYYFRVMAENEFGVGVPVETVDAVKAAEP--------------PSPPGKVTLT 17850

Query: 1368  VTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDF--KDGICTLLITEFSKKDAGI 1425
                + +  L  +       + ++ Y  E +    EK     +  +C  ++T  S      
Sbjct: 17851 DVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVTGLSSGQEYQ 17910

Query: 1426  YEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIAL------SATDLKIQSTAEGIQLYS 1479
             + V   +++GK   R+  V    K+L ++   K+        +  DLKI+    G    +
Sbjct: 17911 FRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPN 17970

Query: 1480  FVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVM 1531
                       ++W  +G  ++ + RV    T     L I E   +D GKY +
Sbjct: 17971 ----------ISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTV 18012



 Score =  219 bits (558), Expect = 2e-56
 Identities = 202/716 (28%), Positives = 292/716 (40%), Gaps = 101/716 (14%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTP-VKFAR 568
             P  P + + L+ ++  I I+W +P  DGGS I GY ++      D W        +K   
Sbjct: 15384 PGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATS 15443

Query: 569   FPVTGLIEGRSYIFRVRAVNKMGIGFPS----------RVSEPVAALD------------ 606
             + +TGL E + Y  R+ A+N  G+G P+          R+  P   LD            
Sbjct: 15444 YTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRAC 15503

Query: 607   ------------PA-------------EKARLKSRPSAPW----------TGQIIVTEEE 631
                         PA             +KA ++S  S             +G+ I+T E 
Sbjct: 15504 CTLRLFVPIKGRPAPEVKWARDHGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVEN 15563

Query: 632   PSEGI----------VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGT 680
              S              PGPP DL V E T++ V L+W PP   G   I  Y VEK E+  
Sbjct: 15564 SSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTR 15623

Query: 681   ENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPK 740
             + +  V T     S  + +  L EG SY FRV   N  G+G P+E  E     ++   P 
Sbjct: 15624 KAYSTVATNCHKTS--WKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASER---PL 15678

Query: 741   APGKIIPSRNTDTSVVVSWE--ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTC 798
              PGKI     T  SV +SWE  E      ++GY +E    GS KW  C    VK +  T 
Sbjct: 15679 PPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATCAT--VKVTEATI 15736

Query: 799   HGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASR 858
              GL+ G+ Y FRV A N  G+S+  Q S  +  K  +       + PA        T   
Sbjct: 15737 TGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLV-------IPPAFKLLFNTFTVLA 15789

Query: 859   GRVHEASPPTFQK--DALLGSKPNKPSLPSSSQNLGQTE---VSKVSETVQEELTPPPQK 913
             G   +   P   +   A+   K N P   ++  N   TE   +  + +  +E++     K
Sbjct: 15790 GEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVK 15849

Query: 914   AAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYR 973
                      + L       P  P   +   E   DS+ L W  P   GG+ I  Y V  R
Sbjct: 15850 LTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKR 15909

Query: 974   EVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEE 1033
                D     W+  +   V+    K   LK    YQF++AA N    G  + ++      +
Sbjct: 15910 ---DTSTTTWQIVSA-TVARTTIKACRLKTGCEYQFRIAAENR--YGKSTYLNSEPTVAQ 15963

Query: 1034  WTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEA 1093
             +   VPGPP +   +   +DS+ +QW  P+  G + V GY ++ KE  +    W  LN+ 
Sbjct: 15964 YPFKVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNS--ILWVKLNKT 16021

Query: 1094  AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAE---TRPGTKEVVV 1146
              I     K  GL+EGV Y FRV A N  G+GKPS ++   VA      PG  E ++
Sbjct: 16022 PIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAII 16077



 Score =  219 bits (557), Expect = 2e-56
 Identities = 204/808 (25%), Positives = 322/808 (39%), Gaps = 89/808 (11%)

Query: 439   PEIQWYRN--GVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAY 496
             PE+ W ++     L+ S  V+     + +  + +   + D G Y +           +A 
Sbjct: 11859 PEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATN-------TAG 11911

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
              FV  A   +   P    ++K ++ + D   + W  P  DGG  I  Y ++KCE     W
Sbjct: 11912 SFVAYATVNVLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVW 11971

Query: 557   SQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSR 616
             S  + T V      VT LIEG  YIFRVRA NK+G G P+  S+PV A    +K      
Sbjct: 11972 STYSAT-VLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTE-SKPVIAKTKYDK------ 12023

Query: 617   PSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEK 675
                                  PG P    VT+ ++  + + W PP   G + I  YF+EK
Sbjct: 12024 ---------------------PGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEK 12062

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
              E  +  W  VN +  +   R  + +L     Y FRV+  N  G+GEPS  +   V  D 
Sbjct: 12063 KEKHSTRWVPVN-KSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDP 12121

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIE-----ASVAGSGKWEPCN- 787
             ++ P  P        T  S+ + W +        ++GY +E     A  +    W+ CN 
Sbjct: 12122 IEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNA 12181

Query: 788   NNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPAL 847
                +    FT   L   Q Y FRV A N  G+   ++  EAI+ K  +     P++    
Sbjct: 12182 AAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEIL---EPPEI---- 12234

Query: 848   SDEPGGLTASRGR--VHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSET--- 902
                   L AS  +  +  A  P      L      +P+   + + +G   V +  +    
Sbjct: 12235 -----DLDASMRKLVIVRAGCPI----RLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLV 12285

Query: 903   -VQEELTPPPQKAAPQGKSKSDPLKKKTDRA---------PPSPPCDITCLESFRDSMVL 952
                  L  P       GK     +    ++A          P P  D+   +  + S  +
Sbjct: 12286 DTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHV 12345

Query: 953   GWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVA 1012
              W  P+  GG+++T Y V  RE       K        V + ++ ++NL     Y F+V 
Sbjct: 12346 SWAPPENDGGSQVTHYIVEKRE----ADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVT 12401

Query: 1013  AMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTG 1072
             A+N  G G P+ V +     +  ++ P PP  L+ +E+ K+S  L W PP+  G   + G
Sbjct: 12402 AVNEYGPGVPTDVPKPVLASD-PLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDG 12460

Query: 1073  YFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGP 1132
             Y    +E +   D+W     + +K++ L V GLKEG  Y FRV A N  GV  P +  G 
Sbjct: 12461 YITSYREEEQPADRW--TEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGV 12518

Query: 1133  VVAETRPGTKEVVV--NVDDDGVISLNFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESK 1189
               A+ +    ++++   +       L  E      P     W K       S  L V   
Sbjct: 12519 YEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKA 12578

Query: 1190  GNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
              + + +  KD+   D G YS    ++ G
Sbjct: 12579 DSSSILIIKDVTRKDSGYYSLTAENSSG 12606



 Score =  216 bits (551), Expect = 1e-55
 Identities = 206/784 (26%), Positives = 323/784 (41%), Gaps = 104/784 (13%)

Query: 475   EDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPA 534
             ED G+Y++ V      +  S  V V D        P  P D++  E  KD   ++WK+P 
Sbjct: 10910 EDGGIYSLTVENPAGSKTVSVKVLVLDK-------PGPPRDLEVSEIRKDSCYLTWKEPL 10962

Query: 535   VDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGF 594
              DGGS I  Y +++ +V +  WS  + T  K + F    L EG  Y+FRV A N+ G G 
Sbjct: 10963 DDGGSVITNYVVERRDVASAQWSPLSATSKKKSHF-AKHLNEGNQYLFRVAAENQYGRGP 11021

Query: 595   PSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYV 654
                  +P+ ALDP                              PGPP DL   +  ++ V
Sbjct: 11022 FVETPKPIKALDPLHP---------------------------PGPPKDLHHVDVDKTEV 11054

Query: 655   VLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVR 713
              L W  P + G   I  Y VE  E GT++W +  T   V +    +  L +GK+Y FRV+
Sbjct: 11055 SLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKT---VTNLECVVTGLQQGKTYRFRVK 11111

Query: 714   CSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYI 773
               N  G+G P   T + +   +  +P       PS   D  ++                I
Sbjct: 11112 AENIVGLGLPD--TTIPIECQEKLVP-------PSVELDVKLIEGLVVKAGTTVRFPAII 11162

Query: 774   EASVAGSGKWEPCNNNPVKGSRFT--------------CHGLVTGQSYIFRVRAVNAAGL 819
                   + KW    +       +T              C    TG+   +++   NAAG 
Sbjct: 11163 RGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGE---YQITVSNAAGS 11219

Query: 820   SEYSQDSEAIEVKAAIGGGVSP-DVCP---ALSDEP----GGLTASRGRVHEASPPTFQK 871
                +     ++V     G ++  DV P    +S +P    GG       V +      +K
Sbjct: 11220 KTVAVHLTVLDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDT---RK 11276

Query: 872   DA--LLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKT 929
             D   ++ S  +K  L       G   V +V    +  + PP           S P   K 
Sbjct: 11277 DTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENKIGVGPPLD---------STPTVAKH 11327

Query: 930   DRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVK 989
               +PPSPP      +   ++  + W  P   GG+ ITGYY+  RE    V GKW   N  
Sbjct: 11328 KFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERRE----VTGKWVRVNKT 11383

Query: 990   AVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFK-CEEWTIAVPGPPHSLKCS 1048
              +++  ++++ L E   Y+F+V A N+AGL  PS  S+  K C    I  PGPP + K  
Sbjct: 11384 PIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACR--PIKPPGPPINPKLK 11441

Query: 1049  EVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN-EAAIKNVYLKVRGLKE 1107
             +  +++  L W  P+  G +P+ GY V+ +  K    QW  +N +  I+    +V GL E
Sbjct: 11442 DKSRETADLVWTKPLSDGGSPILGYVVECQ--KPGTAQWNRINKDELIRQCAFRVPGLIE 11499

Query: 1108  GVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLN-------FEC 1160
             G  Y FR++A N  G G+P +LA  V+A+      EV ++V    VI++           
Sbjct: 11500 GNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILAR 11559

Query: 1161  DKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIAS 1220
              K  P+ + +W+K+        R+++     + ++  K+    D G Y     ++ G A 
Sbjct: 11560 VKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQ 11619

Query: 1221  SYLI 1224
                I
Sbjct: 11620 GSAI 11623



 Score =  216 bits (550), Expect = 1e-55
 Identities = 215/827 (25%), Positives = 330/827 (39%), Gaps = 99/827 (11%)

Query: 417   REGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKED 476
             R G TM L   V   P      P+I W +  V L     +    +     L   ++NK D
Sbjct: 13334 RAGVTMRLYVPVKGRPP-----PKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYD 13388

Query: 477   EGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVD 536
              G Y + +      ++Y+  V V D        P  P++V   E +KD   ++W+ P +D
Sbjct: 13389 AGKYILTLENSCGKKEYTIVVKVLDT-------PGPPVNVTVKEISKDSAYVTWEPPIID 13441

Query: 537   GGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPS 596
             GGSPI+ Y + K +    SWS    T      F V  L EG+SY FRV A N+ GIG P 
Sbjct: 13442 GGSPIINYVVQKRDAERKSWSTVT-TECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPG 13500

Query: 597   RVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVL 656
                + V A                                 PGP  DL V   ++S   +
Sbjct: 13501 ETRDAVKASQ------------------------------TPGPVVDLKVRSVSKSSCSI 13530

Query: 657   SWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSN 716
              WK P   G   I+ +V         WQRV   L   S +++  DL EGK Y FRV   N
Sbjct: 13531 GWKKPHSDGGSRIIGYVVDFLTEENKWQRVMKSL---SLQYSAKDLTEGKEYTFRVSAEN 13587

Query: 717   SAGVGEPSEATEVT---VVGDKLDIPKAPGKIIPSRNTDT-----------SVVVSWEES 762
               G G PSE T V    VV   LD+   P     ++               +  VSW++ 
Sbjct: 13588 ENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKG 13647

Query: 763   KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEY 822
             +D        +      S +    N   +    + C     G+   + +   N AG  E 
Sbjct: 13648 EDP-------LATDTRVSVESSAVNTTLIV---YDCQKSDAGK---YTITLKNVAGTKE- 13693

Query: 823   SQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKP 882
                + +I+V    G    P     ++ E   L  +  +    S  T        S  NK 
Sbjct: 13694 --GTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKW 13751

Query: 883   SLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKS-KSDPLKKKTDRAPPSPPCDIT 941
                +S+       V+++ E ++       +     G+  KS+P+  +     P  P    
Sbjct: 13752 VTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPN 13811

Query: 942   CLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNL 1001
              ++   DS+ L W  P K GG+ ITGY++ ++E    +   W+ AN   +    +K++ L
Sbjct: 13812 IVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLL---WKRANKTPIRMRDFKVTGL 13868

Query: 1002  KENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKP 1061
              E + Y+F+V A+N+AG+G PS  SE     +  I  PG P  +    + ++S+ L W  
Sbjct: 13869 TEGLEYEFRVMAINLAGVGKPSLPSEPVVALD-PIDPPGKPEVI---NITRNSVTLIWTE 13924

Query: 1062  PVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQA 1121
             P + G   +TGY V+ ++  +K   W   N   +      V  L EG  Y FR+RA N A
Sbjct: 13925 PKYDGGHKLTGYIVEKRDLPSK--SWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTA 13982

Query: 1122  G-VGKPSDLAGPVVAETR---------PGTKE-VVVNVDDDGVISLNFECDKMTPKSEFS 1170
             G +  PS+    ++ +           P  K+ + +   D  V++      K  PKS  S
Sbjct: 13983 GAISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKS--S 14040

Query: 1171  WSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
             WSK       S   ++ S    + +T K     D G Y+   T+  G
Sbjct: 14041 WSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFG 14087



 Score =  216 bits (550), Expect = 1e-55
 Identities = 203/835 (24%), Positives = 345/835 (41%), Gaps = 98/835 (11%)

Query: 411   FDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFS 470
             FD    + GE++ +   V   P      P + W+++GV +     ++        +L   
Sbjct: 21593 FDGLIIKSGESLRIKALVQGRPV-----PRVTWFKDGVEIEKRMNMEITDVLGSTSLFVR 21647

Query: 471   HLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISW 530
                ++  G+YT+  +      +    V V+D   ++ G       ++      + + + W
Sbjct: 21648 DATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGP------IRFTNITGEKMTLWW 21701

Query: 531   KQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKM 590
               P  DG +PI  Y I+K E    +W+   D   +   +    LI G  Y FRV AVNK 
Sbjct: 21702 DAPLNDGCAPITHYIIEKRETSRLAWALIEDK-CEAQSYTAIKLINGNEYQFRVSAVNKF 21760

Query: 591   GIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEAT 650
             G+G P   S+PV A                   QI  T        VP  P     +  T
Sbjct: 21761 GVGRPLD-SDPVVA-------------------QIQYT--------VPDAPGIPEPSNIT 21792

Query: 651   RSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYC 709
              + + L+W +P    G E   Y +E+ E  +  W +V ++ P+   RF +  L EG  Y 
Sbjct: 21793 GNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYE 21852

Query: 710   FRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKE 767
             F V   N+AGVG  S  + +    + ++ P  P  +  +  + T+V + W +       E
Sbjct: 21853 FHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGME 21912

Query: 768   LVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSE 827
             ++GY IE   A  G W   N      +R+T   L  G+ Y FRV A+N AG  +  + + 
Sbjct: 21913 IIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTG 21972

Query: 828   AIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRV-----HEASP-PT---FQKDALLGSK 878
              I+   A+    +P++    + +   +  +   +     ++  P PT    + D+ L  +
Sbjct: 21973 TIK---AVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLR 22029

Query: 879   PNKPSLPSSS----QNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPP 934
              +  +  S S    +N  + +  K + TV+               SKS     K     P
Sbjct: 22030 ADIHTTDSFSTLTVENCNRNDAGKYTLTVEN-----------NSGSKSITFTVKV-LDTP 22077

Query: 935   SPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEE 994
              PP  IT  +  R S  L W  P   GGA I  Y V  RE        W+  + K  + +
Sbjct: 22078 GPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKRE---ASRRSWQVISEKC-TRQ 22133

Query: 995   AYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDS 1054
              +K+++L E + Y F+V+A+N  G+G P  + E     E     P PP  L   +  K S
Sbjct: 22134 IFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATE----QPAPPRRLDVVDTSKSS 22189

Query: 1055  LVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFR 1114
              VL W  P H G + +TGY +++++  +  D W  +     K +   V  L E   Y FR
Sbjct: 22190 AVLAWLKPDHDGGSRITGYLLEMRQKGS--DFW--VEAGHTKQLTFTVERLVEKTEYEFR 22245

Query: 1115  VRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMT---------- 1164
             V+A N AG  +P +    V+ +      ++    D  G+ +    C   +          
Sbjct: 22246 VKAKNDAGYSEPREAFSSVIIK----EPQIEPTADLTGITNQLITCKAGSPFTIDVPISG 22301

Query: 1165  -PKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGI 1218
              P  + +W  + +  +++ R+ + +  ++T +T KD    D G Y   + +T G+
Sbjct: 22302 RPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGV 22356



 Score =  209 bits (533), Expect = 1e-53
 Identities = 206/802 (25%), Positives = 328/802 (40%), Gaps = 99/802 (12%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVR--MGEYYEQYSAY 496
             P I+WY++   L  +  V    + + A++     ++ + G Y +++R  MG      SA 
Sbjct: 20530 PTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMG------SAS 20583

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
               +R    +  G P  P++ K + A K  I + W+ PA DGG+ I  Y ++K E     W
Sbjct: 20584 ATIRVQILDKPGPPGGPIEFKTVTAEK--ITLLWRPPADDGGAKITHYIVEKRETSRVVW 20641

Query: 557   SQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSR 616
             S  ++  ++      T +I+G  YIFRVRAVNK GIG P      VA             
Sbjct: 20642 SMVSE-HLEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVA------------- 20687

Query: 617   PSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEK 675
                             +  + PGPP    VT+ T++ + + W  P   G   I  YF+EK
Sbjct: 20688 ---------------KNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEK 20732

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
              +  +  W +V  E  ++  R  +  L E   Y +RV   N+AG G  SE +E     D 
Sbjct: 20733 RDKKSLGWFKVLKE-TIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADP 20791

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCN-NNPVK 792
             +D P  P KI  + +T +S+ + W +        + GY +E       +W   +    V+
Sbjct: 20792 IDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVR 20851

Query: 793   GSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPG 852
              + +    L  G +Y FRV AVN AG  E  + +E ++ K  +    +P++   ++    
Sbjct: 20852 TTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDIL---EAPEIDLDVALRTS 20908

Query: 853   GLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQ 912
              +  +   V    P         G  P   +     +NLG      +  T    L   PQ
Sbjct: 20909 VIAKAGEDVQVLIP-------FKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQ 20961

Query: 913   KAAPQ------------GKSKSDPLKKKTDRAPPSPPCD-ITCLESFRDSMVLGWKQPDK 959
                              G+ KS  +  K    P +  C  +      R ++ L W  P  
Sbjct: 20962 VTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAA--CQKLQVKHVSRGTVTLLWDPPLI 21019

Query: 960   IGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 1019
              GG+ I  Y +  R   D     W   + K  S  ++K+ +L E   + F+V A N  G+
Sbjct: 21020 DGGSPIINYVIEKR---DATKRTWSVVSHKC-SSTSFKLIDLSEKTPFFFRVLAENEIGI 21075

Query: 1020  GAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE 1079
             G P   +E  K  E    VP P   L   +  K S++L W  P   G + +T Y V   E
Sbjct: 21076 GEPCETTEPVKAAE----VPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVV---E 21128

Query: 1080  AKAKEDQ-WRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETR 1138
              K K +Q W   +    K   ++V  LKE     FRV A N+ G+  P  + GP+  +  
Sbjct: 21129 RKGKGEQTWS--HAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTI-GPITVKEL 21185

Query: 1139  -----------PGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVE 1187
                        PG  +V V +  +  + L +   K  PK   SW KD +  ++S  +   
Sbjct: 21186 IITPEVDLSDIPGA-QVTVRIGHNVHLELPY---KGKPKPSISWLKDGLPLKESEFVRFS 21241

Query: 1188  SKGNKTKMTFKDLGMDDLGIYS 1209
                NK  ++ K+   +  G Y+
Sbjct: 21242 KTENKITLSIKNAKKEHGGKYT 21263



 Score =  206 bits (525), Expect = 1e-52
 Identities = 199/815 (24%), Positives = 338/815 (41%), Gaps = 110/815 (13%)

Query: 438   QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
             +PE++W +    L+    ++   +     L   ++ + D G Y + +      +  +A+V
Sbjct: 18764 EPEVKWEKAEGILTDRAQIEV--TSSFTMLVIDNVTRFDSGRYNLTLENNSGSK--TAFV 18819

Query: 498   FVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
              VR  D+     P+AP+++   E  KD + +SW+ P +DGG+ I  Y ++K E    +++
Sbjct: 18820 NVRVLDS-----PSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYA 18874

Query: 558   QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRP 617
                +   K   F +  L EG SY FRV A N+ GIG P+  +EPV   +P          
Sbjct: 18875 TITNNCTK-TTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEP---------- 18923

Query: 618   SAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKC 676
                                 P PP  +++ + TR+   + W+ P   G   I  Y VE  
Sbjct: 18924 --------------------PLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQ 18963

Query: 677   EAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKL 736
               G+E W   +T   VK+    +  L  G+ Y FRV   N  G  +P +   V V+   +
Sbjct: 18964 TKGSEKW---STCTQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLG-VPVIARDI 19019

Query: 737   DIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRF 796
             +I   P   +P     T  V + E+ K     +    +     +  W        + +R 
Sbjct: 19020 EIK--PSVELPFH---TFNVKAREQLK-----IDVPFKGRPQATVNWRKDGQTLKETTRV 19069

Query: 797   TCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTA 856
                   T  S   +  +    G  E    + A        G ++  +   + D PG    
Sbjct: 19070 NVSSSKTVTSLSIKEASKEDVGTYELCVSNSA--------GSITVPITIIVLDRPG--PP 19119

Query: 857   SRGRVHEAS---------PPTFQKDALLGSKPNKPSLPSS------SQNLGQTEVSKVSE 901
                R+ E S         PP +     + +   +    +S      SQ + +T +  V  
Sbjct: 19120 GPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSIKIVRL 19179

Query: 902   TVQEELTPPPQKAAPQGKS---KSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPD 958
             T   E           GKS   +S  +  +   +PP PP     + + + +M++ W+ P 
Sbjct: 19180 TTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPV 19239

Query: 959   KIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAG 1018
               GG+ + GY++ Y+E    +   W +AN   +++   K+S L E ++Y+++V A N+AG
Sbjct: 19240 NDGGSRVIGYHLEYKERSSIL---WSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAG 19296

Query: 1019  LGAPSAVSECFKCEEWTIAVPG-----PPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGY 1073
             +G         KC +    VP      PP   + + + + S+ L+W  P + G   +TGY
Sbjct: 19297 IG---------KCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGY 19347

Query: 1074  FVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQA-GVGKPSDLAGP 1132
              V+ +E    + +W   N   I+  Y +V  L E   Y FRV A N A  V +PS+  GP
Sbjct: 19348 IVERRELP--DGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGP 19405

Query: 1133  VVAETRPGTKEVVVNVDDDGVISLNF-ECDKMT------PKSEFSWSKDYVSTEDSPRLE 1185
             ++ +       V+++V    VI +   E  K+       P    SW+KD +  E+  R E
Sbjct: 19406 IIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTE 19465

Query: 1186  VESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIAS 1220
             + S  N T +T KD    D G Y   + +  G  S
Sbjct: 19466 IISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRS 19500



 Score =  206 bits (523), Expect = 2e-52
 Identities = 199/804 (24%), Positives = 355/804 (44%), Gaps = 75/804 (9%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P  +W  +G  +   +          + LT  +  + D G Y I V      +  + ++ 
Sbjct: 11168 PTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLT 11227

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V D    + G P  P+++  L+   +++ ISW+ P  DGGSP++ Y ++K +   D+W  
Sbjct: 11228 VLD----VPGPPTGPINI--LDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGV 11281

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
              +    K  +  +  L +G  Y+FRVRA NK+G+G P   +  V        A+ K  P 
Sbjct: 11282 VSSGSSK-TKLKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPTV--------AKHKFSPP 11332

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
             +P                 PG P    VT+ T +   +SW  P   G   I  Y++E+ E
Sbjct: 11333 SP-----------------PGKPV---VTDITENAATVSWTLPKSDGGSPITGYYMERRE 11372

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
               T  W RVN + P+   +F +  L EG +Y FRV   N AG+ +PS +++       + 
Sbjct: 11373 V-TGKWVRVN-KTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIK 11430

Query: 738   IPKAP-GKIIPSRNTDTSVVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNP-VKG 793
              P  P    +  ++ +T+ +V W +  S     ++GY +E    G+ +W   N +  ++ 
Sbjct: 11431 PPGPPINPKLKDKSRETADLV-WTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQ 11489

Query: 794   SRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAI-GGGVSPDVC--PALSDE 850
               F   GL+ G  Y FR++A N  G  E  + +E++  K  +    V  DV     ++  
Sbjct: 11490 CAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVR 11549

Query: 851   PGGLTASRGRVHEASPP--TFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELT 908
              G       RV     P  T+ K+  +  +  +  L    Q+L + E+ ++ E V+ +  
Sbjct: 11550 VGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDL---IQDLPRVEL-QIKEAVRADHG 11605

Query: 909   PPPQKAA-PQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITG 967
                  A    G ++   +    DR  P P  ++      +++  + W+ P   GG+EIT 
Sbjct: 11606 KYIISAKNSSGHAQGSAIVNVLDR--PGPCQNLKVTNVTKENCTISWENPLDNGGSEITN 11663

Query: 968   YYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSE 1027
             + V YR+     P +   + V +   +    +NL  N  Y F+V A N  G+G P+  ++
Sbjct: 11664 FIVEYRK-----PNQKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVG-PTIETK 11717

Query: 1028  CFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQW 1087
                     I  PG P +L  ++  K  + L+W+ P + G +P   Y V+ +  K  +D W
Sbjct: 11718 TPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVE-RRLKGSDD-W 11775

Query: 1088  RGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVN 1147
               +++ +IK  +  V    E   Y FRV+  N+ G    SD         +   ++ V++
Sbjct: 11776 ERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGG---ESDWVKTEEVVVKEDLQKPVLD 11832

Query: 1148  VDDDGVI------SLNFECD-KMTPKSEFSWSKDYVSTE--DSPRLEVESKGNKTKMTFK 1198
             +   GV+      ++  E   +  P  E +W+KD  +T+   SPR++++++ + +K +  
Sbjct: 11833 LKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLT 11892

Query: 1199  DLGMDDLGIYSCDVTDTDGIASSY 1222
                  D G Y    T+T G   +Y
Sbjct: 11893 KAKRSDGGKYVVTATNTAGSFVAY 11916



 Score =  204 bits (519), Expect = 6e-52
 Identities = 197/777 (25%), Positives = 323/777 (41%), Gaps = 98/777 (12%)

Query: 474  KEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQP 533
            + D GLY I+V       +    V V D        P  P++    +  K  ++  W+ P
Sbjct: 8401 RPDHGLYMIKVENDHGIAKAPCTVSVLDT-------PGPPINFVFEDIRKTSVLCKWEPP 8453

Query: 534  AVDGGSPILGYFIDKCE-VGTDS-WSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMG 591
              DGGS I+ Y ++K +    DS W     T ++  ++ VT LIEG+ Y+FRVRA N+ G
Sbjct: 8454 LDDGGSEIINYTLEKKDKTKPDSEWIVVTST-LRHCKYSVTKLIEGKEYLFRVRAENRFG 8512

Query: 592  IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATR 651
             G P  VS+P+ A DP                              P  P    V + T 
Sbjct: 8513 PG-PPCVSKPLVAKDPFGP---------------------------PDAPDKPIVEDVTS 8544

Query: 652  SYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFR 711
            + +++ W  P   G   + Y++EK E  + +W RVN  L + + +  +  L EG +Y FR
Sbjct: 8545 NSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSL-LNALKANVDGLLEGLTYVFR 8603

Query: 712  VRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTS---VVVSWEES--KDAK 766
            V   N+AG G+ S  ++     D +  P  P   IP R TDTS   + + WE        
Sbjct: 8604 VCAENAAGPGKFSPPSDPKTAHDPISPPGPP---IP-RVTDTSSTTIELEWEPPAFNGGG 8659

Query: 767  ELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDS 826
            E+VGY+++  + G+ +W  C    +K  ++T   +  G  Y  RV AVNAAG     +  
Sbjct: 8660 EIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGETQ 8719

Query: 827  EAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPS 886
                 +      V  DV        GG+    G+       T +  A++  +P    + +
Sbjct: 8720 PVTVAEPQEPPAVELDV-----SVKGGIQIMAGK-------TLRIPAVVTGRPVPTKVWT 8767

Query: 887  SSQ-----------NLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPS 935
              +           N+G      + + ++++       A     SK    + +     P 
Sbjct: 8768 KEEGELDKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDV-PG 8826

Query: 936  PPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEA 995
            P  D+  + + R   +L W  P+  GG+EITG+ +  +   D     WR+     +  E 
Sbjct: 8827 PVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERK---DAKMHTWRQ----PIETER 8879

Query: 996  YK--ISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKD 1053
             K  I+ L E   Y+F+V A N  G G P  +      +   +  P  P  L  +E  K 
Sbjct: 8880 SKCDITGLLEGQEYKFRVIAKNKFGCGPPVEIGPILAVD--PLGPPTSPERLTYTERTKS 8937

Query: 1054 SLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVF 1113
            ++ L WK P  +G +P+ GY ++ K    K D +  +N+         V  L E   Y F
Sbjct: 8938 TITLDWKEPRSNGGSPIQGYIIE-KRRHDKPD-FERVNKRLCPTTSFLVENLDEHQMYEF 8995

Query: 1114 RVRAINQAGVGKPSDLAGPVVAETR-PGTKEVVVNVDDDGV-----ISLNFECDKM-TPK 1166
            RV+A+N+ G  +PS     V+ +   P T ++ ++V  D +       ++   D    P 
Sbjct: 8996 RVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPM 9055

Query: 1167 SEFSWSKDYVSTE------DSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
             +  WSK+    E         + EV     KT+++      +D G Y+   ++  G
Sbjct: 9056 PKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLG 9112



 Score =  202 bits (515), Expect = 2e-51
 Identities = 243/1051 (23%), Positives = 411/1051 (39%), Gaps = 156/1051 (14%)

Query: 274   LHAPEFIIKP-RSHTVWEK--ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIES 330
             L  PE  +K   SHTV+ +   N+K+   I+G P P+VT  ++ VP+         I   
Sbjct: 20099 LEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAE 20158

Query: 331   RYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPL 390
                  T+ +      D  +Y  +A N  G   A+ ++VV              G  T P+
Sbjct: 20159 NL---TINLKESVTADAGRYEITAANSSGTTKAFINIVVLD----------RPGPPTGPV 20205

Query: 391   SFG-VTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVP 449
                 +T      ++E     K+D            G +V     +K              
Sbjct: 20206 VISDITEESVTLKWE---PPKYDG-----------GSQVTNYILLKR------------E 20239

Query: 450   LSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRV--RMGEYYEQYSAYVFVRDADAEIE 507
              S + W +   +  R  +    L   +E  + I+   R G      SA V V+       
Sbjct: 20240 TSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVK-LPYTTP 20298

Query: 508   GAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFA 567
             G P+ P         ++ I + W +P  +GGS ++GY ++  +  +  W + N   ++  
Sbjct: 20299 GPPSTPW---VTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTT 20355

Query: 568   RFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIV 627
              F VT +  G  Y FRV A N  G+G PS  SEPV A+D  E                  
Sbjct: 20356 HFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACE------------------ 20397

Query: 628   TEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRV 686
                         PP ++ +T+ +++ V LSW+ P   G   I  Y VE+ +     W + 
Sbjct: 20398 ------------PPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKA 20445

Query: 687   NTELPVKSPRFALFDLAEGKSYCFRVRCSNSAG-VGEPSEATEVTVVGDKLDIPKAPGKI 745
             +    V   +F +  L +   Y FRV   N+ G +  PSE     VVG    I    G +
Sbjct: 20446 SFT-NVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSE-----VVGPITCIDSYGGPV 20499

Query: 746   IPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQ 805
             I      T VV         K   G  ++     SGK  P             + LV  +
Sbjct: 20500 IDLPLEYTEVV---------KYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVE 20550

Query: 806   SYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEAS 865
             +    + ++        +     ++++ A+G   S  +   + D+PG      G   E  
Sbjct: 20551 NTT-DLASILIKDADRLNSGCYELKLRNAMGSA-SATIRVQILDKPG----PPGGPIEFK 20604

Query: 866   PPTFQKDALLGSKPNKPSLPS------SSQNLGQTEVSKVSETVQEELTPPPQ------- 912
               T +K  LL   P               +   +   S VSE ++E +    +       
Sbjct: 20605 TVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECIITTTKIIKGNEY 20664

Query: 913   --------KAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAE 964
                     K       +SD +  K     P PP      +  ++SM + W +P   GG++
Sbjct: 20665 IFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSD 20724

Query: 965   ITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSA 1024
             I+GY++  R   D     W +   + + +   K++ L EN  YQ++V A+N AG G  S 
Sbjct: 20725 ISGYFLEKR---DKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSE 20781

Query: 1025  VSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKE 1084
              SE +K  +  I  PGPP  ++ ++  K S+ L W  PV+ G + VTGY V++++   +E
Sbjct: 20782 PSEFYKAAD-PIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQ--GEE 20838

Query: 1085  DQWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKE 1143
             ++W  ++ +  ++     V  LK GV+Y FRV A+N AG G+P ++  PV A+      E
Sbjct: 20839 EEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPE 20898

Query: 1144  ----------VVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKT 1193
                       V+    +D  + + F   K  P    +W KD  +     R  +E+  + +
Sbjct: 20899 IDLDVALRTSVIAKAGEDVQVLIPF---KGRPPPTVTWRKDEKNLGSDARYSIENTDSSS 20955

Query: 1194  KMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVE 1253
              +T   +  +D G Y   + +  G   S  +  + L             T     +L V+
Sbjct: 20956 LLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVL------------DTPAACQKLQVK 21003

Query: 1254  ILEKGQVRFWMQAEKLSGNAK-VNYIFNEKE 1283
              + +G V        + G +  +NY+  +++
Sbjct: 21004 HVSRGTVTLLWDPPLIDGGSPIINYVIEKRD 21034



 Score =  202 bits (513), Expect = 3e-51
 Identities = 201/738 (27%), Positives = 302/738 (40%), Gaps = 66/738 (8%)

Query: 438   QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
             +P I W ++G+PL  S++V+   +  + TL+  +  KE  G YT+ +            V
Sbjct: 21220 KPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITV 21279

Query: 498   FVRDADAEIEGAPAAPLD-VKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
                       G P+ P   ++  E   D +I+SW  P  +GG  I  Y I+K E    +W
Sbjct: 21280 ITL-------GPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNW 21332

Query: 557   SQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSR 616
                  +  +   F V  L++   Y FRVRA N+ G+                        
Sbjct: 21333 KMVCSSVAR-TTFKVPNLVKDAEYQFRVRAENRYGV------------------------ 21367

Query: 617   PSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYF-VEK 675
              S P    IIV + +     +PGPP    +   T   + L+W  P   G   +  F VEK
Sbjct: 21368 -SQPLVSSIIVAKHQFR---IPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEK 21423

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
              E  +  WQ+VNT  P+    +    L EG  Y FRV   NSAG+  PS+ ++ T+    
Sbjct: 21424 KERNSILWQKVNTS-PISGREYRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSP 21482

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKG 793
             +D P  P  I  +R T   + + W         ++VGY IE    G+ +W  CN   V  
Sbjct: 21483 VDPPGTPDYIDVTRET---ITLKWNPPLRDGGSKIVGYSIEKR-QGNERWVRCNFTDVSE 21538

Query: 794   SRFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIGGGV---SPDVCPALSD 849
              ++T  GL  G  Y FR+ A NA G +S  SQ S  I  +      +    P+    L  
Sbjct: 21539 CQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLII 21598

Query: 850   EPGGLTASRGRVHEASPP--TFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEEL 907
             + G     +  V     P  T+ KD   G +  K      +  LG T +     T     
Sbjct: 21599 KSGESLRIKALVQGRPVPRVTWFKD---GVEIEKRMNMEITDVLGSTSLFVRDATRDHRG 21655

Query: 908   TPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITG 967
                 +     G +K++ +K K    P      I       + M L W  P   G A IT 
Sbjct: 21656 VYTVEAKNASGSAKAE-IKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITH 21714

Query: 968   YYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSE 1027
             Y +  RE    +     E   +A S  A K+ N  E   YQF+V+A+N  G+G P     
Sbjct: 21715 YIIEKRET-SRLAWALIEDKCEAQSYTAIKLINGNE---YQFRVSAVNKFGVGRPLDSDP 21770

Query: 1028  CFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQW 1087
                  ++T  VP  P   + S +  +S+ L W  P   G + +  Y ++ +E K+   +W
Sbjct: 21771 VVAQIQYT--VPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKKS--TRW 21826

Query: 1088  -RGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAE--TRPGTKEV 1144
              + +++  I     KV GL EG  Y F V A N AGVG  S ++  +       P     
Sbjct: 21827 VKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPT 21886

Query: 1145  VVNVDDDGVISLNFECDK 1162
             VV V D    +++ E  K
Sbjct: 21887 VVKVTDTSKTTVSLEWSK 21904



 Score =  201 bits (510), Expect = 6e-51
 Identities = 194/718 (27%), Positives = 295/718 (41%), Gaps = 94/718 (13%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P++ W    + L  +  V    + +R TLT     + D G Y + +      + +S  V 
Sbjct: 22305 PKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVV 22364

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V      + G    P++V  + A     ++SW +P   GG+ I  Y ++K E GT +W  
Sbjct: 22365 VIGRPGPVTG----PIEVSSVSAES--CVLSWGEPKDGGGTEITNYIVEKRESGTTAWQL 22418

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
              N + VK  +  VT L +   Y FRV + N+ G+  P   S P+ A  P           
Sbjct: 22419 VNSS-VKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE-SAPIIAEHPF---------- 22466

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                              + P  PT   V   + + + + W+ P   G   I+ Y+VEK E
Sbjct: 22467 -----------------VPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKE 22509

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
               T  W + N ++P     + +  L EG  Y FR    N+AGV + SEA+   +  + +D
Sbjct: 22510 RNTILWVKEN-KVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVD 22568

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIE---ASVAGSGKWEPCNNNPVKGS 794
              P  P     +R+T  S++ S        ++VGY IE    S  G G+W  CN   V  +
Sbjct: 22569 APGRPEVTDVTRST-VSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDN 22627

Query: 795   RFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGG 853
              FT   L  G +Y FRV A NAAG +S+ S+ +  +  +         +  P  ++    
Sbjct: 22628 FFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCR--------DEYAPPKAELDAR 22679

Query: 854   LTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQK 913
             L      +   S      DA +G KP     P      G  E+  + E V  + T     
Sbjct: 22680 LHGDLVTIRAGSDLVL--DAAVGGKPE----PKIIWTKGDKELD-LCEKVSLQYTGKRAT 22732

Query: 914   AAPQGKSKSDPLK------------------KKTDRAPPSPPCDITCLESFRDSMVLGWK 955
             A  +   +SD  K                  K  D   P P   +T     ++   L W 
Sbjct: 22733 AVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLD--SPGPCGKLTVSRVTQEKCTLAWS 22790

Query: 956   QPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEE----AYKISNLKENMVYQFQV 1011
              P + GGAEIT Y V  RE            N   V  E    +Y ++ L +N  Y F+V
Sbjct: 22791 LPQEDGGAEITHYIVERRET--------SRLNWVIVEGECPTLSYVVTRLIKNNEYIFRV 22842

Query: 1012  AAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVT 1071
              A+N  G G P           +TI  P PP   +     K+ +++QW  P   G   ++
Sbjct: 22843 RAVNKYGPGVPVESEPIVARNSFTI--PSPPGIPEEVGTGKEHIIIQWTKPESDGGNEIS 22900

Query: 1072  GYFVDLKEAKAKEDQWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSD 1128
              Y VD +E K+   +W  +N +  + +  LKV  L EG  Y FRV A+N AG  +PS+
Sbjct: 22901 NYLVDKREKKSL--RWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSE 22956



 Score =  191 bits (486), Expect = 4e-48
 Identities = 191/741 (25%), Positives = 302/741 (40%), Gaps = 88/741 (11%)

Query: 412   DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSH 471
             DV   R G+T+ +  RV   PE     P+I W + G  L   K V  +    R  L    
Sbjct: 11544 DVITVRVGQTIRILARVKGRPE-----PDITWTKEGKVLVREKRVDLIQDLPRVELQIKE 11598

Query: 472   LNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWK 531
               + D G Y I  +    + Q SA V V D        P    ++K     K+   ISW+
Sbjct: 11599 AVRADHGKYIISAKNSSGHAQGSAIVNVLDR-------PGPCQNLKVTNVTKENCTISWE 11651

Query: 532   QPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMG 591
              P  +GGS I  + ++  +     WS       K  R     L+    Y FRV A NK+G
Sbjct: 11652 NPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTK--RLIKANLLANNEYYFRVCAENKVG 11709

Query: 592   IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATR 651
             +G       P+ A++P ++                           PG P +L + +  +
Sbjct: 11710 VGPTIETKTPILAINPIDR---------------------------PGEPENLHIADKGK 11742

Query: 652   SYVVLSWKPPG-QRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCF 710
             ++V L W+ P    G   + Y VE+   G+++W+RV+ +  +K   + +    E + Y F
Sbjct: 11743 TFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVH-KGSIKETHYMVDRCVENQIYEF 11801

Query: 711   RVRCSNSAGVGEPSEATEVTVVGD----KLDIPKAPGKIIPSRNT---DTSV------VV 757
             RV+  N  G  +  +  EV V  D     LD+  +    + + +T   +  V       V
Sbjct: 11802 RVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEV 11861

Query: 758   SWEESKDAKELV---GYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAV 814
             +W + KDA +L       I+   A S K+         G ++      T  S++     V
Sbjct: 11862 AWTKDKDATDLTRSPRVKIDTR-ADSSKFSLTKAKRSDGGKYVVTATNTAGSFV-AYATV 11919

Query: 815   NAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEP--GGLTASRGRVHEASPPTFQKD 872
             N        ++ + ++        VS D C    D P   G    +  + E         
Sbjct: 11920 NVLDKPGPVRNLKIVD--------VSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVW 11971

Query: 873   ALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRA 932
             +   +    P    +    G   + +V    +    PP +      K+K D    K  R 
Sbjct: 11972 STYSATVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYD----KPGR- 12026

Query: 933   PPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVS 992
              P PP ++T +   ++ M + W  P+  GG  ITGY++  +E       +W   N  A+ 
Sbjct: 12027 -PDPP-EVTKVS--KEEMTVVWNPPEYDGGKSITGYFLEKKEKHS---TRWVPVNKSAIP 12079

Query: 993   EEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRK 1052
             E   K+ NL  +  YQF+V A N  G+G PS  S     ++  I  PGPP + +  +  K
Sbjct: 12080 ERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKD-PIEPPGPPTNFRVVDTTK 12138

Query: 1053  DSLVLQWKPPVHSGRTPVTGYFVDL--KEAKAKEDQ-WRGLNEAA-IKNVYLKVRGLKEG 1108
              S+ L W  PV+ G  P+ GY V++  K A A  D+ W+  N AA +      V  L E 
Sbjct: 12139 HSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDEN 12198

Query: 1109  VSYVFRVRAINQAGVGKPSDL 1129
               Y FRV A NQ G+G+P++L
Sbjct: 12199 QEYEFRVCAQNQVGIGRPAEL 12219



 Score =  191 bits (484), Expect = 7e-48
 Identities = 185/740 (25%), Positives = 303/740 (40%), Gaps = 88/740 (11%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P+ P +V  L+  K  + +SW +P  DGGS + GY+I++ E  TD W + N T +    +
Sbjct: 23960 PSNPPEV--LDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMY 24017

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              VTGL+    Y FR+ A N +G+   S  SEPV   DP +K                   
Sbjct: 24018 TVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDK------------------- 24058

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNT 688
                     P  P +L +   ++  V L W KP    G E + Y+VE  ++G   W++ N 
Sbjct: 24059 --------PSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNK 24110

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPS 748
             E  +K  +F +  L E   Y FRV   N  G+  P        +  KL   +APG     
Sbjct: 24111 ER-IKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTA--MSIKTKLTSGEAPGIRKEM 24167

Query: 749   RNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYI 808
             ++  T +    E ++ + ++VG  +        KW       ++  ++       G+++ 
Sbjct: 24168 KDVTTKL---GEAAQLSCQIVGRPLPDI-----KWYRFGKELIQSRKYKMSS--DGRTHT 24217

Query: 809   FRVRAVNAAGLSEYS----QDSEAIEVKAAIGGGVSPDVCPA--LSDEPGGLTASRGRVH 862
               V          Y+     +   +E  + +    +P   P   L ++  G   S  R+H
Sbjct: 24218 LTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLH 24277

Query: 863   EA--SPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKS 920
                   P        G K     L  +S+N+        +  V + +    Q+    GK 
Sbjct: 24278 VMYIGRPVPAMTWFHGQK-----LLQNSENITIENTEHYTHLVMKNV----QRKTHAGKY 24328

Query: 921   KSDP----------LKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYV 970
             K             L  +    P  P   I      ++S V+ WK P   GG+ IT Y V
Sbjct: 24329 KVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVV 24388

Query: 971   NYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFK 1030
                E  +G   +W+  +  A+S    +I NL EN  Y F+V+A N  G+  P  VS    
Sbjct: 24389 EKCEAKEGA--EWQLVS-SAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVI 24445

Query: 1031  CEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGL 1090
              +      PG P     + V KDS V+ WKPP   G   +  Y+++ +E   K+++W  +
Sbjct: 24446 IKS-PFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKRE--KKQNKWISV 24502

Query: 1091  NEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAET-----RPGTKEVV 1145
                 I+     V+ L EG+ Y FRV+  N  G  + S+++ P+  ++      P  KE +
Sbjct: 24503 TTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEEL 24562

Query: 1146  VNVDDDGVISLNFECDKMT--PKSEFSW---SKDYVSTEDSPRLEVESKGNKTKMTFKDL 1200
              N++     +    C K+T  PK    W    K+ ++     R++ E KG   ++    +
Sbjct: 24563 RNLNVRYQSNATLVC-KVTGHPKPIVKWYRQGKEIIADGLKYRIQ-EFKGGYHQLIIASV 24620

Query: 1201  GMDDLGIYSCDVTDTDGIAS 1220
               DD  +Y    T+  G  S
Sbjct: 24621 TDDDATVYQVRATNQGGSVS 24640



 Score =  189 bits (481), Expect = 1e-47
 Identities = 201/817 (24%), Positives = 331/817 (40%), Gaps = 114/817 (13%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             PEI W R     +    VQ         L+  + ++ D G Y +++      +  SA+V 
Sbjct: 17682 PEITWSREEGEFTDK--VQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSK--SAFVT 17737

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V+  D      P  P ++   E  KD   + W+ P +DGG+ +  Y IDK E    +++ 
Sbjct: 17738 VKVLDT-----PGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYAN 17792

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
              +    K + F V  L EG  Y FRV A N+ G+G P    + V A +P           
Sbjct: 17793 VSSKCSKTS-FKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEP----------- 17840

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                                P PP  +++T+ +++   L W+ P   G   ++ Y VE   
Sbjct: 17841 -------------------PSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQP 17881

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
              GTE W  V      K     +  L+ G+ Y FRV+  N  G  +P     V V+   L 
Sbjct: 17882 KGTEKWSIVAES---KVCNAVVTGLSSGQEYQFRVKAYNEKGKSDP-RVLGVPVIAKDLT 17937

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGK----WEPCNNNPVKG 793
             I   P   +P          S +  +D K      IE  V G  +    W   +  P+K 
Sbjct: 17938 IQ--PSLKLPFNT------YSIQAGEDLK------IEIPVIGRPRPNISWVK-DGEPLKQ 17982

Query: 794   SRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGG 853
             +    +   T  S +  ++  N     +Y+       V A    G + +    +  E  G
Sbjct: 17983 TT-RVNVEETATSTVLHIKEGNKDDFGKYT-------VTATNSAGTATENLSVIVLEKPG 18034

Query: 854   LTASRGRVHEAS---------PPTFQKDALLGSK-PNKPSLPSSSQNLGQTEVSKVSETV 903
                   R  E S         PP +     + +    K    +++ ++    V++ +  +
Sbjct: 18035 PPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKI 18094

Query: 904   QEELTPPPQKA---APQGKSKSDPLKKKT-----DRAPPSPPCDITCLESFRDSMVLGWK 955
              +  T    +    A     KS PL  K          P PP         +D M++ W 
Sbjct: 18095 TKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQWH 18154

Query: 956   QPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMN 1015
             +P   GG +I GY++  +E    +   W + N   + +  +K + L E + Y+F+V+A N
Sbjct: 18155 EPVNDGGTKIIGYHLEQKEKNSIL---WVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAEN 18211

Query: 1016  MAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFV 1075
             + G+G PS VSECF   +     PG P ++    + ++++ L+WK P + G + +TGY V
Sbjct: 18212 IVGIGKPSKVSECFVARD-PCDPPGRPEAI---VITRNNVTLKWKKPAYDGGSKITGYIV 18267

Query: 1076  DLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG-VGKPSDLAGPVV 1134
             + K+    + +W   +   +      V GL E   Y FRV A N AG   +PSD +G + 
Sbjct: 18268 EKKD--LPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAIT 18325

Query: 1135  AETR---------PGTKEV-VVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTED-SPR 1183
             A            P  K+V VV+  +  V+  +    +  P  +  WSKD    E+ + R
Sbjct: 18326 ARDEIDAPNASLDPKYKDVIVVHAGETFVLEADI---RGKPIPDVVWSKDGKELEETAAR 18382

Query: 1184  LEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIAS 1220
             +E++S   KT +  KD    D G Y   +++  G  S
Sbjct: 18383 MEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKS 18419



 Score =  188 bits (477), Expect = 4e-47
 Identities = 155/528 (29%), Positives = 237/528 (44%), Gaps = 49/528 (9%)

Query: 638   PGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPR 696
             P PP +L VTE T+  V ++W+PP   G   I  Y VEK EA  +++  V T     S  
Sbjct: 16662 PSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNS-- 16719

Query: 697   FALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVV 756
             + +  L EG SY FRV   N  G+G P++  +   V +   +P+ PGKI     T  SV 
Sbjct: 16720 WKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAE---VPQPPGKITVDDVTRNSVS 16776

Query: 757   VSWE--ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAV 814
             +SW   E     +++ Y +E     S KW  C    VK  +     L  G+ Y+FRV AV
Sbjct: 16777 LSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECAR--VKSLQAVITNLTQGEEYLFRVVAV 16834

Query: 815   NAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDAL 874
             N  G S+    +  I  K  +   + PDV PA S      +   G+  +   P       
Sbjct: 16835 NEKGRSDPRSLAVPIVAKDLV---IEPDVKPAFSS----YSVQVGQDLKIEVP------- 16880

Query: 875   LGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKS-------------K 921
             +  +P KP++  +   L   + ++++ T   +LT    K   +                K
Sbjct: 16881 ISGRP-KPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQK 16939

Query: 922   SDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPG 981
             +  ++  T   P  P   +   +   +S+ L W  P   GG +IT Y V  R+    V  
Sbjct: 16940 TASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTV-- 16997

Query: 982   KWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGP 1041
              W   +   V+    K++ LK    YQF++ A N    G   A+       ++    PGP
Sbjct: 16998 -WDVVSA-TVARTTLKVTKLKTGTEYQFRIFAENR--YGQSFALESDPIVAQYPYKEPGP 17053

Query: 1042  PHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLK 1101
             P +   + + KDS+V+QW  PV++G +PV GY ++ KE  +    W  +N+  I +   K
Sbjct: 17054 PGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNS--ILWTKVNKTIIHDTQFK 17111

Query: 1102  VRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAE---TRPGTKEVVV 1146
              + L+EG+ Y FRV A N  GVGK S  +   VA      PGT E ++
Sbjct: 17112 AQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEPIM 17159



 Score =  179 bits (455), Expect = 2e-44
 Identities = 211/823 (25%), Positives = 315/823 (38%), Gaps = 119/823 (14%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRV--RMGEYYEQYSAY 496
             P++ W + G+     K    L     A L   +  ++D G Y++ +    GE     + +
Sbjct: 12264 PKVTWRKVGIDNVVRKGQVDLVD-TMAFLVIPNSTRDDSGKYSLTLVNPAGEK----AVF 12318

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
             V VR  D      P    D+K  +  K    +SW  P  DGGS +  Y ++K E    +W
Sbjct: 12319 VNVRVLDT-----PGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTW 12373

Query: 557   SQCNDTP-VKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKS 615
             S    TP VK   F VT L+ G  Y FRV AVN+ G G P+ V +PV A DP  +     
Sbjct: 12374 STV--TPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPLSE----- 12426

Query: 616   RPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEK 675
                                   P PP  L VTE T++   L+W PP + G   I  ++  
Sbjct: 12427 ----------------------PDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITS 12464

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
                  +   R      VK     +  L EGK Y FRV   N+ GV  P EA  V    ++
Sbjct: 12465 YREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQ 12524

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSG----KWEPCNNNPV 791
             L  PK    ++P + T           K  K+L    IEA V G      KW+   +  V
Sbjct: 12525 LLPPKI---LMPEQIT----------IKAGKKL---RIEAHVYGKPHPTCKWKKGEDEVV 12568

Query: 792   KGSRFTCHGLVTGQSYIFRVRAVNAAGL----SEYSQDSEAIEVKAAIGGGVSPDVCPA- 846
               S    H   +    I +      +G     +E S  ++  ++K  +     P   P  
Sbjct: 12569 TSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFD 12628

Query: 847   LSD--------------EPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLG 892
             +SD              E GG   +   V +           L S   K S        G
Sbjct: 12629 ISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASV-TKTSCRVGKLIPG 12687

Query: 893   QTEVSKVSET----VQEELTPPPQKAA-PQGKSKSDPLKKKTDRAPPSPPCDITCLESFR 947
             Q  + +V       + E LT P   A  P G               PS P +    +  +
Sbjct: 12688 QEYIFRVRAENRFGISEPLTSPKMVAQFPFGV--------------PSEPKNARVTKVNK 12733

Query: 948   DSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVY 1007
             D + + W +PD  GG+ I GY +  +E    +   W +AN   V    Y  + L E + Y
Sbjct: 12734 DCIFVAWDRPDSDGGSPIIGYLIERKERNSLL---WVKANDTLVRSTEYPCAGLVEGLEY 12790

Query: 1008  QFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGR 1067
              F++ A+N AG   PS  +E +      +  PG P  +   +V K ++ L W  P H G 
Sbjct: 12791 SFRIYALNKAGSSPPSKPTE-YVTARMPVDPPGKPEVI---DVTKSTVSLIWARPKHDGG 12846

Query: 1068  TPVTGYFVDLKEAKAKEDQWRGLNEAA--IKNVYLKVRGLKEGVSYVFRVRAINQAGVGK 1125
             + + GYFV+    K   D+W   N A   I        GL+E   Y FR  A     +  
Sbjct: 12847 SKIIGYFVEA--CKLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISP 12904

Query: 1126  PSDLAGPV--VAETRPGTKEVVVNVDDDGVISLNFE-CDKMT----PKSEFSWSKDYVST 1178
             PS+ + PV  +AE  P   ++ V +     +      C   T    P    SW KD    
Sbjct: 12905 PSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLL 12964

Query: 1179  EDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1221
             + +  +++  + N   +    +   D G Y+    ++ G  S+
Sbjct: 12965 KPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSA 13007



 Score =  177 bits (450), Expect = 6e-44
 Identities = 186/778 (23%), Positives = 306/778 (39%), Gaps = 86/778 (11%)

Query: 465   ATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKD 524
             +TLT  + N+ D G YT+ V      +  +  V V D        P  P+  K  +  + 
Sbjct: 22039 STLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPG-----PPGPITFK--DVTRG 22091

Query: 525   YIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRV 584
                + W  P +DGG+ I  Y ++K E    SW   ++   +   F V  L EG  Y FRV
Sbjct: 22092 SATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISEKCTRQI-FKVNDLAEGVPYYFRV 22150

Query: 585   RAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDL 644
              AVN+ G+G P  + EP+ A                       TE+       P PP  L
Sbjct: 22151 SAVNEYGVGEPYEMPEPIVA-----------------------TEQ-------PAPPRRL 22180

Query: 645   SVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLA 703
              V + ++S  VL+W  P   G   I  Y +E  + G++ W         K   F +  L 
Sbjct: 22181 DVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGH---TKQLTFTVERLV 22237

Query: 704   EGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK-----LDIPKAPGKIIPSRNTDTSVVVS 758
             E   Y FRV+  N AG  EP EA    ++ +       D+     ++I  +      +  
Sbjct: 22238 EKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDV 22297

Query: 759   WEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAG 818
                 + A ++     E  +  + +           +  T    + G S  + +   N AG
Sbjct: 22298 PISGRPAPKVTWKLEEMRLKETDRVSITTTKD--RTTLTVKDSMRGDSGRYFLTLENTAG 22355

Query: 819   LSEYSQDSEAIEVKAAIGG-----GVSPDVCPALSDEP--GGLTASRGRVHEASPPTFQK 871
             +  +S     I     + G      VS + C     EP  GG T     + E        
Sbjct: 22356 VKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGGGTEITNYIVEKRE----- 22410

Query: 872   DALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKS-KSDPLKKKTD 930
                  S      L +SS    Q +V+ +++ ++       +      K  +S P+  +  
Sbjct: 22411 -----SGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESAPIIAEHP 22465

Query: 931   RAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKA 990
               PPS P          ++M + W++P   GG++I GY+V  +E    +   W + N   
Sbjct: 22466 FVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTIL---WVKENKVP 22522

Query: 991   VSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEV 1050
               E  YK++ L E + YQF+  A+N AG+   S  S     +   +  PG P   + ++V
Sbjct: 22523 CLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQN-PVDAPGRP---EVTDV 22578

Query: 1051  RKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKED-QWRGLNEAAIKNVYLKVRGLKEGV 1109
              + ++ L W  P + G + V GY ++ K      D +W   N   + + +  V  L EG 
Sbjct: 22579 TRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGD 22638

Query: 1110  SYVFRVRAINQAGV-GKPSDLAGPVVA--ETRPGTKEVVVNVDDDGVISLNFECDKM--- 1163
             +Y FRV A N AGV  K S+  GPV    E  P   E+   +  D ++++    D +   
Sbjct: 22639 TYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGD-LVTIRAGSDLVLDA 22697

Query: 1164  ----TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
                  P+ +  W+K     +   ++ ++  G +     K     D G Y+  V +  G
Sbjct: 22698 AVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASG 22755



 Score =  167 bits (422), Expect = 1e-40
 Identities = 156/528 (29%), Positives = 237/528 (44%), Gaps = 54/528 (10%)

Query: 637  VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFV-EKCEAGTENWQRVNTELPVKSP 695
            VPGP  DL      R   +L+W  P   G   I  F+ E+ +A    W++     P+++ 
Sbjct: 8824 VPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQ-----PIETE 8878

Query: 696  RFA--LFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDT 753
            R    +  L EG+ Y FRV   N  G G P E   +  V D L  P +P ++  +  T +
Sbjct: 8879 RSKCDITGLLEGQEYKFRVIAKNKFGCGPPVEIGPILAV-DPLGPPTSPERLTYTERTKS 8937

Query: 754  SVVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRV 811
            ++ + W+E  S     + GY IE        +E  N      + F    L   Q Y FRV
Sbjct: 8938 TITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRV 8997

Query: 812  RAVNAAGLSEYS-------QDSEA---IEVKAAIGGGVSPDVCPALSDEPGGLTASRGRV 861
            +AVN  G SE S       QD E    I+++ ++ G    D     + EP  + A    V
Sbjct: 8998 KAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRG----DTIKVKAGEPVHIPAD---V 9050

Query: 862  HEASPPTFQ--KDALLGSKPNKP---SLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAP 916
                 P  +  K+  +  KP      +    S++  +TE+S      +++ T     +  
Sbjct: 9051 TGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNR 9110

Query: 917  QGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVI 976
             G    +   +  DR  PSPP ++   +   +S  L W  P   GG+EIT Y ++ R+  
Sbjct: 9111 LGSVFRNVHVEVYDR--PSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDA- 9167

Query: 977  DGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTI 1036
                 +W E    AV E+ Y I  L  N  Y+F+V A+N  G+       EC K ++  I
Sbjct: 9168 SRKKAEWEEVTNTAV-EKRYGIWKLIPNGQYEFRVRAVNKYGIS-----DEC-KSDKVVI 9220

Query: 1037 A----VPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNE 1092
                 +PGPP   K     K S+++ W PP+ +G +P+TGY+++ +E  +    W  ++ 
Sbjct: 9221 QDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSP--YWSRVSR 9278

Query: 1093 AAIKNVYLK-----VRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA 1135
            A I  V LK     V  L EGV Y FR  AIN AG+G PS+ + P VA
Sbjct: 9279 APITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVA 9326



 Score =  157 bits (397), Expect = 8e-38
 Identities = 201/762 (26%), Positives = 300/762 (39%), Gaps = 125/762 (16%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESR-YGM------HTLEINGCDF 344
             E  +L C I G P P + WY+           GK +I+SR Y M      HTL +   + 
Sbjct: 24176 EAAQLSCQIVGRPLPDIKWYRF----------GKELIQSRKYKMSSDGRTHTLTVMTEEQ 24225

Query: 345   EDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFE 404
             ED   Y   A N  GE+   + ++++         +FH G    PL              
Sbjct: 24226 EDEGVYTCIATNEVGEVETSSKLLLQA------TPQFHPG---YPLK------------- 24263

Query: 405   IHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGER 464
                 +K+   +G  G T+ L    +  P      P + W+     L  S+ + T+ + E 
Sbjct: 24264 ----EKY---YGAVGSTLRLHVMYIGRPV-----PAMTWFHGQKLLQNSENI-TIENTEH 24310

Query: 465   AT-LTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDA--DAEIEGAPAAPLDVKCLEA 521
              T L   ++ +        +   G+Y  Q S      DA  D EI+  P  P     +EA
Sbjct: 24311 YTHLVMKNVQR--------KTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEA 24362

Query: 522   N-KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSY 580
               K+  +ISWK PA DGGS I  Y ++KCE    +  Q   + +      +  L E   Y
Sbjct: 24363 LLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGY 24422

Query: 581   IFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGP 640
              FRV A N  GI  P  VS  V    P EK                           PG 
Sbjct: 24423 YFRVSAQNTFGISDPLEVSSVVIIKSPFEK---------------------------PGA 24455

Query: 641   PTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFAL 699
             P   ++T  T+   V++WKPP   G   I  Y++EK E     W  V TE  ++   F++
Sbjct: 24456 PGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTE-EIRETVFSV 24514

Query: 700   FDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIP-KAPGKIIPSRNTD----TS 754
              +L EG  Y FRV+C N  G  E SE +E   +  K D+P +AP      RN +    ++
Sbjct: 24515 KNLIEGLEYEFRVKCENLGGESEWSEISE--PITPKSDVPIQAPHFKEELRNLNVRYQSN 24572

Query: 755   VVVSWEESKDAKELVGYYIEAS--VAGSGKWEPCNNNPVKGS--RFTCHGLVTGQSYIFR 810
               +  + +   K +V +Y +    +A   K+        KG   +     +    + +++
Sbjct: 24573 ATLVCKVTGHPKPIVKWYRQGKEIIADGLKY---RIQEFKGGYHQLIIASVTDDDATVYQ 24629

Query: 811   VRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQ 870
             VRA N  G S     S  +EV A I         P   +  G + A RG V     P   
Sbjct: 24630 VRATNQGG-SVSGTASLEVEVPAKIH-------LPKTLEGMGAVHALRGEVVSIKIPFSG 24681

Query: 871   K-DALLGSKPNKPSLPSSSQN---LGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLK 926
             K D ++  +  +  + ++      + ++  S V     E           + +   D   
Sbjct: 24682 KPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKT 24741

Query: 927   KKTDRAP-PSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWRE 985
              + D A  P PP  +   +  RDS+ L W +P   GG++IT Y V   E       +W  
Sbjct: 24742 VELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIV---EKCATTAERW-- 24796

Query: 986   ANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSE 1027
               V    E  Y + NL     YQF+V A N  GL  PS  SE
Sbjct: 24797 LRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSE 24838



 Score =  153 bits (387), Expect = 1e-36
 Identities = 143/539 (26%), Positives = 230/539 (42%), Gaps = 61/539 (11%)

Query: 637  VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFV-EKCEAGTENWQRVNTELPVKSP 695
            +PGP  D+  ++ T+S   L+W+PP   G   I+++V E+ EAG        T +PV S 
Sbjct: 8107 LPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRR------TYIPVMSG 8160

Query: 696  R----FALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNT 751
                 + + DL     Y FRV+  N  G GE  E     +  D    P  P  +     T
Sbjct: 8161 ENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPT 8220

Query: 752  DTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIF 809
              ++ ++W+        +++GY IE    G  +W+ CN + V    +T  GL  G+ Y F
Sbjct: 8221 AEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQF 8280

Query: 810  RVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVC--PALSDEPGGLTASRGRVHEASPP 867
            RVRA NAAG+SE    S A     A+    +P V    +L  + G   A    +  +  P
Sbjct: 8281 RVRAENAAGISE---PSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYP 8337

Query: 868  TFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEE---LTPPPQKAAPQGKSKSDP 924
            T     +   K     +P   +      V +    VQEE   + P  Q+ +     K + 
Sbjct: 8338 T-----ITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGES 8392

Query: 925  ----------------LKKKTDRAPPSPPCDITCLES--------FRD----SMVLGWKQ 956
                            +K + D      PC ++ L++        F D    S++  W+ 
Sbjct: 8393 QLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFVFEDIRKTSVLCKWEP 8452

Query: 957  PDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNM 1016
            P   GG+EI  Y +  ++     P          +    Y ++ L E   Y F+V A N 
Sbjct: 8453 PLDDGGSEIINYTLEKKDKTK--PDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENR 8510

Query: 1017 AGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVD 1076
             G G P  VS+    ++     P  P      +V  +S++++W  P  +G +P+ GY+++
Sbjct: 8511 FGPG-PPCVSKPLVAKD-PFGPPDAPDKPIVEDVTSNSMLVKWNEPKDNG-SPILGYWLE 8567

Query: 1077 LKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA 1135
             +E  +    W  +N++ +  +   V GL EG++YVFRV A N AG GK S  + P  A
Sbjct: 8568 KREVNS--THWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTA 8624



 Score =  153 bits (386), Expect = 2e-36
 Identities = 113/372 (30%), Positives = 180/372 (48%), Gaps = 30/372 (8%)

Query: 921   KSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVP 980
             +S P+       PP PP         +DSMV+ W +P   GG EI GY +  R+  +GV 
Sbjct: 18517 ESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDK-EGV- 18574

Query: 981   GKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPG 1040
              +W + N K +++   +++ L E   Y+F+VAA N AG+G PS  S  ++  +  +  PG
Sbjct: 18575 -RWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACD-ALYPPG 18632

Query: 1041  PPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN-EAAIKNVY 1099
             PP + K ++  + S+ L W  P++ G  PV GY V++KEA A  D+W        ++   
Sbjct: 18633 PPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAA--DEWTTCTPPTGLQGKQ 18690

Query: 1100  LKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLN-- 1157
               V  LKE   Y FR+ AIN  GVG+P+ L G VVA+ R    E+ ++ D   V+ L   
Sbjct: 18691 FTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRAS 18750

Query: 1158  -----FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDV 1212
                  F   K  P+ E  W K      D  ++EV S  + T +   ++   D G Y+  +
Sbjct: 18751 ATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTS--SFTMLVIDNVTRFDSGRYNLTL 18808

Query: 1213  TDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGN 1272
              +  G  ++++       R+L        P+ PV   L +  ++K  V    +   + G 
Sbjct: 18809 ENNSGSKTAFV-----NVRVL------DSPSAPV--NLTIREVKKDSVTLSWEPPLIDGG 18855

Query: 1273  AKV-NYIFNEKE 1283
             AK+ NYI  ++E
Sbjct: 18856 AKITNYIVEKRE 18867



 Score =  152 bits (385), Expect = 2e-36
 Identities = 165/617 (26%), Positives = 249/617 (40%), Gaps = 104/617 (16%)

Query: 478  GLYTIRVRMGEYY----EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQP 533
            G Y  RVR    Y    E  S  V ++D    + G P  P   K L   K  +++SW  P
Sbjct: 9195 GQYEFRVRAVNKYGISDECKSDKVVIQDP-YRLPGPPGKP---KVLARTKGSMLVSWTPP 9250

Query: 534  AVDGGSPILGYFIDKCEVGTDSWSQCNDTPV-----KFARFPVTGLIEGRSYIFRVRAVN 588
              +GGSPI GY+++K E G+  WS+ +  P+     K   F V  L+EG  Y FR  A+N
Sbjct: 9251 LDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAIN 9310

Query: 589  KMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTE 648
              GIG PS  S+P  A DP                              PGPP+   V +
Sbjct: 9311 AAGIGPPSEPSDPEVAGDPI---------------------------FPPGPPSCPEVKD 9343

Query: 649  ATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNT-ELPVKSPRFALFDLAEGK 706
             T+S + L WKPP + G   I  Y VE  E GT +W+RVN  +  + +    + +L E +
Sbjct: 9344 KTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCECVVPNLKELR 9403

Query: 707  SYCFRVRCSNSAGVGEPSEATE-----------------------VTVVGDKLDIPKAPG 743
             Y FRV+  N AG  EPS+ T                        V   G ++ IP    
Sbjct: 9404 KYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPA--- 9460

Query: 744  KIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVT 803
             +I  R T  S   SWE    AK+ +   +   +    + E   N+ V      C    T
Sbjct: 9461 -VIKGRPTPKS---SWEFDGKAKKAMKDGVH-DIPEDAQLETAENSSVIIIP-ECKRSHT 9514

Query: 804  GQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHE 863
            G+   + + A N AG     Q +    VK     G   D+   +SD    +T    R+  
Sbjct: 9515 GK---YSITAKNKAG-----QKTANCRVKVMDVPGPPKDL--KVSD----ITRGSCRLSW 9560

Query: 864  ASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKS- 922
              P     D + G    K ++   +      +    +  V + L+        + +++  
Sbjct: 9561 KMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFG 9620

Query: 923  -----DPLKKKTDRAP---PSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYR- 973
                 + +++ T R P   P PP  +      ++++ L WK P   GG+ +T Y V    
Sbjct: 9621 IGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLA 9680

Query: 974  -EVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCE 1032
             +        WR+ N + V E  + + +L E   Y+F+V A+N AG+  PSA      C+
Sbjct: 9681 WDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQ 9740

Query: 1033 EWTIAVPGPPHSLKCSE 1049
                  P  P S+   E
Sbjct: 9741 R-----PDMPPSIDLKE 9752



 Score =  150 bits (380), Expect = 8e-36
 Identities = 169/756 (22%), Positives = 290/756 (38%), Gaps = 92/756 (12%)

Query: 287   TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
             T+    +++L  S++G P P +TW K  + +   A     II++      L ++  +  D
Sbjct: 23085 TIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRA-----IIDTTESYSLLIVDKVNRYD 23139

Query: 347   TAQYRASAMNVKGELSAYASVVVKRYKGEFDETRF-HAGASTMPLSFGVTPYGYASRFEI 405
               +Y   A N  G+ SA   V V    G     +       ++ +++ +      +    
Sbjct: 23140 AGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNN 23199

Query: 406   HFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERA 465
             +  +K + +  R  +T++  C   +             YR          +  L  G   
Sbjct: 23200 YIVEKREAAM-RAFKTVTTKCSKTL-------------YR----------ISGLVEG--- 23232

Query: 466   TLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDY 525
               T  +     E +Y I    GE  E   A +        +   P  P  ++ ++  K  
Sbjct: 23233 --TMYYFRVLPENIYGI----GEPCETSDAVL--------VSEVPLVPAKLEVVDVTKST 23278

Query: 526   IIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVR 585
             + ++W++P  DGGS + GY ++ C+ GT+ W +            VT L EG  Y+FR+R
Sbjct: 23279 VTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIR 23338

Query: 586   AVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLS 645
             A N+ G+  P      V   D      L+  P+       + T  + +  +  G P +L 
Sbjct: 23339 AQNEKGVSEPRETVTAVTVQD------LRVLPTID-----LSTMPQKTIHVPAGRPVELV 23387

Query: 646   VTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEG 705
             +  A R     SW   G +  E                +RV  E   K  +  + +    
Sbjct: 23388 IPIAGRPPPAASWFFAGSKLRES---------------ERVTVETHTKVAKLTIRETTIR 23432

Query: 706   KSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE--ESK 763
              +  + +   N  G    SE  +V ++ DK   P  P KI       TS+ +SWE  E  
Sbjct: 23433 DTGEYTLELKNVTGT--TSETIKVIIL-DKPGPPTGPIKI--DEIDATSITISWEPPELD 23487

Query: 764   DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYS 823
                 L GY +E   A    W P + + V  S F    L  G  Y+FRV A N  G+  Y 
Sbjct: 23488 GGAPLSGYVVEQRDAHRPGWLPVSES-VTRSTFKFTRLTEGNEYVFRVAATNRFGIGSYL 23546

Query: 824   QDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTAS------RGRVHEASPPTFQKDALLGS 877
             Q SE IE +++I     P+          G+T +       G          +K+     
Sbjct: 23547 Q-SEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADR 23605

Query: 878   KPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPP 937
                   +P +      T +++  E  +  +T    + + +    S P+      APP  P
Sbjct: 23606 WVRVNKVPVTMTRYRSTGLTEGLE-YEHRVTAINARGSGKPSRPSKPIVAMDPIAPPGKP 23664

Query: 938   CDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYK 997
              +    ++ R S+ L W  P+  GG+++TGY +  ++V      +W + N        Y 
Sbjct: 23665 QNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQ---HEWTKCNTTPTKIREYT 23721

Query: 998   ISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEE 1033
             +++L +   Y+F+V A N  G G P+ V    K  E
Sbjct: 23722 LTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTE 23757



 Score =  145 bits (366), Expect = 3e-34
 Identities = 132/461 (28%), Positives = 195/461 (42%), Gaps = 55/461 (11%)

Query: 367   VVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKF-DVSFGREGETMSLG 425
             V+ +   G F E    +GA        +T            D K+ DV     GET  L 
Sbjct: 18305 VIARNAAGNFSEPSDSSGA--------ITARDEIDAPNASLDPKYKDVIVVHAGETFVLE 18356

Query: 426   CRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSG-ERATLTFSHLNKEDEGLYTIRV 484
               +   P      P++ W ++G  L  +     + S  ++ TL      + D G Y +++
Sbjct: 18357 ADIRGKPI-----PDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKL 18411

Query: 485   RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGY 544
                   +     V V D      G P  PL V  + A K Y+  +W  P  DGG+ I  Y
Sbjct: 18412 SNVGGTKSIPITVKVLDRP----GPPEGPLKVTGVTAEKCYL--AWNPPLQDGGANISHY 18465

Query: 545   FIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAA 604
              I+K E    SW+Q + T V+   + VT L+ G  YIFRV AVNK GIG P   S PV A
Sbjct: 18466 IIEKRETSRLSWTQVS-TEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLE-SGPVTA 18523

Query: 605   LDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQ 663
              +P +                            PGPP+   V+  T+  +V++W +P   
Sbjct: 18524 CNPYKP---------------------------PGPPSTPEVSAITKDSMVVTWARPVDD 18556

Query: 664   RGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEP 723
              G E   Y +EK +     W + N +  +   R  +  L EG SY FRV   N+AGVGEP
Sbjct: 18557 GGTEIEGYILEKRDKEGVRWTKCNKKT-LTDLRLRVTGLTEGHSYEFRVAAENAAGVGEP 18615

Query: 724   SEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSG 781
             SE +      D L  P  P     +  + +SV ++W +        + GY +E   A + 
Sbjct: 18616 SEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAAD 18675

Query: 782   KWEPCN-NNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSE 821
             +W  C     ++G +FT   L     Y FR+ A+N+ G+ E
Sbjct: 18676 EWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGE 18716



 Score =  145 bits (365), Expect = 4e-34
 Identities = 179/719 (24%), Positives = 290/719 (40%), Gaps = 83/719 (11%)

Query: 638  PGPPTDLSVTEATRSYVVLSWKPP-GQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPR 696
            PGPP +    +  ++ V+  W+PP    G E I Y +EK +    + + +     ++  +
Sbjct: 8430 PGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCK 8489

Query: 697  FALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVV 756
            +++  L EGK Y FRVR  N  G G P   ++  V  D    P AP K I    T  S++
Sbjct: 8490 YSVTKLIEGKEYLFRVRAENRFGPGPPC-VSKPLVAKDPFGPPDAPDKPIVEDVTSNSML 8548

Query: 757  VSWEESKD-AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVN 815
            V W E KD    ++GY++E     S  W   N + +   +    GL+ G +Y+FRV A N
Sbjct: 8549 VKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAEN 8608

Query: 816  AAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEASPPTFQKDA-L 874
            AAG  ++S  S+       I     P   P ++D     T+S     E  PP F     +
Sbjct: 8609 AAGPGKFSPPSDPKTAHDPISPPGPP--IPRVTD-----TSSTTIELEWEPPAFNGGGEI 8661

Query: 875  LGSKPNKPSLPSSSQN--------LGQTEVSKVSETVQEELTPPPQKAAPQGK-SKSDPL 925
            +G   +K  + ++  +        + Q  V ++ E    +L      AA +G   ++ P+
Sbjct: 8662 VGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGETQPV 8721

Query: 926  KKKTDRAPPSPPCDITCLESFR---------DSMVLGWKQPDKIGGAEITGYYVNYREVI 976
                 + PP+   D++     +          ++V G   P K+   E  G     R VI
Sbjct: 8722 TVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKE-EGELDKDRVVI 8780

Query: 977  DGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTI 1036
            D         NV   SE   K +  K++  Y   + A N  G    +A  E F       
Sbjct: 8781 D---------NVGTKSELIIKDALRKDHGRYV--ITATNSCGSKFAAARVEVFD------ 8823

Query: 1037 AVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIK 1096
             VPGP   LK     +   +L W  P   G + +TG+ ++ K+AK     WR   E   +
Sbjct: 8824 -VPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKM--HTWRQPIET--E 8878

Query: 1097 NVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPG----TKEVVVNVDDDG 1152
                 + GL EG  Y FRV A N+ G G P ++ GP++A    G     + +        
Sbjct: 8879 RSKCDITGLLEGQEYKFRVIAKNKFGCGPPVEI-GPILAVDPLGPPTSPERLTYTERTKS 8937

Query: 1153 VISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDV 1212
             I+L+++  +    S            D P  E  +K      +F    +D+  +Y   V
Sbjct: 8938 TITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRV 8997

Query: 1213 TDTDGIASS-------YLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQ 1265
               + I  S        +I ++E+   + L    +  T+ VK+   V I           
Sbjct: 8998 KAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHI----------- 9046

Query: 1266 AEKLSG--NAKVNYIFNEKEIFEGPK-----YKMHIDRNTGIIEMFMEKLQDEDEGTYT 1317
               ++G    K+ +  NE  + E P       K  + R+    E+ + K   ED+GTYT
Sbjct: 9047 PADVTGLPMPKIEWSKNE-TVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYT 9104



 Score =  139 bits (351), Expect = 2e-32
 Identities = 139/561 (24%), Positives = 228/561 (40%), Gaps = 59/561 (10%)

Query: 510  PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
            P  P+DV+      + + I+WK P  DGGS I+GY I+K   G + W +CN+  V    +
Sbjct: 8208 PDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTY 8267

Query: 570  PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
               GL EG+ Y FRVRA N  GI  PSR + P  A+DP +  ++  R S     ++   +
Sbjct: 8268 TAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSL----EVKRGD 8323

Query: 630  EEPSEGIVPGPP-------TDLSV---TEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAG 679
            E   +  + G P        D +V    E  +    L  +  G+   E            
Sbjct: 8324 EIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLS 8383

Query: 680  TENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIP 739
             +N ++  ++L V+       D        + ++  N  G+ +      V      LD P
Sbjct: 8384 IDNSKKGESQLRVR-------DSLRPDHGLYMIKVENDHGIAKAPCTVSV------LDTP 8430

Query: 740  KAPGKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEA--SVAGSGKWEPCNNNPVKGSR 795
              P   +      TSV+  WE   D    E++ Y +E         +W    +  ++  +
Sbjct: 8431 GPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTST-LRHCK 8489

Query: 796  FTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLT 855
            ++   L+ G+ Y+FRVRA N  G       S+ +  K   G   +PD  P + D      
Sbjct: 8490 YSVTKLIEGKEYLFRVRAENRFGPGPPCV-SKPLVAKDPFGPPDAPDK-PIVED-----V 8542

Query: 856  ASRGRVHEASPPTFQKDALLGSKPNKPSLPS--------SSQNLGQTEVSKVSETVQEEL 907
             S   + + + P      +LG    K  + S        S  N  +  V  + E +    
Sbjct: 8543 TSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVF 8602

Query: 908  TPPPQKAAPQGK--SKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEI 965
                + AA  GK    SDP       +PP PP      ++   ++ L W+ P   GG EI
Sbjct: 8603 RVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIP-RVTDTSSTTIELEWEPPAFNGGGEI 8661

Query: 966  TGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAV 1025
             GY+V+ + V      +W     K +    Y +  ++E   Y+ +V+A+N AG G P   
Sbjct: 8662 VGYFVDKQLV---GTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPG-- 8716

Query: 1026 SECFKCEEWTIAVPGPPHSLK 1046
                + +  T+A P  P +++
Sbjct: 8717 ----ETQPVTVAEPQEPPAVE 8733



 Score =  134 bits (337), Expect = 7e-31
 Identities = 227/973 (23%), Positives = 378/973 (38%), Gaps = 127/973 (13%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFI-----DKCEVGTDSWSQCNDTPV 564
             P  P+ +K     K+ + +SWK P  DGGSP+  Y +     D      ++W QCN   V
Sbjct: 9640  PDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDV 9699

Query: 565   KFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQ 624
             +  +F V  L+EG  Y FRV+AVN  G      VS+P A + P +  R    PS     +
Sbjct: 9700  EELQFTVEDLVEGGEYEFRVKAVNAAG------VSKPSATVGPCDCQRPDMPPSID-LKE 9752

Query: 625   IIVTEEEPSEGIV---PGPPTDLSVTEATRSYVVLSW-KPPGQR--GHEGIMYFVEKCEA 678
              +  EE  +  IV    G P           +  L+W K P ++    E ++Y       
Sbjct: 9753  FMEVEEGTNVNIVAKIKGVP-----------FPTLTWFKAPPKKPDNKEPVLYDT----- 9796

Query: 679   GTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDI 738
                    VN  +   +    +       +  + +   N+  +G  S+   + V+G +   
Sbjct: 9797  ------HVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNN--LGTASKEMRLNVLG-RPGP 9847

Query: 739   PKAPGKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRF 796
             P  P K   S + D  + +SW   KD    ++  Y IE   A    W   ++ P K   +
Sbjct: 9848  PVGPIK-FESVSAD-QMTLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSEP-KECTY 9904

Query: 797   TCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTA 856
             T   L+ G  Y+FR+ A N  G+ E   DSE    +       +PD     S     +T 
Sbjct: 9905  TIPKLLEGHEYVFRIMAQNKYGIGE-PLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTV 9963

Query: 857   S--RGRVHEASPPT----FQKDALLGSKPNKPSLPSSSQNLGQT-EVSKVSETVQEELTP 909
             +         SP T      KD            P  +  LG + +V+ + E    +   
Sbjct: 9964  NWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRV 10023

Query: 910   PPQKAAPQGKSK--SDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITG 967
                 AA  G +   SDP   +   APP PP      +  + S  L W  P K GG+++TG
Sbjct: 10024 YAINAAGVGPASLPSDPATARDPIAPPGPPFP-KVTDWTKSSADLEWSPPLKDGGSKVTG 10082

Query: 968   YYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSE 1027
             Y V Y+E  +G   +W +   K V      ++ LKE   Y+F+V A+N+AG+G P  V++
Sbjct: 10083 YIVEYKE--EG-KEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTD 10139

Query: 1028  CFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVH-----SGRTPVTGYFVDLKEAKA 1082
               + ++  ++   P   L  S   +D +V+     +      SG+ P T   V     + 
Sbjct: 10140 VIEMKDRLVS---PDLQLDASV--RDRIVVHAGGVIRIIAYVSGKPPPT---VTWNMNER 10191

Query: 1083  KEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPS------DLAGPVVAE 1136
                Q   +   AI +  + ++  +     V+ + A N+AG  K +      D+ GPV   
Sbjct: 10192 TLPQEATIETTAISS-SMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPV--- 10247

Query: 1137  TRPGTKEVVVNVDDDGVISLNF--ECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTK 1194
                GT  +  N+ ++      F  E D  +P + +   K     E   R         T+
Sbjct: 10248 ---GTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEK----RESDRRAWTPVTYTVTR 10300

Query: 1195  MTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEI 1254
                   G+     Y   +   + I     ++  E    L +      P  P   +L V+ 
Sbjct: 10301 QNATVQGLIQGKAYFFRIAAENSIGMGPFVETSE---ALVIREPITVPERP--EDLEVKE 10355

Query: 1255  LEKGQVRFWMQAEKLSGNAK-VNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDE 1313
             + K  V       K  G ++ +NY+   + I      K H   N  ++         ++ 
Sbjct: 10356 VTKNTVTLTWNPPKYDGGSEIINYVLESRLI---GTEKFHKVTNDNLLSRKYTVKGLKEG 10412

Query: 1314  GTYTFQLQ------DGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWE 1367
              TY +++        GK +  +  +   D         +F+ +  IR  G  F       
Sbjct: 10413 DTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIR-VGEAFA------ 10465

Query: 1368  VTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKK--DAGI 1425
             +TG  +   K KV+         W+KDE ++  D++   K    TL + +   K  D+G 
Sbjct: 10466 LTGRYSGKPKPKVS---------WFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGK 10516

Query: 1426  YEVILKDDRGKDK 1438
             Y V++++  G  K
Sbjct: 10517 YCVVVENSTGSRK 10529



 Score =  131 bits (330), Expect = 5e-30
 Identities = 219/1039 (21%), Positives = 387/1039 (37%), Gaps = 164/1039 (15%)

Query: 287   TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
             T+    ++ L  ++ G PEP++ W K    +++     K  ++      T  I  CD  D
Sbjct: 22686 TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCE---KVSLQYTGKRATAVIKFCDRSD 22742

Query: 347   TAQYRASAMNVKGELSAYASVVVKRYK-----GEFDETRFHAGASTMPLSFGVTPYGYAS 401
             + +Y  +  N  G  +   SV+VK        G+   +R      T+  S      G   
Sbjct: 22743 SGKYTLTVKNASG--TKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGG--- 22797

Query: 402   RFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWS 461
                                            EI H+  E +        S   WV  +  
Sbjct: 22798 ------------------------------AEITHYIVERR------ETSRLNWV--IVE 22819

Query: 462   GERATLTF--SHLNKEDEGLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVK 517
             GE  TL++  + L K +E ++ +R   + G      S  +  R++   I   P  P +V 
Sbjct: 22820 GECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNS-FTIPSPPGIPEEV- 22877

Query: 518   CLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCN-DTPVKFARFPVTGLIE 576
                  K++III W +P  DGG+ I  Y +DK E  +  W++ N D  V   R  VT L+E
Sbjct: 22878 --GTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLME 22935

Query: 577   GRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGI 636
             G  Y FRV AVN  G   PS  S  ++  +P+                            
Sbjct: 22936 GCDYQFRVTAVNAAGNSEPSEASNFISCREPS---------------------------Y 22968

Query: 637   VPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSP 695
              PGPP+   V + T+  + L+W KP    G + + Y +E  E  T+ W RV+T   +++ 
Sbjct: 22969 TPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNT 23028

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSV 755
              F + DL  G+ Y FRV   N  G+ E SE+       ++++IP                
Sbjct: 23029 EFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIP---------------- 23072

Query: 756   VVSWEESKDAKELV----GYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLV-TGQSY-IF 809
                 E + D K+ V    G  +   V+ SG+  P      +G       ++ T +SY + 
Sbjct: 23073 --DLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSLL 23130

Query: 810   RVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGR--VHEASPP 867
              V  VN     +Y+ ++E         G  S  V   + D PG   + + +    ++   
Sbjct: 23131 IVDKVNRYDAGKYTIEAE------NQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTI 23184

Query: 868   TFQKDALLGSKPNKPSL---PSSSQNLGQTEVSKVSETVQE-----ELTPPPQKAAPQGK 919
             T++   + G  P    +     ++    +T  +K S+T+       E T    +  P+  
Sbjct: 23185 TWEIPTIDGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENI 23244

Query: 920   SKSDPLKKKTDRA----PPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREV 975
                    + +D       P  P  +  ++  + ++ L W++P   GG+ +TGY +   E 
Sbjct: 23245 YGIGEPCETSDAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVL---EA 23301

Query: 976   IDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWT 1035
                   +W +      +   + +++L E   Y F++ A N  G+  P         ++  
Sbjct: 23302 CKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLR 23361

Query: 1036  I-----AVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGL 1090
             +         P  ++     R   LV+    P+     P   +F     +K +E + R  
Sbjct: 23362 VLPTIDLSTMPQKTIHVPAGRPVELVI----PIAGRPPPAASWF--FAGSKLRESE-RVT 23414

Query: 1091  NEAAIKNVYLKVR--GLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNV 1148
              E   K   L +R   +++   Y   ++ +     G  S+    ++ + +PG     + +
Sbjct: 23415 VETHTKVAKLTIRETTIRDTGEYTLELKNV----TGTTSETIKVIILD-KPGPPTGPIKI 23469

Query: 1149  DDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPR---LEVESKGNKTKMTFKDLGMDDL 1205
             D+    S+    +          S   V   D+ R   L V     ++   F  L   + 
Sbjct: 23470 DEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNE 23529

Query: 1206  GIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQ 1265
              ++    T+  GI  SYL  E     ++      + P  P   ++  ++   G    W  
Sbjct: 23530 YVFRVAATNRFGI-GSYLQSE-----VIECRSSIRIPGPPETLQI-FDVSRDGMTLTWYP 23582

Query: 1266  AEKLSGNAKVNYIFNEKEI 1284
              E   G+    YI   KE+
Sbjct: 23583 PEDDGGSQVTGYIVERKEV 23601



 Score =  131 bits (329), Expect = 6e-30
 Identities = 97/326 (29%), Positives = 140/326 (42%), Gaps = 46/326 (14%)

Query: 418  EGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDE 477
            EGE +S+       P      P + W+++G  +  S  +        A L      + D 
Sbjct: 8028 EGEKLSIPVPFRAVPV-----PTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADA 8082

Query: 478  GLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAV 535
            G+YTI +  ++G               + ++ G P    D+K  +  K    ++W+ P  
Sbjct: 8083 GIYTITLENKLGSA---------TASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEF 8133

Query: 536  DGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFP 595
            DGG+PIL Y +++ E G  ++        K + + V  LI    Y FRV+AVNK+G G  
Sbjct: 8134 DGGTPILHYVLERREAGRRTYIPVMSGENKLS-WTVKDLIPNGEYFFRVKAVNKVGGGEY 8192

Query: 596  SRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVV 655
              +  PV A DP +                            P PP D+ V   T   + 
Sbjct: 8193 IELKNPVIAQDPKQP---------------------------PDPPVDVEVHNPTAEAMT 8225

Query: 656  LSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRC 714
            ++WKPP   G   IM Y +EK   G E W+R N  L V    +    L EGK Y FRVR 
Sbjct: 8226 ITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHL-VPILTYTAKGLEEGKEYQFRVRA 8284

Query: 715  SNSAGVGEPSEATEVTVVGDKLDIPK 740
             N+AG+ EPS AT  T   D +D PK
Sbjct: 8285 ENAAGISEPSRATPPTKAVDPIDAPK 8310



 Score =  129 bits (323), Expect = 3e-29
 Identities = 129/471 (27%), Positives = 187/471 (39%), Gaps = 95/471 (20%)

Query: 288   VWEKENVKLHCSIAGWPEPRVTWYK-------NQVPINVHANPGKYIIESRYGMHTLEIN 340
             V E  NV +   I G P P +TW+K       N+ P+    +  K +++      TL I 
Sbjct: 9756  VEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTC---TLVIP 9812

Query: 341   GCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYA 400
                  DT  Y  +A+N  G  S               E R +      P      P G  
Sbjct: 9813  QSRRSDTGLYTITAVNNLGTAS--------------KEMRLNVLGRPGP------PVG-P 9851

Query: 401   SRFEIHFDDKFDVS-FGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTL 459
              +FE    D+  +S F  + +  S     VI                    +   WV   
Sbjct: 9852  IKFESVSADQMTLSWFPPKDDGGSKITNYVIEKR---------------EANRKTWVHVS 9896

Query: 460   WSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGA------PAAP 513
                +  T T   L +  E ++ I  +        + Y      D+E E A      P AP
Sbjct: 9897  SEPKECTYTIPKLLEGHEYVFRIMAQ--------NKYGIGEPLDSEPETARNLFSVPGAP 9948

Query: 514   LDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKF----ARF 569
                      ++ + ++W++P  DGGSP+ GY+++  +  +  W + N  P+K       +
Sbjct: 9949  DKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSY 10008

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              VTGLIEG  Y FRV A+N  G+G  S  S+P  A DP           AP         
Sbjct: 10009 KVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPI----------AP--------- 10049

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNT 688
                     PGPP    VT+ T+S   L W PP + G   +  Y VE  E G E W++   
Sbjct: 10050 --------PGPPFP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEK-GK 10099

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIP 739
             +  V+  +  +  L EG  Y FRVR  N AG+GEP E T+V  + D+L  P
Sbjct: 10100 DKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSP 10150



 Score =  125 bits (313), Expect = 5e-28
 Identities = 183/774 (23%), Positives = 298/774 (38%), Gaps = 129/774 (16%)

Query: 274   LHAPEFIIKP---RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIES 330
             L APE  I     ++H V    +++L  +  G P P   W K    +++ A+     I +
Sbjct: 21980 LTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRAD-----IHT 22034

Query: 331   RYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPL 390
                  TL +  C+  D  +Y  +  N  G  S   +V V    G              P+
Sbjct: 22035 TDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGP-----------PGPI 22083

Query: 391   SFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPL 450
             +F     G A+                +   +  G R      I H+  E +        
Sbjct: 22084 TFKDVTRGSATLMW-------------DAPLLDGGAR------IHHYVVEKR------EA 22118

Query: 451   SPSKWVQTLWSGERATLTFSHLNKEDEGL-YTIRVRMGEYYEQYSAYVFVRDADAEIEGA 509
             S   W Q +   E+ T     +N   EG+ Y  RV     Y     Y       A  + A
Sbjct: 22119 SRRSW-QVI--SEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPA 22175

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P   LDV  ++ +K   +++W +P  DGGS I GY ++  + G+D W +   T  K   F
Sbjct: 22176 PPRRLDV--VDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHT--KQLTF 22231

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTG---QII 626
              V  L+E   Y FRV+A N  G   P      V   +P      +  P+A  TG   Q+I
Sbjct: 22232 TVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEP------QIEPTADLTGITNQLI 22285

Query: 627   VTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRV 686
               +         G P  + V  + R    ++WK    R        +++ +  +    + 
Sbjct: 22286 TCK--------AGSPFTIDVPISGRPAPKVTWKLEEMR--------LKETDRVSITTTKD 22329

Query: 687   NTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKII 746
              T L VK       D   G S  + +   N+AGV   + +  V V+G    +    G I 
Sbjct: 22330 RTTLTVK-------DSMRGDSGRYFLTLENTAGV--KTFSVTVVVIGRPGPV---TGPIE 22377

Query: 747   PSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTG 804
              S  +  S V+SW E KD    E+  Y +E   +G+  W+  N++ VK ++     L   
Sbjct: 22378 VSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSS-VKRTQIKVTHLTKY 22436

Query: 805   QSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRV--- 861
               Y FRV + N  G+S+  + +  I           P V P+    P     S   +   
Sbjct: 22437 MEYSFRVSSENRFGVSKPLESAPII--------AEHPFVPPSAPTRPEVYHVSANAMSIR 22488

Query: 862   -----HEASPPTF-------QKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTP 909
                  H+             +++ +L  K NK  +P    N    +V+ + E ++ +   
Sbjct: 22489 WEEPYHDGGSKIIGYWVEKKERNTILWVKENK--VPCLECNY---KVTGLVEGLEYQFRT 22543

Query: 910   PPQKAAPQGKSK--SDPLKKKTDRAPPSPP--CDITCLESFRDSMVLGWKQPDKIGGAEI 965
                 AA   K+   S P+  +     P  P   D+T     R ++ L W  P   GG+++
Sbjct: 22544 YALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVT-----RSTVSLIWSAPAYDGGSKV 22598

Query: 966   TGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 1019
              GY +  + V +   G+W + N   VS+  + ++ L E   Y+F+V A N AG+
Sbjct: 22599 VGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGV 22652



 Score =  122 bits (307), Expect = 2e-27
 Identities = 234/997 (23%), Positives = 368/997 (36%), Gaps = 139/997 (13%)

Query: 508  GAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFA 567
            G P +P  +   E  K  I + WK+P  +GGSPI GY I+K       + + N       
Sbjct: 8921 GPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTT 8980

Query: 568  RFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALD---PAEKARLKSRPSAPWTGQ 624
             F V  L E + Y FRV+AVN++G   PS     V   D   P  K RL  R        
Sbjct: 8981 SFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDT----- 9035

Query: 625  IIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQ 684
            I V   EP    +P   T L + +       + W     +    I    +  +   E   
Sbjct: 9036 IKVKAGEPVH--IPADVTGLPMPK-------IEWS----KNETVIEKPTDALQITKEEVS 9082

Query: 685  RVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGK 744
            R   +  +  P+    D        + V  SN  G    +   EV       D P  P  
Sbjct: 9083 RSEAKTELSIPKAVREDKGT-----YTVTASNRLGSVFRNVHVEV------YDRPSPPRN 9131

Query: 745  IIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGK--WEPCNNNPVKGSRFTCHG 800
            +  +     S  ++W+   D    E+  Y I+   A   K  WE   N  V+  R+    
Sbjct: 9132 LAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVE-KRYGIWK 9190

Query: 801  LVTGQSYIFRVRAVNAAGLSEYSQDSEAI--------------EVKAAIGGGVSPDVCPA 846
            L+    Y FRVRAVN  G+S+  +  + +              +V A   G +     P 
Sbjct: 9191 LIPNGQYEFRVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPP 9250

Query: 847  LSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEE 906
            L +    +T       E   P +       S+ ++  +        +  V ++ E V+ +
Sbjct: 9251 LDNGGSPITGYWLEKREEGSPYW-------SRVSRAPITKVGLKGVEFNVPRLLEGVKYQ 9303

Query: 907  LTPPPQKAAPQG--KSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAE 964
                   AA  G     SDP        PP PP      +  + S+ LGWK P K GG+ 
Sbjct: 9304 FRAMAINAAGIGPPSEPSDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSP 9363

Query: 965  ITGYYVNYREVIDGVPGKWREANV--KAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAP 1022
            I GY V  +E  +G    W+  N   K ++     + NLKE   Y+F+V A+N AG   P
Sbjct: 9364 IKGYIVEMQE--EGTTD-WKRVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEP 9420

Query: 1023 SAVSECFKC----EEWTIAVP-GPPHSLKCSEVRKDSLVLQWKPPVHSGR-TPVTGYFVD 1076
            S  +         EE  + +  G    L C    +  +     P V  GR TP + +  D
Sbjct: 9421 SDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRI-----PAVIKGRPTPKSSWEFD 9475

Query: 1077 LKEAKAKEDQWRGLNE-----AAIKNVYLKVRGLKEGVSYVFRVRAINQAGVG------K 1125
             K  KA +D    + E      A  +  + +   K   +  + + A N+AG        K
Sbjct: 9476 GKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVK 9535

Query: 1126 PSDLAGP-----VVAETRPGTKEVVVNVDDDGVISLN-FECDKMTPKSEFSWSKDYVSTE 1179
              D+ GP     V   TR   +      DDDG   +  +  +K T   + +W+K      
Sbjct: 9536 VMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGK-AWTK------ 9588

Query: 1180 DSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEH 1239
                  V      T     DL  +    +     +  GI        E ++R  A    +
Sbjct: 9589 ------VNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPV----ETIQRTTARDPIY 9638

Query: 1240 KFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFE--GPKYKMHIDRN 1297
              P  P+K  L + ++ K  V    +  K  G + V +   E   ++  G K +     N
Sbjct: 9639 P-PDPPIK--LKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCN 9695

Query: 1298 TGIIEMFMEKLQDEDEG-TYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQ 1356
               +E     ++D  EG  Y F++   KA N + V          +  A     +  R  
Sbjct: 9696 KRDVEELQFTVEDLVEGGEYEFRV---KAVNAAGVS---------KPSATVGPCDCQRPD 9743

Query: 1357 GPHFVEYLSW-EVTGECNVLLKCKVANIKKETHIVWYK------DEREISVDEKHDFK-- 1407
             P  ++   + EV    NV +  K+  +   T + W+K      D +E  + + H  K  
Sbjct: 9744 MPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPT-LTWFKAPPKKPDNKEPVLYDTHVNKLV 9802

Query: 1408 -DGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKL 1443
             D  CTL+I +  + D G+Y +   ++ G     ++L
Sbjct: 9803 VDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRL 9839



 Score =  121 bits (304), Expect = 5e-27
 Identities = 115/467 (24%), Positives = 177/467 (37%), Gaps = 86/467 (18%)

Query: 287   TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
             TV   + ++L   + G P P V W K++   ++  +P +  I++R       +      D
Sbjct: 11840 TVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSP-RVKIDTRADSSKFSLTKAKRSD 11898

Query: 347   TAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIH 406
               +Y  +A N  G   AYA+V V    G     +                          
Sbjct: 11899 GGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKI------------------------- 11933

Query: 407   FDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERAT 466
                  DVS  R        C V   P       EIQ Y     L   +  + +WS   AT
Sbjct: 11934 ----VDVSSDR--------CTVCWDPPEDDGGCEIQNY----ILEKCETKRMVWSTYSAT 11977

Query: 467   L-----TFSHLNKEDEGLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCL 519
             +     T + L + +E ++ +R   ++G      S  V  +         P  P   +  
Sbjct: 11978 VLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTK----YDKPGRPDPPEVT 12033

Query: 520   EANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRS 579
             + +K+ + + W  P  DGG  I GYF++K E  +  W   N + +   R  V  L+    
Sbjct: 12034 KVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHE 12093

Query: 580   YIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPG 639
             Y FRV+A N++GIG PS  S PV A DP E                            PG
Sbjct: 12094 YQFRVKAENEIGIGEPSLPSRPVVAKDPIEP---------------------------PG 12126

Query: 640   PPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCE------AGTENWQRVNTELPVK 693
             PPT+  V + T+  + L W  P   G   I+ +V +        +  E W+R N    + 
Sbjct: 12127 PPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLV 12186

Query: 694   SPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPK 740
                F +  L E + Y FRV   N  G+G P+E  E     + L+ P+
Sbjct: 12187 RKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPE 12233



 Score =  120 bits (300), Expect = 1e-26
 Identities = 118/471 (25%), Positives = 184/471 (39%), Gaps = 81/471 (17%)

Query: 277   PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
             P   +   ++++   E++K+   + G P P ++W K+  P+       +  +E       
Sbjct: 17940 PSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLK---QTTRVNVEETATSTV 17996

Query: 337   LEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTP 396
             L I   + +D  +Y  +A N  G  +   SV+V    G                     P
Sbjct: 17997 LHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPG--------------------PP 18036

Query: 397   YGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWV 456
              G     E+  D    V    E    + GC++      K       W+     ++     
Sbjct: 18037 VGPVRFDEVSAD---FVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVA----- 18088

Query: 457   QTLWSGERATLTFSHLNKEDEGLYTIRV----RMGEYYEQYSAYVFVRDADAEIEGAPAA 512
                    R T+  + L    E  Y  R+    R G+     S  V V+    E  G P  
Sbjct: 18089 -------RTTIKITKLKTGTE--YQFRIFAENRYGKSAPLDSKAVIVQYPFKE-PGPPGT 18138

Query: 513   PLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVT 572
             P        +KD +++ W +P  DGG+ I+GY +++ E  +  W + N TP++  +F  T
Sbjct: 18139 PF---VTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTT 18195

Query: 573   GLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEP 632
             GL EG  Y F+V A N +GIG PS+VSE   A DP +                       
Sbjct: 18196 GLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDP---------------------- 18233

Query: 633   SEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELP 691
                  PG P  + +   TR+ V L WK P   G   I  Y VEK +     W + +    
Sbjct: 18234 -----PGRPEAIVI---TRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASF-TN 18284

Query: 692   VKSPRFALFDLAEGKSYCFRVRCSNSAG-VGEPSEATEVTVVGDKLDIPKA 741
             V    F +  L E + Y FRV   N+AG   EPS+++      D++D P A
Sbjct: 18285 VLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNA 18335



 Score =  117 bits (293), Expect = 9e-26
 Identities = 95/316 (30%), Positives = 144/316 (45%), Gaps = 39/316 (12%)

Query: 510  PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
            P+ PLD+   +A + +I I+WK P  +GGSPI+GY ++ C VGT+ W + N  P+K  +F
Sbjct: 7913 PSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKF 7972

Query: 570  PV-TGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVT 628
             V  G++  + Y+ RVRAVN +G+  PS +SE V A DP  K  +        T  IIV 
Sbjct: 7973 KVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLE-----THDIIVI 8027

Query: 629  EEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNT 688
            E E     +P P   + V         +SW   G+         V+  +  T     ++ 
Sbjct: 8028 EGEKLS--IPVPFRAVPVP-------TVSWHKDGKE--------VKASDRLTMKNDHISA 8070

Query: 689  ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPS 748
             L V  P+    D        + +   N   +G  + +  V V+G    +P     I  S
Sbjct: 8071 HLEV--PKSVRADAG-----IYTITLENK--LGSATASINVKVIG----LPGPCKDIKAS 8117

Query: 749  RNTDTSVVVSWE--ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQS 806
              T +S  ++WE  E      ++ Y +E   AG   + P  +   K S +T   L+    
Sbjct: 8118 DITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLS-WTVKDLIPNGE 8176

Query: 807  YIFRVRAVNAAGLSEY 822
            Y FRV+AVN  G  EY
Sbjct: 8177 YFFRVKAVNKVGGGEY 8192



 Score =  117 bits (292), Expect = 1e-25
 Identities = 89/308 (28%), Positives = 141/308 (45%), Gaps = 18/308 (5%)

Query: 922   SDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPG 981
             SDP+  +     P  P          +S+ L W +P+  GG+EI  Y +  RE       
Sbjct: 21768 SDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKKST--- 21824

Query: 982   KW-REANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPG 1040
             +W +  + + +SE  +K++ L E   Y+F V A N AG+G  S +S   KC E  +  PG
Sbjct: 21825 RWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCRE-PVNPPG 21883

Query: 1041  PPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN-EAAIKNVY 1099
             PP  +K ++  K ++ L+W  PV  G   + GY +++   KA    W  +N EA +K  Y
Sbjct: 21884 PPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEM--CKADLGDWHKVNAEACVKTRY 21941

Query: 1100  LKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVV-------NVDDDG 1152
               V  L+ G  Y FRV AIN AG G   ++ G + A  R    E+ +       +V   G
Sbjct: 21942 -TVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAG 22000

Query: 1153  VISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDV 1212
                  F   +  P     WSK    +  S R ++ +  + + +T ++   +D G Y+  V
Sbjct: 22001 ASIRLFIAYQGRPTPTAVWSKP--DSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTV 22058

Query: 1213  TDTDGIAS 1220
              +  G  S
Sbjct: 22059 ENNSGSKS 22066



 Score =  116 bits (290), Expect = 2e-25
 Identities = 133/548 (24%), Positives = 220/548 (40%), Gaps = 61/548 (11%)

Query: 638   PGPPTD-LSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSP 695
             PGPP   +   E +  +VV+SW+PP   G   I  Y VEK +  T  W  V+    V   
Sbjct: 18033 PGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSAT--VART 18090

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSV 755
                +  L  G  Y FR+   N  G   P ++  V +V      P  PG    +  +   +
Sbjct: 18091 TIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAV-IVQYPFKEPGPPGTPFVTSISKDQM 18149

Query: 756   VVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRA 813
             +V W E  +    +++GY++E     S  W   N  P++ ++F   GL  G  Y F+V A
Sbjct: 18150 LVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSA 18209

Query: 814   VNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGG-----LTASRGRVHEASPPT 868
              N  G+ + S+ SE           V+ D C    D PG      +T +   +    P  
Sbjct: 18210 ENIVGIGKPSKVSECF---------VARDPC----DPPGRPEAIVITRNNVTLKWKKPAY 18256

Query: 869   FQKDALLGSKPNKPSLP------SSSQNLGQTE--VSKVSETVQEELTPPPQKAAPQGKS 920
                  + G    K  LP      +S  N+ +TE  VS + E  + E     + AA     
Sbjct: 18257 DGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSE 18316

Query: 921   KSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVP 980
              SD     T R     P + +    ++D +V+        G   +    +  + + D V 
Sbjct: 18317 PSDSSGAITARDEIDAP-NASLDPKYKDVIVV------HAGETFVLEADIRGKPIPDVVW 18369

Query: 981   GKWREANVKAVSEEAYKISNLKENMVYQFQVAA------MNMAGLGAPSAVSECFKCEEW 1034
              K  +   +  +    K +  K  +V +  +        + ++ +G   ++    K    
Sbjct: 18370 SKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVK---- 18425

Query: 1035  TIAVPGPPHS-LKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEA 1093
              +  PGPP   LK + V  +   L W PP+  G   ++ Y ++ +E       W  ++  
Sbjct: 18426 VLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLS--WTQVS-T 18482

Query: 1094  AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA------ETRPGTKEVVVN 1147
              ++ +  KV  L  G  Y+FRV A+N+ G+G+P + +GPV A         P T EV   
Sbjct: 18483 EVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLE-SGPVTACNPYKPPGPPSTPEVSAI 18541

Query: 1148  VDDDGVIS 1155
               D  V++
Sbjct: 18542 TKDSMVVT 18549



 Score =  115 bits (289), Expect = 3e-25
 Identities = 166/757 (21%), Positives = 275/757 (36%), Gaps = 129/757 (17%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYR 351
             E +K++  IAG P P ++W K+ + I   A   +  I S      L +  C   DT QY 
Sbjct: 19433 EVLKINADIAGRPLPVISWAKDGIEIEERA---RTEIISTDNHTLLTVKDCIRRDTGQYV 19489

Query: 352   ASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF-GVTPYGYASRFEIHFDDK 410
              +  NV G  S   +  V       D+    AG    PL   G+T             +K
Sbjct: 19490 LTLKNVAGTRSVAVNCKV------LDKPGPPAG----PLEINGLTA------------EK 19527

Query: 411   FDVSFGREGET--MSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGE--RAT 466
               +S+GR  E     +   +V   E  H    + W              T+  GE    +
Sbjct: 19528 CSLSWGRPQEDGGADIDYYIVEKRETSH----LAW--------------TICEGELQMTS 19569

Query: 467   LTFSHLNKEDEGLYTI----RVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEAN 522
                + L K +E ++ +    +  +GE  E     V ++  D      P+ P  ++     
Sbjct: 19570 CKVTKLLKGNEYIFRVTGVNKYGVGEPLES----VAIKALDPFT--VPSPPTSLEITSVT 19623

Query: 523   KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIF 582
             K+ + + W +P  DGGS I GY I++ E  +  W + N  PV   R   TGL EG  Y +
Sbjct: 19624 KESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEY 19683

Query: 583   RVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPT 642
             RV A N  G+  PS  S  + A DP                             +P PP+
Sbjct: 19684 RVYAENAAGLSLPSETSPLIRAEDPV---------------------------FLPSPPS 19716

Query: 643   DLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFD 701
                + ++ ++ + ++W KP    G     Y VE  ++   +W+     L  +   + +  
Sbjct: 19717 KPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTSIQSL--RGTEYTISG 19774

Query: 702   LAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK-------LDIPKAPGKIIPSRNTDTS 754
             L  G  Y FRV+  N  G  +PS++++  +  ++       +D       I+ +  + T 
Sbjct: 19775 LTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASFTM 19834

Query: 755   VV---------VSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQ 805
              V         V W +         Y        S   E  N N       T   +++  
Sbjct: 19835 TVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAA 19894

Query: 806   SYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLTASRGRVHEAS 865
             S    V+ ++  G        +  +  A +   V         +  GG       + +  
Sbjct: 19895 SLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDV--------PENDGGAPVKNYHIEKRE 19946

Query: 866   PPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPL 925
                  K A +    N   L     NL +  +     + + E          +G       
Sbjct: 19947 A---SKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEG------- 19996

Query: 926   KKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWRE 985
              K T++  P     +T +   +DS+ L W +P+  GG+ I  Y V   E ++     W +
Sbjct: 19997 VKITEKPSPPEKLGVTSIS--KDSVSLTWLKPEHDGGSRIVHYVV---EALEKGQKNWVK 20051

Query: 986   ANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAP 1022
               V       + +S L+EN  Y F+V A N AGL  P
Sbjct: 20052 CAV--AKSTHHVVSGLRENSEYFFRVFAENQAGLSDP 20086



 Score =  113 bits (282), Expect = 2e-24
 Identities = 82/300 (27%), Positives = 136/300 (45%), Gaps = 26/300 (8%)

Query: 934   PSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSE 993
             P PP          D M L W  P   GG+E+TG++V  +E    +   W++ N   +S 
Sbjct: 21385 PGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSIL---WQKVNTSPISG 21441

Query: 994   EAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVP--GPPHSLKCSEVR 1051
               Y+ + L E + YQF+V A N AGL +PS  S+      +T+AV    PP +    +V 
Sbjct: 21442 REYRATGLVEGLDYQFRVYAENSAGLSSPSDPSK------FTLAVSPVDPPGTPDYIDVT 21495

Query: 1052  KDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSY 1111
             ++++ L+W PP+  G + + GY ++ ++     ++W   N   +      V GL  G  Y
Sbjct: 21496 RETITLKWNPPLRDGGSKIVGYSIEKRQGN---ERWVRCNFTDVSECQYTVTGLSPGDRY 21552

Query: 1112  VFRVRAINQAG-VGKPSDLAGPVVAETRPGTKEVVVNVDD---DGVISLNFECDKMT--- 1164
              FR+ A N  G +  PS  +G ++  TR      +V       DG+I  + E  ++    
Sbjct: 21553 EFRIIARNAVGTISPPSQSSGIIM--TRDENVPPIVEFGPEYFDGLIIKSGESLRIKALV 21610

Query: 1165  ---PKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1221
                P    +W KD V  E    +E+      T +  +D   D  G+Y+ +  +  G A +
Sbjct: 21611 QGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKA 21670



 Score =  112 bits (279), Expect = 4e-24
 Identities = 71/232 (30%), Positives = 103/232 (44%), Gaps = 28/232 (12%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P  P   +     KD ++++W +P  DGG+ I GY ++K +     W++CN   +   R 
Sbjct: 18530 PGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWTKCNKKTLTDLRL 18589

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              VTGL EG SY FRV A N  G+G PS  S    A D                       
Sbjct: 18590 RVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDAL--------------------- 18628

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNT 688
                     PGPP++  VT+ +RS V L+W  P   G   +  Y VE  EA  + W     
Sbjct: 18629 ------YPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTP 18682

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPK 740
                ++  +F +  L E   Y FR+   NS GVGEP+      V  ++++ P+
Sbjct: 18683 PTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPE 18734



 Score =  108 bits (269), Expect = 6e-23
 Identities = 127/511 (24%), Positives = 214/511 (41%), Gaps = 52/511 (10%)

Query: 638   PGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPR 696
             PGPP  + + E +   + +SW PP   G   I  Y VEK E  +  W  V+  +   S +
Sbjct: 19116 PGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSIK 19175

Query: 697   FALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVV 756
               +  L  G  Y FRV   N  G    SE++ V V       P  PG       T ++++
Sbjct: 19176 --IVRLTTGSEYQFRVCAENRYGKSSYSESSAV-VAEYPFSPPGPPGTPKVVHATKSTML 19232

Query: 757   VSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAV 814
             V+W+   +     ++GY++E     S  W   N   +  ++    GL  G  Y +RV A 
Sbjct: 19233 VTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAE 19292

Query: 815   NAAGLSEYSQDSEAIEVKAAIGGGVSPDVC-PALSDEPGGLTASRGRVHEASPPTFQKDA 873
             N AG+ + S+  E +  +         D C P    E   +T     +  + P       
Sbjct: 19293 NIAGIGKCSKSCEPVPAR---------DPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAK 19343

Query: 874   LLGSKPNKPSLPS------SSQNLGQT--EVSKVSETVQEELTPPPQKAAPQGKSKSD-- 923
             + G    +  LP       +  N+ +T  EV++++E  + E     + AA      S+  
Sbjct: 19344 ITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSEST 19403

Query: 924   -PLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGY---YVNYREVIDGV 979
              P+  K D  PP    D+     FRD +V+   +  KI  A+I G     +++ +  DG+
Sbjct: 19404 GPIIVKDDVEPPRVMMDV----KFRDVIVVKAGEVLKI-NADIAGRPLPVISWAK--DGI 19456

Query: 980   PGKWREANVKAVSEEAYKISNLKENM---VYQFQVAAMNMAGLGAPSAVSECFKCEEWTI 1036
               + R A  + +S + + +  +K+ +     Q+ +   N+AG       S    C+   +
Sbjct: 19457 EIEER-ARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAG-----TRSVAVNCK--VL 19508

Query: 1037  AVPGPPHS-LKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAI 1095
               PGPP   L+ + +  +   L W  P   G   +  Y V+ +E       W  + E  +
Sbjct: 19509 DKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRE--TSHLAWT-ICEGEL 19565

Query: 1096  KNVYLKVRGLKEGVSYVFRVRAINQAGVGKP 1126
             +    KV  L +G  Y+FRV  +N+ GVG+P
Sbjct: 19566 QMTSCKVTKLLKGNEYIFRVTGVNKYGVGEP 19596



 Score =  107 bits (267), Expect = 1e-22
 Identities = 81/279 (29%), Positives = 125/279 (44%), Gaps = 45/279 (16%)

Query: 462  GERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEA 521
            G ++ L      ++D G Y I         +++A      A  E+   P   LD+K +  
Sbjct: 8784 GTKSELIIKDALRKDHGRYVITAT-NSCGSKFAA------ARVEVFDVPGPVLDLKPVVT 8836

Query: 522  NKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYI 581
            N+   +++W  P  DGGS I G+ I++ +    +W Q  +T  + ++  +TGL+EG+ Y 
Sbjct: 8837 NRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIET--ERSKCDITGLLEGQEYK 8894

Query: 582  FRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPP 641
            FRV A NK G G P  +  P+ A+DP                               GPP
Sbjct: 8895 FRVIAKNKFGCGPPVEIG-PILAVDPL------------------------------GPP 8923

Query: 642  TD---LSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRF 697
            T    L+ TE T+S + L WK P   G   I  Y +EK      +++RVN  L   +  F
Sbjct: 8924 TSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRL-CPTTSF 8982

Query: 698  ALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKL 736
             + +L E + Y FRV+  N  G  EPS    V +  D++
Sbjct: 8983 LVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEV 9021



 Score =  103 bits (256), Expect = 2e-21
 Identities = 71/193 (36%), Positives = 91/193 (47%), Gaps = 7/193 (3%)

Query: 638   PGPPTD-LSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSP 695
             PGPP   L VT  T     L+W PP Q G   I  Y +EK E    +W +V+TE  V++ 
Sbjct: 18430 PGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTE--VQAL 18487

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSV 755
              + +  L  G  Y FRV   N  G+GEP E+  VT   +    P  P     S  T  S+
Sbjct: 18488 NYKVTKLLPGNEYIFRVMAVNKYGIGEPLESGPVTAC-NPYKPPGPPSTPEVSAITKDSM 18546

Query: 756   VVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRA 813
             VV+W    D    E+ GY +E       +W  CN   +   R    GL  G SY FRV A
Sbjct: 18547 VVTWARPVDDGGTEIEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAA 18606

Query: 814   VNAAGLSEYSQDS 826
              NAAG+ E S+ S
Sbjct: 18607 ENAAGVGEPSEPS 18619



 Score = 95.1 bits (235), Expect = 5e-19
 Identities = 161/728 (22%), Positives = 271/728 (37%), Gaps = 135/728 (18%)

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
             VF R  DA     P  P + K  + ++  + ++W +P  DGG+P+ GY ++  E   D W
Sbjct: 18620 VFYRACDALYP--PGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEW 18677

Query: 557   SQCND-TPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKS 615
             + C   T ++  +F VT L E   Y FR+ A+N  G+G P+ +   V A +  E   ++ 
Sbjct: 18678 TTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIEL 18737

Query: 616   RPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQ---RGHEGIMYF 672
                     +++V                L  +   R +V +  +P  +      EGI+  
Sbjct: 18738 DAD---LRKVVV----------------LRASATLRLFVTIKGRPEPEVKWEKAEGIL-- 18776

Query: 673   VEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVV 732
                         R   E+        + ++    S  + +   N++G    S+   V V 
Sbjct: 18777 ----------TDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSG----SKTAFVNV- 18821

Query: 733   GDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCNNNP 790
                LD P AP  +        SV +SWE        ++  Y +E        +    NN 
Sbjct: 18822 -RVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNC 18880

Query: 791   VKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDE 850
              K + F    L  G SY FRV A N  G+   ++ +E ++V             P L   
Sbjct: 18881 TK-TTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSE-----------PPL--P 18926

Query: 851   PGGLTASRGRVHEASPPTFQKDALLGSKPN----KPSLPSSSQNLGQTEVSKVSETVQEE 906
             PG +T      + A+    + ++  GSK      +     S +    T+V  +  T+   
Sbjct: 18927 PGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATI-SG 18985

Query: 907   LTPPPQ----KAAPQGKSKSDP-----------LKKKTDRAPPSPPCDITCLESF----- 946
             LT   +     AA   K +SDP           ++ K     P    ++   E       
Sbjct: 18986 LTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKIDVP 19045

Query: 947   ---RDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKE 1003
                R    + W++ D     E T   V+  + +  +  K  EA+ + V      +SN   
Sbjct: 19046 FKGRPQATVNWRK-DGQTLKETTRVNVSSSKTVTSLSIK--EASKEDVGTYELCVSNSAG 19102

Query: 1004  NMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPV 1063
             ++     +  ++  G   P  + E   C+  TI+                     W PP 
Sbjct: 19103 SITVPITIIVLDRPGPPGPIRIDE-VSCDSITIS---------------------WNPPE 19140

Query: 1064  HSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGV 1123
             + G   ++ Y V+ KE  +    W  +++ A+    +K+  L  G  Y FRV A N+ G 
Sbjct: 19141 YDGGCQISNYIVEKKETTS--TTWHIVSQ-AVARTSIKIVRLTTGSEYQFRVCAENRYGK 19197

Query: 1124  GKPSDLAGPVVAE------TRPGTKEVV------------VNVDDDGVISLNFECDKMTP 1165
                S+ +  VVAE        PGT +VV            V V+D G   + +  +    
Sbjct: 19198 SSYSE-SSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLE-YKE 19255

Query: 1166  KSEFSWSK 1173
             +S   WSK
Sbjct: 19256 RSSILWSK 19263



 Score = 94.0 bits (232), Expect = 1e-18
 Identities = 84/340 (24%), Positives = 135/340 (39%), Gaps = 45/340 (13%)

Query: 274   LHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYII-ESRY 332
             + AP F  + R+  V  + N  L C + G P+P V WY+    I   A+  KY I E + 
Sbjct: 24553 IQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEII--ADGLKYRIQEFKG 24610

Query: 333   GMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF 392
             G H L I     +D   Y+  A N  G +S  AS+ V+         + H   +   +  
Sbjct: 24611 GYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEV------PAKIHLPKTLEGMGA 24664

Query: 393   GVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSP 452
                  G     +I F  K D                          P I W +    +  
Sbjct: 24665 VHALRGEVVSIKIPFSGKPD--------------------------PVITWQKGQDLIDN 24698

Query: 453   SKWVQTLWSGERATLTFSH-LNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPA 511
             +   Q + +    +L F + + ++D G Y +  +     +Q       +  + ++   P 
Sbjct: 24699 NGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQ-------KTVELDVADVPD 24751

Query: 512   APLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPV 571
              P  VK  + ++D + ++W +PA DGGS I  Y ++KC    + W +      +  R+ V
Sbjct: 24752 PPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQ--ARETRYTV 24809

Query: 572   TGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKA 611
               L    SY FRV A NK G+  PS  SEP    +   +A
Sbjct: 24810 INLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRA 24849



 Score = 77.8 bits (190), Expect = 8e-14
 Identities = 58/224 (25%), Positives = 109/224 (48%), Gaps = 17/224 (7%)

Query: 157   ERIKEAAAYIAQRNLLASEEGITTSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTA 216
             E +K++AA   +++++  E  IT + Q++   +T A  ++ +++ S    Q    + + A
Sbjct: 26634 EEVKKSAATSLEKSIVHEE--ITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIA 26691

Query: 217   SRQSVV----SKQATSALQQEETSEKKSRKVVIREKAER-----LSLRKTLEETET--YH 265
                 V       + T++ +         + + I++ + R       + KT E      Y 
Sbjct: 26692 GATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYD 26751

Query: 266   AKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGK 325
               L+++ L  AP FI +PRS  + E +NV   C I+G P P + W+KN +PI++ +N   
Sbjct: 26752 LTLSKE-LSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVS- 26809

Query: 326   YIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVV 369
               I     +++LEI      D+ +Y   A N +G+ SA AS++V
Sbjct: 26810 --ISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV 26851



 Score = 77.0 bits (188), Expect = 1e-13
 Identities = 112/520 (21%), Positives = 196/520 (37%), Gaps = 54/520 (10%)

Query: 1158 FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
            FEC+   P     W KD    + + R++++ +    ++      M D G Y+  V     
Sbjct: 3031 FECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYT--VVAGGN 3088

Query: 1218 IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQ--VRFWMQAEKLSGNAKV 1275
            ++++ L  E    R+ ++  E             V+++EK +  V F +  + +  +   
Sbjct: 3089 VSTAKLFVEGRDVRIRSIKKE-------------VQVIEKQRAVVEFEVNEDDVDAHWYK 3135

Query: 1276 NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVG 1335
            + I    ++ E  KY   ++R   I  MF+ + +  D G YTF        N S+V L  
Sbjct: 3136 DGIEINFQVQERHKYV--VERR--IHRMFISETRQSDAGEYTFVA----GRNRSSVTLYV 3187

Query: 1336 DVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDE 1395
            +  +  Q   E Q       +   F                 C V + + +  I WYK+E
Sbjct: 3188 NAPEPPQVLQELQPVTVQSGKPARF-----------------CAVISGRPQPKISWYKEE 3230

Query: 1396 REISVDEKHDF-KDGI-CTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMM 1453
            + +S   K  F  DG   TLL+ E   +DA +Y    K+D G   +   L  E  + +  
Sbjct: 3231 QLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSP 3290

Query: 1454 EVCKKIALSA--TDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTG 1511
            +    +   A  T L+   T+EG            DLKV+W      I+ S   +     
Sbjct: 3291 DQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFE 3350

Query: 1512 EQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLK-QAAIAEKN 1570
            +   L+I E  P D+G Y     +       T +LS + + +        +   +++   
Sbjct: 3351 DTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEGFSKFEENTSNSQWHVSLSVSF 3410

Query: 1571 RARVLGGLPDVV------TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFE 1624
            +   LG  P  +       +  G+ +     V G P PE+ W  N++ +         FE
Sbjct: 3411 KKEPLGQKPSFIQPLSSLRVHNGETVRFHARVSGIPKPEIQWFHNQQLILPTKDVVFHFE 3470

Query: 1625 AGR-TAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
                 A   I    +  +G+Y     N  G  T   T++V
Sbjct: 3471 ESTGMALMLIVDAYSEHAGQYSCKAANSAGEATCAATLTV 3510



 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 104/533 (19%), Positives = 203/533 (38%), Gaps = 97/533 (18%)

Query: 1158 FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
            F C+  T  ++  W ++  +  DS +  +  K     +  +D  +DD   Y+  +T+  G
Sbjct: 6287 FNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRG 6346

Query: 1218 ----IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNA 1273
                 A++ +++EE+L+ +            P+K    +E +EK  V FW +  +L  N 
Sbjct: 6347 ENVKSAANLIVEEEDLRIV-----------EPLKD---IETMEKKSVTFWCKVNRL--NV 6390

Query: 1274 KVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVL 1333
             + +  N +E+    +    +D+   ++ +  +     DEG Y       K+     ++ 
Sbjct: 6391 TLKWTKNGEEVPFDNRVSYRVDKYKHMLTI--KDCGFPDEGEYIVTAGQDKSVAELLII- 6447

Query: 1334 VGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECN-VLLKCKVANIKKETHIVWY 1392
                                 +    FVE+L  +   E +  +  C+++  +++ ++ WY
Sbjct: 6448 ---------------------EAPTEFVEHLEDQTVTEFDDAVFSCQLS--REKANVKWY 6484

Query: 1393 KDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKE-- 1450
            ++ REI   +K+ F+             KD  I+ +I+KD R  D+       E  K   
Sbjct: 6485 RNGREIKEGKKYKFE-------------KDGSIHRLIIKDCRLDDECEYACGVEDRKSRA 6531

Query: 1451 --LMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTG 1508
               + E+  +I     D+     A G  +        + ++V W  N   +   D+ +  
Sbjct: 6532 RLFVEEIPVEIIRPPQDIL---EAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMM 6588

Query: 1509 VTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAE 1568
              G+   LQI +  P D+G+Y     D                 EA A+ +      I  
Sbjct: 6589 SEGKIHRLQICDIKPRDQGEYRFIAKD----------------KEARAKLELAAAPKIKT 6632

Query: 1569 KNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRT 1628
             ++  V         +  GK L +       P  E  W K  + L++     +   A +T
Sbjct: 6633 ADQDLV---------VDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTK---TIDTTAEQT 6680

Query: 1629 AYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVF-IPEEEARMAALESLKG 1680
            + F I      D G+Y +V++NK+G       + V  +P     +   E+  G
Sbjct: 6681 S-FRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDG 6732



 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 67/296 (22%), Positives = 117/296 (39%), Gaps = 27/296 (9%)

Query: 1378  CKVANIKKETHIVWYKDEREISVDEKHD--FKDGICTLLITEFSKKDAGIYEVILKDDRG 1435
             CK+ N  + T + WY   R++   EK++  ++DG+  L + + +K D G Y   + +D G
Sbjct: 25217 CKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYG 25276

Query: 1436  KDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHN 1495
             +D S  +L  +  +E+    C++     T  KI+   + ++L      +   L    ++ 
Sbjct: 25277 EDSSYAELFVKGVREVYDYYCRR-----TMKKIKRRTDTMRLLERPPEFTLPLYNKTAYV 25331

Query: 1496  GSAIRYSDRVKTGVTGEQIWLQINE---PTPNDKGKYVMELFDGKTGHQKTVDLSGQAYD 1552
             G  +R+   +         W +  +   P  NDK KY  E    K  +Q T++      D
Sbjct: 25332 GENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDK-KYTFE--SDKGLYQLTINSVTTDDD 25388

Query: 1553  EAYAEFQRLKQAAIAEKNRARVLGGLPDV--------------VTIQEGKALNLTCNVWG 1598
               Y    R K    + K +  V    P                   QEG+++     V G
Sbjct: 25389 AEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSG 25448

Query: 1599  DPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGS 1654
              PPP + W K+ + L+   +  +  E        I      D+G Y +   N  GS
Sbjct: 25449 IPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGS 25504



 Score = 69.7 bits (169), Expect = 2e-11
 Identities = 102/489 (20%), Positives = 180/489 (36%), Gaps = 79/489 (16%)

Query: 1165 PKSEFSWSKDYVSTEDSPRLE-VESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1223
            P  E  W K+ V  E S R+     + N  ++  +D+  +D         +  G  SS+ 
Sbjct: 2059 PDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHA 2118

Query: 1224 IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1283
                + K+L+  + E +      K  +A             + E      KV +  +  E
Sbjct: 2119 FLLVQAKQLITFTQELQDVVAKEKDTMAT-----------FECETSEPFVKVKWYKDGME 2167

Query: 1284 IFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQK 1343
            + EG KY+MH DR    + +      D ++ +    ++D      + +++ G V + +++
Sbjct: 2168 VHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVL-VEDENVKTTAKLIVEGAVVEFVKE 2226

Query: 1344 EAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVA--NIKKETHIVWYKDEREISVD 1401
              + +  E                 +GE    L+C V+  NI+ +    WY ++ E+  +
Sbjct: 2227 LQDIEVPE---------------SYSGE----LECIVSPENIEGK----WYHNDVELKSN 2263

Query: 1402 EKHDF--KDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKI 1459
             K+    + G   L + + +K+D G Y  ++  D  K   +LK+       L        
Sbjct: 2264 GKYTITSRRGRQNLTVKDVTKEDQGEYSFVI--DGKKTTCKLKMKPRPIAILQ------- 2314

Query: 1460 ALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQIN 1519
                  L  Q   EG  +   V   +E ++  W  +G  ++ SDRV   +  +   L I 
Sbjct: 2315 -----GLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIE 2369

Query: 1520 EPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLP 1579
            + T  D G Y   +          + LS       Y+                 V+  L 
Sbjct: 2370 DMTKEDAGNYSFTI--------PALGLSTSGRVSVYS---------------VDVITPLK 2406

Query: 1580 DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
            DV  I+  KA+ L C V       V W  N++ +  DD        G      IN    +
Sbjct: 2407 DVNVIEGTKAV-LECKVSVPDVTSVKWYLNDEQIKPDDRVQ-AIVKGTKQRLVINRTHAS 2464

Query: 1640 DSGKYGLVV 1648
            D G Y L+V
Sbjct: 2465 DEGPYKLIV 2473



 Score = 69.7 bits (169), Expect = 2e-11
 Identities = 121/559 (21%), Positives = 206/559 (36%), Gaps = 117/559 (20%)

Query: 1168  EFSWSKDYVSTEDSPRLEVESKGNKT-KMTFKDLGMDDLGIYSCDVTDTDGIASSYL--- 1223
             E +W KD    +++   +     + T ++   +L   D G Y C+++   G + + L   
Sbjct: 26376 EVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFM 26435

Query: 1224  -------------------IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWM 1264
                                 D++  +  +    E K P       + V  L+   V    
Sbjct: 26436 GQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDS 26495

Query: 1265  QAE---KLSGNAKVNYIFNE--KEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQ 1319
              A+   K +G  +   I+ +  K I +G KYK+  D+    +E+   K    D G YT  
Sbjct: 26496 VAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEI--HKTDTSDSGLYTCT 26553

Query: 1320  LQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCK 1379
             +++   +  S+  L      K  K+ E Q+              +S + T E   +   K
Sbjct: 26554 VKNSAGSVSSSCKLT----IKAIKDTEAQK--------------VSTQKTSE---ITPQK 26592

Query: 1380  VANIKKETHIVWYKDER----EISVDEKHDFKDGICTLLITEFSKKDAG-------IYEV 1428
              A +++E      + E     E    EK   K+    +LI+E  KK A        ++E 
Sbjct: 26593 KAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEE 26652

Query: 1429  ILKDDRGKDKSRLKLVDEAFKELMME------VCKKIALSATDLKIQSTAEGIQLYSFVT 1482
             I K  +  ++ R     +AF   M        V K     ATD+K               
Sbjct: 26653 ITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGATDVK--------------- 26697

Query: 1483  YYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKG--KYVMELFDGKTGH 1540
                      W  NG  +  S+  + GV+G    L I + +  D+G    + +  +G    
Sbjct: 26698 ---------WVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKC 26748

Query: 1541  QKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDP 1600
             Q  + LS +  D           A I++          P    I EG+ +  TC + G+P
Sbjct: 26749 QYDLTLSKELSDAP---------AFISQ----------PRSQNINEGQNVLFTCEISGEP 26789

Query: 1601  PPEVSWLKNEKALASDDHCNLKFEAGRTAY-FTINGVSTADSGKYGLVVKNKYGSETSDF 1659
              PE+ W KN   ++     N+     R  Y   I   S +DSGKY +  KN  G  ++  
Sbjct: 26790 SPEIEWFKNNLPISISS--NVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATA 26847

Query: 1660  TVSVF-IPEEEARMAALES 1677
             ++ V  + EE +R   L +
Sbjct: 26848 SLMVLPLVEEPSREVVLRT 26866



 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 91/360 (25%), Positives = 148/360 (41%), Gaps = 39/360 (10%)

Query: 175  EEGITTSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEE 234
            E  I  S  +T  K+ +A+  S+A K + + K  T     T  R               +
Sbjct: 785  EASIAGSAIATLQKELSAT--SSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPD 842

Query: 235  TSEKKSRKVVIREKAERLSLRKTLEET-ETYH---AKLNEDHLLHAP-EFIIKP------ 283
            T + ++   V +E    ++     EE  E  H   AK+ E   + AP E  + P      
Sbjct: 843  TYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSG 902

Query: 284  -RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGC 342
             ++ TV E E+V L C I+G+P P VTWY+    I    +   + I  + G+  L I   
Sbjct: 903  LKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSID---FQITFQSGIARLMIREA 959

Query: 343  DFEDTAQYRASAMNVKGEL--SAYASVVVKR----------YKGEFDETRFHAGASTMPL 390
              ED+ ++  SA+N  G +  S Y +V V             K   +E RF      +  
Sbjct: 960  FAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMT 1019

Query: 391  SFGVT--PYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGV 448
               +T    G       +F  K  V    EG ++  GC+V   P     +P + W ++GV
Sbjct: 1020 DTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNP-----KPHVYWKKSGV 1074

Query: 449  PLSPSKWVQTLWSGE--RATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEI 506
            PL+     +  ++ +     L  S    +D G YTI VR  ++ E  ++   + +AD E+
Sbjct: 1075 PLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVR-NKHGETSASASLLEEADYEL 1133



 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 63/303 (20%), Positives = 130/303 (42%), Gaps = 23/303 (7%)

Query: 1039  PGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNV 1098
             P  P +L   EV+KDS+ L W+PP+  G   +T Y V+ +E   K   +  +     K  
Sbjct: 18827 PSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRK--AYATITNNCTKTT 18884

Query: 1099  YLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVD-DDGVISLN 1157
             + ++  L+EG SY FRV A N+ G+G P++   PV     P     V  VD      ++ 
Sbjct: 18885 F-RIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIK 18943

Query: 1158  FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
             +E  +    S+ +     + T+ S +    ++    + T   L   +  ++     +  G
Sbjct: 18944 WEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATISGLTAGEEYVFRVAAVNEKG 19003

Query: 1218  IASSYLIDEEELKRLLALSHEHKFP----TVPVKSELAVEILEKGQVRFWMQAEKLSGNA 1273
              +    +    + R + +    + P     V  + +L +++  KG+ +           A
Sbjct: 19004 RSDPRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKIDVPFKGRPQ-----------A 19052

Query: 1274  KVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQD--GKATNHSTV 1331
              VN+  + + + E    ++++  +  +  + +++   ED GTY   + +  G  T   T+
Sbjct: 19053 TVNWRKDGQTLKE--TTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITI 19110

Query: 1332  VLV 1334
             +++
Sbjct: 19111 IVL 19113



 Score = 67.4 bits (163), Expect = 1e-10
 Identities = 62/233 (26%), Positives = 93/233 (39%), Gaps = 35/233 (15%)

Query: 251   RLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTW 310
             R +++K    T+T         L   PEF +   + T +  ENV+   +I   PEP VTW
Sbjct: 25298 RRTMKKIKRRTDTMRL------LERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTW 25351

Query: 311   YKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
             YK+   I    N  KY  ES  G++ L IN    +D A+Y   A N  GE S  A + V 
Sbjct: 25352 YKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVT 25411

Query: 371   RYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVI 430
              +    D T         P+                F      +  +EG+++    RV  
Sbjct: 25412 LHPPPTDST-------LRPM----------------FKRLLANAECQEGQSVCFEIRVSG 25448

Query: 431   TPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSG-ERATLTFSHLNKEDEGLYTI 482
              P      P ++W ++G PLS    ++ +  G +   L       ED G Y +
Sbjct: 25449 IP-----PPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRV 25496



 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 110/549 (20%), Positives = 203/549 (36%), Gaps = 91/549 (16%)

Query: 1132 PVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGN 1191
            P V  T+P   + V    ++G  ++  EC+     ++  W K+      S + E+ + G 
Sbjct: 5911 PPVEFTKPLEDQTV----EEGATAV-LECEVSRENAKVKWFKNGTEILKSKKYEIVADGR 5965

Query: 1192 KTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELA 1251
              K+   D   +D+  Y+CD  D     +  ++                 P V     L 
Sbjct: 5966 VRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVP----------------PHVEFLRPLT 6009

Query: 1252 -VEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQD 1310
             +++ EK   RF  + E    NAKV +  +  EI +G KY   I     +  + + K   
Sbjct: 6010 DLQVREKEMARF--ECELSRENAKVKWFKDGAEIKKGKKY--DIISKGAVRILVINKCLL 6065

Query: 1311 EDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTG 1370
            +DE  Y+ +++  + +   TV         L++EA F +               + EV+ 
Sbjct: 6066 DDEAEYSCEVRTARTSGMLTV---------LEEEAVFTK------------NLANIEVSE 6104

Query: 1371 ECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVIL 1430
               + L C+V+  K    ++WYK + EI    +++        ++TE  K+   I    L
Sbjct: 6105 TDTIKLVCEVS--KPGAEVIWYKGDEEIIETGRYE--------ILTEGRKRILVIQNAHL 6154

Query: 1431 KDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKV 1490
             +D G    RL       K  + E+  +      +L+I    EG +     +   E   V
Sbjct: 6155 -EDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEI---LEGEKAEFVCSISKESFPV 6210

Query: 1491 NWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQA 1550
             W  +   +   D+      G++  L + + T  D G YV+ +   +     TV      
Sbjct: 6211 QWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTV------ 6264

Query: 1551 YDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNE 1610
                                + R++  L D   ++E + +   C V      +  W +NE
Sbjct: 6265 ------------------IEKLRIVVPLKD-TRVKEQQEVVFNCEV-NTEGAKAKWFRNE 6304

Query: 1611 KALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEA 1670
            +A+  D    +  +        I      D   Y + + N  G E      ++ + EE+ 
Sbjct: 6305 EAI-FDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRG-ENVKSAANLIVEEEDL 6362

Query: 1671 RMAALESLK 1679
            R+  +E LK
Sbjct: 6363 RI--VEPLK 6369



 Score = 65.5 bits (158), Expect = 4e-10
 Identities = 62/235 (26%), Positives = 100/235 (42%), Gaps = 13/235 (5%)

Query: 142   SGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITTSKQSTASKQTTASKQSTASKQ 201
             S RQ+ V+ IT+ EEE   E + + AQR   +S   +   ++S +       +  +   +
Sbjct: 25863 SRRQREVTEITEIEEEY--EISKH-AQRESSSSASRLLRRRRSLSPTYIELMRPVSELIR 25919

Query: 202   STAS-----KQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKVVIREKAERLSLRK 256
             S        +  T  R  T  R    S    S+ +     E+ +R  +        +  K
Sbjct: 25920 SRPQPAEEYEDDTERRSPTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALK 25979

Query: 257   TLEETETYHAKLNEDH--LLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQ 314
             T + +E  +  L++    L HAP   ++ RSH V   +N +   ++   P   V WY N 
Sbjct: 25980 TQKTSERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNG 26039

Query: 315   VPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVV 369
             V +       K    +  G+ TLEI  C  +D+  YRA   N KGE S YA++ V
Sbjct: 26040 VELQ---ESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDV 26091



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 105/531 (19%), Positives = 200/531 (37%), Gaps = 98/531 (18%)

Query: 1147 NVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLG 1206
            N++     + +FEC+         W K+ V  E S + ++  +G   ++   +   +D  
Sbjct: 2844 NIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSA 2903

Query: 1207 IYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQA 1266
             Y+  V   D ++++  +    +  +L   +  +  T+  +    V +  +G    W++ 
Sbjct: 2904 EYTF-VCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFE----VTVNYEGISYKWLK- 2957

Query: 1267 EKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKAT 1326
                         N  EI    K +M   + T  + +    +   D   YTF    GKAT
Sbjct: 2958 -------------NGVEIKSTDKCQMRTKKLTHSLNI--RNVHFGDAADYTFVA--GKAT 3000

Query: 1327 NHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKE 1386
            + +T+ +         +  EF++         H  +    +V  +   + +C+V+  + +
Sbjct: 3001 STATLYVEA-------RHIEFRK---------HIKDI---KVLEKKRAMFECEVS--EPD 3039

Query: 1387 THIVWYKDEREISVDEKHDFKDG--ICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLV 1444
              + W KD++E+ + ++   +    +  LLI      DAG Y V+     G + S  KL 
Sbjct: 3040 ITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVA----GGNVSTAKLF 3095

Query: 1445 DEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVE------DLKVNWSHNGSA 1498
             E                  D++I+S  + +Q+       VE      D+  +W  +G  
Sbjct: 3096 VEG----------------RDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIE 3139

Query: 1499 IRYS--DRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYA 1556
            I +   +R K  V      + I+E   +D G+Y      G+     T+ ++     +   
Sbjct: 3140 INFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA--GRNRSSVTLYVNAPEPPQVLQ 3197

Query: 1557 EFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASD 1616
            E Q                      VT+Q GK       + G P P++SW K E+ L++ 
Sbjct: 3198 ELQP---------------------VTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTG 3236

Query: 1617 DHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPE 1667
              C    +        I      D+  Y    KN YG  T+  ++SV +PE
Sbjct: 3237 FKCKFLHDGQEYTLLLIEAF-PEDAAVYTCEAKNDYGVATTSASLSVEVPE 3286



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 46/149 (30%), Positives = 67/149 (44%), Gaps = 9/149 (6%)

Query: 637   VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSP 695
             VP PP  + V++ +R  V L+W  P   G   I  Y VEKC    E W RV      +  
Sbjct: 24749 VPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQ---ARET 24805

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVV-GDKLDIPKAPGKIIPSRNTDTS 754
             R+ + +L    SY FRV   N  G+ +PSE +E T+   DK        ++  +R     
Sbjct: 24806 RYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDETR----E 24861

Query: 755   VVVSWEESKDAKELVGYYIEASVAGSGKW 783
             V ++       KEL   Y+ A   G G++
Sbjct: 24862 VSMTKASHSSTKELYEKYMIAEDLGRGEF 24890



 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 101/468 (21%), Positives = 186/468 (39%), Gaps = 77/468 (16%)

Query: 1073 YFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGP 1132
            +F D  E K K  ++  +++ A++ + +    L +   Y   VR    +G+         
Sbjct: 6034 WFKDGAEIK-KGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLT------- 6085

Query: 1133 VVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNK 1192
            V+ E    TK +  N++     ++   C+   P +E  W K      ++ R E+ ++G K
Sbjct: 6086 VLEEEAVFTKNLA-NIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRK 6144

Query: 1193 TKMTFKDLGMDDLGIYSCDVTD--TDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSEL 1250
              +  ++  ++D G Y+C +    TDG    + +  E + +   L               
Sbjct: 6145 RILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNL--------------- 6189

Query: 1251 AVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQD 1310
              EILE  +  F     K S    V +  ++K +  G KY +  D    ++ +    LQD
Sbjct: 6190 --EILEGEKAEFVCSISKES--FPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQD 6245

Query: 1311 EDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTG 1370
               GTY   +   +A  H TV+    +   L+     ++QE                   
Sbjct: 6246 M--GTYVVMVGAARAAAHLTVIEKLRIVVPLKDTRVKEQQE------------------- 6284

Query: 1371 ECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDF--KDGICTLLITEFSKKDAGIYEV 1428
               V+  C+V    +     W+++E  I    K+    KD + TL I +    D   Y V
Sbjct: 6285 ---VVFNCEVNT--EGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNV 6339

Query: 1429 ILKDDRGKD-KSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVED 1487
             L + RG++ KS   L+ E     ++E  K I             E ++  S VT++ + 
Sbjct: 6340 SLTNHRGENVKSAANLIVEEEDLRIVEPLKDI-------------ETMEKKS-VTFWCKV 6385

Query: 1488 LKVN----WSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVM 1531
             ++N    W+ NG  + + +RV   V   +  L I +    D+G+Y++
Sbjct: 6386 NRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIV 6433



 Score = 60.8 bits (146), Expect = 1e-08
 Identities = 47/165 (28%), Positives = 74/165 (44%), Gaps = 14/165 (8%)

Query: 1038  VPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKN 1097
             VP PP  +K S+V +DS+ L W  P   G + +T Y V+  +     ++W  + +A  + 
Sbjct: 24749 VPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVE--KCATTAERWLRVGQA--RE 24804

Query: 1098  VYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLN 1157
                 V  L    SY FRV A N+ G+ KPS+ + P + +     K   +N D++   +  
Sbjct: 24805 TRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKE---DKTRAMNYDEEVDETRE 24861

Query: 1158  FECDKMTPKSEFSWSKDYVSTEDSPRLE-------VESKGNKTKM 1195
                 K +  S     + Y+  ED  R E       VE+   KT M
Sbjct: 24862 VSMTKASHSSTKELYEKYMIAEDLGRGEFGIVHRCVETSSKKTYM 24906



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 36/116 (31%), Positives = 59/116 (50%), Gaps = 7/116 (6%)

Query: 1036 IAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKE--DQWRGLNEA 1093
            I +PGP   +K S++ K S  L W+PP   G TP+  Y ++ +EA  +       G N+ 
Sbjct: 8105 IGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKL 8164

Query: 1094 AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVD 1149
            +       V+ L     Y FRV+A+N+ G G+  +L  PV+A+      +  V+V+
Sbjct: 8165 S-----WTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVE 8215



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 63/288 (21%), Positives = 114/288 (39%), Gaps = 96/288 (33%)

Query: 1489  KVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKY--VMELFDGKTGHQKTVDL 1546
             +V W HNG  ++ S ++    T   + L+I +   +D G Y  V   + G+     T+D+
Sbjct: 26032 EVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDV 26091

Query: 1547  SGQAYD----------------------EAYA--EFQR---------------------- 1560
             +G  Y                       EAYA   F++                      
Sbjct: 26092 TGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRE 26151

Query: 1561  ------------LKQAAIAEKN--------------RARVLGGLPDVVTIQEGKALNLTC 1594
                         +K AA+ EK+               AR+L   P  +T+ EG++   +C
Sbjct: 26152 SLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTK-PRSMTVYEGESARFSC 26210

Query: 1595  NVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAY---FTINGVSTADSGKYGLVVKNK 1651
             +  G+P P V+WL+  + L++    + + +   T Y   F I+ V  +D G Y +VV+N 
Sbjct: 26211 DTDGEPVPTVTWLRKGQVLST----SARHQVTTTKYKSTFEISSVQASDEGNYSVVVENS 26266

Query: 1652  YGSETSDFTVSV--------------FIPEEEARMAALESLKGGKKAK 1685
              G + ++FT+++               +   E R+ + E++K  K+ K
Sbjct: 26267 EGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVK 26314



 Score = 58.2 bits (139), Expect = 7e-08
 Identities = 70/284 (24%), Positives = 102/284 (35%), Gaps = 55/284 (19%)

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
            P FI    S  V   E V+ H  ++G P+P + W+ NQ  I +      +  E   GM  
Sbjct: 3419 PSFIQPLSSLRVHNGETVRFHARVSGIPKPEIQWFHNQQLI-LPTKDVVFHFEESTGMAL 3477

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVV---------------------KRYKGE 375
            + I     E   QY   A N  GE +  A++ V                     K +   
Sbjct: 3478 MLIVDAYSEHAGQYSCKAANSAGEATCAATLTVTPKAPESILHERIEQEIEMEMKEFSSS 3537

Query: 376  F---DETRFHAG----------------ASTMPLSFGVTPYGYASRFEIHFDDKFDVSFG 416
            F   +E   H+                 +   P  F     G    F I      D+S  
Sbjct: 3538 FLSAEEEGLHSAELQLSKINETLELLSESPVYPTKFDSEKEGTGPIF-IKEVSNADISM- 3595

Query: 417  REGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKED 476
              G+  +L   V+  P     +P+IQW+ NGV L+PS   + ++ G+  +L       ED
Sbjct: 3596 --GDVATLSVTVIGIP-----KPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLED 3648

Query: 477  EGLYTIRVRMGEYYEQYSAYVFVRD-----ADAEIEGAPAAPLD 515
            EG YT            SAY+ +        D E E A A  L+
Sbjct: 3649 EGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLE 3692



 Score = 57.8 bits (138), Expect = 9e-08
 Identities = 116/592 (19%), Positives = 217/592 (36%), Gaps = 102/592 (17%)

Query: 1165 PKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLI 1224
            P+ + SW K+        + +    G +  +   +   +D  +Y+C+  +  G+A++   
Sbjct: 3220 PQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSAS 3279

Query: 1225 DEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQ-VRFWMQAEKLSGNAKVNYIFNEKE 1283
               E+  +++   E       + + L   +  +GQ  RF  Q      + KV++   +K+
Sbjct: 3280 LSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARF--QCRVSGTDLKVSWYSKDKK 3337

Query: 1284 IFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQK 1343
            I     ++M    +T  +E+   +   EDEGTYTF   +      ST  L  + F K ++
Sbjct: 3338 IKPSRFFRMTQFEDTYQLEI--AEAYPEDEGTYTFVASNAVGQVSSTANLSLEGFSKFEE 3395

Query: 1344 EAEFQRQEW-------IRK----QGPHFVEYLS-WEVTGECNVLLKCKVANIKKETHIVW 1391
                   +W        +K    Q P F++ LS   V     V    +V+ I K   I W
Sbjct: 3396 NTS--NSQWHVSLSVSFKKEPLGQKPSFIQPLSSLRVHNGETVRFHARVSGIPKP-EIQW 3452

Query: 1392 YKDEREI--SVDEKHDFKD--GICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLV--- 1444
            + +++ I  + D    F++  G+  +LI +   + AG Y     +  G+      L    
Sbjct: 3453 FHNQQLILPTKDVVFHFEESTGMALMLIVDAYSEHAGQYSCKAANSAGEATCAATLTVTP 3512

Query: 1445 --------DEAFKELMMEV---------CKKIALSATDLKIQSTAEGIQLYSFVTYY--- 1484
                    +   +E+ ME+          ++  L + +L++    E ++L S    Y   
Sbjct: 3513 KAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYPTK 3572

Query: 1485 -----------------------------------VEDLKVNWSHNGSAIRYSDRVKTGV 1509
                                               +   K+ W  NG  +  S   K   
Sbjct: 3573 FDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVF 3632

Query: 1510 TGEQIWLQINEPTPNDKGKYVMELFD--GKT--GHQKTVDLSGQAYDEAYAEFQRLKQAA 1565
             G+   L I      D+G+Y     +  GKT       ++  G+ + +   E      +A
Sbjct: 3633 DGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETE------SA 3686

Query: 1566 IAEKNRARVLGG------LPDVVTIQ--EGKALNLTCNVWGDPPPEVSWLKNEKALASDD 1617
            +A+      LGG      L ++  I+  +G        V G+P P V+W K  K L +  
Sbjct: 3687 VAKS--LEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSV 3744

Query: 1618 HCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEE 1669
            +  +      +  F +N     DSG Y    +N  G  T    + V + + +
Sbjct: 3745 YYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLLEDTD 3796



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 57/235 (24%), Positives = 100/235 (42%), Gaps = 27/235 (11%)

Query: 1466  LKIQSTAEGIQLYSFVTYYVEDLK-VNWSHNGSAIRYSDRVKTGVTGEQIW-LQINEPTP 1523
             LK +++ E  +L   V   V   K V W  +G  ++ +   +   + +  + L+IN  T 
Sbjct: 26352 LKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTE 26411

Query: 1524  NDKGKYVMELFDGKTGHQKT-VDLSGQAY----------DEAYAEFQRLKQAAIAEKNRA 1572
             +D+G+YV E+  G+ G  KT +   GQA+           E     Q+  ++ +  K   
Sbjct: 26412 SDQGEYVCEI-SGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEP 26470

Query: 1573  R----------VLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLK 1622
             +          ++ GL D  T+             G+P P   W K+ KA+       L 
Sbjct: 26471 KAPEPISSKPVIVTGLQD-TTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLS 26529

Query: 1623  FEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV-FIPEEEARMAALE 1676
              + G   +  I+   T+DSG Y   VKN  GS +S   +++  I + EA+  + +
Sbjct: 26530 EDKG-GFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQ 26583



 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 93/428 (21%), Positives = 159/428 (37%), Gaps = 58/428 (13%)

Query: 1039  PGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNV 1098
             PGP   L  S V ++   L W  P   G   +T Y V+ +E       W  +        
Sbjct: 22769 PGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLN--WVIVEGECPTLS 22826

Query: 1099  YLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA--------------ETRPGTKEV 1144
             Y+  R +K    Y+FRVRA+N+ G G P + + P+VA              E   G + +
Sbjct: 22827 YVVTRLIKNN-EYIFRVRAVNKYGPGVPVE-SEPIVARNSFTIPSPPGIPEEVGTGKEHI 22884

Query: 1145  VVN----VDDDGVISLNFECDKMTPKSEFSWS---KDYVSTEDSPRLEVESKGNKTKMTF 1197
             ++       D G    N+  DK   KS   W+   KDYV  +            + K+T 
Sbjct: 22885 IIQWTKPESDGGNEISNYLVDKREKKS-LRWTRVNKDYVVYD-----------TRLKVTS 22932

Query: 1198  KDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEK 1257
                G D    Y   VT  +   +S   +  E    ++   E  +   P  +   V+  + 
Sbjct: 22933 LMEGCD----YQFRVTAVNAAGNS---EPSEASNFISC-REPSYTPGPPSAPRVVDTTKH 22984

Query: 1258  GQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYT 1317
                  W +     G   V Y+   +E      Y++H +      E  +  L+   +  Y+
Sbjct: 22985 SISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQK--YS 23042

Query: 1318  FQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLK 1377
             F++           V V  + +  +  AE +  E I        + L   VT      L+
Sbjct: 23043 FRV---------AAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGASLR 23093

Query: 1378  CKVANIKKETHIV-WYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGK 1436
               V+   +   ++ W K   +++     D  +    L++ + ++ DAG Y +  ++  GK
Sbjct: 23094 LMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGK 23153

Query: 1437  DKSRLKLV 1444
              KS   LV
Sbjct: 23154 -KSATVLV 23160



 Score = 54.7 bits (130), Expect = 8e-07
 Identities = 100/495 (20%), Positives = 186/495 (37%), Gaps = 92/495 (18%)

Query: 1158 FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
            FEC+     ++  W KD    +   + ++ SKG    +      +DD   YSC+V     
Sbjct: 6021 FECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTART 6080

Query: 1218 IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNY 1277
                 +++EE                V  K+   +E+ E   ++   +  K    A+V +
Sbjct: 6081 SGMLTVLEEE---------------AVFTKNLANIEVSETDTIKLVCEVSK--PGAEVIW 6123

Query: 1278 IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQL----QDGKATNHSTVVL 1333
               ++EI E  +Y++  +    I  + ++    ED G Y  +L     DGK   H     
Sbjct: 6124 YKGDEEIIETGRYEILTEGRKRI--LVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAA- 6180

Query: 1334 VGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYK 1393
                             E+I K  P  +E L  E          C ++  K+   + W +
Sbjct: 6181 -----------------EFISK--PQNLEILEGE-----KAEFVCSIS--KESFPVQWKR 6214

Query: 1394 DEREISVDEKHD-FKDG-ICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKEL 1451
            D++ +   +K+D   DG    L++ + + +D G Y V++   R    + L ++++     
Sbjct: 6215 DDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARA--AAHLTVIEKL---- 6268

Query: 1452 MMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTG 1511
                  +I +   D +++   E +      T   E  K  W  N  AI  S +       
Sbjct: 6269 ------RIVVPLKDTRVKEQQEVVFNCEVNT---EGAKAKWFRNEEAIFDSSKYIILQKD 6319

Query: 1512 EQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAA--IAEK 1569
                L+I +   +D+  Y + L    T H+                 + +K AA  I E+
Sbjct: 6320 LVYTLRIRDAHLDDQANYNVSL----TNHRG----------------ENVKSAANLIVEE 6359

Query: 1570 NRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTA 1629
               R++  L D+ T+ E K++   C V       + W KN + +  D+  + + +  +  
Sbjct: 6360 EDLRIVEPLKDIETM-EKKSVTFWCKV-NRLNVTLKWTKNGEEVPFDNRVSYRVDKYK-H 6416

Query: 1630 YFTINGVSTADSGKY 1644
              TI      D G+Y
Sbjct: 6417 MLTIKDCGFPDEGEY 6431



 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1637
             +P+ +TI+ GK L +  +V+G P P   W K E  + +  H  +  +A  ++   I  V+
Sbjct: 12532 MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAV-HKADSSSILIIKDVT 12590

Query: 1638  TADSGKYGLVVKNKYGSETSDFTVSV 1663
               DSG Y L  +N  G++T    V V
Sbjct: 12591 RKDSGYYSLTAENSSGTDTQKIKVVV 12616



 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 44/192 (22%), Positives = 83/192 (43%), Gaps = 30/192 (15%)

Query: 180   TSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKK 239
             T   + +S + T+  ++++S +   S Q T +R+S +S +   S +  SA  +E++ E  
Sbjct: 26119 TEAYAVSSFKKTSEMEASSSVREVKS-QMTETRESLSSYEHSASAEMKSAALEEKSLE-- 26175

Query: 240   SRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCS 299
                    EK+    ++ TL                 A   + KPRS TV+E E+ +  C 
Sbjct: 26176 -------EKSTTRKIKTTL-----------------AARILTKPRSMTVYEGESARFSCD 26211

Query: 300   IAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKG 359
               G P P VTW +    ++  A   ++ + +     T EI+     D   Y     N +G
Sbjct: 26212 TDGEPVPTVTWLRKGQVLSTSA---RHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEG 26268

Query: 360   ELSAYASVVVKR 371
             +  A  ++ +++
Sbjct: 26269 KQEAEFTLTIQK 26280



 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 1/84 (1%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             D +TI+ G+A  LT    G P P+VSW K+E  +  DD  ++K      A   I     +
Sbjct: 10454 DKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIK-AKRS 10512

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
             DSGKY +VV+N  GS      V+V
Sbjct: 10513 DSGKYCVVVENSTGSRKGFCQVNV 10536



 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 47/166 (28%), Positives = 72/166 (43%), Gaps = 9/166 (5%)

Query: 1503  DRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQ--- 1559
             +R      G+  WL+ N    +D    V  L +G T   + +  +        +E     
Sbjct: 22604 ERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPV 22663

Query: 1560  --RLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDD 1617
               R + A    +  AR+ G   D+VTI+ G  L L   V G P P++ W K +K L   +
Sbjct: 22664 TCRDEYAPPKAELDARLHG---DLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCE 22720

Query: 1618  HCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
               +L++  G+ A   I     +DSGKY L VKN  G++     V V
Sbjct: 22721 KVSLQY-TGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKV 22765



 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 78/375 (20%), Positives = 132/375 (35%), Gaps = 84/375 (22%)

Query: 184  STASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKV 243
            +T +K+    K++         ++S   R     R      +A +A++ +   + +S + 
Sbjct: 1924 TTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEE 1983

Query: 244  VIREKAERLSLRKTLEETETYHAKLNEDHLL----------------HAPEFIIKPRSHT 287
            ++R+  + L L  T E TE     L E+  +                 AP+   + +S T
Sbjct: 1984 LLRKTKDEL-LHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQT 2042

Query: 288  VWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDT 347
            V +  +      + G P+P   WYKN V I        Y  E    +  L I     ED+
Sbjct: 2043 VGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPED--NVCELVIRDVTAEDS 2100

Query: 348  AQYRASAMNVKGELSAYASVVVKRYK-------------GEFDETRFHAGASTMPLSFGV 394
            A     A+N+ GE S++A ++V+  +              E D        ++ P    V
Sbjct: 2101 ASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPF---V 2157

Query: 395  TPYGYASRFEIHFDDKFDVSFGR-----------------------EGETMSLGCRVVIT 431
                Y    E+H  DK+ +   R                       E E +    ++++ 
Sbjct: 2158 KVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVE 2217

Query: 432  PEIKHFQPEIQ------------------------WYRNGVPL-SPSKWVQTLWSGERAT 466
              +  F  E+Q                        WY N V L S  K+  T   G R  
Sbjct: 2218 GAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRG-RQN 2276

Query: 467  LTFSHLNKEDEGLYT 481
            LT   + KED+G Y+
Sbjct: 2277 LTVKDVTKEDQGEYS 2291



 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 59/299 (19%), Positives = 114/299 (38%), Gaps = 36/299 (12%)

Query: 1373  NVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDG--ICTLLITEFSKKDAGIYEVIL 1430
             NVL  C+++  +    I W+K+   IS+           + +L I   S  D+G Y +  
Sbjct: 26778 NVLFTCEISG-EPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKA 26836

Query: 1431  KDDRGKDKSR-----LKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYV 1485
             K+ RG+  +      L LV+E  +E+++          T L+   +++ +Q+ +      
Sbjct: 26837 KNFRGQCSATASLMVLPLVEEPSREVVLRTS-----GDTSLQGSFSSQSVQMSAS----- 26886

Query: 1486  EDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVD 1545
                        S   +S    + +T  +      +   + +  +V        G      
Sbjct: 26887 -------KQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQ 26939

Query: 1546  LSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVS 1605
             L             ++ +A I  +     +  LP  ++I EGK L + C   G+P PEV+
Sbjct: 26940 LESST--------SKMLKAGI--RGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVT 26989

Query: 1606  WLKNEKALASDDHCNLKFE-AGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
             W    + + S +      E         I  V   D G Y L + N++GS+++   + +
Sbjct: 26990 WSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 27048



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 42/157 (26%), Positives = 69/157 (43%), Gaps = 20/157 (12%)

Query: 217  SRQS-VVSKQATSALQQEETSEK---KSRKVVIREKAERLSLRKTLEETETYHAKLNEDH 272
            SR S +++ +AT+    + TS     K  K ++ E+++    RK L+  E      +E  
Sbjct: 1723 SRDSGIITCRATNKYGTDHTSATLIVKDEKSLV-EESQLPEGRKGLQRIEELERMAHEGA 1781

Query: 273  LL---------HAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANP 323
            L            P+ ++ P    V E E  +  C + G+P+P+V WY N   I      
Sbjct: 1782 LTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKR- 1840

Query: 324  GKYIIESRY-GMHTLEINGCDFEDTAQYRASAMNVKG 359
                   RY G+H L+I  C   DT + + +A N +G
Sbjct: 1841 ----FRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEG 1873



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 93/463 (20%), Positives = 166/463 (35%), Gaps = 72/463 (15%)

Query: 1114 RVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSK 1173
            RV A+  +   K + L G        G  +    V+ D VI    +C+     +   W K
Sbjct: 5627 RVEAMGMSSEAKLTVLEGDPYFT---GKLQDYTGVEKDEVI---LQCEISKADAPVKWFK 5680

Query: 1174 DYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLL 1233
            D    + S    +++ G K  +  K     D+G Y+CD   TD  +    I++ E+K + 
Sbjct: 5681 DGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCD-CGTDKTSGKLDIEDREIKLVR 5739

Query: 1234 ALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMH 1293
             L               +VE++E    RF  + E    +   N+    + + + P     
Sbjct: 5740 PLH--------------SVEVMETETARF--ETEISEDDIHANWKLKGEALLQTP--DCE 5781

Query: 1294 IDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTV-VLVGDVFKKLQKEAEFQRQEW 1352
            I     I  + +   + +  G   FQ  + K++ H  V   V  + + L+          
Sbjct: 5782 IKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVT------- 5834

Query: 1353 IRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICT 1412
                           VT        C+++   ++  + WY   +++   +K         
Sbjct: 5835 ---------------VTAGETATFDCELS--YEDIPVEWYLKGKKLEPSDK--------- 5868

Query: 1413 LLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSAT-DLKIQST 1471
                   + +  ++ + L+D + +D   ++L  + FK       K+  +  T  L+ Q+ 
Sbjct: 5869 ----VVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKPLEDQTV 5924

Query: 1472 AEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVM 1531
             EG           E+ KV W  NG+ I  S + +    G    L I++ TP D   Y  
Sbjct: 5925 EEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTC 5984

Query: 1532 ELFDGKTGHQKTVDLSGQAYDEAYAEFQR-LKQAAIAEKNRAR 1573
            +  D KT     V          + EF R L    + EK  AR
Sbjct: 5985 DAKDFKTSCNLNV-------VPPHVEFLRPLTDLQVREKEMAR 6020



 Score = 49.3 bits (116), Expect = 3e-05
 Identities = 96/436 (22%), Positives = 168/436 (38%), Gaps = 62/436 (14%)

Query: 1100 LKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFE 1159
            L +R +    S    V+AIN AG             +    T+E+   V  +      FE
Sbjct: 2090 LVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFE 2149

Query: 1160 CDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIA 1219
            C+   P  +  W KD +   +  +  + S      ++   +   D   YSC + + + + 
Sbjct: 2150 CETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVK 2209

Query: 1220 SSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILE--KGQVRFWMQAEKLSGNAKVNY 1277
            ++         +L+      +F    VK    +E+ E   G++   +  E + G     +
Sbjct: 2210 TT--------AKLIVEGAVVEF----VKELQDIEVPESYSGELECIVSPENIEG----KW 2253

Query: 1278 IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDV 1337
              N+ E+    KY   I    G   + ++ +  ED+G Y+F + DGK T           
Sbjct: 2254 YHNDVELKSNGKYT--ITSRRGRQNLTVKDVTKEDQGEYSFVI-DGKKTT---------- 2300

Query: 1338 FKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVL-LKCKVANIKKETHIVWYKDER 1396
              KL+          ++ +    ++ LS +   E +++ L+ KV+   +    VW KD +
Sbjct: 2301 -CKLK----------MKPRPIAILQGLSDQKVCEGDIVQLEVKVS--LESVEGVWMKDGQ 2347

Query: 1397 EIS-VDEKHDFKDGIC-TLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMME 1454
            E+   D  H   D     LLI + +K+DAG Y   +         R+ +         ++
Sbjct: 2348 EVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYS-------VD 2400

Query: 1455 VCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDL-KVNWSHNGSAIRYSDRVKTGVTGEQ 1513
            V        T LK  +  EG +        V D+  V W  N   I+  DRV+  V G +
Sbjct: 2401 V-------ITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTK 2453

Query: 1514 IWLQINEPTPNDKGKY 1529
              L IN    +D+G Y
Sbjct: 2454 QRLVINRTHASDEGPY 2469



 Score = 48.9 bits (115), Expect = 4e-05
 Identities = 115/564 (20%), Positives = 203/564 (35%), Gaps = 88/564 (15%)

Query: 1090 LNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVD 1149
            L E   + + ++   L++  +Y  R+ +    G  K  +LA   ++  +P   E++    
Sbjct: 6139 LTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFIS--KPQNLEILEGEK 6196

Query: 1150 DDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYS 1209
             + V S++ E   +       W +D  + E   + +V + G K  +  KD  + D+G Y 
Sbjct: 6197 AEFVCSISKESFPV------QWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYV 6250

Query: 1210 CDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKL 1269
              V      A   +I++  +              VP+K      + E+ +V F    E  
Sbjct: 6251 VMVGAARAAAHLTVIEKLRI-------------VVPLKD---TRVKEQQEVVF--NCEVN 6292

Query: 1270 SGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHS 1329
            +  AK  +  NE+ IF+  KY   I +   +  + +     +D+  Y   L + +  N  
Sbjct: 6293 TEGAKAKWFRNEEAIFDSSKYI--ILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVK 6350

Query: 1330 TVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHI 1389
            +   +    + L+     +  E + K+   F     W      NV LK            
Sbjct: 6351 SAANLIVEEEDLRIVEPLKDIETMEKKSVTF-----WCKVNRLNVTLK------------ 6393

Query: 1390 VWYKDEREISVDEKHDFKDGICTLLIT--EFSKKDAGIYEVILKDDRGKDKSRLKLVDEA 1447
             W K+  E+  D +  ++      ++T  +    D G Y V      G+DKS  +L    
Sbjct: 6394 -WTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTA----GQDKSVAEL---- 6444

Query: 1448 FKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKT 1507
               L++E   +      D   Q+  E            E   V W  NG  I+   + K 
Sbjct: 6445 ---LIIEAPTEFVEHLED---QTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKF 6498

Query: 1508 GVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIA 1567
               G    L I +   +D+ +Y   + D K+  +  V       +E   E  R  Q  + 
Sbjct: 6499 EKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFV-------EEIPVEIIRPPQDILE 6551

Query: 1568 EKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGR 1627
                        DVV + E   LN           EV WL+N   +   D   +  E G+
Sbjct: 6552 APG--------ADVVFLAE---LN-------KDKVEVQWLRNNMVVVQGDKHQMMSE-GK 6592

Query: 1628 TAYFTINGVSTADSGKYGLVVKNK 1651
                 I  +   D G+Y  + K+K
Sbjct: 6593 IHRLQICDIKPRDQGEYRFIAKDK 6616



 Score = 48.9 bits (115), Expect = 4e-05
 Identities = 44/200 (22%), Positives = 83/200 (41%), Gaps = 11/200 (5%)

Query: 1484  YVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKT 1543
             Y +  +V W      +  S++ +         L + + T  D G Y  ++ +        
Sbjct: 25222 YDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSY 25281

Query: 1544  VDLSGQAYDEAYAEFQRLKQAAIAEK-NRARVLGGLPDVV------TIQEGKALNLTCNV 1596
              +L  +   E Y  + R     I  + +  R+L   P+        T   G+ +     +
Sbjct: 25282 AELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTI 25341

Query: 1597  WGDPPPEVSWLKN-EKALASDDHCNLKFEAGRTAY-FTINGVSTADSGKYGLVVKNKYGS 1654
                P P V+W K+ +K    D+     FE+ +  Y  TIN V+T D  +Y +V +NKYG 
Sbjct: 25342 TVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGE 25401

Query: 1655  ET--SDFTVSVFIPEEEARM 1672
             ++  +  TV++  P  ++ +
Sbjct: 25402 DSCKAKLTVTLHPPPTDSTL 25421



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 49/207 (23%), Positives = 79/207 (38%), Gaps = 35/207 (16%)

Query: 276 APEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMH 335
           AP F    +S  V E         I+G+P P V+W+++   I+    PG  I  S  G  
Sbjct: 5   APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD-GRA 63

Query: 336 TLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVT 395
            L I      ++ +Y   A N  G+ ++ A ++VK              A T P      
Sbjct: 64  KLTIPAVTKANSGRYSLKATNGSGQATSTAELLVK--------------AETAP------ 103

Query: 396 PYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKW 455
                     +F  +      R+G  + L  RV   P      P +++YR+G  +  S  
Sbjct: 104 ---------PNFVQRLQSMTVRQGSQVRLQVRVTGIP-----TPVVKFYRDGAEIQSSLD 149

Query: 456 VQTLWSGERATLTFSHLNKEDEGLYTI 482
            Q    G+  +L  +    ED G Y++
Sbjct: 150 FQISQEGDLYSLLIAEAYPEDSGTYSV 176



 Score = 48.1 bits (113), Expect = 7e-05
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query: 1575  LGGLPDVVTI-QEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTI 1633
             L GLPD+  + +E     L   + G P P VSW K E  LA+D   +++  A  T    +
Sbjct: 13612 LKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTT-LIV 13670

Query: 1634  NGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
                  +D+GKY + +KN  G++    ++ V
Sbjct: 13671 YDCQKSDAGKYTITLKNVAGTKEGTISIKV 13700



 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 112/499 (22%), Positives = 178/499 (35%), Gaps = 92/499 (18%)

Query: 1158 FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
            FEC+       F W K         R E+   G K  M  K    +D   Y  +  D   
Sbjct: 5487 FECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKH- 5545

Query: 1218 IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNY 1277
             +   +I+   LK L            P+K    V   EK    F    E    N +V +
Sbjct: 5546 TSGKLIIEGIRLKFL-----------TPLKD---VTAKEKESAVF--TVELSHDNIRVKW 5589

Query: 1278 IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDV 1337
              N++ +       M  +  T  I    + L  +D      +   G ++     VL GD 
Sbjct: 5590 FKNDQRLHTTRSVSMQDEGKTHSIT--FKDLSIDDTSQIRVEAM-GMSSEAKLTVLEGDP 5646

Query: 1338 F--KKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDE 1395
            +   KLQ     ++ E                      V+L+C+++  K +  + W+KD 
Sbjct: 5647 YFTGKLQDYTGVEKDE----------------------VILQCEIS--KADAPVKWFKDG 5682

Query: 1396 REISVDEKHDFK-DGICTLLITEFS-KKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMM 1453
            +EI   +    K DG   +LI + + K D G Y      D G DK+  KL D   +E+  
Sbjct: 5683 KEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC----DCGTDKTSGKL-DIEDREI-- 5735

Query: 1454 EVCKKIALSATDLKIQSTAEGIQLYSFVTYYVE-DLKVNWSHNGSAIRYSDRVKTGVTGE 1512
                K+      +++  T    +   F T   E D+  NW   G A+             
Sbjct: 5736 ----KLVRPLHSVEVMET----ETARFETEISEDDIHANWKLKGEAL------------- 5774

Query: 1513 QIWLQINEPTPNDKGK-YVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNR 1571
               LQ  +    ++GK + + L + +      VD   QA +   +   R+K   I     
Sbjct: 5775 ---LQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDF--QAANVKSSAHLRVKPRVIG---- 5825

Query: 1572 ARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYF 1631
              +L  L D VT+  G+     C +  +  P V W    K L   D    + E G+    
Sbjct: 5826 --LLRPLKD-VTVTAGETATFDCELSYEDIP-VEWYLKGKKLEPSDKVVPRSE-GKVHTL 5880

Query: 1632 TINGVSTADSGKYGLVVKN 1650
            T+  V   D+G+  L  K+
Sbjct: 5881 TLRDVKLEDAGEVQLTAKD 5899



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 2/95 (2%)

Query: 1582  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADS 1641
             V  + G+ + +     G PPP V+W K+EK L SD   +++     ++  TI  V+  D+
Sbjct: 20909 VIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIE-NTDSSSLLTIPQVTRNDT 20967

Query: 1642  GKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALE 1676
             GKY L ++N  G E    TVSV + +  A    L+
Sbjct: 20968 GKYILTIENGVG-EPKSSTVSVKVLDTPAACQKLQ 21001



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 7/122 (5%)

Query: 1544  VDLSGQA-YDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPP 1602
             V++ G + Y E+ AE + +++  I +   A     L   VTI+ G +L L  +V G PPP
Sbjct: 23048 VNVKGMSEYSESIAEIEPVERIEIPDLELA---DDLKKTVTIRAGASLRLMVSVSGRPPP 23104

Query: 1603  EVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVS 1662
              ++W K    LAS    +        +   ++ V+  D+GKY +  +N+ G +++   V 
Sbjct: 23105 VITWSKQGIDLASRAIID---TTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVK 23161

Query: 1663  VF 1664
             V+
Sbjct: 23162 VY 23163



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 152/790 (19%), Positives = 286/790 (36%), Gaps = 153/790 (19%)

Query: 997  KISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLV 1056
            KIS  K    Y+  +A   +A L     +S     ++ T +V  P  ++K SE R     
Sbjct: 774  KISVPKTEHGYEASIAGSAIATL--QKELSATSSAQKITKSVKAP--TVKPSETR----- 824

Query: 1057 LQWKPPVHSGRTPVTGY-FVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRV 1115
                  V +  TP+  + F D  +    E       E  +      VR  +  V +    
Sbjct: 825  ------VRAEPTPLPQFPFADTPDTYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREA 878

Query: 1116 RAINQAGVGKPSDLAGPVVAETR-PGTKEVVVNVDDDGVISLNFECD-KMTPKSEFSWSK 1173
            +    A V  P ++  PV   T   G K V V   +    S+  EC     P    +W +
Sbjct: 879  KVTETARVPAPVEI--PVTPPTLVSGLKNVTVIEGE----SVTLECHISGYPSPTVTWYR 932

Query: 1174 DYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS--YL---IDEE- 1227
            +    E S   ++  +    ++  ++   +D G ++C   +  G  S+  YL   + EE 
Sbjct: 933  EDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEF 992

Query: 1228 -------------ELKRLL----------ALSHEHKFPTVP-----VKSELAVEILEKGQ 1259
                         E KR +          +L+ E   P  P     +   +  +++E G 
Sbjct: 993  EKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGS 1052

Query: 1260 VRFWMQAEKLSGNAKVNYIFNEKEI--FEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYT 1317
            V F  Q   + GN K +  + +  +    G +YK+  ++ TG  ++ +     +D G YT
Sbjct: 1053 VVFGCQ---VGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYT 1109

Query: 1318 FQLQDGKATNHSTVVLVGD----VFKKLQKEAEFQRQEWIRKQGPHFVE------YLSWE 1367
              +++      ++  L+ +    +  K Q+E  +Q Q     Q P   E      Y  +E
Sbjct: 1110 IVVRNKHGETSASASLLEEADYELLMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYE 1169

Query: 1368 VTGECN-VLLKCKVANIKKETHIV-WYKDEREISVDEKHDFKDGICTLLITEFSKKDAGI 1425
               E    L++ K+A   K+T +V  Y +++E  +     F++ +   +     K     
Sbjct: 1170 KEYEKEQALIRKKMA---KDTVVVRTYVEDQEFHISS---FEERLIKEIEYRIIKTTL-- 1221

Query: 1426 YEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQS----TAEGIQLYSFV 1481
             E +L++D G++K  + + +    E           S  D +I++       G+  +  +
Sbjct: 1222 -EELLEED-GEEKMAVDISESEAVE-----------SGFDSRIKNYRILEGMGVTFHCKM 1268

Query: 1482 TYYVEDLKVNWSHNGSAIRYSDRVKTGVTGE-QIWLQINEPTPNDKGKYVM--------E 1532
            + Y    K+ W  +G  I++ +R +     + +  L+I    P D+G Y           
Sbjct: 1269 SGYPLP-KIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNA 1327

Query: 1533 LFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNR--------------------- 1571
            +  GK   +    L    Y        R++  +    +R                     
Sbjct: 1328 ICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMS 1387

Query: 1572 -ARVLGGL---------------------PDVVTIQEGKALNLTCNVWGDPPPEVSWLKN 1609
             AR+  G                      P      EG+       V G P PE  W  +
Sbjct: 1388 PARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHD 1447

Query: 1610 EKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEE 1669
             + + +D    +  +   T    I   + +DSG++ +V +N+ G  +    ++V   E +
Sbjct: 1448 GQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQ 1507

Query: 1670 ARMAALESLK 1679
             +   +E LK
Sbjct: 1508 VKPMFVEKLK 1517



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 41/205 (20%), Positives = 77/205 (37%), Gaps = 33/205 (16%)

Query: 1358  PHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFK---DGICTLL 1414
             P   ++L  E + E   L     +++ +   + WYKD +++  +    F    DG   L 
Sbjct: 26346 PKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELK 26405

Query: 1415  ITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTA-- 1472
             I   ++ D G Y   +  + G  K+ L+ + +AFK +  +V K      +D K   +   
Sbjct: 26406 INNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVT 26465

Query: 1473  --------EGIQLYSFVTYYVEDLKVN--------------------WSHNGSAIRYSDR 1504
                     E I     +   ++D  V+                    W+ +G AI    +
Sbjct: 26466 RKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGK 26525

Query: 1505  VKTGVTGEQIWLQINEPTPNDKGKY 1529
              K        +L+I++   +D G Y
Sbjct: 26526 YKLSEDKGGFFLEIHKTDTSDSGLY 26550



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 64/306 (20%), Positives = 122/306 (39%), Gaps = 34/306 (11%)

Query: 184   STASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKV 243
             S++ K T  + + T +++ +  K S  + Q  A  Q  +S++A  + + + +  K   K+
Sbjct: 26562 SSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKL 26621

Query: 244   VIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGW 303
              ++E+A ++ +    EE +   A   E  ++H  E I K    T    E V+ H  I   
Sbjct: 26622 ALKEEASKVLIS---EEVKKSAATSLEKSIVH--EEITK----TSQASEEVRTHAEIKA- 26671

Query: 304   PEPRVTWYKNQVPINVHANPGKYIIESRYGMHT---LEINGCDFEDTAQYRASAMNVKGE 360
                    +  Q+ IN      + ++++     T     +NG +  ++ +YR         
Sbjct: 26672 -------FSTQMSIN---EGQRLVLKANIAGATDVKWVLNGVELTNSEEYRYG------- 26714

Query: 361   LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGE 420
             +S     +  +     DE      + T     G+    Y         D          +
Sbjct: 26715 VSGSDQTLTIKQASHRDEGILTCISKTKE---GIVKCQYDLTLSKELSDAPAFISQPRSQ 26771

Query: 421   TMSLGCRVVITPEIK-HFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGL 479
              ++ G  V+ T EI     PEI+W++N +P+S S  V    S    +L   + +  D G 
Sbjct: 26772 NINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGK 26831

Query: 480   YTIRVR 485
             YTI+ +
Sbjct: 26832 YTIKAK 26837



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 46/190 (24%), Positives = 78/190 (41%), Gaps = 28/190 (14%)

Query: 1492 WSHNGSAI--RYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQ 1549
            W H+G  I   Y+ +V     G Q  L I   TP+D G++ +   +       +V L+ +
Sbjct: 1444 WFHDGQQIVNDYTHKVVIKEDGTQS-LIIVPATPSDSGEWTVVAQNRAGRSSISVILTVE 1502

Query: 1550 AYDEAYAEF--QRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWL 1607
            A +        ++LK                   V I+EG  L +     G+P P++ WL
Sbjct: 1503 AVEHQVKPMFVEKLKN------------------VNIKEGSRLEMKVRATGNPNPDIVWL 1544

Query: 1608 KNEKALASDDHCNLKFEAGR-TAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFI- 1665
            KN   +    +  ++ E  +  A   I+   + DS  Y     NK G +T+   V+V + 
Sbjct: 1545 KNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVE 1604

Query: 1666 ---PEEEARM 1672
               PE E ++
Sbjct: 1605 FAEPEPERKL 1614



 Score = 44.7 bits (104), Expect = 8e-04
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 5/91 (5%)

Query: 1582 VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASD--DHCNLKFEAGRTAYFTINGVSTA 1639
            V + EG       ++ G P PEVSW ++ + +++       + F  GR A  TI  V+ A
Sbjct: 15   VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR-AKLTIPAVTKA 73

Query: 1640 DSGKYGLVVKNKYGSETSDFTVSVFIPEEEA 1670
            +SG+Y L   N  G  TS  T  + +  E A
Sbjct: 74   NSGRYSLKATNGSGQATS--TAELLVKAETA 102



 Score = 44.7 bits (104), Expect = 8e-04
 Identities = 47/180 (26%), Positives = 77/180 (42%), Gaps = 16/180 (8%)

Query: 277  PEFIIKPRSHTVW-EKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRY-GM 334
            P  II P   TV  E +  +  C ++G  + +V+WY     I     P ++   +++   
Sbjct: 3298 PPAIITPLQDTVTSEGQPARFQCRVSG-TDLKVSWYSKDKKIK----PSRFFRMTQFEDT 3352

Query: 335  HTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGV 394
            + LEI     ED   Y   A N  G++S+ A++ ++ +    + T       ++ +SF  
Sbjct: 3353 YQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEGFSKFEENTSNSQWHVSLSVSFKK 3412

Query: 395  TPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSK 454
             P G    F I       V     GET+    RV   P     +PEIQW+ N   + P+K
Sbjct: 3413 EPLGQKPSF-IQPLSSLRV---HNGETVRFHARVSGIP-----KPEIQWFHNQQLILPTK 3463



 Score = 44.7 bits (104), Expect = 8e-04
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             DV+T++ G+ + +   V G P P+++W K  K L  +   +L  +  R     I     A
Sbjct: 11544 DVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVE-LQIKEAVRA 11602

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
             D GKY +  KN  G       V+V
Sbjct: 11603 DHGKYIISAKNSSGHAQGSAIVNV 11626



 Score = 44.7 bits (104), Expect = 8e-04
 Identities = 29/86 (33%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1637
             L  VV ++    L L   + G P PEV W K E  L   D   ++  +  T    I+ V+
Sbjct: 18741 LRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT--DRAQIEVTSSFTM-LVIDNVT 18797

Query: 1638  TADSGKYGLVVKNKYGSETSDFTVSV 1663
               DSG+Y L ++N  GS+T+   V V
Sbjct: 18798 RFDSGRYNLTLENNSGSKTAFVNVRV 18823



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 56/255 (21%), Positives = 97/255 (38%), Gaps = 41/255 (16%)

Query: 238  KKSRKVVIREKAERLSLRKTLEETE---TYHAKLNEDHLL------HAPEFIIKPRSHTV 288
            ++  K V+  +  R+ + +T +      T+ A  N   +         P+ + + +  TV
Sbjct: 3145 QERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTV 3204

Query: 289  WEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTA 348
               +  +    I+G P+P+++WYK +  ++      K++ + +   +TL +     ED A
Sbjct: 3205 QSGKPARFCAVISGRPQPKISWYKEEQLLST-GFKCKFLHDGQ--EYTLLLIEAFPEDAA 3261

Query: 349  QYRASAMNVKG--ELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIH 406
             Y   A N  G    SA  SV V        E   +  A   PL   VT  G  +RF+  
Sbjct: 3262 VYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQ-- 3319

Query: 407  FDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERAT 466
                               CRV  T        ++ WY     + PS++ +     +   
Sbjct: 3320 -------------------CRVSGT------DLKVSWYSKDKKIKPSRFFRMTQFEDTYQ 3354

Query: 467  LTFSHLNKEDEGLYT 481
            L  +    EDEG YT
Sbjct: 3355 LEIAEAYPEDEGTYT 3369



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 83/367 (22%), Positives = 145/367 (39%), Gaps = 60/367 (16%)

Query: 1181 SPRLEVESKGNKTKMTFKDLGMDDLG--IYSCDVTDTDGIASSYLIDEEELKRLLALSHE 1238
            SP  E++++G K  +T   + +D  G  +Y      T  I +   + E EL         
Sbjct: 5067 SPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILT---VKEIELDF------- 5116

Query: 1239 HKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNT 1298
                 VP+K    V + E+ Q RF      L+  A V +      I    K+ +  D   
Sbjct: 5117 ----AVPLKD---VTVPERRQARFECV---LTREANVIWSKGPDIIKSSDKFDIIADGKK 5166

Query: 1299 GIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGP 1358
             I+   +   Q +DEG YT +++ GK T  S  + V  +  K     E Q  +       
Sbjct: 5167 HIL--VINDSQFDDEGVYTAEVE-GKKT--SARLFVTGIRLKFMSPLEDQTVK------- 5214

Query: 1359 HFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEF 1418
                       GE    + C++++ K   H+VW+K++ ++             T+LI+  
Sbjct: 5215 ----------EGETATFV-CELSHEKM--HVVWFKNDAKLHTSR---------TVLISSE 5252

Query: 1419 SKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLY 1478
             K      + +  DD  + K+++K +    +  ++E      +   D K     + I L 
Sbjct: 5253 GKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHD-KTAVEKDEITLK 5311

Query: 1479 SFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKT 1538
              V+   +D+ V W  +G  I  S +      G +  L+I +    DKG+YV +    KT
Sbjct: 5312 CEVS---KDVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKT 5368

Query: 1539 GHQKTVD 1545
                TV+
Sbjct: 5369 KANVTVE 5375



 Score = 43.5 bits (101), Expect = 0.002
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEA-GRTAYFTINGV 1636
             L  V+T++ G  + L   V G P PEV+W K++ A        +K +    ++ F++   
Sbjct: 11835 LSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKA 11894

Query: 1637  STADSGKYGLVVKNKYGSETSDFTVSV 1663
               +D GKY +   N  GS  +  TV+V
Sbjct: 11895 KRSDGGKYVVTATNTAGSFVAYATVNV 11921



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 30/116 (25%), Positives = 51/116 (43%), Gaps = 5/116 (4%)

Query: 1552  DEAYAEFQRLKQAAIAEKNR----ARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWL 1607
             D  Y+E +    + I ++ +    A + G    ++T + G    +   + G P P+V+W 
Sbjct: 22251 DAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWK 22310

Query: 1608  KNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
               E  L   D  ++     RT   T+      DSG+Y L ++N  G +T   TV V
Sbjct: 22311 LEEMRLKETDRVSITTTKDRTT-LTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVV 22365



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 22/84 (26%), Positives = 35/84 (41%), Gaps = 1/84 (1%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             D + +  G+   L  +V G P P + WL+ +K +     C +K      A   +      
Sbjct: 17261 DTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIK-NTDFKALLIVKDAIRI 17319

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
             D G+Y L   N  GS++    V V
Sbjct: 17320 DGGQYILRASNVAGSKSFPVNVKV 17343



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 1/94 (1%)

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
            P F+ K ++  + E   +++     G P P + W KN   I  H  P K  IE   G   
Sbjct: 1510 PMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYP-KIRIEGTKGEAA 1568

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
            L+I+    +D+A Y A+A+N  G  +    V V+
Sbjct: 1569 LKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVE 1602



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 66/302 (21%), Positives = 111/302 (36%), Gaps = 30/302 (9%)

Query: 224  KQATSALQQEETSEKKSRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKP 283
            K+ +S+    E     S ++ + +  E L L   L E+  Y  K + +     P FI + 
Sbjct: 3532 KEFSSSFLSAEEEGLHSAELQLSKINETLEL---LSESPVYPTKFDSEKEGTGPIFIKEV 3588

Query: 284  RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCD 343
             +  +   +   L  ++ G P+P++ W+ N V +   A+  K++ +     H+L I    
Sbjct: 3589 SNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSAD-YKFVFDG--DDHSLIILFTK 3645

Query: 344  FEDTAQYRASAMNVKGE--LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYAS 401
             ED  +Y   A N  G+   SAY  +  K    +  ET      S   L     P     
Sbjct: 3646 LEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPP----- 3700

Query: 402  RFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWS 461
                HF  +       +G        VV  P      P + W++    L  S +   + +
Sbjct: 3701 ----HFLKELKPIRCAQGLPAIFEYTVVGEP-----APTVTWFKENKQLCTSVYYTIIHN 3751

Query: 462  -GERATLTFSHLNKEDEGLYTIRVR--MGEYYEQYSAYVFVRDAD-----AEIEGAPAAP 513
                 T   +   +ED GLY  +    +GE        V + D D      + +  P AP
Sbjct: 3752 PNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLLEDTDMTDTPCKAKSTPEAP 3811

Query: 514  LD 515
             D
Sbjct: 3812 ED 3813



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 43/211 (20%), Positives = 77/211 (36%), Gaps = 25/211 (11%)

Query: 1468 IQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPND-K 1526
            + + +E   +    T      +VNW      +   ++ K         L I++    D +
Sbjct: 4375 VDTVSEEGDIVHLTTSITNAKEVNWYFENKLVPSDEKFKCLQDQNTYTLVIDKVNTEDHQ 4434

Query: 1527 GKYVMELFD--GKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTI 1584
            G+YV E  +  GKT                 A+   +K+AA   K +   L        +
Sbjct: 4435 GEYVCEALNDSGKTATS--------------AKLTVVKRAAPVIKRKIEPL-------EV 4473

Query: 1585 QEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKY 1644
              G     TC +   P     W K  + +   D C+++  +   +   I      D G+Y
Sbjct: 4474 ALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIR-SSKYISSLEILRTQVVDCGEY 4532

Query: 1645 GLVVKNKYGSETSDFTVSVFIPEEEARMAAL 1675
                 N+YGS +   T++V +P  E ++  L
Sbjct: 4533 TCKASNEYGSVSCTATLTVTVPGGEKKVRKL 4563



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 72/365 (19%), Positives = 133/365 (36%), Gaps = 62/365 (16%)

Query: 124  LSGEEKENLPSDYMVPIFSGRQKHVSGITDTEEERIKE----AAAYIAQRNLLASEEGIT 179
            L G++ E  PSD +VP   G+  H   + D + E   E    A  +    NL   E  + 
Sbjct: 5858 LKGKKLE--PSDKVVPRSEGKV-HTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVE 5914

Query: 180  TSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKK 239
             +K           +  T  + +TA  +   SR++   +      +   + + E  ++ +
Sbjct: 5915 FTKPL---------EDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGR 5965

Query: 240  SRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCS 299
             RK+VI +      ++    + + +    N + +    EF+       V EKE  +  C 
Sbjct: 5966 VRKLVIHDCTPE-DIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFECE 6024

Query: 300  IAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKG 359
            ++     +V W+K+   I       KY I S+  +  L IN C  +D A+Y       + 
Sbjct: 6025 LSR-ENAKVKWFKDGAEIK---KGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTAR- 6079

Query: 360  ELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREG 419
              S   +V+        +E  F    + + +S                          E 
Sbjct: 6080 -TSGMLTVLE-------EEAVFTKNLANIEVS--------------------------ET 6105

Query: 420  ETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGL 479
            +T+ L C      E+     E+ WY+    +  +   + L  G +  L   + + ED G 
Sbjct: 6106 DTIKLVC------EVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGN 6159

Query: 480  YTIRV 484
            Y  R+
Sbjct: 6160 YNCRL 6164



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 26/84 (30%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 1580 DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
            D++ I EG+ L++       P P VSW K+ K + + D   +K +   +A+  +     A
Sbjct: 8023 DIIVI-EGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKND-HISAHLEVPKSVRA 8080

Query: 1640 DSGKYGLVVKNKYGSETSDFTVSV 1663
            D+G Y + ++NK GS T+   V V
Sbjct: 8081 DAGIYTITLENKLGSATASINVKV 8104



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 50/209 (23%), Positives = 82/209 (39%), Gaps = 25/209 (11%)

Query: 286   HTVWEKE-NVKLHCSIAGWPEP-RVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCD 343
             H V E+  +VK  C I  + +  +VTWY     +    N  KY I    G+  L +    
Sbjct: 25204 HAVGEEGGHVKYVCKIENYDQSTQVTWYFG---VRQLENSEKYEITYEDGVAILYVKDIT 25260

Query: 344   FEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASR- 402
               D   YR   +N  GE S+YA + VK  +  +D   ++   +   +           R 
Sbjct: 25261 KLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYD---YYCRRTMKKIKRRTDTMRLLERP 25317

Query: 403   --FEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSP----SKWV 456
               F +   +K        GE +  G  + + PE     P + WY++G  + P     K+ 
Sbjct: 25318 PEFTLPLYNK----TAYVGENVRFGVTITVHPE-----PHVTWYKSGQKIKPGDNDKKYT 25368

Query: 457   QTLWSGERATLTFSHLNKEDEGLYTIRVR 485
                  G    LT + +  +D+  YT+  R
Sbjct: 25369 FESDKG-LYQLTINSVTTDDDAEYTVVAR 25396



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             D + +  G++  +  +++G P P + W+K ++ L++     +K     T+  ++      
Sbjct: 16179 DTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATS-LSVKDAVRV 16237

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
             DSG Y L  KN  G  +    V V
Sbjct: 16238 DSGNYILKAKNVAGERSVTVNVKV 16261



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 29/96 (30%), Positives = 42/96 (43%), Gaps = 5/96 (5%)

Query: 290   EKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQ 349
             E ++V     ++G P P + W K+  P+++   P   II      + L I     EDT  
Sbjct: 25436 EGQSVCFEIRVSGIPPPTLKWEKDGQPLSL--GPNIEIIHEGLDYYALHIRDTLPEDTGY 25493

Query: 350   YRASAMNVKGELSAYASVVVKRY---KGEFDETRFH 382
             YR +A N  G  S  A + V+R    K EF     H
Sbjct: 25494 YRVTATNTAGSTSCQAHLQVERLRYKKQEFKSKEEH 25529



 Score = 41.2 bits (95), Expect = 0.009
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 1/81 (1%)

Query: 1583  TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSG 1642
             +IQ G+ L +   V G P P +SW+K+ + L      N++  A  T      G +  D G
Sbjct: 17950 SIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEG-NKDDFG 18008

Query: 1643  KYGLVVKNKYGSETSDFTVSV 1663
             KY +   N  G+ T + +V V
Sbjct: 18009 KYTVTATNSAGTATENLSVIV 18029



 Score = 40.8 bits (94), Expect = 0.011
 Identities = 40/166 (24%), Positives = 64/166 (38%), Gaps = 21/166 (12%)

Query: 1492 WSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAY 1551
            W  +GS IR S + +    G+   L I +   +D G+Y   L  G      T  L     
Sbjct: 4779 WMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKL----- 4833

Query: 1552 DEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEK 1611
                          + E+   R +  L + VT+ +G+ L L+C +  +   +V W K+ K
Sbjct: 4834 --------------VVEELPVRFVKTLEEEVTVVKGQPLYLSCEL--NKERDVVWRKDGK 4877

Query: 1612 ALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETS 1657
             +       +    G     TIN     D+G Y + V+N    E S
Sbjct: 4878 IVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECS 4923



 Score = 40.8 bits (94), Expect = 0.011
 Identities = 61/309 (19%), Positives = 119/309 (38%), Gaps = 50/309 (16%)

Query: 1143 EVVVNVDDDGVISLN---FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKD 1199
            E V +++D  V   +   F C     K+   W ++    ++  + + E  G+  ++  KD
Sbjct: 6452 EFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKD 6511

Query: 1200 LGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVK-SELAVEILEKG 1258
              +DD   Y+C V D    A  ++ +                  +PV+      +ILE  
Sbjct: 6512 CRLDDECEYACGVEDRKSRARLFVEE------------------IPVEIIRPPQDILEAP 6553

Query: 1259 QVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTF 1318
                   AE      +V ++ N   + +G K++M  +    I  + +  ++  D+G Y F
Sbjct: 6554 GADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGK--IHRLQICDIKPRDQGEYRF 6611

Query: 1319 QLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKC 1378
              +D +A     +     +     K A+   Q+ +   G      + ++           
Sbjct: 6612 IAKDKEARAKLELAAAPKI-----KTAD---QDLVVDVGKPLTMVVPYD----------- 6652

Query: 1379 KVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDK 1438
              A  K E    W+K+   +S  +  D      +  I E  K D G Y+++L++  GK +
Sbjct: 6653 --AYPKAEAE--WFKENEPLST-KTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAE 6707

Query: 1439 S--RLKLVD 1445
                LK++D
Sbjct: 6708 GFINLKVID 6716



 Score = 40.4 bits (93), Expect = 0.015
 Identities = 29/85 (34%), Positives = 37/85 (43%), Gaps = 3/85 (3%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVST- 1638
             D V ++ G+A  L  +V G PPP + W K+ K L       +K     T    +N  ST 
Sbjct: 15097 DTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTN--LVNKDSTR 15154

Query: 1639  ADSGKYGLVVKNKYGSETSDFTVSV 1663
              DSG Y L   N  G     F V V
Sbjct: 15155 RDSGAYTLTATNPGGFAKHIFNVKV 15179



 Score = 40.4 bits (93), Expect = 0.015
 Identities = 36/155 (23%), Positives = 63/155 (40%), Gaps = 16/155 (10%)

Query: 1510  TGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEK 1569
             +G+  W + N+    DK   +  L +         +   + + E      R ++ A++ K
Sbjct: 24100 SGDSAWKKSNKERIKDKQFTIGGLLEA-------TEYEFRVFAENETGLSRPRRTAMSIK 24152

Query: 1570  NRARVLGGLPDV------VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKF 1623
              +    G  P +      VT + G+A  L+C + G P P++ W +  K L       +  
Sbjct: 24153 TKL-TSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSS 24211

Query: 1624  EAGRTAYFTINGVSTADSGKYGLVVKNKYGS-ETS 1657
             + GRT   T+      D G Y  +  N+ G  ETS
Sbjct: 24212 D-GRTHTLTVMTEEQEDEGVYTCIATNEVGEVETS 24245



 Score = 40.0 bits (92), Expect = 0.019
 Identities = 112/546 (20%), Positives = 188/546 (34%), Gaps = 108/546 (19%)

Query: 1110 SYVFRVRAINQAGVGKPSDLAGPVVAETRP-----GTKEVVVNVDDDGVISLNFECDKMT 1164
            +Y F + A+  +  G+ S  +  V+   +      GTK V+             EC    
Sbjct: 2378 NYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVL-------------ECKVSV 2424

Query: 1165 PK-SEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1223
            P  +   W  +    +   R++   KG K ++        D G Y   V     + ++  
Sbjct: 2425 PDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIV---GRVETNCN 2481

Query: 1224 IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1283
            +  E++K +  L       T  V  E  VE+   G    W               F +KE
Sbjct: 2482 LSVEKIKIIRGLRDLTCTETQNVVFE--VELSHSGIDVLWN--------------FKDKE 2525

Query: 1284 IFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQK 1343
            I    KYK  I+ +  I ++ +  +  +DEG YTF   +   +   TV   G + K L  
Sbjct: 2526 IKPSSKYK--IEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVA-GGAISKPLTD 2582

Query: 1344 EAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEK 1403
            +   + QE                       + +C+VAN   ++   W +D + + +   
Sbjct: 2583 QTVAESQE----------------------AVFECEVAN--PDSKGEWLRDGKHLPLTNN 2618

Query: 1404 -HDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALS 1462
                 DG    LI   +K D  I E   K    K  ++LK+  EA          KI  +
Sbjct: 2619 IRSESDGHKRRLIIAATKLD-DIGEYTYKVATSKTSAKLKV--EAV---------KIKKT 2666

Query: 1463 ATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPT 1522
              +L +  T + +         V+   V W  NG  +  +++    V G    L+I    
Sbjct: 2667 LKNLTVTETQDAVFTVELTHPNVKG--VQWIKNGVVLESNEKYAISVKGTIYSLRIKNCA 2724

Query: 1523 PNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVV 1582
              D+  Y   L  G+ G    +                ++   I +K         P  V
Sbjct: 2725 IVDESVYGFRL--GRLGASARL---------------HVETVKIIKK---------PKDV 2758

Query: 1583 TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSG 1642
            T  E   +    +V  D  P V W      +   D   L  E  +     +  +S +D+G
Sbjct: 2759 TALENATVAFEVSVSHDTVP-VKWFHKSVEIKPSDKHRLVSER-KVHKLMLQNISPSDAG 2816

Query: 1643 KYGLVV 1648
            +Y  VV
Sbjct: 2817 EYTAVV 2822



 Score = 40.0 bits (92), Expect = 0.019
 Identities = 29/86 (33%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1637
             L  VVTI+    L L   + G P PEV W ++     S D  +++  +  T    +  V+
Sbjct: 15494 LRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGE--SLDKASIESTSSYTLLI-VGNVN 15550

Query: 1638  TADSGKYGLVVKNKYGSETSDFTVSV 1663
               DSGKY L V+N  GS+++   V V
Sbjct: 15551 RFDSGKYILTVENSSGSKSAFVNVRV 15576



 Score = 40.0 bits (92), Expect = 0.019
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1637
             L  ++ I+ G +L L   + G P PEV W K +  +   D   +   +  T+   ++ V+
Sbjct: 16576 LRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIR--DAAIIDVTSSFTS-LVLDNVN 16632

Query: 1638  TADSGKYGLVVKNKYGSETSDFTVSV 1663
               DSGKY L ++N  G++++  TV V
Sbjct: 16633 RYDSGKYTLTLENSSGTKSAFVTVRV 16658



 Score = 40.0 bits (92), Expect = 0.019
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 7/82 (8%)

Query: 1584  IQEGKALNLTCNVWGDPPPEVSWLKNEK--ALASDDHCNLKFEAGRTAYFTINGVSTADS 1641
             ++ G ++ L     G P P   W K +   +L +D H    F        T+   +  D+
Sbjct: 21997 VRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTTDSFST-----LTVENCNRNDA 22051

Query: 1642  GKYGLVVKNKYGSETSDFTVSV 1663
             GKY L V+N  GS++  FTV V
Sbjct: 22052 GKYTLTVENNSGSKSITFTVKV 22073



 Score = 40.0 bits (92), Expect = 0.019
 Identities = 27/78 (34%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1356  QGPHFVEYL-SWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVD----EKHDFKDGI 1410
             Q PHF E L +  V  + N  L CKV    K   + WY+  +EI  D       +FK G 
Sbjct: 24554 QAPHFKEELRNLNVRYQSNATLVCKVTGHPKPI-VKWYRQGKEIIADGLKYRIQEFKGGY 24612

Query: 1411  CTLLITEFSKKDAGIYEV 1428
               L+I   +  DA +Y+V
Sbjct: 24613 HQLIIASVTDDDATVYQV 24630



 Score = 39.7 bits (91), Expect = 0.025
 Identities = 34/135 (25%), Positives = 52/135 (38%), Gaps = 9/135 (6%)

Query: 245   IREKAERLSL-----RKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENV-KLHC 298
             I EK  ++S      +KT E T T   +      + +   I+     T    ++V K   
Sbjct: 26442 IHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAV 26501

Query: 299   SIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVK 358
                G P P   W K+   I      GKY +    G   LEI+  D  D+  Y  +  N  
Sbjct: 26502 KATGEPRPTAIWTKDGKAIT---QGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSA 26558

Query: 359   GELSAYASVVVKRYK 373
             G +S+   + +K  K
Sbjct: 26559 GSVSSSCKLTIKAIK 26573



 Score = 39.3 bits (90), Expect = 0.033
 Identities = 36/157 (22%), Positives = 63/157 (40%), Gaps = 10/157 (6%)

Query: 1511 GEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKN 1570
            G   W+   EP    K + V  L +GK    +   L+ Q   +     + ++     E  
Sbjct: 7258 GSDKWVACGEPVAETKME-VTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAP 7316

Query: 1571 R----ARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAG 1626
                  ++L GL    T++ G  + L   V G P P+++W K +  L  D    ++    
Sbjct: 7317 EIFLDVKLLAGL----TVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIE-NVP 7371

Query: 1627 RTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
            + +  TI     +D+G Y +   N  G  T+   V+V
Sbjct: 7372 KKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 7408



 Score = 39.3 bits (90), Expect = 0.033
 Identities = 46/191 (24%), Positives = 78/191 (40%), Gaps = 11/191 (5%)

Query: 180   TSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKK 239
             TS Q + S Q   S Q +ASKQ  +    ++S  S+ +     S  A S    +E+  + 
Sbjct: 26870 TSLQGSFSSQ---SVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEM 26926

Query: 240   SRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCS 299
             S    +      +S    LE + +   K     +   P+    P   ++ E + + + C+
Sbjct: 26927 SSSSFMG-----ISNMTQLESSTSKMLKAGIRGI--PPKIEALPSDISIDEGKVLTVACA 26979

Query: 300   IAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKG 359
               G P P VTW      I+     G++ IE+   + TL I     +D   Y  S  N  G
Sbjct: 26980 FTGEPTPEVTWSCGGRKIH-SQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFG 27038

Query: 360   ELSAYASVVVK 370
               SA  ++ ++
Sbjct: 27039 SDSATVNIHIR 27049



 Score = 38.9 bits (89), Expect = 0.043
 Identities = 54/228 (23%), Positives = 97/228 (42%), Gaps = 27/228 (11%)

Query: 144  RQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITTSKQSTASKQT-----TASKQSTA 198
            R KH  G T      ++EA   +    L+ S++ +    Q TA  Q      TA     +
Sbjct: 1113 RNKH--GETSASASLLEEADYEL----LMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYS 1166

Query: 199  SKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKVVIREKAERLSLRKTL 258
              +    K+    R+  A    VV     + ++ +E       + +I+E   R+ ++ TL
Sbjct: 1167 EYEKEYEKEQALIRKKMAKDTVVVR----TYVEDQEFHISSFEERLIKEIEYRI-IKTTL 1221

Query: 259  EET------ETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYK 312
            EE       E     ++E   + +  F  + +++ + E   V  HC ++G+P P++ WYK
Sbjct: 1222 EELLEEDGEEKMAVDISESEAVESG-FDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYK 1280

Query: 313  NQVPINVHANPGKYIIE-SRYGMHTLEINGCDFEDTAQYRASAMNVKG 359
            +   I    +  +Y ++  + G  +L I     ED   Y A A N+KG
Sbjct: 1281 DGKRIK---HGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKG 1325



 Score = 38.9 bits (89), Expect = 0.043
 Identities = 63/315 (20%), Positives = 110/315 (34%), Gaps = 43/315 (13%)

Query: 171  LLASEEGITTSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSA- 229
            +L  +EGI T+  S        S +      +     +        SR   +S ++ S  
Sbjct: 1308 VLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRS 1367

Query: 230  -LQQEETSEKKSRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTV 288
             ++        +R    R    R+S  + LEET+      ++   L+ P F++KP S   
Sbjct: 1368 PIRMSPARMSPARMSPARMSPARMSPGRRLEETDE-----SQLERLYKPVFVLKPVSFKC 1422

Query: 289  WEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTA 348
             E +  +    + G P P   W+ +   I V+    K +I+   G  +L I      D+ 
Sbjct: 1423 LEGQTARFDLKVVGRPMPETFWFHDGQQI-VNDYTHKVVIKED-GTQSLIIVPATPSDSG 1480

Query: 349  QYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFD 408
            ++   A N  G  S    + V+  + +                  V P          F 
Sbjct: 1481 EWTVVAQNRAGRSSISVILTVEAVEHQ------------------VKPM---------FV 1513

Query: 409  DKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGER--AT 466
            +K      +EG  + +  R    P      P+I W +N   + P K+ +    G +  A 
Sbjct: 1514 EKLKNVNIKEGSRLEMKVRATGNP-----NPDIVWLKNSDIIVPHKYPKIRIEGTKGEAA 1568

Query: 467  LTFSHLNKEDEGLYT 481
            L       +D   YT
Sbjct: 1569 LKIDSTVSQDSAWYT 1583



 Score = 38.5 bits (88), Expect = 0.056
 Identities = 76/371 (20%), Positives = 137/371 (36%), Gaps = 83/371 (22%)

Query: 231  QQEETSEKKSRKVVIREKAERLSLRK--TLEETETYHAKLNEDH------LLHAPEFIIK 282
            + ++T E   +  VI +  +R+ + K  TL++  TY   +          ++     ++ 
Sbjct: 6214 RDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIVVP 6273

Query: 283  PRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGC 342
             +   V E++ V  +C +      +  W++N+  I    +  KYII  +  ++TL I   
Sbjct: 6274 LKDTRVKEQQEVVFNCEV-NTEGAKAKWFRNEEAI---FDSSKYIILQKDLVYTLRIRDA 6329

Query: 343  DFEDTAQYRASAMNVKGE-LSAYASVVVKR------------YKGEFDETRFHAGASTMP 389
              +D A Y  S  N +GE + + A+++V+                E     F    + + 
Sbjct: 6330 HLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLN 6389

Query: 390  LSFGVTPYGYASRFEIHFD-------DKF-------DVSFGREGETM-------SLGCRV 428
            ++   T  G     E+ FD       DK+       D  F  EGE +       S+   +
Sbjct: 6390 VTLKWTKNGE----EVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELL 6445

Query: 429  VI---TPEIKHFQPE--------------------IQWYRNGVPLSPSKWVQTLWSGERA 465
            +I   T  ++H + +                    ++WYRNG  +   K  +    G   
Sbjct: 6446 IIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIH 6505

Query: 466  TLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLD------VKCL 519
             L       +DE  Y      G    +  A +FV +   EI   P   L+      V   
Sbjct: 6506 RLIIKDCRLDDECEYA----CGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLA 6561

Query: 520  EANKDYIIISW 530
            E NKD + + W
Sbjct: 6562 ELNKDKVEVQW 6572



 Score = 38.5 bits (88), Expect = 0.056
 Identities = 27/105 (25%), Positives = 47/105 (44%), Gaps = 5/105 (4%)

Query: 1580 DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKAL--ASDDHCNLKFEAGRTAYFTINGVS 1637
            D + ++ G+ +++  +V G P P++ W KNE  +   +D     K E  R+   T   + 
Sbjct: 9034 DTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIP 9093

Query: 1638 TA---DSGKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALESLK 1679
             A   D G Y +   N+ GS   +  V V+      R  A+  +K
Sbjct: 9094 KAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIK 9138



 Score = 38.1 bits (87), Expect = 0.073
 Identities = 27/122 (22%), Positives = 55/122 (45%), Gaps = 7/122 (5%)

Query: 1532 ELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALN 1591
            +L +G+ G Q+  +L   A++ A       ++    EK +  ++   P+ V + EG+   
Sbjct: 1759 QLPEGRKGLQRIEELERMAHEGALTGVTTDQK----EKQKPDIVL-YPEPVRVLEGETAR 1813

Query: 1592 LTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNK 1651
              C V G P P+V+W  N + +       ++++     Y  I    + D+G+  +  +N 
Sbjct: 1814 FRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG--IHYLDIVDCKSYDTGEVKVTAENP 1871

Query: 1652 YG 1653
             G
Sbjct: 1872 EG 1873



 Score = 38.1 bits (87), Expect = 0.073
 Identities = 36/174 (20%), Positives = 69/174 (39%), Gaps = 20/174 (11%)

Query: 1158 FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1217
            F C+    K    W K+      S  + + S+G   K+  K++ +DD+      V +   
Sbjct: 5221 FVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSS 5280

Query: 1218 IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNY 1277
             A   +++ +             + TV +  + AV   EK ++    +  K   +  V +
Sbjct: 5281 TAQLKVLEAD------------PYFTVKLHDKTAV---EKDEITLKCEVSK---DVPVKW 5322

Query: 1278 IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTV 1331
              + +EI   PKY +  D    I++  ++K   +D+G Y       K   + TV
Sbjct: 5323 FKDGEEIVPSPKYSIKADGLRRILK--IKKADLKDKGEYVCDCGTDKTKANVTV 5374



 Score = 37.7 bits (86), Expect = 0.095
 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 1/83 (1%)

Query: 1581  VVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTAD 1640
             +V  + G  + +   V G P P V+W K ++ L      N +  A  T    IN    +D
Sbjct: 14702 LVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATST-ILNINECVRSD 14760

Query: 1641  SGKYGLVVKNKYGSETSDFTVSV 1663
             SG Y L  +N  G      T+ V
Sbjct: 14761 SGPYPLTARNIVGEVGDVITIQV 14783



 Score = 37.7 bits (86), Expect = 0.095
 Identities = 18/77 (23%), Positives = 36/77 (46%)

Query: 1587  GKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGL 1646
             G+ +++     G P P ++W K +  + ++ H  +      T+    NGV   D+G Y +
Sbjct: 24670 GEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVV 24729

Query: 1647  VVKNKYGSETSDFTVSV 1663
               KN++G +     + V
Sbjct: 24730 CAKNRFGIDQKTVELDV 24746



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 21/84 (25%), Positives = 33/84 (39%), Gaps = 3/84 (3%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             D + +  G  + +   V G PPP V+W  NE+ L  +           ++   I     +
Sbjct: 10160 DRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIE---TTAISSSMVIKNCQRS 10216

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
               G Y L+ KN+ G       V V
Sbjct: 10217 HQGVYSLLAKNEAGERKKTIIVDV 10240



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1637
             +  ++T++ G  + L   V+G P P VSW K+   L   +   +  +        +  V+
Sbjct: 12929 MKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQR-NLCTLELFSVN 12987

Query: 1638  TADSGKYGLVVKNKYGSETSDFTVSV 1663
               DSG Y +  +N  GS+++   + V
Sbjct: 12988 RKDSGDYTITAENSSGSKSATIKLKV 13013



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 20/79 (25%), Positives = 35/79 (44%), Gaps = 1/79 (1%)

Query: 1583  TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSG 1642
             ++Q G+ L +   + G P P ++W K+   L      N+      T   +I      D G
Sbjct: 16868 SVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTT-LSIKETHKDDGG 16926

Query: 1643  KYGLVVKNKYGSETSDFTV 1661
             +YG+ V N  G +T+   +
Sbjct: 16927 QYGITVANVVGQKTASIEI 16945



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 3/84 (3%)

Query: 1582  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADS 1641
             + +  G+ + L   + G PPP  SW      L   +   ++    + A  TI   +  D+
Sbjct: 23376 IHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHT-KVAKLTIRETTIRDT 23434

Query: 1642  GKYGLVVKNKYGSETSDFTVSVFI 1665
             G+Y L +KN  G  T+  T+ V I
Sbjct: 23435 GEYTLELKNVTG--TTSETIKVII 23456



 Score = 37.0 bits (84), Expect = 0.16
 Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 8/93 (8%)

Query: 1578 LPDVVTIQEGKALNLTCNVWGDPPPEVSWLK-------NEKALASDDHCNLKFEAGRTAY 1630
            L + + ++EG  +N+   + G P P ++W K       N++ +  D H N K     T  
Sbjct: 9750 LKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVN-KLVVDDTCT 9808

Query: 1631 FTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
              I     +D+G Y +   N  G+ + +  ++V
Sbjct: 9809 LVIPQSRRSDTGLYTITAVNNLGTASKEMRLNV 9841



 Score = 37.0 bits (84), Expect = 0.16
 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 19/86 (22%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKN-----EKA----LASDDHCNLKFEAGRTAY 1630
             DV+ ++ G+ L +  ++ G P P +SW K+     E+A    +++D+H  L         
Sbjct: 19425 DVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLL--------- 19475

Query: 1631  FTINGVSTADSGKYGLVVKNKYGSET 1656
              T+      D+G+Y L +KN  G+ +
Sbjct: 19476 -TVKDCIRRDTGQYVLTLKNVAGTRS 19500



 Score = 36.6 bits (83), Expect = 0.21
 Identities = 99/530 (18%), Positives = 188/530 (35%), Gaps = 110/530 (20%)

Query: 1142 KEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLG 1201
            K++++   +    S  FEC      +  +W KD  +  +SP+    + G   K+   D+ 
Sbjct: 4750 KDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQ 4809

Query: 1202 MDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVP-VKSELAVEILEKGQV 1260
            + D G Y+C                     +L L ++ K  T   V  EL V  ++  + 
Sbjct: 4810 LSDAGEYTC---------------------VLRLGNKEKTSTAKLVVEELPVRFVKTLEE 4848

Query: 1261 RFW-MQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGII--------EMFMEKLQDE 1311
                ++ + L  + ++N    E+++      K+ +++   I+         + +    D 
Sbjct: 4849 EVTVVKGQPLYLSCELN---KERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDT 4905

Query: 1312 DEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGE 1371
            D GTYT  +++      S+ V V +V +           +W+ K            V  +
Sbjct: 4906 DAGTYTVTVENANNLECSSCVKVVEVIR-----------DWLVK------PIRDQHVKPK 4948

Query: 1372 CNVLLKCKVANIKKETHIVWYKDEREISV---DEKHDFKDG-ICTLLITEFSKKDAGIYE 1427
               +  C +A  K   +I W+K   EI     D+    +DG    L I     +D   Y 
Sbjct: 4949 GTAIFACDIA--KDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYA 5006

Query: 1428 VILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLY-----SFVT 1482
            V ++  R                       K+ L   ++++    E + +Y     SF  
Sbjct: 5007 VEIEGKR--------------------YPAKLTLGEREVELLKPIEDVTIYEKESASFDA 5046

Query: 1483 YYVE-DLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQ 1541
               E D+   W   G  +R S   +    G + +L +++   +  G+ + +  +  T   
Sbjct: 5047 EISEADIPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAIT--- 5103

Query: 1542 KTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPP 1601
             T  L+ +  +  +A    LK   + E+ +AR      + V  +E               
Sbjct: 5104 -TAILTVKEIELDFA--VPLKDVTVPERRQARF-----ECVLTREA-------------- 5141

Query: 1602 PEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNK 1651
              V W K    + S D  ++    G+     IN     D G Y   V+ K
Sbjct: 5142 -NVIWSKGPDIIKSSDKFDI-IADGKKHILVINDSQFDDEGVYTAEVEGK 5189



 Score = 36.2 bits (82), Expect = 0.28
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 293   NVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRA 352
             ++++   I G P P VTW K+ + +   AN     IE+      L I  C+  DT ++  
Sbjct: 14421 SIRIFVPIKGRPAPEVTWTKDNINLKNRAN-----IENTESFTLLIIPECNRYDTGKFVM 14475

Query: 353   SAMNVKGELSAYASVVV 369
             +  N  G+ S + +V V
Sbjct: 14476 TIENPAGKKSGFVNVRV 14492



 Score = 36.2 bits (82), Expect = 0.28
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 2/85 (2%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKAL-ASDDHCNLKFEAGRTAYFTINGVST 1638
             DV+ +  G+   L  ++ G P P+V W K+ K L  +     +K    +T     + + T
Sbjct: 18343 DVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRT 18402

Query: 1639  ADSGKYGLVVKNKYGSETSDFTVSV 1663
              D G+Y L + N  G+++   TV V
Sbjct: 18403 -DGGQYILKLSNVGGTKSIPITVKV 18426



 Score = 35.8 bits (81), Expect = 0.36
 Identities = 24/94 (25%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 277 PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
           P F+ + +S TV +   V+L   + G P P V +Y++   I    +   + I     +++
Sbjct: 104 PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLD---FQISQEGDLYS 160

Query: 337 LEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
           L I     ED+  Y  +A N  G  ++ A ++V+
Sbjct: 161 LLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 35.8 bits (81), Expect = 0.36
 Identities = 38/153 (24%), Positives = 61/153 (39%), Gaps = 11/153 (7%)

Query: 221  VVSKQATSALQQEETSEKKSRKVVIREKA-ERLSLRKTLEETETYHAKLNEDHLLHAPEF 279
            V   +  +  + E T  ++ +    R KA  R    K    TE   A   ++    APE 
Sbjct: 7263 VACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQE----APEI 7318

Query: 280  IIKPR---SHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
             +  +     TV     ++L  ++ G PEP++TW K  +   +     +  IE+     T
Sbjct: 7319 FLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADM---ILKQDKRITIENVPKKST 7375

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVV 369
            + I      DT  Y   A+NV G  +A   V V
Sbjct: 7376 VTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 7408



 Score = 35.8 bits (81), Expect = 0.36
 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             +VV  + G ++ L   + G P P + W K++K L ++    ++      A   I      
Sbjct: 20508 EVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVE-NTTDLASILIKDADRL 20566

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
             +SG Y L ++N  GS ++   V +
Sbjct: 20567 NSGCYELKLRNAMGSASATIRVQI 20590



 Score = 35.4 bits (80), Expect = 0.47
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query: 1580  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1639
             D + I+ G++L +   V G P P V+W K+   +    +  +    G T+ F +   +  
Sbjct: 21594 DGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLF-VRDATRD 21652

Query: 1640  DSGKYGLVVKNKYGSETSDFTVSV 1663
               G Y +  KN  GS  ++  V V
Sbjct: 21653 HRGVYTVEAKNASGSAKAEIKVKV 21676



 Score = 35.0 bits (79), Expect = 0.62
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 439 PEIQWYRNGVPLSPS--KWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAY 496
           PE+ W+R+G  +S S    VQ  +S  RA LT   + K + G Y+++   G      +A 
Sbjct: 35  PEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAE 94

Query: 497 VFVR 500
           + V+
Sbjct: 95  LLVK 98



 Score = 35.0 bits (79), Expect = 0.62
 Identities = 17/75 (22%), Positives = 35/75 (46%), Gaps = 1/75 (1%)

Query: 1582  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADS 1641
             + ++ G  +     + G P P   W  +   + +D+H  ++ +   ++  TI      D+
Sbjct: 11148 LVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETD-NFSSVLTIKNCLRRDT 11206

Query: 1642  GKYGLVVKNKYGSET 1656
             G+Y + V N  GS+T
Sbjct: 11207 GEYQITVSNAAGSKT 11221



 Score = 35.0 bits (79), Expect = 0.62
 Identities = 23/84 (27%), Positives = 35/84 (41%), Gaps = 3/84 (3%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYR 351
             E++++   + G P PRVTW+K+ V I    N     I    G  +L +     +    Y 
Sbjct: 21602 ESLRIKALVQGRPVPRVTWFKDGVEIEKRMN---MEITDVLGSTSLFVRDATRDHRGVYT 21658

Query: 352   ASAMNVKGELSAYASVVVKRYKGE 375
               A N  G   A   V V+   G+
Sbjct: 21659 VEAKNASGSAKAEIKVKVQDTPGK 21682



 Score = 34.7 bits (78), Expect = 0.80
 Identities = 22/86 (25%), Positives = 37/86 (43%), Gaps = 1/86 (1%)

Query: 1578  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1637
             L   + ++ G  + L   V G PPP+++W K    L      ++K       +     V+
Sbjct: 13327 LRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIK-STDFDTFLRCENVN 13385

Query: 1638  TADSGKYGLVVKNKYGSETSDFTVSV 1663
               D+GKY L ++N  G +     V V
Sbjct: 13386 KYDAGKYILTLENSCGKKEYTIVVKV 13411



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 41/195 (21%), Positives = 77/195 (39%), Gaps = 19/195 (9%)

Query: 1389 IVWYKDEREISVDE----KHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLV 1444
            + W++D + IS       +  F DG   L I   +K ++G Y +   +  G+  S  +L+
Sbjct: 37   VSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELL 96

Query: 1445 ---DEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRY 1501
               + A    +  +        + +++Q    GI     V +Y          +G+ I+ 
Sbjct: 97   VKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPT-PVVKFY---------RDGAEIQS 146

Query: 1502 SDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQR- 1560
            S   +    G+   L I E  P D G Y +   +       T +L  Q  +E  A+  + 
Sbjct: 147  SLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKT 206

Query: 1561 -LKQAAIAEKNRARV 1574
             +  A I+E  + R+
Sbjct: 207  IVSTAQISESRQTRI 221



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 25/94 (26%), Positives = 43/94 (45%), Gaps = 7/94 (7%)

Query: 1577 GLPDVVTIQEGKALNLTCNVWGDPPPEVSWL---KNEKALASDDHC---NLKFE-AGRTA 1629
            G  D +  + G  + +   + G P P+ SW    K +KA+    H    + + E A  ++
Sbjct: 9443 GAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSS 9502

Query: 1630 YFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
               I     + +GKY +  KNK G +T++  V V
Sbjct: 9503 VIIIPECKRSHTGKYSITAKNKAGQKTANCRVKV 9536



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 21/83 (25%), Positives = 39/83 (46%), Gaps = 5/83 (6%)

Query: 1582  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAG-RTAYFTINGVSTAD 1640
             + ++ G +  +     G P PE++W + E          ++ E G      +I+     D
Sbjct: 17662 IVVRAGGSARIHIPFKGRPTPEITWSREEGEFTD----KVQIEKGVNYTQLSIDNCDRND 17717

Query: 1641  SGKYGLVVKNKYGSETSDFTVSV 1663
             +GKY L ++N  GS+++  TV V
Sbjct: 17718 AGKYILKLENSSGSKSAFVTVKV 17740



 Score = 33.9 bits (76), Expect = 1.4
 Identities = 26/87 (29%), Positives = 33/87 (37%), Gaps = 10/87 (11%)

Query: 1582 VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASD----DHCNLKFEAGRTAYFTINGVS 1637
            + I  GK L +   V G P P   W K E  L  D    D+   K E        I    
Sbjct: 8742 IQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSE------LIIKDAL 8795

Query: 1638 TADSGKYGLVVKNKYGSETSDFTVSVF 1664
              D G+Y +   N  GS+ +   V VF
Sbjct: 8796 RKDHGRYVITATNSCGSKFAAARVEVF 8822



 Score = 33.5 bits (75), Expect = 1.8
 Identities = 31/109 (28%), Positives = 54/109 (49%), Gaps = 4/109 (3%)

Query: 1358 PHFVEYL-SWEVTGECNVLLKCKVANIKKETHIVWYKDEREI--SVDEKHDFKDGICTLL 1414
            P+FV+ L S  V     V L+ +V  I     + +Y+D  EI  S+D +   +  + +LL
Sbjct: 104  PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPV-VKFYRDGAEIQSSLDFQISQEGDLYSLL 162

Query: 1415 ITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSA 1463
            I E   +D+G Y V   +  G+  S  +L+ +  +E+  +  K I  +A
Sbjct: 163  IAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIVSTA 211



 Score = 33.5 bits (75), Expect = 1.8
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 5/67 (7%)

Query: 418  EGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDE 477
            EG    L C+V + P++      ++WY N   + P   VQ +  G +  L  +  +  DE
Sbjct: 2412 EGTKAVLECKVSV-PDVT----SVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDE 2466

Query: 478  GLYTIRV 484
            G Y + V
Sbjct: 2467 GPYKLIV 2473



 Score = 33.1 bits (74), Expect = 2.3
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 3/80 (3%)

Query: 1584  IQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGK 1643
             I+ G  L L+  + G P P+V+W K ++   +    ++     +     I   +  D G 
Sbjct: 10858 IKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGSK---LEIRNAAHEDGGI 10914

Query: 1644  YGLVVKNKYGSETSDFTVSV 1663
             Y L V+N  GS+T    V V
Sbjct: 10915 YSLTVENPAGSKTVSVKVLV 10934



 Score = 33.1 bits (74), Expect = 2.3
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 13/87 (14%)

Query: 1582  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAG--RTAYFT---INGV 1636
             + ++ G ++ +   + G P PEV+W K        D+ NLK  A    T  FT   I   
Sbjct: 14414 LVVRAGLSIRIFVPIKGRPAPEVTWTK--------DNINLKNRANIENTESFTLLIIPEC 14465

Query: 1637  STADSGKYGLVVKNKYGSETSDFTVSV 1663
             +  D+GK+ + ++N  G ++    V V
Sbjct: 14466 NRYDTGKFVMTIENPAGKKSGFVNVRV 14492



 Score = 32.7 bits (73), Expect = 3.1
 Identities = 38/176 (21%), Positives = 75/176 (42%), Gaps = 16/176 (9%)

Query: 1165 PKSEFSWSKD--YVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSY 1222
            P  E SW +D   +ST   P +++     + K+T   +   + G YS   T+  G A+S 
Sbjct: 33   PVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATS- 91

Query: 1223 LIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEK 1282
                 EL     L      P   V+   ++ + +  QVR  ++   +     V +  +  
Sbjct: 92   ---TAEL-----LVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIP-TPVVKFYRDGA 142

Query: 1283 EIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQD--GKATNHSTVVLVGD 1336
            EI     ++  I +   +  + + +   ED GTY+    +  G+AT+ + +++ G+
Sbjct: 143  EIQSSLDFQ--ISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGE 196



 Score = 32.7 bits (73), Expect = 3.1
 Identities = 43/204 (21%), Positives = 67/204 (32%), Gaps = 47/204 (23%)

Query: 278  EFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTL 337
            + I KP+  T  E   V    S++    P V W+   V I       K+ + S   +H L
Sbjct: 2750 KIIKKPKDVTALENATVAFEVSVSHDTVP-VKWFHKSVEIKPS---DKHRLVSERKVHKL 2805

Query: 338  EINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPY 397
             +      D  +Y A    V G+L   A + V+                           
Sbjct: 2806 MLQNISPSDAGEYTA----VVGQLECKAKLFVET-------------------------- 2835

Query: 398  GYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQ 457
                   +H           E +T S  C      E+ HF     W +NGV +  S+  +
Sbjct: 2836 -------LHITKTMKNIEVPETKTASFEC------EVSHFNVPSMWLKNGVEIEMSEKFK 2882

Query: 458  TLWSGERATLTFSHLNKEDEGLYT 481
             +  G+   L   + + ED   YT
Sbjct: 2883 IVVQGKLHQLIIMNTSTEDSAEYT 2906



 Score = 32.3 bits (72), Expect = 4.0
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 3/80 (3%)

Query: 1584  IQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGK 1643
             ++ G +  +T    G P P V W K +  L +  + +      RT+  TI   +  DSGK
Sbjct: 19826 VKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDT--TDSRTS-LTIENANRNDSGK 19882

Query: 1644  YGLVVKNKYGSETSDFTVSV 1663
             Y L ++N   + +    V V
Sbjct: 19883 YTLTIQNVLSAASLTLVVKV 19902



 Score = 32.0 bits (71), Expect = 5.2
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 5/45 (11%)

Query: 418  EGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSG 462
            EGET    CRV   P     QP++ WY NG  +  SK  +  + G
Sbjct: 1808 EGETARFRCRVTGYP-----QPKVNWYLNGQLIRKSKRFRVRYDG 1847



 Score = 32.0 bits (71), Expect = 5.2
 Identities = 23/89 (25%), Positives = 36/89 (40%), Gaps = 17/89 (19%)

Query: 1582  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALA-------SDDHCNLKFEAGRTAYFTIN 1634
             + +++G  + LT  + G P P   W K  + ++       S+ H  L           I 
Sbjct: 23774 IFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTEL----------VIK 23823

Query: 1635  GVSTADSGKYGLVVKNKYGSETSDFTVSV 1663
                  DSG Y LV++NK G +     V V
Sbjct: 23824 EADRGDSGTYDLVLENKCGKKAVYIKVRV 23852



 Score = 31.6 bits (70), Expect = 6.8
 Identities = 44/203 (21%), Positives = 71/203 (34%), Gaps = 46/203 (22%)

Query: 278  EFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTL 337
            +F+      TV E E     C ++   +  V W+KN   ++        +I S    H L
Sbjct: 5203 KFMSPLEDQTVKEGETATFVCELSH-EKMHVVWFKNDAKLHTSRT---VLISSEGKTHKL 5258

Query: 338  EINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPY 397
            E+     +D +Q +A       ELS+ A + V                          PY
Sbjct: 5259 EMKEVTLDDISQIKAQVK----ELSSTAQLKVLE----------------------ADPY 5292

Query: 398  GYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQ 457
                 F +   DK  V    E + ++L C V     +K       W+++G  + PS    
Sbjct: 5293 -----FTVKLHDKTAV----EKDEITLKCEVSKDVPVK-------WFKDGEEIVPSPKYS 5336

Query: 458  TLWSGERATLTFSHLNKEDEGLY 480
                G R  L     + +D+G Y
Sbjct: 5337 IKADGLRRILKIKKADLKDKGEY 5359



 Score = 31.2 bits (69), Expect = 8.9
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 8/88 (9%)

Query: 1598 GDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTIN-GVS-TADSGKYGLVVKNKYGSE 1655
            GDP   V WL + K L + +   +  E G   Y +++ GV+ + DSG       NKYG  
Sbjct: 1684 GDPTMVVEWLHDGKPLEAANRLRMINEFG---YCSLDYGVAYSRDSGIITCRATNKYG-- 1738

Query: 1656 TSDFTVSVFIPEEEARMAALESLKGGKK 1683
             +D T +  I ++E  +     L  G+K
Sbjct: 1739 -TDHTSATLIVKDEKSLVEESQLPEGRK 1765



 Score = 31.2 bits (69), Expect = 8.9
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 6/60 (10%)

Query: 419  GETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEG 478
            GET +  C      E+ +    ++WY  G  L PS  V     G+  TLT   +  ED G
Sbjct: 5838 GETATFDC------ELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAG 5891



 Score = 31.2 bits (69), Expect = 8.9
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 6/88 (6%)

Query: 1598 GDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETS 1657
            G P P  +W   +K L + D   +K      A   I+    +D G Y L ++N+  + + 
Sbjct: 7048 GYPRPTATWCFGDKVLETGDRVKMK-TLSAYAELVISPSERSDKGIYTLKLENRVKTISG 7106

Query: 1658 DFTVSVFIPEEEARMAALESLKGGKKAK 1685
            +  V+V      AR +A + LK G   K
Sbjct: 7107 EIDVNVI-----ARPSAPKELKFGDITK 7129



 Score = 31.2 bits (69), Expect = 8.9
 Identities = 24/91 (26%), Positives = 38/91 (41%), Gaps = 7/91 (7%)

Query: 1592  LTCNVWGDPPPEVSWLKNEKALASDDHCNLKFE----AGRTAYFTINGVSTADSGKYGLV 1647
             L C V G P P V W +  K + +D    LK+      G      I  V+  D+  Y + 
Sbjct: 24575 LVCKVTGHPKPIVKWYRQGKEIIAD---GLKYRIQEFKGGYHQLIIASVTDDDATVYQVR 24631

Query: 1648  VKNKYGSETSDFTVSVFIPEEEARMAALESL 1678
               N+ GS +   ++ V +P +      LE +
Sbjct: 24632 ATNQGGSVSGTASLEVEVPAKIHLPKTLEGM 24662


>gi|110349715 titin isoform N2-B [Homo sapiens]
          Length = 26926

 Score =  257 bits (656), Expect = 8e-68
 Identities = 233/902 (25%), Positives = 381/902 (42%), Gaps = 102/902 (11%)

Query: 405   IHFDDKF-DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGE 463
             +  D KF DV   + GE + +   +   P      P I W ++G+ +      + + +  
Sbjct: 19292 VMMDVKFRDVIVVKAGEVLKINADIAGRP-----LPVISWAKDGIEIEERARTEIISTDN 19346

Query: 464   RATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANK 523
                LT     + D G Y + ++        +    V D      G PA PL++  L A K
Sbjct: 19347 HTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKP----GPPAGPLEINGLTAEK 19402

Query: 524   DYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFR 583
                 +SW +P  DGG+ I  Y ++K E    +W+ C +  ++     VT L++G  YIFR
Sbjct: 19403 --CSLSWGRPQEDGGADIDYYIVEKRETSHLAWTIC-EGELQMTSCKVTKLLKGNEYIFR 19459

Query: 584   VRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTD 643
             V  VNK G+G P   S  + ALDP                             VP PPT 
Sbjct: 19460 VTGVNKYGVGEPLE-SVAIKALDPFT---------------------------VPSPPTS 19491

Query: 644   LSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDL 702
             L +T  T+  + L W +P    G E   Y +E+ E  +  W RVN + PV   R     L
Sbjct: 19492 LEITSVTKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKK-PVYDLRVKSTGL 19550

Query: 703   AEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES 762
              EG  Y +RV   N+AG+  PSE + +    D + +P  P K     +  T++ ++W + 
Sbjct: 19551 REGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKP 19610

Query: 763   --KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLS 820
                    + GY +E   +    W+    + ++G+ +T  GL TG  Y+FRV++VN  G S
Sbjct: 19611 LFDGGAPITGYTVEYKKSDDTDWKTSIQS-LRGTEYTISGLTTGAEYVFRVKSVNKVGAS 19669

Query: 821   EYSQDSE---AIEVKAAIGGGVSPDVCPALSDEPGG----LTASRGR----VHEASPPT- 868
             + S  S+   A E +      +  ++   L  + G         RGR    V  + P T 
Sbjct: 19670 DPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTD 19729

Query: 869   FQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKK 928
              +  A + +  ++ SL  + +N  + +  K + T+Q  L+           +    + K 
Sbjct: 19730 LRTRAYVDTTDSRTSL--TIENANRNDSGKYTLTIQNVLS----------AASLTLVVKV 19777

Query: 929   TDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANV 988
              D   P PP +IT  +  ++S VL W  P+  GGA +  Y++  RE       K   +  
Sbjct: 19778 LD--TPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKRE----ASKKAWVSVT 19831

Query: 989   KAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCS 1048
                +  +YK++NL+E  +Y F+V+  N  G+G P+   E  K  E     P PP  L  +
Sbjct: 19832 NNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVKITE----KPSPPEKLGVT 19887

Query: 1049  EVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEG 1108
              + KDS+ L W  P H G + +  Y V+  E   K   W  +  A  K+ +  V GL+E 
Sbjct: 19888 SISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQK--NW--VKCAVAKSTHHVVSGLREN 19943

Query: 1109  VSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISL----NFECD--- 1161
               Y FRV A NQAG+  P +L  PV+ + +    E+ +       + +    N + D   
Sbjct: 19944 SEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPI 20003

Query: 1162  KMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1221
                P  + + S+D V  + + R   E       +  K+    D G Y     ++ G   +
Sbjct: 20004 SGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKA 20063

Query: 1222  YLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNE 1281
             ++        ++ L      P  P    +  +I E+     W   +   G+   NYI  +
Sbjct: 20064 FI-------NIVVLDR----PGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLK 20112

Query: 1282  KE 1283
             +E
Sbjct: 20113 RE 20114



 Score =  248 bits (632), Expect = 5e-65
 Identities = 214/828 (25%), Positives = 356/828 (42%), Gaps = 107/828 (12%)

Query: 429  VITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGE 488
            ++ P   + + E +W++   PLS +K + T  + E+ +       K D+G Y I ++   
Sbjct: 6522 MVVPYDAYPKAEAEWFKENEPLS-TKTIDT--TAEQTSFRILEAKKGDKGRYKIVLQ--N 6576

Query: 489  YYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDK 548
             + +   ++ ++  D      P    +++  E     + ++W++P  DGGS I+GY +++
Sbjct: 6577 KHGKAEGFINLKVIDV-----PGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVER 6631

Query: 549  CEVGTDSWSQCNDTPVKFARFPVTGLIEGR-SYIFRVRAVNKMGIGFPSRVSEPVAALDP 607
             ++   +W    D   +   F VTGL +G   Y+FRV A N++G G P     PV     
Sbjct: 6632 RDIKRKTWVLATDR-AESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPV----- 6685

Query: 608  AEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHE 667
                                  E  S+  VPGPP ++++T+  R  V L+W+PP   G  
Sbjct: 6686 ----------------------EARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGA 6723

Query: 668  GIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEA 726
             I  Y +E  +  +  W    T +  +     + D+ EG+ Y FRVR  N  GVG+PS A
Sbjct: 6724 EITNYVIELRDKTSIRWDTAMT-VRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAA 6782

Query: 727  TEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES-KD-AKELVGYYIEASVAGSGKWE 784
            T    V D ++ P  P  +  S  T +SV + WE   KD    ++GY IE    G   W 
Sbjct: 6783 TPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWI 6842

Query: 785  PCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVC 844
             CN   V    +   GL  G  Y++RV A N AG+S+ S+                    
Sbjct: 6843 RCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEIL------------------ 6884

Query: 845  PALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVS-----KV 899
                   G LTA    V      +  KD L    PN  ++   S    +   +     KV
Sbjct: 6885 -------GPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKV 6937

Query: 900  SET----------VQEELTPPPQKAAPQG------KSKSDPLKKKTD---RAPPSPPCDI 940
             ET             EL   P + + +G      +++   +  + D    A PS P ++
Sbjct: 6938 LETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKEL 6997

Query: 941  TCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISN 1000
               +  +DS+ L W+ PD  GG+ +TGY V  REV       W +  +  V++  + + +
Sbjct: 6998 KFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKT---WTKV-MDFVTDLEFTVPD 7053

Query: 1001 LKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWK 1060
            L +   Y F+V A N  G G P+ V E          VP PP ++K  +   +S+ L W 
Sbjct: 7054 LVQGKEYLFKVCARNKCGPGEPAYVDEPVNMST-PATVPDPPENVKWRDRTANSIFLTWD 7112

Query: 1061 PPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEG