Guide to the Human Genome
Home | Table of Contents | Search text | Search genes | Search sequences | Purchase | FAQ | Blog | Help

Search of human proteins with 140560917

BLASTP 2.2.11 [Jun-05-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|140560917 myomesin 1 isoform b [Homo sapiens]
         (1589 letters)

Database: hs.faa 
           37,866 sequences; 18,247,518 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|140560917 myomesin 1 isoform b [Homo sapiens]                     3202   0.0  
gi|140560919 myomesin 1 isoform a [Homo sapiens]                     1723   0.0  
gi|156104903 myomesin 2 [Homo sapiens]                               1341   0.0  
gi|155969693 myomesin family, member 3 [Homo sapiens]                1029   0.0  
gi|110349719 titin isoform N2-A [Homo sapiens]                        266   2e-70
gi|110349717 titin isoform novex-2 [Homo sapiens]                     266   2e-70
gi|110349713 titin isoform novex-1 [Homo sapiens]                     266   2e-70
gi|110349715 titin isoform N2-B [Homo sapiens]                        266   2e-70
gi|253970427 immunoglobulin superfamily, member 22 [Homo sapiens]     190   8e-48
gi|148839296 immunoglobulin-like and fibronectin type III domain...   139   2e-32
gi|148596957 myosin binding protein C, cardiac [Homo sapiens]         135   2e-31
gi|46049110 myosin binding protein C, slow type isoform 4 [Homo ...   132   3e-30
gi|46049125 myosin binding protein C, slow type isoform 2 [Homo ...   132   3e-30
gi|45976288 myosin binding protein C, slow type isoform 1 [Homo ...   132   3e-30
gi|133908641 myosin binding protein C, fast type [Homo sapiens]       127   9e-29
gi|46049119 myosin binding protein C, slow type isoform 3 [Homo ...   122   2e-27
gi|222352127 sidekick 2 [Homo sapiens]                                120   8e-27
gi|18860892 protein tyrosine phosphatase, receptor type, D isofo...   115   4e-25
gi|18860890 protein tyrosine phosphatase, receptor type, D isofo...   114   7e-25
gi|104487297 protein tyrosine phosphatase, receptor type, sigma ...   113   2e-24
gi|4506309 protein tyrosine phosphatase, receptor type, D isofor...   112   2e-24
gi|118918395 fibronectin type III domain containing 3A isoform 1...   111   5e-24
gi|118918397 fibronectin type III domain containing 3A isoform 2...   111   5e-24
gi|109633041 protein tyrosine phosphatase, receptor type, F isof...   111   6e-24
gi|109633039 protein tyrosine phosphatase, receptor type, F isof...   111   6e-24
gi|110431348 deleted in colorectal carcinoma [Homo sapiens]           108   4e-23
gi|157311649 neogenin homolog 1 [Homo sapiens]                        108   5e-23
gi|104487006 protein tyrosine phosphatase, receptor type, sigma ...   107   1e-22
gi|205360934 fibronectin type III domain containing 3B [Homo sap...   106   2e-22
gi|205360932 fibronectin type III domain containing 3B [Homo sap...   106   2e-22

>gi|140560917 myomesin 1 isoform b [Homo sapiens]
          Length = 1589

 Score = 3202 bits (8301), Expect = 0.0
 Identities = 1589/1589 (100%), Positives = 1589/1589 (100%)

Query: 1    MSLPFYQRCHQHYDLSYRNKDVRSTVSHYQREKKRSAVYTQGSTAYSSRSSAAHRRESEA 60
            MSLPFYQRCHQHYDLSYRNKDVRSTVSHYQREKKRSAVYTQGSTAYSSRSSAAHRRESEA
Sbjct: 1    MSLPFYQRCHQHYDLSYRNKDVRSTVSHYQREKKRSAVYTQGSTAYSSRSSAAHRRESEA 60

Query: 61   FRRASASSSQQQASQHALSSEVSRKAASAYDYGSSHGLTDSSLLLDDYSSKLSPKPKRAK 120
            FRRASASSSQQQASQHALSSEVSRKAASAYDYGSSHGLTDSSLLLDDYSSKLSPKPKRAK
Sbjct: 61   FRRASASSSQQQASQHALSSEVSRKAASAYDYGSSHGLTDSSLLLDDYSSKLSPKPKRAK 120

Query: 121  HSLLSGEEKENLPSDYMVPIFSGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITT 180
            HSLLSGEEKENLPSDYMVPIFSGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITT
Sbjct: 121  HSLLSGEEKENLPSDYMVPIFSGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITT 180

Query: 181  SKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKS 240
            SKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKS
Sbjct: 181  SKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKS 240

Query: 241  RKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSI 300
            RKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSI
Sbjct: 241  RKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSI 300

Query: 301  AGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGE 360
            AGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGE
Sbjct: 301  AGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGE 360

Query: 361  LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGE 420
            LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGE
Sbjct: 361  LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGE 420

Query: 421  TMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLY 480
            TMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLY
Sbjct: 421  TMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLY 480

Query: 481  TIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSP 540
            TIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSP
Sbjct: 481  TIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSP 540

Query: 541  ILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSE 600
            ILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSE
Sbjct: 541  ILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSE 600

Query: 601  PVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKP 660
            PVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKP
Sbjct: 601  PVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKP 660

Query: 661  PGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGV 720
            PGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGV
Sbjct: 661  PGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGV 720

Query: 721  GEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGS 780
            GEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGS
Sbjct: 721  GEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGS 780

Query: 781  GKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSP 840
            GKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSP
Sbjct: 781  GKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSP 840

Query: 841  PCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAY 900
            PCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAY
Sbjct: 841  PCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAY 900

Query: 901  KISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLV 960
            KISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLV
Sbjct: 901  KISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLV 960

Query: 961  LQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVR 1020
            LQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVR
Sbjct: 961  LQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVR 1020

Query: 1021 AINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYV 1080
            AINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYV
Sbjct: 1021 AINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYV 1080

Query: 1081 STEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALS 1140
            STEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALS
Sbjct: 1081 STEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALS 1140

Query: 1141 HEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDR 1200
            HEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDR
Sbjct: 1141 HEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDR 1200

Query: 1201 NTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQ 1260
            NTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQ
Sbjct: 1201 NTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQ 1260

Query: 1261 GPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLIT 1320
            GPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLIT
Sbjct: 1261 GPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLIT 1320

Query: 1321 EFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQ 1380
            EFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQ
Sbjct: 1321 EFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQ 1380

Query: 1381 LYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDG 1440
            LYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDG
Sbjct: 1381 LYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDG 1440

Query: 1441 KTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNV 1500
            KTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNV
Sbjct: 1441 KTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNV 1500

Query: 1501 WGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSET 1560
            WGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSET
Sbjct: 1501 WGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSET 1560

Query: 1561 SDFTVSVFIPEEEARMAALESLKGGKKAK 1589
            SDFTVSVFIPEEEARMAALESLKGGKKAK
Sbjct: 1561 SDFTVSVFIPEEEARMAALESLKGGKKAK 1589


>gi|140560919 myomesin 1 isoform a [Homo sapiens]
          Length = 1685

 Score = 1723 bits (4462), Expect = 0.0
 Identities = 885/1039 (85%), Positives = 918/1039 (88%), Gaps = 24/1039 (2%)

Query: 1    MSLPFYQRCHQHYDLSYRNKDVRSTVSHYQREKKRSAVYTQGSTAYSSRSSAAHRRESEA 60
            MSLPFYQRCHQHYDLSYRNKDVRSTVSHYQREKKRSAVYTQGSTAYSSRSSAAHRRESEA
Sbjct: 1    MSLPFYQRCHQHYDLSYRNKDVRSTVSHYQREKKRSAVYTQGSTAYSSRSSAAHRRESEA 60

Query: 61   FRRASASSSQQQASQHALSSEVSRKAASAYDYGSSHGLTDSSLLLDDYSSKLSPKPKRAK 120
            FRRASASSSQQQASQHALSSEVSRKAASAYDYGSSHGLTDSSLLLDDYSSKLSPKPKRAK
Sbjct: 61   FRRASASSSQQQASQHALSSEVSRKAASAYDYGSSHGLTDSSLLLDDYSSKLSPKPKRAK 120

Query: 121  HSLLSGEEKENLPSDYMVPIFSGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITT 180
            HSLLSGEEKENLPSDYMVPIFSGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITT
Sbjct: 121  HSLLSGEEKENLPSDYMVPIFSGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITT 180

Query: 181  SKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKS 240
            SKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKS
Sbjct: 181  SKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKS 240

Query: 241  RKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSI 300
            RKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSI
Sbjct: 241  RKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSI 300

Query: 301  AGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGE 360
            AGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGE
Sbjct: 301  AGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGE 360

Query: 361  LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGE 420
            LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGE
Sbjct: 361  LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGE 420

Query: 421  TMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLY 480
            TMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLY
Sbjct: 421  TMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLY 480

Query: 481  TIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSP 540
            TIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSP
Sbjct: 481  TIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSP 540

Query: 541  ILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSE 600
            ILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSE
Sbjct: 541  ILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSE 600

Query: 601  PVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKP 660
            PVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKP
Sbjct: 601  PVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKP 660

Query: 661  PGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGV 720
            PGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGV
Sbjct: 661  PGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGV 720

Query: 721  GEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGS 780
            GEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGS
Sbjct: 721  GEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGS 780

Query: 781  GKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSP 840
            GKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAI     
Sbjct: 781  GKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVS 840

Query: 841  PCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVN-------YREVIDGVPGKWREANVK 893
            P     L              D+ GG   +   V+        ++ + G   K  + ++ 
Sbjct: 841  PDVCPALS-------------DEPGGLTASRGRVHEASPPTFQKDALLG--SKPNKPSLP 885

Query: 894  AVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSE 953
            + S+   +    K +   Q ++            + S+  K ++   A P PP  + C E
Sbjct: 886  SSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLK-KKTDRAPPSPPCDITCLE 944

Query: 954  VRKDSLVLQWKPPVHSGRTPVTGYFVDLKEA-KAKEDQWRGLNEAAIKNVYLKVRGLKEG 1012
              +DS+VL WK P   G   +TGY+V+ +E       +WR  N  A+     K+  LKE 
Sbjct: 945  SFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKEN 1004

Query: 1013 VSYVFRVRAINQAGVGKPS 1031
            + Y F+V A+N AG+G PS
Sbjct: 1005 MVYQFQVAAMNMAGLGAPS 1023



 Score = 1638 bits (4241), Expect = 0.0
 Identities = 853/1106 (77%), Positives = 905/1106 (81%), Gaps = 50/1106 (4%)

Query: 493  YSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVG 552
            ++  + V + +      P  P D+   EA + Y+++SWK P   G   I+ YF++KCE G
Sbjct: 621  WTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAG 679

Query: 553  TDSWSQCN-DTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKA 611
            T++W + N + PVK  RF +  L EG+SY FRVR  N  G+G PS  +E     D  +  
Sbjct: 680  TENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDI- 738

Query: 612  RLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMY 671
                 P AP               I+P   TD SV        V+SW+   +   E + Y
Sbjct: 739  -----PKAPGK-------------IIPSRNTDTSV--------VVSWEE-SKDAKELVGY 771

Query: 672  FVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTV 731
            ++E   AG+  W+  N   PVK  RF    L  G+SY FRVR  N+AG+ E S+ +E   
Sbjct: 772  YIEASVAGSGKWEPCNNN-PVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIE 830

Query: 732  VGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPV 791
            V   +    +P  + P+ + +   + +           G   EAS     K     + P 
Sbjct: 831  VKAAIGGGVSPD-VCPALSDEPGGLTASR---------GRVHEASPPTFQKDALLGSKPN 880

Query: 792  KGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQD--------SEAIEVKAAIAPPSPPCD 843
            K S         GQ+ + +V       L+   Q         S+ ++ K   APPSPPCD
Sbjct: 881  KPS-LPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCD 939

Query: 844  ITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKIS 903
            ITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKIS
Sbjct: 940  ITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKIS 999

Query: 904  NLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQW 963
            NLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQW
Sbjct: 1000 NLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQW 1059

Query: 964  KPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAIN 1023
            KPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAIN
Sbjct: 1060 KPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAIN 1119

Query: 1024 QAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTE 1083
            QAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTE
Sbjct: 1120 QAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTE 1179

Query: 1084 DSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEH 1143
            DSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEH
Sbjct: 1180 DSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEH 1239

Query: 1144 KFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTG 1203
            KFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTG
Sbjct: 1240 KFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTG 1299

Query: 1204 IIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPH 1263
            IIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPH
Sbjct: 1300 IIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPH 1359

Query: 1264 FVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFS 1323
            FVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFS
Sbjct: 1360 FVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFS 1419

Query: 1324 KKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYS 1383
            KKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYS
Sbjct: 1420 KKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYS 1479

Query: 1384 FVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTG 1443
            FVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTG
Sbjct: 1480 FVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTG 1539

Query: 1444 HQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGD 1503
            HQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGD
Sbjct: 1540 HQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGD 1599

Query: 1504 PPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDF 1563
            PPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDF
Sbjct: 1600 PPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDF 1659

Query: 1564 TVSVFIPEEEARMAALESLKGGKKAK 1589
            TVSVFIPEEEARMAALESLKGGKKAK
Sbjct: 1660 TVSVFIPEEEARMAALESLKGGKKAK 1685



 Score = 87.0 bits (214), Expect = 1e-16
 Identities = 40/97 (41%), Positives = 57/97 (58%), Gaps = 2/97 (2%)

Query: 943  PGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNV 1002
            P  P  +KC E  KD +++ WK P   G +P+ GYF+D  + +   D W   N+  +K  
Sbjct: 510  PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFID--KCEVGTDSWSQCNDTPVKFA 567

Query: 1003 YLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA 1039
               V GL EG SY+FRVRA+N+ G+G PS ++ PV A
Sbjct: 568  RFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAA 604



 Score = 31.2 bits (69), Expect = 8.3
 Identities = 22/83 (26%), Positives = 36/83 (43%), Gaps = 2/83 (2%)

Query: 1487 TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFT--INGVSTAD 1544
            T+ E + + L C++ G P P V+W KN+  +    +        R    T  ING    D
Sbjct: 287  TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346

Query: 1545 SGKYGLVVKNKYGSETSDFTVSV 1567
            + +Y     N  G  ++  +V V
Sbjct: 347  TAQYRASAMNVKGELSAYASVVV 369



 Score = 31.2 bits (69), Expect = 8.3
 Identities = 22/83 (26%), Positives = 36/83 (43%), Gaps = 2/83 (2%)

Query: 287  TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
            T+ E + + L C++ G P P V+W KN+  +    +        R    T  ING    D
Sbjct: 1583 TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFT--INGVSTAD 1640

Query: 347  TAQYRASAMNVKGELSAYASVVV 369
            + +Y     N  G  ++  +V V
Sbjct: 1641 SGKYGLVVKNKYGSETSDFTVSV 1663


>gi|156104903 myomesin 2 [Homo sapiens]
          Length = 1465

 Score = 1341 bits (3470), Expect = 0.0
 Identities = 676/1446 (46%), Positives = 950/1446 (65%), Gaps = 30/1446 (2%)

Query: 138  VPIFSGRQKHVSGITDTEEER--IKEAAAYIAQRNLLASEEGITT-SKQSTASKQTT--- 191
            VP +  R +H        + R  + E A+        +S++ ++  S    AS QT+   
Sbjct: 6    VPFYQKRHRHFDQSYRNIQTRYLLDEYASKKRASTQASSQKSLSQRSSSQRASSQTSLGG 65

Query: 192  ---------ASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRK 242
                      S Q    +++ +  QS  +    A RQ  +S+ A     +E+    +S+ 
Sbjct: 66   TICRVCAKRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHL---EEDVHLARSQA 122

Query: 243  VVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAG 302
               R+K ++ ++++ +E+   +     E+ +  APE +++ RSHTVWE+ +VKL  ++ G
Sbjct: 123  ---RDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVWERMSVKLCFTVQG 179

Query: 303  WPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELS 362
            +P P V WYK+   I   A PGKY IES YG+HTLEIN  DF+DTA Y A A N  G++S
Sbjct: 180  FPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVS 239

Query: 363  AYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETM 422
              A+VVV+R++G+ +  R       +PLS  + PY   + F++ F +KF V+F REGET+
Sbjct: 240  TNAAVVVRRFRGDEEPFRSVGLPIGLPLS-SMIPY---THFDVQFLEKFGVTFRREGETV 295

Query: 423  SLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTI 482
            +L C +++TP++K  QP  +WYR+ V L  SKW +  +   +A+L+FSHL+K+DEGLYT+
Sbjct: 296  TLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLHKDDEGLYTL 355

Query: 483  RVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPIL 542
            R+        +SA++FVRDAD  + GAP AP+D++C +AN+DY+I++WK P     SP++
Sbjct: 356  RIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVM 415

Query: 543  GYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPV 602
            GYF+D+CEVGT++W QCND PVK  ++PVTGL EGRSYIFRVRAVN  GI  PSRVS+ V
Sbjct: 416  GYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAV 475

Query: 603  AALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPG 662
            AALDP +  RL++          I  ++   +  VPGPPT +  +E +R+YVVLSW+PP 
Sbjct: 476  AALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPT 535

Query: 663  QRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGE 722
             RG + +MYF+EK   G+ +WQRVN +  V+SPR+A+FDL EGKSY FRV  +N  G+ E
Sbjct: 536  PRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSE 595

Query: 723  PSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGK 782
            PSE T      D   +P APG+++ SRNT TSVVV W+  K  ++L+GYY++  VAG+  
Sbjct: 596  PSEITSPIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNL 655

Query: 783  WEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPC 842
            WEPCN+ P+  +RF  HGL TG+ YIFRV+AVNA G+SE SQ+S+ I+V+AA+  PS P 
Sbjct: 656  WEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPY 715

Query: 843  DITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKI 902
             IT L     SM LGWK P   GG+ I GYY++ REV       W E N          +
Sbjct: 716  GITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHK---NWHEVNSSPSKPTILTV 772

Query: 903  SNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQ 962
              L E  +Y+F++AA+N+AG+G PS  SE FKCE WT+  PGP + L   EVR  SLV+ 
Sbjct: 773  DGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVML 832

Query: 963  WKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAI 1022
            WK PV+SG +PV+GYFVD +E  A E  W  +N+    N YLKV  L++G +YVFRVRA+
Sbjct: 833  WKAPVYSGSSPVSGYFVDFREEDAGE--WITVNQTTTANRYLKVSDLQQGKTYVFRVRAV 890

Query: 1023 NQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVST 1082
            N  GVGKPSD + PV+ E RPGTKE+   VD+ G I L F+C +MT  S+F+W K Y   
Sbjct: 891  NANGVGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEI 950

Query: 1083 EDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHE 1142
             D  R ++E+ G+ +K+  K+   +DLG YS  V+DTDG++SS+++D EEL+RL+ALS+E
Sbjct: 951  SDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNE 1010

Query: 1143 HKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNT 1202
             K PT+P+KSELA EI +KG+VRFW+QAE LS +A   +I N++E+ +   +++  D+ T
Sbjct: 1011 IKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKAT 1070

Query: 1203 GIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGP 1262
            GIIEM M++   E+EGTYT Q+ DGKA + S++VL+GD FK + +EAEFQR+E++RKQGP
Sbjct: 1071 GIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGP 1130

Query: 1263 HFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEF 1322
            HF EYL W+VT EC V L CKVAN KKET   W KD+     +   + + GIC LLI + 
Sbjct: 1131 HFAEYLHWDVTEECEVRLVCKVANTKKETVFKWLKDDVLYETETLPNLERGICELLIPKL 1190

Query: 1323 SKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLY 1382
            SKKD G Y+  LKDDRG+D S L++  + + ++++ + +    SA+ LK+  T EGI+L 
Sbjct: 1191 SKKDHGEYKATLKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLKVLCTPEGIRLQ 1250

Query: 1383 SFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKT 1442
             F+ Y+ +++KVNW H  + I  S+ ++ G + E  WLQI EPT  DKGKY  E+FDGK 
Sbjct: 1251 CFMKYFTDEMKVNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKD 1310

Query: 1443 GHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWG 1502
             HQ+++DLSGQA+DEA+AEFQ+ K AA AEKNR R++GGLPDVVTI EGK LNLTC V+G
Sbjct: 1311 NHQRSLDLSGQAFDEAFAEFQQFKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFG 1370

Query: 1503 DPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSD 1562
            +P PEV W KN++ +   +H ++K E  +    TI GV++ DSGKY + +KNKYG E  D
Sbjct: 1371 NPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYGGEKID 1430

Query: 1563 FTVSVF 1568
             TVSV+
Sbjct: 1431 VTVSVY 1436



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 18/87 (20%)

Query: 1  MSLPFYQRCHQHYDLSYRNKDVRSTVSHYQREKKRSAVYTQGSTAYSSRSSAAHRRESEA 60
          +++PFYQ+ H+H+D SYRN   R  +  Y  +K+        ST  SS+ S + R     
Sbjct: 4  VTVPFYQKRHRHFDQSYRNIQTRYLLDEYASKKR-------ASTQASSQKSLSQR----- 51

Query: 61 FRRASASSSQQQASQHALSSEVSRKAA 87
                SSSQ+ +SQ +L   + R  A
Sbjct: 52 ------SSSQRASSQTSLGGTICRVCA 72


>gi|155969693 myomesin family, member 3 [Homo sapiens]
          Length = 1437

 Score = 1029 bits (2661), Expect = 0.0
 Identities = 575/1427 (40%), Positives = 840/1427 (58%), Gaps = 54/1427 (3%)

Query: 175  EEGITTSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQ---SVVSKQATSALQ 231
            EE   + +  ++ ++ T        + S A     A+   TAS +       ++ TSA++
Sbjct: 34   EERQHSLRMGSSVRRRTFRSSEEEHEFSAADYALAAALALTASSELSWEAQLRRQTSAVE 93

Query: 232  QEETSEKK---------------SRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHA 276
             EE  +K+                   ++R++ +  +LR+  EE      +L E      
Sbjct: 94   LEERGQKRVGFGNDWERTEIAFLQTHRLLRQRRDWKTLRRRTEEKVQEAKELRELCYGRG 153

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHA-NPGKYIIESRYGMH 335
            P F I  RSH VWE   V L C++   P P+VTWYKN   I+      GKY I + YG+ 
Sbjct: 154  PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLL 213

Query: 336  TLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGE---FDETRFHAGASTMPLSF 392
            +LEI  C  ED+A Y     N  G+ S++A V+V+ Y G+   FD   F         +F
Sbjct: 214  SLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRS------TF 267

Query: 393  GVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSP 452
            G +         + F       F RE E  SL C  + + ++   +  IQW+R+G  L  
Sbjct: 268  GPS---------VEFTSVLKPVFAREKEPFSLSC--LFSEDVLDAE-SIQWFRDGSLLRS 315

Query: 453  SKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAA 512
            S+  + L++  +A+L  S   KEDEGLY +RV       + S YV VRDA+AE  GAP +
Sbjct: 316  SRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGS 375

Query: 513  PLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVT 572
            PL+V+CL+ N+D +I++W  P+   G+PI  Y I++C+  +  W  C++ P    R P+ 
Sbjct: 376  PLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQ 435

Query: 573  GLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEP 632
            GL+EG+SY FRVRA++++G   PS+ SE V   D  + AR K+        +I ++ +  
Sbjct: 436  GLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDH-DAARRKTEIPFDLGNKITISTDAF 494

Query: 633  SEGI-VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELP 691
             + + +P PPT++  +E   +YVVL+W+ P  R    + Y +EK   G+  W+ +++E P
Sbjct: 495  EDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESP 554

Query: 692  VKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATE-VTVVGDKLDIPKAPGKIIPSRN 750
            V+SPRFA+ DL + KSY FRVR  N  G+ +PSE +E + + G    +P  P ++   R+
Sbjct: 555  VRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPP-PAQVQAFRD 613

Query: 751  TDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFR 810
            T TSV ++W+  KD  EL+GYYI +   G+ +W+  NN P++G+RFT  GL TG+ Y F 
Sbjct: 614  TQTSVSLTWDPVKDP-ELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFC 672

Query: 811  VRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEIT 870
            VR+V+ AG+ E S  +E I VK A+A PS P     L   ++ MV+GWK P + GG +I 
Sbjct: 673  VRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKIL 732

Query: 871  GYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVS 930
            GY+++     D     W   N + +     K+S+L E   Y+F+  A N AG+G  SA S
Sbjct: 733  GYFLDQH---DSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPS 789

Query: 931  ECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQ 990
              F+C+EWT+  PGPP+ ++ SEVR  SLVLQW+PP++ G  PVTGY V  +E  +  +Q
Sbjct: 790  SLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGS--EQ 847

Query: 991  WRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVV 1050
            W+ +    I   +L+V  L+ G SYVF+V+A+N AG+G+PS    PV+ E +PG  E+ V
Sbjct: 848  WKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEV 907

Query: 1051 NVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLG 1110
             VD++G I L FE  +    SEF WSKDY    D  R+++E K NK+K+  K+ G++DLG
Sbjct: 908  GVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLG 967

Query: 1111 IYSCDVTDTD-GIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQ 1169
             YS  VTD D  I++S+ + EEEL++L  LSHE + P + + S   ++ILE+G+VR W++
Sbjct: 968  TYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLE 1027

Query: 1170 AEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKA 1229
             EKLS  A+++ IFN KEIF  P  K++ DR  G++E+ ++ L +ED+G+YT QLQDGKA
Sbjct: 1028 VEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKA 1087

Query: 1230 TNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKK 1289
             N  T+ LV D F KL ++A+ +R++W RKQGP+F   L W+VT +C V L CKV N KK
Sbjct: 1088 KNQITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKK 1147

Query: 1290 ETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVD 1349
            ET   W+    E+  D ++D + G   L I E SKKD GIY  ++ DDRG+D + L L  
Sbjct: 1148 ETRFQWFFQRAEMP-DGQYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTG 1206

Query: 1350 EAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYY-VEDLKVNWSHNGSAIRYSDR 1408
            +A   +  E+ +  ALSAT LKIQ T EGI+++S V YY VE +K  W H    +   DR
Sbjct: 1207 DALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDR 1266

Query: 1409 VKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQA 1468
            ++TG T ++IWL I +P  +DKGKY +E+  GK   Q + DLSGQA+++A AE QRLK  
Sbjct: 1267 IRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTL 1326

Query: 1469 AIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFE 1528
            AI EKNRA+V+ GLPDV TI E K L LTC V GDP PE+SWLKN++ +   D   ++  
Sbjct: 1327 AIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVR 1386

Query: 1529 AGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEAR 1575
             G     TI  V++ DSG+YG+ VKNKYGSET   T+SVF   +E +
Sbjct: 1387 -GTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPK 1432


>gi|110349719 titin isoform N2-A [Homo sapiens]
          Length = 33423

 Score =  266 bits (679), Expect = 2e-70
 Identities = 184/627 (29%), Positives = 295/627 (47%), Gaps = 50/627 (7%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P  P  ++  +  KD + ++W +P  DGGSPI GY++++ +  TD W +CN  PVK   +
Sbjct: 13883 PGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTY 13942

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              V GL   + Y FRV A N  G G PS+ +EP+   DP +          PW        
Sbjct: 13943 RVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPID---------PPWP------- 13986

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGI-MYFVEKCEAGTENWQRVNT 688
                     PG PT   V +  ++ V L+W  P   G   I  Y +E  + GT+ W RV  
Sbjct: 13987 --------PGKPT---VKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAE 14035

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPS 748
              +P  + +  L  L EG+ Y FRVR  N AG  EPSE ++  +  +KL  P  P  +   
Sbjct: 14036 GVP--TTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVI 14093

Query: 749   RNTDTSVVVSW--EESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQS 806
               T  +  + W   E      +  Y +E        W+  +   VK ++ T   L  G  
Sbjct: 14094 NITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTT-VKDTKCTVTPLTEGSL 14152

Query: 807   YIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGG 866
             Y+FRV A NA G S+Y++  +++  K     P PP  +  ++  +  + L W+ P   GG
Sbjct: 14153 YVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGG 14212

Query: 867   AEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAP 926
               I  Y +  +E +     +W +A   A  +  ++++++ E    QFQV A N AG+G P
Sbjct: 14213 RPIQRYVIEKKERLG---TRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHP 14269

Query: 927   SAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKA 986
             S  +E    E+ T + P PP  L  ++  +  + + WKPP  +G +P+ GY V++     
Sbjct: 14270 SEPTEILSIEDPT-SPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEM--CPV 14326

Query: 987   KEDQWRGLNEAAIKNVYLKV-RGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA---ETR 1042
               ++W  +N   IK++  KV  G+     YV RVRA+N  GV +PS+++  VVA   + +
Sbjct: 14327 GTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCK 14386

Query: 1043  P----GTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTK 1098
             P     T +++V   +   I + F   +  P    SW KD    + S RL +++      
Sbjct: 14387 PTIDLETHDIIVIEGEKLSIPVPF---RAVPVPTVSWHKDGKEVKASDRLTMKNDHISAH 14443

Query: 1099  MTFKDLGMDDLGIYSCDVTDTDGIASS 1125
             +        D GIY+  + +  G A++
Sbjct: 14444 LEVPKSVRADAGIYTITLENKLGSATA 14470



 Score =  251 bits (642), Expect = 3e-66
 Identities = 187/627 (29%), Positives = 290/627 (46%), Gaps = 56/627 (8%)

Query: 438   QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
             +P+I W +  + L   K +      +++T+T     + D G Y I         + +A V
Sbjct: 13719 EPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAV--NVCGRATAVV 13776

Query: 498   FVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
              V   D      P  P      +   +  +++W  P  DGGS I  Y +++    ++ W 
Sbjct: 13777 EVNVLDK-----PGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWH 13831

Query: 558   QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAA---LDPAEKARLK 614
             + + T VK   F  T LI  + YIFRV A N  G+G P + S P+ A    DP       
Sbjct: 13832 KLSST-VKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQAS-PITAKYQFDP------- 13882

Query: 615   SRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFV 673
                                    PGPPT L  ++ T+  V L+W  P   G   I  Y+V
Sbjct: 13883 -----------------------PGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWV 13919

Query: 674   EKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVG 733
             E+ +  T+ W R N ++PVK   + +  L   K Y FRV   N AG G+PS++TE  ++ 
Sbjct: 13920 ERLDPDTDKWVRCN-KMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIK 13978

Query: 734   DKLDIPKAPGKIIPSRNTDTSVVVSW--EESKDAKELVGYYIEASVAGSGKWEPCNNNPV 791
             D +D P  PGK        TSV ++W   E     ++  Y IE    G+ +W       V
Sbjct: 13979 DPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEG-V 14037

Query: 792   KGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFR 851
               ++    GL+ GQ Y FRVRAVN AG SE S+ S+ +  +  + PPSPP  +  +   +
Sbjct: 14038 PTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITK 14097

Query: 852   DSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVY 911
             ++  L W  P+K GG+ IT Y V  R+V       W+  +   V +    ++ L E  +Y
Sbjct: 14098 NTADLKWTVPEKDGGSPITNYIVEKRDV---RRKGWQTVDT-TVKDTKCTVTPLTEGSLY 14153

Query: 912   QFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGR 971
              F+VAA N  G    + + +    ++ T   PGPP++L   +V K  + L+W+PP + G 
Sbjct: 14154 VFRVAAENAIGQSDYTEIEDSVLAKD-TFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGG 14212

Query: 972   TPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPS 1031
              P+  Y ++ KE      +W    + A  +   +V  + EG    F+VRA N+AGVG PS
Sbjct: 14213 RPIQRYVIEKKERLG--TRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPS 14270

Query: 1032  DLAGPVVAE--TRPGTKEVVVNVDDDG 1056
             +    +  E  T P +  + ++V D G
Sbjct: 14271 EPTEILSIEDPTSPPSPPLDLHVTDAG 14297



 Score =  226 bits (577), Expect = 1e-58
 Identities = 198/661 (29%), Positives = 274/661 (41%), Gaps = 96/661 (14%)

Query: 417   REGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKED 476
             R G TM L   V   P      P+I W +  V L     +    +     L   ++NK D
Sbjct: 19706 RAGVTMRLYVPVKGRPP-----PKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYD 19760

Query: 477   EGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVD 536
              G Y + +      ++Y+  V V D        P  P++V   E +KD   ++W+ P +D
Sbjct: 19761 AGKYILTLENSCGKKEYTIVVKVLDT-------PGPPVNVTVKEISKDSAYVTWEPPIID 19813

Query: 537   GGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPS 596
             GGSPI+ Y + K +    SWS    T      F V  L EG+SY FRV A N+ GIG P 
Sbjct: 19814 GGSPIINYVVQKRDAERKSWSTVT-TECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPG 19872

Query: 597   RVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVL 656
                + V A                                 PGP  DL V   ++S   +
Sbjct: 19873 ETRDAVKASQ------------------------------TPGPVVDLKVRSVSKSSCSI 19902

Query: 657   SWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSN 716
              WK P   G   I+ +V         WQRV   L   S +++  DL EGK Y FRV   N
Sbjct: 19903 GWKKPHSDGGSRIIGYVVDFLTEENKWQRVMKSL---SLQYSAKDLTEGKEYTFRVSAEN 19959

Query: 717   SAGVGEPSEATEVT---VVGDKLDIPKAPGKIIPSRNTDT-----------SVVVSWEES 762
               G G PSE T V    VV   LD+   P     ++               +  VSW++ 
Sbjct: 19960 ENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKG 20019

Query: 763   KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEY 822
             +D        +      S +    N   +    + C     G+   + +   N AG  E 
Sbjct: 20020 EDP-------LATDTRVSVESSAVNTTLIV---YDCQKSDAGK---YTITLKNVAGTKEG 20066

Query: 823   SQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDG 882
             +     I +K    P  P   I   E   ++M L W  P   GG+EIT Y +  R   D 
Sbjct: 20067 T-----ISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKR---DS 20118

Query: 883   VPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCE----EW 938
             V  KW      AV +  ++++ L E M Y F+V+A N  G+G      E  K E      
Sbjct: 20119 VNNKWVTC-ASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVG------EGLKSEPIVARH 20171

Query: 939   TIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAA 998
                VP  P      +VR DS+ L W  P  +G +P+TGY ++ KE  +    W+  N+  
Sbjct: 20172 PFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSL--LWKRANKTP 20229

Query: 999   IKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA--ETRPGTKEVVVNVDDDG 1056
             I+    KV GL EG+ Y FRV AIN AGVGKPS  + PVVA     P  K  V+N+  + 
Sbjct: 20230 IRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITRNS 20289

Query: 1057  V 1057
             V
Sbjct: 20290 V 20290



 Score =  224 bits (571), Expect = 5e-58
 Identities = 170/614 (27%), Positives = 266/614 (43%), Gaps = 55/614 (8%)

Query: 429   VITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGE 488
             ++ P   + +P   W      L     V+       A L  S   + D+G+YT+++    
Sbjct: 13414 ILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKL---- 13469

Query: 489   YYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDK 548
                +        + D  +   P+AP ++K  +  KD + ++W+ P  DGGSP+ GY ++K
Sbjct: 13470 ---ENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEK 13526

Query: 549   CEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPA 608
              EV   +W++  D  V    F V  L++G+ Y+F+V A NK G G P+ V EPV    PA
Sbjct: 13527 REVSRKTWTKVMDF-VTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPA 13585

Query: 609   EKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEG 668
                                         VP PP ++   + T + + L+W PP   G   
Sbjct: 13586 ---------------------------TVPDPPENVKWRDRTANSIFLTWDPPKNDGGSR 13618

Query: 669   IM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEAT 727
             I  Y VE+C  G++ W  V    PV   +  +  L EGK Y +RV+  N  G  +PS  T
Sbjct: 13619 IKGYIVERCPRGSDKW--VACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPT 13676

Query: 728   EVTVVGDKLDIPK--APGKIIPSRNTDTSVVVSWEESKDAK-ELVGYYIEASVAGSGKWE 784
             E     D  + P+     K++          +    +   K E    + +A +       
Sbjct: 13677 EEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKR 13736

Query: 785   PCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDI 844
                 N  K S  T        +  + + AVN  G     + +  +EV   +  P PP   
Sbjct: 13737 ITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCG-----RATAVVEVN-VLDKPGPPAAF 13790

Query: 845   TCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISN 904
                +   +S +L W  P   GG++IT Y V  R     V   W + +   V +  +K + 
Sbjct: 13791 DITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEV---WHKLS-STVKDTNFKATK 13846

Query: 905   LKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWK 964
             L  N  Y F+VAA NM G+G P   S      ++    PGPP  L+ S++ KD++ L W 
Sbjct: 13847 LIPNKEYIFRVAAENMYGVGEPVQASPI--TAKYQFDPPGPPTRLEPSDITKDAVTLTWC 13904

Query: 965   PPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQ 1024
              P   G +P+TGY+V+  +     D+W   N+  +K+   +V+GL     Y FRV A N 
Sbjct: 13905 EPDDDGGSPITGYWVERLDPDT--DKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENL 13962

Query: 1025  AGVGKPSDLAGPVV 1038
             AG GKPS    P++
Sbjct: 13963 AGPGKPSKSTEPIL 13976



 Score =  221 bits (564), Expect = 3e-57
 Identities = 186/596 (31%), Positives = 260/596 (43%), Gaps = 91/596 (15%)

Query: 478   GLYTIRVRMGEYY----EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQP 533
             G Y  RVR    Y    E  S  V ++D    + G P  P   K L   K  +++SW  P
Sbjct: 15567 GQYEFRVRAVNKYGISDECKSDKVVIQDP-YRLPGPPGKP---KVLARTKGSMLVSWTPP 15622

Query: 534   AVDGGSPILGYFIDKCEVGTDSWSQCNDTPV-----KFARFPVTGLIEGRSYIFRVRAVN 588
               +GGSPI GY+++K E G+  WS+ +  P+     K   F V  L+EG  Y FR  A+N
Sbjct: 15623 LDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAIN 15682

Query: 589   KMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTE 648
               GIG PS  S+P  A DP                              PGPP+   V +
Sbjct: 15683 AAGIGPPSEPSDPEVAGDPI---------------------------FPPGPPSCPEVKD 15715

Query: 649   ATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNT-ELPVKSPRFALFDLAEGK 706
              T+S + L WKPP + G   I  Y VE  E GT +W+RVN  +  + +    + +L E +
Sbjct: 15716 KTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCECVVPNLKELR 15775

Query: 707   SYCFRVRCSNSAGVGEPSEATE-----------------------VTVVGDKLDIPKAPG 743
              Y FRV+  N AG  EPS+ T                        V   G ++ IP    
Sbjct: 15776 KYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPA--- 15832

Query: 744   KIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVT 803
              +I  R T  S   SWE    AK+ +   +   +    + E   N+ V      C    T
Sbjct: 15833 -VIKGRPTPKS---SWEFDGKAKKAMKDGVH-DIPEDAQLETAENSSVIIIP-ECKRSHT 15886

Query: 804   GQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDK 863
             G+   + + A N AG    +   + ++V      P PP D+   +  R S  L WK PD 
Sbjct: 15887 GK---YSITAKNKAGQKTANCRVKVMDV------PGPPKDLKVSDITRGSCRLSWKMPDD 15937

Query: 864   IGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 923
              GG  I GY +  R  IDG    W + N    S   + + +L     Y F+V A N  G+
Sbjct: 15938 DGGDRIKGYVIEKR-TIDGKA--WTKVNPDCGST-TFVVPDLLSEQQYFFRVRAENRFGI 15993

Query: 924   GAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDL-- 981
             G P    +     +  I  P PP  LK   + K+++ L WKPP + G +PVT Y V+   
Sbjct: 15994 GPPVETIQRTTARD-PIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLA 16052

Query: 982   -KEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGP 1036
                   K++ WR  N+  ++ +   V  L EG  Y FRV+A+N AGV KPS   GP
Sbjct: 16053 WDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGP 16108



 Score =  221 bits (563), Expect = 4e-57
 Identities = 182/641 (28%), Positives = 273/641 (42%), Gaps = 85/641 (13%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P  P  ++     KD + + W +P  DGGS I+GY ++K +     W +CN   +   R 
Sbjct: 23819 PGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRL 23878

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              VTGL E   Y FRV A N  G+G PS  +    A DP  K                   
Sbjct: 23879 RVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFK------------------- 23919

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNT 688
                     PGPPT+  + + T++ + L+W KP    G E + Y VE C+A  E WQ V  
Sbjct: 23920 --------PGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVTP 23971

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIP--------- 739
             +  ++  RF +  L E + Y  RV   N  G+GE +         DKL+ P         
Sbjct: 23972 QTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELR 24031

Query: 740   -----KAPGKI---IPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPV 791
                  +A G     IP +   T  +    E  +  + V   IE  V           N  
Sbjct: 24032 KGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTDKV--QIEKGV-----------NYT 24078

Query: 792   KGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFR 851
             + S   C     G+ YI ++   N++G       S  + VK  +  P PP ++   E  +
Sbjct: 24079 QLSIDNCDRNDAGK-YILKLE--NSSG-----SKSAFVTVKV-LDTPGPPQNLAVKEVRK 24129

Query: 852   DSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKA-VSEEAYKISNLKENMV 910
             DS  L W+ P   GGA++  Y ++ RE       +   ANV +  S+ ++K+ NL E  +
Sbjct: 24130 DSAFLVWEPPIIDGGAKVKNYVIDKREST-----RKAYANVSSKCSKTSFKVENLTEGAI 24184

Query: 911   YQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSG 970
             Y F+V A N  G+G P    +  K  E     P PP  +  ++V + S  L W+ P H G
Sbjct: 24185 YYFRVMAENEFGVGVPVETVDAVKAAE----PPSPPGKVTLTDVSQTSASLMWEKPEHDG 24240

Query: 971   RTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKP 1030
              + V GY V+++      ++W  + E+ + N    V GL  G  Y FRV+A N+ G   P
Sbjct: 24241 GSRVLGYVVEMQPKGT--EKWSIVAESKVCNAV--VTGLSSGQEYQFRVKAYNEKGKSDP 24296

Query: 1031  SDLAGPVVAET---RPGTKEVVVNVDDDGVISLNFECDKM-TPKSEFSWSKDYVSTEDSP 1086
               L  PV+A+    +P  K             L  E   +  P+   SW KD    + + 
Sbjct: 24297 RVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTT 24356

Query: 1087  RLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1127
             R+ VE     T +  K+   DD G Y+   T++ G A+  L
Sbjct: 24357 RVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENL 24397



 Score =  219 bits (557), Expect = 2e-56
 Identities = 209/852 (24%), Positives = 345/852 (40%), Gaps = 99/852 (11%)

Query: 287   TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
             T+    +++L  S++G P P +TW K  + +   A     II++      L ++  +  D
Sbjct: 29457 TIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRA-----IIDTTESYSLLIVDKVNRYD 29511

Query: 347   TAQYRASAMNVKGELSAYASVVVKRYKGEFDETRF-HAGASTMPLSFGVTPYGYASRFEI 405
               +Y   A N  G+ SA   V V    G     +       ++ +++ +      +    
Sbjct: 29512 AGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNN 29571

Query: 406   HFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERA 465
             +  +K + +  R  +T++  C   +             YR          +  L  G   
Sbjct: 29572 YIVEKREAAM-RAFKTVTTKCSKTL-------------YR----------ISGLVEG--- 29604

Query: 466   TLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDY 525
               T  +     E +Y I    GE  E   A +        +   P  P  ++ ++  K  
Sbjct: 29605 --TMYYFRVLPENIYGI----GEPCETSDAVL--------VSEVPLVPAKLEVVDVTKST 29650

Query: 526   IIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVR 585
             + ++W++P  DGGS + GY ++ C+ GT+ W +            VT L EG  Y+FR+R
Sbjct: 29651 VTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIR 29710

Query: 586   AVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLS 645
             A N+ G+  P      V   D      L+  P+       + T  + +  +  G P +L 
Sbjct: 29711 AQNEKGVSEPRETVTAVTVQD------LRVLPTID-----LSTMPQKTIHVPAGRPVELV 29759

Query: 646   VTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEG 705
             +  A R     SW   G +  E                +RV  E   K  +  + +    
Sbjct: 29760 IPIAGRPPPAASWFFAGSKLRES---------------ERVTVETHTKVAKLTIRETTIR 29804

Query: 706   KSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE--ESK 763
              +  + +   N  G    SE  +V ++ DK   P  P KI       TS+ +SWE  E  
Sbjct: 29805 DTGEYTLELKNVTGT--TSETIKVIIL-DKPGPPTGPIKI--DEIDATSITISWEPPELD 29859

Query: 764   DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYS 823
                 L GY +E   A    W P + + V  S F    L  G  Y+FRV A N  G+  Y 
Sbjct: 29860 GGAPLSGYVVEQRDAHRPGWLPVSES-VTRSTFKFTRLTEGNEYVFRVAATNRFGIGSYL 29918

Query: 824   QDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGV 883
             Q SE IE +++I  P PP  +   +  RD M L W  P+  GG+++TGY V  +EV    
Sbjct: 29919 Q-SEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEV---R 29974

Query: 884   PGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVP 943
               +W   N   V+   Y+ + L E + Y+ +V A+N  G G PS  S+     +  IA P
Sbjct: 29975 ADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMD-PIAPP 30033

Query: 944   GPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVY 1003
             G P + + ++  + S+ L W  P   G + VTGY ++++  K  + +W   N    K   
Sbjct: 30034 GKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQ--KVDQHEWTKCNTTPTKIRE 30091

Query: 1004  LKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVN--------VDDD 1055
               +  L +G  Y FRV A N  G G+P+++ G V         +  ++        V   
Sbjct: 30092 YTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQG 30151

Query: 1056  GVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCD 1115
             GVI L     K  P     W+K+    + S R  + +    T++  K+    D G Y   
Sbjct: 30152 GVIRLTIPI-KGKPFPICKWTKE--GQDISKRAMIATSETHTELVIKEADRGDSGTYDLV 30208

Query: 1116  VTDTDGIASSYL 1127
             + +  G  + Y+
Sbjct: 30209 LENKCGKKAVYI 30220



 Score =  218 bits (554), Expect = 5e-56
 Identities = 175/618 (28%), Positives = 260/618 (42%), Gaps = 69/618 (11%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P + W ++G  L P++ ++        TL    +N++D G YTI        +  +  + 
Sbjct: 19325 PTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLK 19384

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V D        P  P  VK  +   D  ++SW+ P  DGGS I  Y +DK E    +W+Q
Sbjct: 19385 VLDK-------PGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQ 19437

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
              + T V      V  LIEG  Y FR+ A NK G+G P   +EP  A +P +         
Sbjct: 19438 VSAT-VPITSCSVEKLIEGHEYQFRICAENKYGVGDPV-FTEPAIAKNPYDP-------- 19487

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                                PG      ++  T+ ++ +SWKPP   G   I  Y +EK E
Sbjct: 19488 -------------------PGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRE 19528

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
                 NW +VN + P+         L EG  Y FRV   N AG G+PS+A++     D   
Sbjct: 19529 TQAVNWTKVNRK-PIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQY 19587

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCN-NNPVKGS 794
              P  P        T +SV +SW +        ++GY +E   A S  W  CN    ++ +
Sbjct: 19588 PPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKT 19647

Query: 795   RFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSM 854
             RF   GL+    Y FRV AVN  G S+ S   +    K  + PP    D       R ++
Sbjct: 19648 RFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELD----ADLRKTL 19703

Query: 855   VLGWKQPDKIGGAEITGYYVNYREVIDGVPG---KWREANVKAVSEEAYKISNLKENMVY 911
             +L              G  +     + G P     W + NV         I +   +   
Sbjct: 19704 ILR------------AGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFL 19751

Query: 912   QFQVAAMNMAGLGAPSAVSECFKCEEWTIAV-----PGPPHSLKCSEVRKDSLVLQWKPP 966
             + +      AG    +  + C K +E+TI V     PGPP ++   E+ KDS  + W+PP
Sbjct: 19752 RCENVNKYDAGKYILTLENSCGK-KEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPP 19810

Query: 967   VHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG 1026
             +  G +P+  Y V  ++A+ K   W  +     K  + +V  L+EG SY FRV A N+ G
Sbjct: 19811 IIDGGSPIINYVVQKRDAERK--SWSTVTTECSKTSF-RVANLEEGKSYFFRVFAENEYG 19867

Query: 1027  VGKPSDLAGPVVAETRPG 1044
             +G P +    V A   PG
Sbjct: 19868 IGDPGETRDAVKASQTPG 19885



 Score =  216 bits (550), Expect = 1e-55
 Identities = 195/731 (26%), Positives = 300/731 (41%), Gaps = 100/731 (13%)

Query: 339   INGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYG 398
             + G    DT +YR SA+N+ G+            K E      H                
Sbjct: 16778 VKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLH---------------- 16821

Query: 399   YASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQT 458
                   + F DK  +   R GE  +L  R    P+     P++ W+++   +        
Sbjct: 16822 ------LDFRDKLTI---RVGEAFALTGRYSGKPK-----PKVSWFKDEADVLEDDRTHI 16867

Query: 459   LWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKC 518
               +     L      + D G Y + V       +    V V D      G P  P+    
Sbjct: 16868 KTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRP----GPPVGPVSFD- 16922

Query: 519   LEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGR 578
              E  KDY++ISWK P  DGGS I  Y I+K EVG D W        K     V+ L+EG+
Sbjct: 16923 -EVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAK-TTCKVSKLLEGK 16980

Query: 579   SYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVP 638
              YIFR+ A N  GI      S+P+ +     K R +                      VP
Sbjct: 16981 DYIFRIHAENLYGI------SDPLVSDSMKAKDRFR----------------------VP 17012

Query: 639   GPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFA 698
               P    VTE T+   +++W  P   G     Y +EK E  ++ W RV  +      +F 
Sbjct: 17013 DAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKRETMSKRWARVTKDPIHPYTKFR 17072

Query: 699   LFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVS 758
             + DL EG  Y FRV   N  G+G+PS  ++     D +  P  P        T  SV ++
Sbjct: 17073 VPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLT 17132

Query: 759   WEESK--DAKELVGYYIEASVAGSGKWEPCNNNP--VKGSRFTCHGLVTGQSYIFRVRAV 814
             W+  +     +++GY +E    G  +W   N+ P     +++   GL  GQ+Y FRV AV
Sbjct: 17133 WQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVLAV 17192

Query: 815   NAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYV 874
             NAAG S+ +   E + VK  + PP    D            +  +Q  K+G        +
Sbjct: 17193 NAAGESDPAHVPEPVLVKDRLEPPELILDAN----------MAREQHIKVGDT------L 17236

Query: 875   NYREVIDGVP---GKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPS---- 927
                 +I GVP     W++ +  A ++    ++ +   +  + + AA    G+ + +    
Sbjct: 17237 RLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGSKL--EIRNAAHEDGGIYSLTVENP 17294

Query: 928   AVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAK 987
             A S+    +   +  PGPP  L+ SE+RKDS  L WK P+  G + +T Y V+ ++  + 
Sbjct: 17295 AGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASA 17354

Query: 988   EDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAET---RPG 1044
               QW  L+  + K  +   + L EG  Y+FRV A NQ G G   +   P+ A      PG
Sbjct: 17355 --QWSPLSATSKKKSHF-AKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPG 17411

Query: 1045  TKEVVVNVDDD 1055
               + + +VD D
Sbjct: 17412 PPKDLHHVDVD 17422



 Score =  216 bits (550), Expect = 1e-55
 Identities = 178/625 (28%), Positives = 265/625 (42%), Gaps = 65/625 (10%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P AP   +     KD +I+ W++PA DGGS ILGY ++K +     W++C+   +   R 
Sbjct: 22737 PDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRL 22796

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              VTGLIE   Y FRV A N  G+  PS  S    A DP  K                   
Sbjct: 22797 RVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACDPIYK------------------- 22837

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNT 688
                     PGPP +  V + TRS V LSW KP    G E   Y VEKC+     W     
Sbjct: 22838 --------PGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTP 22889

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAP-----G 743
                +      +  L E   Y FR+   N AGVGE ++     +V +KL+ P         
Sbjct: 22890 PTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELR 22949

Query: 744   KIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVT 803
             KII  R   +  +    + +   E+    ++  +  +   +         S FT   L  
Sbjct: 22950 KIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVT-------SSFTSLVLDN 23002

Query: 804   GQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDK 863
                Y      +    L   S    A      +  PSPP ++   E  +DS+ + W+ P  
Sbjct: 23003 VNRYDSGKYTLT---LENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLL 23059

Query: 864   IGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 923
              GG++I  Y V  RE       K   A V    + ++KI  L+E   Y F+V A N  G+
Sbjct: 23060 DGGSKIKNYIVEKREATR----KSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGI 23115

Query: 924   GAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE 983
             G P+  ++  K  E    VP PP  +   +V ++S+ L W  P H G + +  Y V++ +
Sbjct: 23116 GLPAQTADPIKVAE----VPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEM-Q 23170

Query: 984   AKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA---- 1039
             AK  E +W     A +K++   +  L +G  Y+FRV A+N+ G   P  LA P+VA    
Sbjct: 23171 AKHSE-KWSEC--ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLV 23227

Query: 1040  ---ETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNK 1096
                + +P      V V  D  I +        PK   +W+KD +  + + R+ V    + 
Sbjct: 23228 IEPDVKPAFSSYSVQVGQDLKIEVPI---SGRPKPTITWTKDGLPLKQTTRINVTDSLDL 23284

Query: 1097  TKMTFKDLGMDDLGIYSCDVTDTDG 1121
             T ++ K+   DD G Y   V +  G
Sbjct: 23285 TTLSIKETHKDDGGQYGITVANVVG 23309



 Score =  213 bits (541), Expect = 2e-54
 Identities = 192/700 (27%), Positives = 285/700 (40%), Gaps = 118/700 (16%)

Query: 523   KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIF 582
             KD++ +SWK PA DGGSPI GY ++K E    +W++ N  P+       TGL EG  Y F
Sbjct: 19501 KDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEF 19560

Query: 583   RVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPT 642
             RV A+NK G G PS  S+   A DP                              PGPP 
Sbjct: 19561 RVTAINKAGPGKPSDASKAAYARDPQYP---------------------------PGPPA 19593

Query: 643   DLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFD 701
                V + TRS V LSW  P   G   I+ Y VE   A ++NW R N    ++  RF +  
Sbjct: 19594 FPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTG 19653

Query: 702   LAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEE 761
             L E   Y FRV   N  G  +PS+                    +P ++    +++  E 
Sbjct: 19654 LMEDTQYQFRVYAVNKIGYSDPSD--------------------VPDKHYPKDILIPPEG 19693

Query: 762   SKDA---KELV---GYYIEASVAGSGK------WEPCNNN-------PVKGSRFT----C 798
               DA   K L+   G  +   V   G+      W   N N        +K + F     C
Sbjct: 19694 ELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRC 19753

Query: 799   HGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGW 858
               +    +  + +   N+ G  EY+     I VK  +  P PP ++T  E  +DS  + W
Sbjct: 19754 ENVNKYDAGKYILTLENSCGKKEYT-----IVVKV-LDTPGPPVNVTVKEISKDSAYVTW 19807

Query: 859   KQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAM 918
             + P   GG+ I  Y V  R   D     W     +  S+ +++++NL+E   Y F+V A 
Sbjct: 19808 EPPIIDGGSPIINYVVQKR---DAERKSWSTVTTEC-SKTSFRVANLEEGKSYFFRVFAE 19863

Query: 919   NMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYF 978
             N  G+G P    +  K  +     PGP   LK   V K S  + WK P   G + + GY 
Sbjct: 19864 NEYGIGDPGETRDAVKASQ----TPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYV 19919

Query: 979   VDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVV 1038
             VD      +E++W+ + ++   ++    + L EG  Y FRV A N+ G G PS++   VV
Sbjct: 19920 VDFL---TEENKWQRVMKSL--SLQYSAKDLTEGKEYTFRVSAENENGEGTPSEIT--VV 19972

Query: 1039  AETRPGTKEVVVNVDDDGVISL--------NFECD---KMTPKSEFSWSKDYVSTEDSPR 1087
             A        V  ++D  G+  L        NF      K  P    SW K         R
Sbjct: 19973 ARD----DVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTR 20028

Query: 1088  LEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPT 1147
             + VES    T +   D    D G Y+  + +  G     +         + +  +   PT
Sbjct: 20029 VSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTI--------SIKVVGKPGIPT 20080

Query: 1148  VPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1187
              P+K +   E+  +     W   +   G+   NYI  +++
Sbjct: 20081 GPIKFD---EVTAEAMTLKWAPPKDDGGSEITNYILEKRD 20117



 Score =  213 bits (541), Expect = 2e-54
 Identities = 293/1258 (23%), Positives = 492/1258 (39%), Gaps = 198/1258 (15%)

Query: 273   LLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRY 332
             L+  P F +   + TV   E++K+     G P P VTW+K+ VP+       +   ES  
Sbjct: 22144 LVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLK---QTTRVNAESTE 22200

Query: 333   GMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKG------EFDETRFHAGAS 386
                 L I     ED   Y     N  GE     +V+V    G      + DE      A 
Sbjct: 22201 NNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVT----AD 22256

Query: 387   TMPLSFGVTPYGYASRFEIHFDDKFDVSF-------GREGETMSLGCRVVITPEIK---- 435
             ++ LS+G   Y   S    +  +K D S             T    CR+    E +    
Sbjct: 22257 SITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFRIA 22316

Query: 436   -----------HFQPEIQWYRNGVPLSPSKWVQTLWSG---------------------- 462
                        + +P +  Y   VP  P   V TL S                       
Sbjct: 22317 AENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYH 22376

Query: 463   ----ERATLTFSHLNKE------------DEGL-YTIRVR------MGEYYEQYSAYVFV 499
                 ER ++ +  LNK             +EG+ Y  RV       +G+  +    YV  
Sbjct: 22377 LERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYV-A 22435

Query: 500   RDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQC 559
             RD   +  G P A +        ++ + + WK+P  DGGS I GY ++K E+    W + 
Sbjct: 22436 RDP-CDPPGRPEAII------VTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKA 22488

Query: 560   NDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGI-GFPSRVSEPVAALDPAEKARLKSRPS 618
             + T +    F VTGL+E   Y FRV A N  G+   PS  +  + A D  +  R+   P 
Sbjct: 22489 SFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPK 22548

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEA 678
                T  +   E    +  + G P              + W    Q               
Sbjct: 22549 YKDTIVVHAGESFKVDADIYGKPIP-----------TIQWIKGDQE-------------- 22583

Query: 679   GTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDI 738
                N  R+  +    +   ++ D     S  + ++  N AG         VTV    LD 
Sbjct: 22584 -LSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAG------ERSVTVNVKVLDR 22636

Query: 739   PKAP-GKIIPSRNTDTSVVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSR 795
             P  P G ++ S  T     ++W+        +++ Y +E        W   + N V+   
Sbjct: 22637 PGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDAN-VQTLS 22695

Query: 796   FTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPC-DITCLESFRDSM 854
                  L+ G  Y FR+ AVN  G+ E  +    +     + P +P   ++T +   +DSM
Sbjct: 22696 CKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVT--KDSM 22753

Query: 855   VLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQ 914
             ++ W++P   GG+EI GY +  R+  +G+  +W   + + + E   +++ L EN  Y+F+
Sbjct: 22754 IVVWERPASDGGSEILGYVLEKRDK-EGI--RWTRCHKRLIGELRLRVTGLIENHDYEFR 22810

Query: 915   VAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPV 974
             V+A N AGL  PS  S   K  +  I  PGPP++ K  ++ + S+ L W  P++ G   +
Sbjct: 22811 VSAENAAGLSEPSPPSAYQKACD-PIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEI 22869

Query: 975   TGYFVDLKEAKAKEDQWRGLNE-AAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDL 1033
              GY V+  +    E  W        I    ++V  L E   Y FR+ AIN+AGVG+ +D+
Sbjct: 22870 QGYIVEKCDVSVGE--WTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADV 22927

Query: 1034  AGPVVAETRPGTKEV--------VVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDS 1085
              GP++ E +    ++        ++N+   G + L F   K  P  E  W K      D+
Sbjct: 22928 PGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRL-FVPIKGRPTPEVKWGKVDGEIRDA 22986

Query: 1086  PRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKF 1145
               ++V S  + T +   ++   D G Y+  + ++ G  S+++       R+L        
Sbjct: 22987 AIIDVTS--SFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFV-----TVRVL------DT 23033

Query: 1146  PTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKV-NYIFNEKEIFEGPKYKMHIDRNTGI 1204
             P+ PV   L V  + K  V    +   L G +K+ NYI  ++E     K    +  N   
Sbjct: 23034 PSPPV--NLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATR--KSYAAVVTNCHK 23089

Query: 1205  IEMFMEKLQDEDEG-TYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPH 1263
                 +++LQ   EG +Y F++    A N   + L       + K AE           P 
Sbjct: 23090 NSWKIDQLQ---EGCSYYFRV---TAENEYGIGLPAQTADPI-KVAEV----------PQ 23132

Query: 1264  FVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTL--LITE 1321
                 ++ +     +V L          + I+ Y  E +    EK      + +L  +IT 
Sbjct: 23133 PPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVITN 23192

Query: 1322  FSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSA------TDLKIQST 1375
              ++ +  ++ V+  +++G+   R   V    K+L++E   K A S+       DLKI+  
Sbjct: 23193 LTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVP 23252

Query: 1376  AEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKY 1433
               G    +          + W+ +G  ++ + R+    + +   L I E   +D G+Y
Sbjct: 23253 ISGRPKPT----------ITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQY 23300



 Score =  213 bits (541), Expect = 2e-54
 Identities = 172/632 (27%), Positives = 276/632 (43%), Gaps = 62/632 (9%)

Query: 505   EIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPV 564
             ++   P  P  V  ++  ++   I W++P  DGGS I GY ++    G++ WS C  T V
Sbjct: 25291 KVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTC--TQV 25348

Query: 565   KFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQ 624
             K     ++GL  G  Y+FRV AVN+ G   P ++  PV A D      +K     P+   
Sbjct: 25349 KTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARD----IEIKPSVELPFHTF 25404

Query: 625   IIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQ 684
              +   E+            + V    R    ++W+  GQ                 +   
Sbjct: 25405 NVKAREQ----------LKIDVPFKGRPQATVNWRKDGQT---------------LKETT 25439

Query: 685   RVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGK 744
             RVN          ++ + ++     + +  SNSAG    S    +T++   LD P  PG 
Sbjct: 25440 RVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAG----SITVPITII--VLDRPGPPGP 25493

Query: 745   IIPSRNTDTSVVVSWE--ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLV 802
             I     +  S+ +SW   E     ++  Y +E     S  W    +  V  +      L 
Sbjct: 25494 IRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWH-IVSQAVARTSIKIVRLT 25552

Query: 803   TGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPD 862
             TG  Y FRV A N  G S YS +S A+  +   +PP PP     + + + +M++ W+ P 
Sbjct: 25553 TGSEYQFRVCAENRYGKSSYS-ESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPV 25611

Query: 863   KIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAG 922
               GG+ + GY++ Y+E    +   W +AN   +++   K+S L E ++Y+++V A N+AG
Sbjct: 25612 NDGGSRVIGYHLEYKERSSIL---WSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAG 25668

Query: 923   LGAPSAVSECFK-CEEWTIAVP-GPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVD 980
             +G      +C K CE      P  PP   + + + + S+ L+W  P + G   +TGY V+
Sbjct: 25669 IG------KCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVE 25722

Query: 981   LKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQA-GVGKPSDLAGPVVA 1039
              +E    + +W   N   I+  Y +V  L E   Y FRV A N A  V +PS+  GP++ 
Sbjct: 25723 RRE--LPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIV 25780

Query: 1040  ETRPGTKEVVVNVDDDGVI------SLNFECD-KMTPKSEFSWSKDYVSTEDSPRLEVES 1092
             +       V+++V    VI       L    D    P    SW+KD +  E+  R E+ S
Sbjct: 25781 KDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIIS 25840

Query: 1093  KGNKTKMTFKDLGMDDLGIYSCDVTDTDGIAS 1124
               N T +T KD    D G Y   + +  G  S
Sbjct: 25841 TDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRS 25872



 Score =  211 bits (538), Expect = 3e-54
 Identities = 175/691 (25%), Positives = 307/691 (44%), Gaps = 71/691 (10%)

Query: 513   PLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVT 572
             P +V+  + +K+ + +SW+QPA DGGS I GY +++ ++    W++ + T V   +F ++
Sbjct: 26771 PRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIIS 26830

Query: 573   GLIEGRSYIFRVRAVNKMG-IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEE 631
             GL +   Y FRV A N +G I  PS V  P+  +D              + G +I    E
Sbjct: 26831 GLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDS-------------YGGPVIDLPLE 26877

Query: 632   PSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELP 691
              +E +     T + +         +S KP        I ++ +  E  T     V     
Sbjct: 26878 YTEVVKYRAGTSVKLRAG------ISGKPAPT-----IEWYKDDKELQTNALVCVENTTD 26926

Query: 692   VKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRN- 750
             + S    + D     S C+ ++  N+ G      +   T+    LD P  PG  I  +  
Sbjct: 26927 LAS--ILIKDADRLNSGCYELKLRNAMG------SASATIRVQILDKPGPPGGPIEFKTV 26978

Query: 751   TDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYI 808
             T   + + W    D    ++  Y +E        W   + + ++    T   ++ G  YI
Sbjct: 26979 TAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEH-LEECIITTTKIIKGNEYI 27037

Query: 809   FRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAE 868
             FRVRAVN  G+ E   +S+++  K A   P PP      +  ++SM + W +P   GG++
Sbjct: 27038 FRVRAVNKYGIGE-PLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSD 27096

Query: 869   ITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSA 928
             I+GY++  R   D     W +   + + +   K++ L EN  YQ++V A+N AG G  S 
Sbjct: 27097 ISGYFLEKR---DKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSE 27153

Query: 929   VSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKE 988
              SE +K  +  I  PGPP  ++ ++  K S+ L W  PV+ G + VTGY V++++ +  E
Sbjct: 27154 PSEFYKAAD-PIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGE--E 27210

Query: 989   DQWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKE 1047
             ++W  ++ +  ++     V  LK GV+Y FRV A+N AG G+P ++  PV A+      E
Sbjct: 27211 EEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPE 27270

Query: 1048  ----------VVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKT 1097
                       V+    +D  + + F   K  P    +W KD  +     R  +E+  + +
Sbjct: 27271 IDLDVALRTSVIAKAGEDVQVLIPF---KGRPPPTVTWRKDEKNLGSDARYSIENTDSSS 27327

Query: 1098  KMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVE 1157
              +T   +  +D G Y   + +  G   S  +  + L             T     +L V+
Sbjct: 27328 LLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVL------------DTPAACQKLQVK 27375

Query: 1158  ILEKGQVRFWMQAEKLSGNAK-VNYIFNEKE 1187
              + +G V        + G +  +NY+  +++
Sbjct: 27376 HVSRGTVTLLWDPPLIDGGSPIINYVIEKRD 27406



 Score =  208 bits (529), Expect = 4e-53
 Identities = 198/729 (27%), Positives = 309/729 (42%), Gaps = 80/729 (10%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P  P  +  ++  ++ + +SW++P  DGGS ILGY ++    G+D W+ C    VK    
Sbjct: 22049 PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATC--ATVKVTEA 22106

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALD----PAEKARLKSRPSAPWTGQI 625
              +TGLI+G  Y FRV A N+ GI  P ++S PV A D    PA K           T  +
Sbjct: 22107 TITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFN-------TFTV 22159

Query: 626   IVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQR 685
             +  E+   +    G PT             ++W                K     +   R
Sbjct: 22160 LAGEDLKVDVPFIGRPTP-----------AVTW---------------HKDNVPLKQTTR 22193

Query: 686   VNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKI 745
             VN E    +    + D        + V+ +NSAG  E  E   V V+ DK   P  P K+
Sbjct: 22194 VNAESTENNSLLTIKDACREDVGHYVVKLTNSAG--EAIETLNVIVL-DKPGPPTGPVKM 22250

Query: 746   IPSRNTDTSVVVSWEESK--DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVT 803
                  T  S+ +SW   K      +  Y +E     +  W+  +    + +   C  L T
Sbjct: 22251 --DEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACR-LKT 22307

Query: 804   GQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDK 863
             G  Y FR+ A N  G S Y  +SE    +     P PP       S RDSM + W +P  
Sbjct: 22308 GCEYQFRIAAENRYGKSTYL-NSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPIS 22366

Query: 864   IGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 923
              GG+ + GY++  +E    +   W + N   + +  +K + L+E + Y+F+V+A N+ G+
Sbjct: 22367 DGGSRVIGYHLERKERNSIL---WVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGI 22423

Query: 924   GAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE 983
             G PS VSEC+   +     PG P ++    V ++S+ LQWK P + G + +TGY V+ KE
Sbjct: 22424 GKPSKVSECYVARD-PCDPPGRPEAII---VTRNSVTLQWKKPTYDGGSKITGYIVEKKE 22479

Query: 984   AKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGV-GKPSDLAGPVVA--E 1040
                 E +W   +   I + + +V GL E   Y FRV A N AGV  +PS+  G + A  E
Sbjct: 22480 LP--EGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDE 22537

Query: 1041  TRPGTKEVVVNVDDDGVISL--NFECDKMT---PKSEFSWSKDYVSTEDSPRLEVESKGN 1095
               P    +     D  V+    +F+ D      P     W K      ++ RLE++S   
Sbjct: 22538 VDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDF 22597

Query: 1096  KTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELA 1155
              T ++ KD    D G Y     +  G   S  ++ + L R          P  P    + 
Sbjct: 22598 ATSLSVKDAVRVDSGNYILKAKNVAG-ERSVTVNVKVLDR----------PGPPEGPVVI 22646

Query: 1156  VEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDE 1215
               +  +     W    +  G+  +NYI   +E          +D N   +   + KL + 
Sbjct: 22647 SGVTAEKCTLAWKPPLQDGGSDIINYIVERRE--TSRLVWTVVDANVQTLSCKVTKLLEG 22704

Query: 1216  DEGTYTFQL 1224
             +E  YTF++
Sbjct: 22705 NE--YTFRI 22711



 Score =  207 bits (527), Expect = 7e-53
 Identities = 166/636 (26%), Positives = 271/636 (42%), Gaps = 72/636 (11%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P  PL+V   + N+  + ++W+ P  DGG+ I  Y I+  +  +  W        +    
Sbjct: 13191 PGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSA 13250

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              VT ++EG+ Y FRVRA N++G+G PS  +  V   DP E+                   
Sbjct: 13251 TVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIER------------------- 13291

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNT 688
                     P PP +L+ ++ T+S V L W+PP + G   I+ Y +E+CE G +NW R N 
Sbjct: 13292 --------PSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNM 13343

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPS 748
             +L V    + +  L +G  Y +RV   N AGV +PSE        D    P         
Sbjct: 13344 KL-VPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEP--------- 13393

Query: 749   RNTDTSVVVSWEESKDAKE-LVGYYIEASVAGSGKWEP----CNNNPV--KGSRFTCHGL 801
                     +     KD  E +V   I   V  +G   P    C  + V   G R     L
Sbjct: 13394 -------TMDLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTL 13446

Query: 802   VTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKA-----AIAPPSPPCDITCLESFRDSMVL 856
                   +      +  G+     ++    +        IA PS P ++   +  +DS+ L
Sbjct: 13447 SAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHL 13506

Query: 857   GWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVA 916
              W+ PD  GG+ +TGY V  REV       W +  +  V++  + + +L +   Y F+V 
Sbjct: 13507 TWEPPDDDGGSPLTGYVVEKREVSRKT---WTKV-MDFVTDLEFTVPDLVQGKEYLFKVC 13562

Query: 917   AMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTG 976
             A N  G G P+ V E          VP PP ++K  +   +S+ L W PP + G + + G
Sbjct: 13563 ARNKCGPGEPAYVDEPVNMST-PATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKG 13621

Query: 977   YFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGP 1036
             Y V+        D+W    E  +    ++V GL+EG  Y +RV+A+N+ G  KPS     
Sbjct: 13622 YIVE--RCPRGSDKWVACGEP-VAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEE 13678

Query: 1037  VVAETRPGTKEVVVNVDDDGVISLN----FECDKMT---PKSEFSWSKDYVSTEDSPRLE 1089
             + A       E+ ++V     +++      E        P+ + +W+K  +  +   R+ 
Sbjct: 13679 IQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRIT 13738

Query: 1090  VESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1125
             +E+   K+ +T  D    D G Y  +  +  G A++
Sbjct: 13739 IENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATA 13774



 Score =  207 bits (527), Expect = 7e-53
 Identities = 186/678 (27%), Positives = 300/678 (44%), Gaps = 67/678 (9%)

Query: 523   KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIF 582
             ++ + + WK+PA DGGS I GY ++K ++    W + + T V    F V+GL+E + Y F
Sbjct: 24616 RNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEF 24675

Query: 583   RVRAVNKMG-IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPP 641
             RV A N  G    PS  S  + A D  +       P       +   E    E  + G P
Sbjct: 24676 RVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKP 24735

Query: 642   TDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFD 701
                 V           W   G+         +E+  A      R+  +  ++     + D
Sbjct: 24736 IPDVV-----------WSKDGKE--------LEETAA------RMEIKSTIQKTTLVVKD 24770

Query: 702   LAEGKSYCFRVRCSNSAGVGEPSEATEVTV-VGDKLDIPKAPGKIIPSRNTDTSVVVSWE 760
                     + ++ SN  G    +++  +TV V D+   P+ P K+  +  T     ++W 
Sbjct: 24771 CIRTDGGQYILKLSNVGG----TKSIPITVKVLDRPGPPEGPLKV--TGVTAEKCYLAWN 24824

Query: 761   ES-KDAKELVGYYI-EASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAG 818
                +D    + +YI E        W   +   V+   +    L+ G  YIFRV AVN  G
Sbjct: 24825 PPLQDGGANISHYIIEKRETSRLSWTQVSTE-VQALNYKVTKLLPGNEYIFRVMAVNKYG 24883

Query: 819   LSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYRE 878
             + E   +S  +       PP PP         +DSMV+ W +P   GG EI GY +  R+
Sbjct: 24884 IGE-PLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRD 24942

Query: 879   VIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEW 938
               +GV  +W + N K +++   +++ L E   Y+F+VAA N AG+G PS  S  ++  + 
Sbjct: 24943 K-EGV--RWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACD- 24998

Query: 939   TIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN-EA 997
              +  PGPP + K ++  + S+ L W  P++ G  PV GY V++KEA A  D+W       
Sbjct: 24999 ALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAA--DEWTTCTPPT 25056

Query: 998   AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGV 1057
              ++     V  LKE   Y FR+ AIN  GVG+P+ L G VVA+ R    E+ ++ D   V
Sbjct: 25057 GLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKV 25116

Query: 1058  ISLN-------FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLG 1110
             + L        F   K  P+ E  W K      D  ++EV S  + T +   ++   D G
Sbjct: 25117 VVLRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTS--SFTMLVIDNVTRFDSG 25174

Query: 1111  IYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQA 1170
              Y+  + +  G  ++++       R+L        P+ PV   L +  ++K  V    + 
Sbjct: 25175 RYNLTLENNSGSKTAFV-----NVRVL------DSPSAPV--NLTIREVKKDSVTLSWEP 25221

Query: 1171  EKLSGNAKV-NYIFNEKE 1187
               + G AK+ NYI  ++E
Sbjct: 25222 PLIDGGAKITNYIVEKRE 25239



 Score =  207 bits (526), Expect = 8e-53
 Identities = 224/876 (25%), Positives = 354/876 (40%), Gaps = 114/876 (13%)

Query: 274   LHAPEFIIKP---RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIES 330
             L  PE I+     R   +   + ++L   I G P P+VTW K          P K  I+ 
Sbjct: 17213 LEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKED-----RDAPTKARIDV 17267

Query: 331   RYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPL 390
                   LEI     ED   Y  +  N  G  +    V+V    G              P 
Sbjct: 17268 TPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGP-------------PR 17314

Query: 391   SFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPL 450
                V+            + + D  +    E +  G  V+    ++              +
Sbjct: 17315 DLEVS------------EIRKDSCYLTWKEPLDDGGSVITNYVVERRD-----------V 17351

Query: 451   SPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGA- 509
             + ++W     + ++ +    HLN+ ++ L+ +         QY    FV +    I+   
Sbjct: 17352 ASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAE-----NQYGRGPFV-ETPKPIKALD 17405

Query: 510   ----PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVK 565
                 P  P D+  ++ +K  + + W +P  DGGSPI GY ++  E GT  W +     V 
Sbjct: 17406 PLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKT--VT 17463

Query: 566   FARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQI 625
                  VTGL +G++Y FRV+A N +G+G P           P E       PS     ++
Sbjct: 17464 NLECVVTGLQQGKTYRFRVKAENIVGLGLPDTTI-------PIECQEKLVPPSVELDVKL 17516

Query: 626   IVTEEEPSEGIVPGPPTDLSVTEATRSYVV--LSWKPPGQRGHEGIMYFVEKCEAGTENW 683
             I       EG+V    T +      R   V    W   G        Y VE     T+N+
Sbjct: 17517 I-------EGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVE-----TDNF 17564

Query: 684   QRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAP- 742
               V   L +K+      D  E     +++  SN+AG    + A  +TV    LD+P  P 
Sbjct: 17565 SSV---LTIKN--CLRRDTGE-----YQITVSNAAG--SKTVAVHLTV----LDVPGPPT 17608

Query: 743   GKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHG 800
             G I     T   + +SW+  KD     ++ Y +E        W   ++   K      H 
Sbjct: 17609 GPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPH- 17667

Query: 801   LVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQ 860
             L  G  Y+FRVRA N  G+     DS     K   +PPSPP      +   ++  + W  
Sbjct: 17668 LQKGCEYVFRVRAENKIGVGP-PLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTL 17726

Query: 861   PDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNM 920
             P   GG+ ITGYY+  REV     GKW   N   +++  ++++ L E   Y+F+V A N+
Sbjct: 17727 PKSDGGSPITGYYMERREVT----GKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENL 17782

Query: 921   AGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVD 980
             AGL  PS  S+  K     I  PGPP + K  +  +++  L W  P+  G +P+ GY V+
Sbjct: 17783 AGLSKPSPSSDPIKACR-PIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVE 17841

Query: 981   LKEAKAKEDQWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA 1039
              +  K    QW  +N +  I+    +V GL EG  Y FR++A N  G G+P +LA  V+A
Sbjct: 17842 CQ--KPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIA 17899

Query: 1040  ETRPGTKEVVVNVDDDGVISLN-------FECDKMTPKSEFSWSKDYVSTEDSPRLEVES 1092
             +      EV ++V    VI++            K  P+ + +W+K+        R+++  
Sbjct: 17900 KDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQ 17959

Query: 1093  KGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLI 1128
                + ++  K+    D G Y     ++ G A    I
Sbjct: 17960 DLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAI 17995



 Score =  205 bits (522), Expect = 2e-52
 Identities = 185/707 (26%), Positives = 292/707 (41%), Gaps = 122/707 (17%)

Query: 494   SAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGT 553
             +A  FV+ AD  IE  P+ P+++   +  +  + + W+ P  DGGSPILGY I++CE G 
Sbjct: 13278 AATPFVKVADP-IE-RPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGK 13335

Query: 554   DSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARL 613
             D+W +CN   V    + VTGL +G  Y++RV A NK G+  PS +  P+ A D   +  +
Sbjct: 13336 DNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTM 13395

Query: 614   K-------------------------SRPSAPW--------TGQ-------------IIV 627
                                        RP+A W        TG              +I 
Sbjct: 13396 DLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVIS 13455

Query: 628   TEEEPSEGIV----------------------PGPPTDLSVTEATRSYVVLSWKPPGQRG 665
               E   +GI                       P  P +L   + T+  V L+W+PP   G
Sbjct: 13456 PSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDG 13515

Query: 666   HEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPS 724
                +  Y VEK E   + W +V     V    F + DL +GK Y F+V   N  G GEP+
Sbjct: 13516 GSPLTGYVVEKREVSRKTWTKVMDF--VTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPA 13573

Query: 725   EATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGK 782
                E   +     +P  P  +     T  S+ ++W+  K+     + GY +E    GS K
Sbjct: 13574 YVDEPVNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDK 13633

Query: 783   WEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPC 842
             W  C   PV  ++    GL  G+ Y +RV+A+N  G S+ S+ +E  E++A     +P  
Sbjct: 13634 WVAC-GEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTE--EIQAVDTQEAP-- 13688

Query: 843   DITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPG---KWREANVKAVSEEA 899
                  E F D  +L        G     G  +     + G P     W +A++    ++ 
Sbjct: 13689 -----EIFLDVKLLA-------GLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKR 13736

Query: 900   YKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKC----EEWTIAVPGPPHSLKCSEVR 955
               I N+ +        +  +  G     AV+ C +     E   +  PGPP +   ++V 
Sbjct: 13737 ITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVT 13796

Query: 956   KDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSY 1015
              +S +L W PP   G + +T Y V+ +   +  + W  L+ + +K+   K   L     Y
Sbjct: 13797 NESCLLTWNPPRDDGGSKITNYVVERRATDS--EVWHKLS-STVKDTNFKATKLIPNKEY 13853

Query: 1016  VFRVRAINQAGVGKPSDLAGPVVAETR---PG----------TKEVVV----NVDDDGVI 1058
             +FRV A N  GVG+P   A P+ A+ +   PG          TK+ V       DDDG  
Sbjct: 13854 IFRVAAENMYGVGEPVQ-ASPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGS 13912

Query: 1059  SL-NFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDL 1104
              +  +  +++ P ++  W +            V+   NK K  F+ L
Sbjct: 13913 PITGYWVERLDPDTD-KWVRCNKMPVKDTTYRVKGLTNKKKYRFRVL 13958



 Score =  205 bits (522), Expect = 2e-52
 Identities = 228/940 (24%), Positives = 353/940 (37%), Gaps = 152/940 (16%)

Query: 288   VWEKENVKLHCSIAGWPEPRVTWYK-------NQVPINVHANPGKYIIESRYGMHTLEIN 340
             V E  NV +   I G P P +TW+K       N+ P+    +  K +++      TL I 
Sbjct: 16128 VEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTC---TLVIP 16184

Query: 341   GCDFEDTAQYRASAMNVKGELSAYASV-VVKRYKGEFDETRFHA-GASTMPLSFGVTPYG 398
                  DT  Y  +A+N  G  S    + V+ R        +F +  A  M LS+      
Sbjct: 16185 QSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDD 16244

Query: 399   YASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQT 458
               S+   +  +K      RE    +                               WV  
Sbjct: 16245 GGSKITNYVIEK------REANRKT-------------------------------WVHV 16267

Query: 459   LWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGA------PAA 512
                 +  T T   L +  E ++ I  +        + Y      D+E E A      P A
Sbjct: 16268 SSEPKECTYTIPKLLEGHEYVFRIMAQ--------NKYGIGEPLDSEPETARNLFSVPGA 16319

Query: 513   PLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKF----AR 568
             P         ++ + ++W++P  DGGSP+ GY+++  +  +  W + N  P+K       
Sbjct: 16320 PDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVS 16379

Query: 569   FPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVT 628
             + VTGLIEG  Y FRV A+N  G+G  S  S+P  A DP           AP        
Sbjct: 16380 YKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPI----------AP-------- 16421

Query: 629   EEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVN 687
                      PGPP    VT+ T+S   L W PP + G   +  Y VE  E G E W++  
Sbjct: 16422 ---------PGPPFP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEK-G 16470

Query: 688   TELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIP 747
              +  V+  +  +  L EG  Y FRVR  N AG+GEP E T+V  + D+L        + P
Sbjct: 16471 KDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRL--------VSP 16522

Query: 748   SRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKW---------EPCNNNPVKGSRFTC 798
                 D SV             +  Y+      +  W         E         S    
Sbjct: 16523 DLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVI 16582

Query: 799   HGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGW 858
                      ++ + A N AG  + +   + ++V   +  P    ++T      +S  L W
Sbjct: 16583 KNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLT-----NESCKLTW 16637

Query: 859   KQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAM 918
               P+  GG+ IT Y +  RE        W         + A  +  L +   Y F++AA 
Sbjct: 16638 FSPEDDGGSPITNYVIEKRE---SDRRAWTPVTYTVTRQNA-TVQGLIQGKAYFFRIAAE 16693

Query: 919   NMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYF 978
             N  G+G     SE     E  I VP  P  L+  EV K+++ L W PP + G + +  Y 
Sbjct: 16694 NSIGMGPFVETSEALVIRE-PITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYV 16752

Query: 979   VDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVV 1038
             ++ +     E   +  N+  +   Y  V+GLKEG +Y +RV A+N  G GKPS    P+ 
Sbjct: 16753 LESRLI-GTEKFHKVTNDNLLSRKYT-VKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPIT 16810

Query: 1039  AETRPGTKEVVVNVDDDGVISLNFECDKMT------PKSEFSWSKDYVSTEDSPRLEVES 1092
              +       + ++  D   I +  E   +T      PK + SW KD     +  R  +++
Sbjct: 16811 CKDELAPPTLHLDFRDKLTIRVG-EAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKT 16869

Query: 1093  KGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSY----LIDEEELKRLLALSHEHKFPTV 1148
                   +        D G Y   V ++ G    +    ++D                P  
Sbjct: 16870 TPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDR---------------PGP 16914

Query: 1149  PVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEI 1188
             PV      E+ +   V  W       G+   NYI  +KE+
Sbjct: 16915 PVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEV 16954



 Score =  205 bits (521), Expect = 3e-52
 Identities = 203/858 (23%), Positives = 332/858 (38%), Gaps = 114/858 (13%)

Query: 287   TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
             TV   + ++L   + G P P V W K++   ++  +P +  I++R       +      D
Sbjct: 18212 TVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSP-RVKIDTRADSSKFSLTKAKRSD 18270

Query: 347   TAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIH 406
               +Y  +A N  G   AYA+V V    G     +                          
Sbjct: 18271 GGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKI------------------------- 18305

Query: 407   FDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERAT 466
                  DVS  R        C V   P       EIQ Y     L   +  + +WS   AT
Sbjct: 18306 ----VDVSSDR--------CTVCWDPPEDDGGCEIQNYI----LEKCETKRMVWSTYSAT 18349

Query: 467   L-----TFSHLNKEDEGLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCL 519
             +     T + L + +E ++ +R   ++G      S  V  +    +    P  P   +  
Sbjct: 18350 VLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYDK----PGRPDPPEVT 18405

Query: 520   EANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRS 579
             + +K+ + + W  P  DGG  I GYF++K E  +  W   N + +   R  V  L+    
Sbjct: 18406 KVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHE 18465

Query: 580   YIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPG 639
             Y FRV+A N++GIG PS  S PV A DP E                            PG
Sbjct: 18466 YQFRVKAENEIGIGEPSLPSRPVVAKDPIEP---------------------------PG 18498

Query: 640   PPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCE------AGTENWQRVNTELPVK 693
             PPT+  V + T+  + L W  P   G   I+ +V +        +  E W+R N    + 
Sbjct: 18499 PPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLV 18558

Query: 694   SPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGD-----KLDIPKAPGKIIPS 748
                F +  L E + Y FRV   N  G+G P+E  E     +     ++D+  +  K++  
Sbjct: 18559 RKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVIV 18618

Query: 749   RNTDTSVVVSWEESKDAKELVGYYIEA-SVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSY 807
             R      + +    + A ++    +   +V   G+ +  +                  S 
Sbjct: 18619 RAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAF----LVIPNSTRDDSG 18674

Query: 808   IFRVRAVNAAGLSEYSQDSEAIEVKAAIAP-PSPPCDITCLESFRDSMVLGWKQPDKIGG 866
              + +  VN AG        +A+ V   +   P P  D+   +  + S  + W  P+  GG
Sbjct: 18675 KYSLTLVNPAG-------EKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGG 18727

Query: 867   AEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAP 926
             +++T Y V  RE       K        V + ++ ++NL     Y F+V A+N  G G P
Sbjct: 18728 SQVTHYIVEKREA----DRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVP 18783

Query: 927   SAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKA 986
             + V +     +  ++ P PP  L+ +E+ K+S  L W PP+  G   + GY    +E + 
Sbjct: 18784 TDVPKPVLASD-PLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQ 18842

Query: 987   KEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTK 1046
               D+W     + +K++ L V GLKEG  Y FRV A N  GV  P +  G   A+ +    
Sbjct: 18843 PADRWT--EYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPP 18900

Query: 1047  EVVV--NVDDDGVISLNFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKD 1103
             ++++   +       L  E      P     W K       S  L V    + + +  KD
Sbjct: 18901 KILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKD 18960

Query: 1104  LGMDDLGIYSCDVTDTDG 1121
             +   D G YS    ++ G
Sbjct: 18961 VTRKDSGYYSLTAENSSG 18978



 Score =  205 bits (521), Expect = 3e-52
 Identities = 227/934 (24%), Positives = 381/934 (40%), Gaps = 151/934 (16%)

Query: 287   TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
             T+    ++ L  ++ G PEP++ W K    +++     K  ++      T  I  CD  D
Sbjct: 29058 TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCE---KVSLQYTGKRATAVIKFCDRSD 29114

Query: 347   TAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIH 406
             + +Y  +  N  G  +    V V    G                     P G  +   + 
Sbjct: 29115 SGKYTLTVKNASGTKAVSVMVKVLDSPG---------------------PCGKLTVSRVT 29153

Query: 407   FDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERAT 466
               +K  +++    E            EI H+  E +        S   WV  +  GE  T
Sbjct: 29154 -QEKCTLAWSLPQEDGGA--------EITHYIVERR------ETSRLNWV--IVEGECPT 29196

Query: 467   LTF--SHLNKEDEGLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEAN 522
             L++  + L K +E ++ +R   + G      S  +  R++   I   P  P +V      
Sbjct: 29197 LSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFT-IPSPPGIPEEVG---TG 29252

Query: 523   KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCN-DTPVKFARFPVTGLIEGRSYI 581
             K++III W +P  DGG+ I  Y +DK E  +  W++ N D  V   R  VT L+EG  Y 
Sbjct: 29253 KEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQ 29312

Query: 582   FRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPP 641
             FRV AVN  G   PS  S  ++  +P+                             PGPP
Sbjct: 29313 FRVTAVNAAGNSEPSEASNFISCREPS---------------------------YTPGPP 29345

Query: 642   TDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALF 700
             +   V + T+  + L+W KP    G + + Y +E  E  T+ W RV+T   +++  F + 
Sbjct: 29346 SAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVP 29405

Query: 701   DLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE 760
             DL  G+ Y FRV   N  G+ E SE+       ++++IP                    E
Sbjct: 29406 DLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIP------------------DLE 29447

Query: 761   ESKDAKELV----GYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLV-TGQSY-IFRVRAV 814
              + D K+ V    G  +   V+ SG+  P      +G       ++ T +SY +  V  V
Sbjct: 29448 LADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSLLIVDKV 29507

Query: 815   NAAGLSEYSQDSE-------AIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGA 867
             N     +Y+ ++E       A  +      P P   +   E  RDS+ + W+ P   GGA
Sbjct: 29508 NRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGA 29567

Query: 868   EITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPS 927
              +  Y V  RE        ++    K  S+  Y+IS L E  +Y F+V   N+ G+G P 
Sbjct: 29568 PVNNYIVEKRE---AAMRAFKTVTTKC-SKTLYRISGLVEGTMYYFRVLPENIYGIGEPC 29623

Query: 928   AVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAK 987
               S+     E    VP  P  L+  +V K ++ L W+ P++ G + +TGY   L+  KA 
Sbjct: 29624 ETSDAVLVSE----VPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYV--LEACKAG 29677

Query: 988   EDQWRGLNEAAIKNVYLK--VRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAE----- 1040
              ++W  +    +K   L+  V  L EG  Y+FR+RA N+ GV +P +    V  +     
Sbjct: 29678 TERW--MKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLRVL 29735

Query: 1041  ------TRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKG 1094
                   T P   +  ++V     + L        P +  SW        +S R+ VE+  
Sbjct: 29736 PTIDLSTMP---QKTIHVPAGRPVELVIPIAGRPPPAA-SWFFAGSKLRESERVTVETHT 29791

Query: 1095  NKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSEL 1154
                K+T ++  + D G Y+ ++ +  G  S       E  +++ L      PT P+K   
Sbjct: 29792 KVAKLTIRETTIRDTGEYTLELKNVTGTTS-------ETIKVIILDKPGP-PTGPIK--- 29840

Query: 1155  AVEILEKGQVRFWMQAEKLSGNAKVN-YIFNEKE 1187
              ++ ++   +    +  +L G A ++ Y+  +++
Sbjct: 29841 -IDEIDATSITISWEPPELDGGAPLSGYVVEQRD 29873



 Score =  204 bits (519), Expect = 6e-52
 Identities = 185/698 (26%), Positives = 293/698 (41%), Gaps = 86/698 (12%)

Query: 508   GAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFA 567
             G P  P + +     KD +++ W  P  DGGS I+ Y +++ +     W +CN   +   
Sbjct: 21653 GPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDL 21712

Query: 568   RFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIV 627
             R+ V+GL EG  Y FR+ A N  GI  PS  S    A D   K                 
Sbjct: 21713 RYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFK----------------- 21755

Query: 628   TEEEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRV 686
                       PGPP +  V + +RS + ++W KP    G E   Y VE      + WQ V
Sbjct: 21756 ----------PGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIV 21805

Query: 687   NTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKII 746
                  +K+  + +  L E + Y  R+   NS G+GEP+      V G     PKA  +++
Sbjct: 21806 TPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPA-----LVPGT----PKAEDRML 21856

Query: 747   PSR---NTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVT 803
             P     + D   VV+       +  V   I+   A   KW   +   +  +        T
Sbjct: 21857 PPEIELDADLRKVVTIRACCTLRLFVP--IKGRPAPEVKWARDHGESLDKASIES----T 21910

Query: 804   GQSYIFRVRAVNAAGLSEY------SQDSEAIEVKAAIAP-PSPPCDITCLESFRDSMVL 856
                 +  V  VN     +Y      S  S++  V   +   P PP D+   E  + S+ L
Sbjct: 21911 SSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTL 21970

Query: 857   GWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVA 916
              W  P   GG++I  Y V  RE       K          + ++K+  L+E   Y F+V 
Sbjct: 21971 TWDPPLLDGGSKIKNYIVEKRESTR----KAYSTVATNCHKTSWKVDQLQEGCSYYFRVL 22026

Query: 917   AMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTG 976
             A N  G+G P+  +E  K  E     P PP  +   +V ++S+ L W+ P H G + + G
Sbjct: 22027 AENEYGIGLPAETAESVKASER----PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILG 22082

Query: 977   YFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGP 1036
             Y V+++   +  D+W     A +K     + GL +G  Y FRV A N+ G+  P  L+ P
Sbjct: 22083 YIVEMQTKGS--DKWATC--ATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVP 22138

Query: 1037  VVAETR--PGTKEVVVNV-----DDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLE 1089
             V+A+    P   +++ N       +D  + + F   + TP    +W KD V  + + R+ 
Sbjct: 22139 VIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPF-IGRPTPA--VTWHKDNVPLKQTTRVN 22195

Query: 1090  VESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVP 1149
              ES  N + +T KD   +D+G Y   +T++ G A        E   ++ L      PT P
Sbjct: 22196 AESTENNSLLTIKDACREDVGHYVVKLTNSAGEAI-------ETLNVIVLDKPGP-PTGP 22247

Query: 1150  VKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1187
             VK +   E+        W   +   G++  NYI  +++
Sbjct: 22248 VKMD---EVTADSITLSWGPPKYDGGSSINNYIVEKRD 22282



 Score =  204 bits (519), Expect = 6e-52
 Identities = 178/675 (26%), Positives = 276/675 (40%), Gaps = 94/675 (13%)

Query: 405   IHFDDKF-DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGE 463
             +  D KF DV   + GE + +   +   P      P I W ++G+ +      + + +  
Sbjct: 25789 VMMDVKFRDVIVVKAGEVLKINADIAGRP-----LPVISWAKDGIEIEERARTEIISTDN 25843

Query: 464   RATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANK 523
                LT     + D G Y + ++        +    V D      G PA PL++  L A K
Sbjct: 25844 HTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKP----GPPAGPLEINGLTAEK 25899

Query: 524   DYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFR 583
                 +SW +P  DGG+ I  Y ++K E    +W+ C +  ++     VT L++G  YIFR
Sbjct: 25900 --CSLSWGRPQEDGGADIDYYIVEKRETSHLAWTIC-EGELQMTSCKVTKLLKGNEYIFR 25956

Query: 584   VRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTD 643
             V  VNK G+G P   S  + ALDP                             VP PPT 
Sbjct: 25957 VTGVNKYGVGEPLE-SVAIKALDPFT---------------------------VPSPPTS 25988

Query: 644   LSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDL 702
             L +T  T+  + L W +P    G E   Y +E+ E  +  W RVN + PV   R     L
Sbjct: 25989 LEITSVTKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKK-PVYDLRVKSTGL 26047

Query: 703   AEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES 762
              EG  Y +RV   N+AG+  PSE + +    D + +P  P K     +  T++ ++W + 
Sbjct: 26048 REGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKP 26107

Query: 763   --KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLS 820
                    + GY +E   +    W+  +   ++G+ +T  GL TG  Y+FRV++VN  G S
Sbjct: 26108 LFDGGAPITGYTVEYKKSDDTDWK-TSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGAS 26166

Query: 821   EYSQDSEAIEVKAAIAPPSPPCD--------------ITCLESFRDSMV--LGWKQPDKI 864
             + S  S+    K     P    D               T    FR   V  + W +PD  
Sbjct: 26167 DPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDT- 26225

Query: 865   GGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLG 924
                      +  R  +D              S  +  I N   N   ++ +   N+    
Sbjct: 26226 --------DLRTRAYVDTTD-----------SRTSLTIENANRNDSGKYTLTIQNVLSAA 26266

Query: 925   APSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEA 984
             + + V +        +  PGPP ++   +V K+S VL W  P + G  PV  Y ++ +EA
Sbjct: 26267 SLTLVVK-------VLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKREA 26319

Query: 985   KAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPG 1044
               K   W  +     +  Y KV  L+EG  Y FRV   N+ GVG P++    V    +P 
Sbjct: 26320 SKK--AWVSVTNNCNRLSY-KVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVKITEKPS 26376

Query: 1045  TKEV--VVNVDDDGV 1057
               E   V ++  D V
Sbjct: 26377 PPEKLGVTSISKDSV 26391



 Score =  204 bits (519), Expect = 6e-52
 Identities = 179/742 (24%), Positives = 308/742 (41%), Gaps = 84/742 (11%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P  P + +  +  +  + ++W  P  +GGS + GY I+  +V    W++CN TP K   +
Sbjct: 30033 PGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREY 30092

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              +T L +G  Y FRV A N  G G P+ V   V   +  E    +              +
Sbjct: 30093 TLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYE-------------LD 30139

Query: 630   EEPSEGIV--PGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVN 687
             E   EGI    G    L++    + + +  W   GQ   +  M    +           +
Sbjct: 30140 ERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSE----------TH 30189

Query: 688   TELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAP-GKII 746
             TEL +K       +   G S  + +   N  G  + +   +V V+G     P +P G + 
Sbjct: 30190 TELVIK-------EADRGDSGTYDLVLENKCG--KKAVYIKVRVIGS----PNSPEGPLE 30236

Query: 747   PSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTG 804
                    SV VSW    D    +++GY +E        W   ++  V+G+     GL   
Sbjct: 30237 YDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSR-VRGTSLVVKGLKEN 30295

Query: 805   QSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDIT-CLESFRDSMVLGWKQPDK 863
               Y FRV A N  G+S+  +  E +  K  + PP PP +    L+  + S+ L W +P  
Sbjct: 30296 VEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKD 30355

Query: 864   IGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 923
              GG+ +TGYY+  +E       KW   N   ++   Y ++ L  +  YQF++ A N  GL
Sbjct: 30356 DGGSRVTGYYIERKETSTD---KWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGL 30412

Query: 924   GAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE 983
                S  SE   C++     P  P  L+   + KDS+ LQW+ P   G   + GY+V+ ++
Sbjct: 30413 SETSPASEPVVCKD-PFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQ 30471

Query: 984   AKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPV----VA 1039
               + +  W+  N+  IK+    + GL E   Y FRV A N+ G+ +P   A  +     +
Sbjct: 30472 --SGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTS 30529

Query: 1040  ETRPGTKEVVVNVDDDGVISLNFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKGNKTK 1098
                PG ++ + +V      +    C  +  P  +  W +       S + ++ S G    
Sbjct: 30530 GEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHT 30589

Query: 1099  MTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVK------- 1151
             +T      +D G+Y+C       IA++ + + E   +LL  +     P  P+K       
Sbjct: 30590 LTVMTEEQEDEGVYTC-------IATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAV 30642

Query: 1152  -SELAVEILEKGQ---VRFWMQAEKLSGNAKVNYIFNEKEI-----------FEGPKYKM 1196
              S L + ++  G+      W   +KL  N++   I N +                 KYK+
Sbjct: 30643 GSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKV 30702

Query: 1197  HIDRNTGIIEMFME-KLQDEDE 1217
              +    G ++  ++ ++QD+ +
Sbjct: 30703 QLSNVFGTVDAILDVEIQDKPD 30724



 Score =  204 bits (518), Expect = 7e-52
 Identities = 183/705 (25%), Positives = 300/705 (42%), Gaps = 98/705 (13%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVK-FAR 568
             P AP      E  KD  +++W +P  DGG PI  Y ++K E  +  W++    P+  + +
Sbjct: 17012 PDAPDQPIVTEVTKDSALVTWNKPH-DGGKPITNYILEKRETMSKRWARVTKDPIHPYTK 17070

Query: 569   FPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVT 628
             F V  L+EG  Y FRV A N++GIG PS  S+PV A DP  K                  
Sbjct: 17071 FRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAK------------------ 17112

Query: 629   EEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVN 687
                      P PP +    + T + V L+W+PP   G   I+ Y VE  + G E W+R N
Sbjct: 17113 ---------PSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRAN 17163

Query: 688   TELPVKSP--RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKI 745
                P   P  ++ +  L +G++Y FRV   N+AG  +P+   E  +V D+L+ P+     
Sbjct: 17164 -HTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPE----- 17217

Query: 746   IPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSG------KWEPCNNN-PVK------ 792
                      +++    +++    VG  +  S    G       W+  + + P K      
Sbjct: 17218 ---------LILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVT 17268

Query: 793   --GSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAP-PSPPCDITCLES 849
               GS+            I+ +   N AG       S+ + VK  +   P PP D+   E 
Sbjct: 17269 PVGSKLEIRNAAHEDGGIYSLTVENPAG-------SKTVSVKVLVLDKPGPPRDLEVSEI 17321

Query: 850   FRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENM 909
              +DS  L WK+P   GG+ IT Y V  R+V      +W   +  +  ++++   +L E  
Sbjct: 17322 RKDSCYLTWKEPLDDGGSVITNYVVERRDVASA---QWSPLSATS-KKKSHFAKHLNEGN 17377

Query: 910   VYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHS 969
              Y F+VAA N  G G      +  K  +  +  PGPP  L   +V K  + L W  P   
Sbjct: 17378 QYLFRVAAENQYGRGPFVETPKPIKALD-PLHPPGPPKDLHHVDVDKTEVSLVWNKPDRD 17436

Query: 970   GRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGK 1029
             G +P+TGY V+ +E   ++  W  +    + N+   V GL++G +Y FRV+A N  G+G 
Sbjct: 17437 GGSPITGYLVEYQEEGTQD--W--IKFKTVTNLECVVTGLQQGKTYRFRVKAENIVGLGL 17492

Query: 1030  PSDLAGPVVAETR--PGTKEVVVNVDDDGVISLNFECD-----KMTPKSEFSWSKDYVST 1082
             P D   P+  + +  P + E+ V + +  V+            +  P     W+ D    
Sbjct: 17493 P-DTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEI 17551

Query: 1083  EDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHE 1142
             +      VE+    + +T K+    D G Y   V++  G         + +   L +   
Sbjct: 17552 KTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAG--------SKTVAVHLTVLDV 17603

Query: 1143  HKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1187
                PT P+     +++  +     W   +   G+  +NYI  +++
Sbjct: 17604 PGPPTGPIN---ILDVTPEHMTISWQPPKDDGGSPVINYIVEKQD 17645



 Score =  203 bits (517), Expect = 9e-52
 Identities = 188/683 (27%), Positives = 288/683 (42%), Gaps = 141/683 (20%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P  P  +  ++  K ++ + W+ P  DGG PI  Y I+K E     W +   T      F
Sbjct: 14184 PGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNF 14243

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              VT +IEG    F+VRA N+ G+G PS  +E ++  DP                      
Sbjct: 14244 RVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSP------------------- 14284

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNT 688
                     P PP DL VT+A R ++ ++WKPP + G   I+ Y VE C  GTE W RVN+
Sbjct: 14285 --------PSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNS 14336

Query: 689   ELPVKSPRFALFD-LAEGKSYCFRVRCSNSAGVGEPSEATE------------------- 728
               P+K  +F + + +   K Y  RVR  N+ GV EPSE +E                   
Sbjct: 14337 R-PIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHD 14395

Query: 729   -VTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCN 787
              + + G+KL IP  P + +P         VSW   KD KE     ++AS          +
Sbjct: 14396 IIVIEGEKLSIP-VPFRAVPVPT------VSWH--KDGKE-----VKAS----------D 14431

Query: 788   NNPVKGSRFTCH----GLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCD 843
                +K    + H      V   + I+ +   N  G +  S     I VK  I  P P  D
Sbjct: 14432 RLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATAS-----INVKV-IGLPGPCKD 14485

Query: 844   ITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEE---AY 900
             I   +  + S  L W+ P+  GG  I  Y +  RE         R   +  +S E   ++
Sbjct: 14486 IKASDITKSSCKLTWEPPEFDGGTPILHYVLERREA-------GRRTYIPVMSGENKLSW 14538

Query: 901   KISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAV-----PGPPHSLKCSEVR 955
              + +L  N  Y F+V A+N  G G      E  + +   IA      P PP  ++     
Sbjct: 14539 TVKDLIPNGEYFFRVKAVNKVGGG------EYIELKNPVIAQDPKQPPDPPVDVEVHNPT 14592

Query: 956   KDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSY 1015
              +++ + WKPP++ G + + GY ++ K AK  E++W+  NE  +  +    +GL+EG  Y
Sbjct: 14593 AEAMTITWKPPLYDGGSKIMGYIIE-KIAKG-EERWKRCNEHLVPILTYTAKGLEEGKEY 14650

Query: 1016  VFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVV----VNVDDDGVISLNFECDKMTPKS 1071
              FRVRA N AG+ +PS    P  A       +V+    + V     I+L+      +P  
Sbjct: 14651 QFRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDASISG-SPYP 14709

Query: 1072  EFSWSKD----------------------YVSTED------SPRLEVE-SKGNKTKMTFK 1102
               +W KD                       V  E+      + RL ++ SK  ++++  +
Sbjct: 14710 TITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVR 14769

Query: 1103  DLGMDDLGIYSCDVTDTDGIASS 1125
             D    D G+Y   V +  GIA +
Sbjct: 14770 DSLRPDHGLYMIKVENDHGIAKA 14792



 Score =  203 bits (516), Expect = 1e-51
 Identities = 196/779 (25%), Positives = 311/779 (39%), Gaps = 124/779 (15%)

Query: 277   PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
             P   +   ++++   E++K+   + G P P ++W K+  P+       +  +E       
Sbjct: 24312 PSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLK---QTTRVNVEETATSTV 24368

Query: 337   LEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTP 396
             L I   + +D  +Y  +A N  G  +   SV+V    G                     P
Sbjct: 24369 LHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPG--------------------PP 24408

Query: 397   YGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWV 456
              G     E+  D    V    E    + GC++      K       W+     ++     
Sbjct: 24409 VGPVRFDEVSAD---FVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVA----- 24460

Query: 457   QTLWSGERATLTFSHLNKEDEGLYTIRV----RMGEYYEQYSAYVFVRDADAEIEGAPAA 512
                    R T+  + L    E  Y  R+    R G+     S  V V+    E  G P  
Sbjct: 24461 -------RTTIKITKLKTGTE--YQFRIFAENRYGKSAPLDSKAVIVQYPFKE-PGPPGT 24510

Query: 513   PLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVT 572
             P        +KD +++ W +P  DGG+ I+GY +++ E  +  W + N TP++  +F  T
Sbjct: 24511 PF---VTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTT 24567

Query: 573   GLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEP 632
             GL EG  Y F+V A N +GIG PS+VSE   A DP +                       
Sbjct: 24568 GLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDP---------------------- 24605

Query: 633   SEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELP 691
                  PG P  + +   TR+ V L WK P   G   I  Y VEK +     W + +    
Sbjct: 24606 -----PGRPEAIVI---TRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASF-TN 24656

Query: 692   VKSPRFALFDLAEGKSYCFRVRCSNSAG-VGEPSEATEVTVVGDKLDIPKAPGKIIPSRN 750
             V    F +  L E + Y FRV   N+AG   EPS+++      D++D P A    +  + 
Sbjct: 24657 VLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNAS---LDPKY 24713

Query: 751   TDTSVVVSWEE-----------------SKDAKELVGYYIEASVAGSGKWEPCNNNPVKG 793
              D  VV + E                  SKD KEL        +           + ++ 
Sbjct: 24714 KDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEI----------KSTIQK 24763

Query: 794   SRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDS 853
             +       +      + ++  N  G          ++V     PP  P  +T + +  + 
Sbjct: 24764 TTLVVKDCIRTDGGQYILKLSNVGGTKSI---PITVKVLDRPGPPEGPLKVTGVTA--EK 24818

Query: 854   MVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQF 913
               L W  P + GGA I+ Y +  RE        W + + + V    YK++ L     Y F
Sbjct: 24819 CYLAWNPPLQDGGANISHYIIEKRET---SRLSWTQVSTE-VQALNYKVTKLLPGNEYIF 24874

Query: 914   QVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTP 973
             +V A+N  G+G P        C  +    PGPP + + S + KDS+V+ W  PV  G T 
Sbjct: 24875 RVMAVNKYGIGEPLESGPVTACNPY--KPPGPPSTPEVSAITKDSMVVTWARPVDDGGTE 24932

Query: 974   VTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSD 1032
             + GY ++ ++ +    +W   N+  + ++ L+V GL EG SY FRV A N AGVG+PS+
Sbjct: 24933 IEGYILEKRDKEGV--RWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSE 24989



 Score =  202 bits (514), Expect = 2e-51
 Identities = 165/622 (26%), Positives = 276/622 (44%), Gaps = 66/622 (10%)

Query: 429   VITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGE 488
             ++ P   + + E +W++   PLS +K + T  + E+ +       K D+G Y I ++   
Sbjct: 13019 MVVPYDAYPKAEAEWFKENEPLS-TKTIDT--TAEQTSFRILEAKKGDKGRYKIVLQ--N 13073

Query: 489   YYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDK 548
              + +   ++ ++  D      P    +++  E     + ++W++P  DGGS I+GY +++
Sbjct: 13074 KHGKAEGFINLKVIDV-----PGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVER 13128

Query: 549   CEVGTDSWSQCNDTPVKFARFPVTGLIEGR-SYIFRVRAVNKMGIGFPSRVSEPVAALDP 607
              ++   +W    D   +   F VTGL +G   Y+FRV A N++G G P     PV     
Sbjct: 13129 RDIKRKTWVLATDR-AESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPV----- 13182

Query: 608   AEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHE 667
                                   E  S+  VPGPP ++++T+  R  V L+W+PP   G  
Sbjct: 13183 ----------------------EARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGA 13220

Query: 668   GIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEA 726
              I  Y +E  +  +  W    T +  +     + D+ EG+ Y FRVR  N  GVG+PS A
Sbjct: 13221 EITNYVIELRDKTSIRWDTAMT-VRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAA 13279

Query: 727   TEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES-KDA-KELVGYYIEASVAGSGKWE 784
             T    V D ++ P  P  +  S  T +SV + WE   KD    ++GY IE    G   W 
Sbjct: 13280 TPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWI 13339

Query: 785   PCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDI 844
              CN   V    +   GL  G  Y++RV A N AG+S+ S+    +    A   P+     
Sbjct: 13340 RCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMD--- 13396

Query: 845   TCLESFRDSMVLGWKQPDKI-----GGAEITGYYVNYREVIDGVPGKWREANVKAVSEEA 899
               L +F+D + +    P  I     G    T  +    +V++    + +   + A +E  
Sbjct: 13397 --LSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLE-TGDRVKMKTLSAYAELV 13453

Query: 900   YKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSL 959
                S   +  +Y  ++        G         + +   IA P  P  LK  ++ KDS+
Sbjct: 13454 ISPSERSDKGIYTLKLENRVKTISG---------EIDVNVIARPSAPKELKFGDITKDSV 13504

Query: 960   VLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRV 1019
              L W+PP   G +P+TGY V+ +E   K   W  + +  + ++   V  L +G  Y+F+V
Sbjct: 13505 HLTWEPPDDDGGSPLTGYVVEKREVSRK--TWTKVMD-FVTDLEFTVPDLVQGKEYLFKV 13561

Query: 1020  RAINQAGVGKPSDLAGPVVAET 1041
              A N+ G G+P+ +  PV   T
Sbjct: 13562 CARNKCGPGEPAYVDEPVNMST 13583



 Score =  202 bits (513), Expect = 3e-51
 Identities = 175/684 (25%), Positives = 289/684 (42%), Gaps = 72/684 (10%)

Query: 519   LEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGR 578
             L   +  + + W +P   GG  I  Y ++K ++    W + N + +    F V+GL E  
Sbjct: 21366 LNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDA 21425

Query: 579   SYIFRVRAVNKMG-IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIV 637
             +Y FRV A N  G I  PS  S+ +   D  E  ++K       T  +   E    E  V
Sbjct: 21426 AYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADV 21485

Query: 638   PG--PPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSP 695
              G  PPT             + W   G+                 E   ++  ++   S 
Sbjct: 21486 SGRPPPT-------------MEWSKDGKE---------------LEGTAKLEIKIADFST 21517

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAP-GKIIPSRNTDTS 754
                  D     S  + +  +N  G  +     +V      LD P  P G +  +  T   
Sbjct: 21518 NLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKV------LDRPGPPEGPLAVTEVTSEK 21571

Query: 755   VVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVR 812
              V+SW    D    ++  Y ++        W    +  V+ ++     L+ G  YIFRV 
Sbjct: 21572 CVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASE-VQVTKLKVTKLLKGNEYIFRVM 21630

Query: 813   AVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGY 872
             AVN  G+ E   +SE +       PP PP +       +DSMV+ W  PD  GG+EI  Y
Sbjct: 21631 AVNKYGVGE-PLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINY 21689

Query: 873   YVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSEC 932
              V  R   D    +W + N K +++  YK+S L E   Y+F++ A N AG+ APS  S  
Sbjct: 21690 IVERR---DKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPF 21746

Query: 933   FKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWR 992
             +K  + T+  PGPP + +  +  + S+ + W  P++ G + +TGY V++  A  +ED+W+
Sbjct: 21747 YKACD-TVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEI--ALPEEDEWQ 21803

Query: 993   GLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVN 1051
              +   A +K     + GL E   Y  R+ A+N  G+G+P+ + G   AE R    E+ ++
Sbjct: 21804 IVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELD 21863

Query: 1052  VDDDGVISLNFECD-------KMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDL 1104
              D   V+++   C        K  P  E  W++D+  + D  +  +ES  + T +   ++
Sbjct: 21864 ADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLD--KASIESTSSYTLLIVGNV 21921

Query: 1105  GMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQV 1164
                D G Y   V ++ G  S+++             +     T     +L V+ + K  V
Sbjct: 21922 NRFDSGKYILTVENSSGSKSAFV-------------NVRVLDTPGPPQDLKVKEVTKTSV 21968

Query: 1165  RFWMQAEKLSGNAKV-NYIFNEKE 1187
                     L G +K+ NYI  ++E
Sbjct: 21969 TLTWDPPLLDGGSKIKNYIVEKRE 21992



 Score =  201 bits (510), Expect = 6e-51
 Identities = 176/628 (28%), Positives = 265/628 (42%), Gaps = 84/628 (13%)

Query: 508   GAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFA 567
             G P  P   +     K+   +SWK+P  DGGS I GY +++ E  +  W +   TPV   
Sbjct: 20570 GPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDL 20629

Query: 568   RFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIV 627
             R  VTGL EG +Y FRV A N+ GIG PS  S+ V   D A                   
Sbjct: 20630 RCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYP----------------- 20672

Query: 628   TEEEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRV 686
                       PGPP++  VT+ T+    L+W KP    G E   Y VE  + G E W + 
Sbjct: 20673 ----------PGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKD 20722

Query: 687   NTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKII 746
              T   ++  +F + DL   + Y FR+   N AGVGEP+   +V +V  ++    AP   +
Sbjct: 20723 TTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREM----APDFEL 20778

Query: 747   PSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSR------FT--- 797
              +    T VV +    +     +   I+   A    W   N N    +       FT   
Sbjct: 20779 DAELRRTLVVRAGLSIR-----IFVPIKGRPAPEVTWTKDNINLKNRANIENTESFTLLI 20833

Query: 798   ---CHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSM 854
                C+   TG+   F +   N AG     + S  + V+  +  P P  ++   +  +DS+
Sbjct: 20834 IPECNRYDTGK---FVMTIENPAG-----KKSGFVNVRV-LDTPGPVLNLRPTDITKDSV 20884

Query: 855   VLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQ 914
              L W  P   GG+ IT Y V  RE        +  A  K   +  YK++ L E   Y F+
Sbjct: 20885 TLHWDLPLIDGGSRITNYIVEKREA---TRKSYSTATTKC-HKCTYKVTGLSEGCEYFFR 20940

Query: 915   VAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPV 974
             V A N  G+G P+  +E  K  E     P PP SL   ++ K ++ L W  P H G + +
Sbjct: 20941 VMAENEYGIGEPTETTEPVKASE----APSPPDSLNIMDITKSTVSLAWPKPKHDGGSKI 20996

Query: 975   TGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLA 1034
             TGY ++ +  +   DQW  +    +K +   VR L EG  Y F+V A+N AG   P + +
Sbjct: 20997 TGYVIEAQ--RKGSDQWTHI--TTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRE-S 21051

Query: 1035  GPVVAETRPGTKE----------VVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTED 1084
              PV+ + +    E          V+    D+  + +        PK   +W K     + 
Sbjct: 21052 RPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPV---LGRPKPTVTWKKGDQILKQ 21108

Query: 1085  SPRLEVESKGNKTKMTFKDLGMDDLGIY 1112
             + R+  E+    T +   +    D G Y
Sbjct: 21109 TQRVNFETTATSTILNINECVRSDSGPY 21136



 Score =  200 bits (508), Expect = 1e-50
 Identities = 160/609 (26%), Positives = 255/609 (41%), Gaps = 68/609 (11%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P + W +    L    +V T  +  R +LT  + N+ D G YT+ ++        +  V 
Sbjct: 26216 PNVLWSKPDTDLRTRAYVDT--TDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVK 26273

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V D        P  P ++   +  K+  ++SW  P  DGG+P+  Y I+K E    +W  
Sbjct: 26274 VLDT-------PGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKREASKKAWVS 26326

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
               +   + + + VT L EG  Y FRV   N+ G+G P+   E V                
Sbjct: 26327 VTNNCNRLS-YKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVK--------------- 26370

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCE 677
                     +TE+       P PP  L VT  ++  V L+W KP    G   + Y VE  E
Sbjct: 26371 --------ITEK-------PSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALE 26415

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
              G +NW +       KS    +  L E   Y FRV   N AG+ +P E     ++ ++L+
Sbjct: 26416 KGQKNWVKCAV---AKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLE 26472

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFT 797
              P+   K  PS    T  V +    K    + G  +   V  S    P        +  T
Sbjct: 26473 PPEIDMKNFPSH---TVYVRAGSNLKVDIPISGKPL-PKVTLSRDGVPLKATMRFNTEIT 26528

Query: 798   CHGL-------VTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESF 850
                L       VT  +  + + A N++G ++       I +     P  P   +   +  
Sbjct: 26529 AENLTINLKESVTADAGRYEITAANSSGTTK-----AFINIVVLDRPGPPTGPVVISDIT 26583

Query: 851   RDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMV 910
              +S+ L W+ P   GG+++T Y +  RE    V   W E +   V+    K+  L     
Sbjct: 26584 EESVTLKWEPPKYDGGSQVTNYILLKRETSTAV---WTEVSA-TVARTMMKVMKLTTGEE 26639

Query: 911   YQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSG 970
             YQF++ A N  G+     +       +     PGPP +   + V ++S+ + W  PV +G
Sbjct: 26640 YQFRIKAENRFGIS--DHIDSACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNG 26697

Query: 971   RTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKP 1030
              + V GY +++K+  +    W+  N+  I+  + KV  +  G+ Y FRV A N AGVGKP
Sbjct: 26698 GSAVVGYHLEMKDRNS--ILWQKANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVGKP 26755

Query: 1031  SDLAGPVVA 1039
             S  + PV+A
Sbjct: 26756 SHPSEPVLA 26764



 Score =  199 bits (505), Expect = 2e-50
 Identities = 216/935 (23%), Positives = 382/935 (40%), Gaps = 106/935 (11%)

Query: 523   KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIF 582
             ++ I + W +P  DGGS I GY ++K ++    W + + T V   +F V+GL E + Y F
Sbjct: 23534 RNEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEF 23593

Query: 583   RVRAVNKMG-IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPP 641
             RV A N  G I  PS  + P+ A D  E  R+   P    T  +   E    E  V G P
Sbjct: 23594 RVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKP 23653

Query: 642   TDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFD 701
                           + W    +   E       +CE    +++ +   L VK        
Sbjct: 23654 LP-----------TIEWLRGDKEIEESA-----RCEIKNTDFKAL---LIVKDAI----- 23689

Query: 702   LAEGKSYCFRVRCSNSAGVGEPSEATEVTV-VGDKLDIPKAPGKIIPSRNTDTSVVVSWE 760
               +G  Y   +R SN AG    S++  V V V D+   P+ P ++    +   S+  S  
Sbjct: 23690 RIDGGQYI--LRASNVAG----SKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPP 23743

Query: 761   ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLS 820
                   ++  Y +E        W    +  V  S      L+ G  Y+FR+ AVN  G+ 
Sbjct: 23744 LQDGGSDISHYVVEKRETSRLAWTVVASEVVTNS-LKVTKLLEGNEYVFRIMAVNKYGVG 23802

Query: 821   EYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVI 880
             E   +S  + +K     P PP  +      +DSM + W +PD  GG+EI GY V  R+  
Sbjct: 23803 E-PLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDR- 23860

Query: 881   DGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTI 940
              G+  +W + N + +++   +++ L E+  Y+F+V+A N AG+G PS  +  +K  +  +
Sbjct: 23861 SGI--RWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACD-PV 23917

Query: 941   AVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN-EAAI 999
               PGPP +    +  K+S+ L W  P++ G + + GY V++   KA E++W+ +  +  +
Sbjct: 23918 FKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEI--CKADEEEWQIVTPQTGL 23975

Query: 1000  KNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKE----------VV 1049
             +    ++  L E   Y  RV A+N+ G+G+ + + G V  E +    E          +V
Sbjct: 23976 RVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIV 24035

Query: 1050  VNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDL 1109
             V       I + F   K  P  E +WS++    E + ++++E   N T+++  +   +D 
Sbjct: 24036 VRAGGSARIHIPF---KGRPTPEITWSRE--EGEFTDKVQIEKGVNYTQLSIDNCDRNDA 24090

Query: 1110  GIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQ 1169
             G Y   + ++ G  S+++  +                T      LAV+ + K       +
Sbjct: 24091 GKYILKLENSSGSKSAFVTVK-------------VLDTPGPPQNLAVKEVRKDSAFLVWE 24137

Query: 1170  AEKLSGNAKV-NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGK 1228
                + G AKV NY+ +++E     K   ++          +E L   +   Y F++    
Sbjct: 24138 PPIIDGGAKVKNYVIDKRE--STRKAYANVSSKCSKTSFKVENL--TEGAIYYFRVMAEN 24193

Query: 1229  ATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIK 1288
                    V   D  K  +               P     ++     + +  L  +     
Sbjct: 24194 EFGVGVPVETVDAVKAAEP--------------PSPPGKVTLTDVSQTSASLMWEKPEHD 24239

Query: 1289  KETHIVWYKDEREISVDEKHDF--KDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLK 1346
               + ++ Y  E +    EK     +  +C  ++T  S      + V   +++GK   R+ 
Sbjct: 24240 GGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVL 24299

Query: 1347  LVDEAFKELMMEVCKKIAL------SATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNG 1400
              V    K+L ++   K+        +  DLKI+    G    +          ++W  +G
Sbjct: 24300 GVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPN----------ISWVKDG 24349

Query: 1401  SAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVM 1435
               ++ + RV    T     L I E   +D GKY +
Sbjct: 24350 EPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTV 24384



 Score =  198 bits (503), Expect = 4e-50
 Identities = 166/618 (26%), Positives = 260/618 (42%), Gaps = 78/618 (12%)

Query: 526   IIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQC-NDTPVKFARFPVTGLIEGRSYIFRV 584
             I ++W +P  DGGS I  Y +++ E  +  W +  +  P+   RF VTGL EG  Y F V
Sbjct: 28168 ITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHV 28227

Query: 585   RAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDL 644
              A N  G+G  S +S  +   +P                              PGPPT +
Sbjct: 28228 MAENAAGVGPASGISRLIKCREPVNP---------------------------PGPPTVV 28260

Query: 645   SVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLA 703
              VT+ +++ V L W KP    G E I Y +E C+A   +W +VN E  VK+ R+ + DL 
Sbjct: 28261 KVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKT-RYTVTDLQ 28319

Query: 704   EGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESK 763
              G+ Y FRV   N AG G+  E T      D+L  P+     I +    T VV       
Sbjct: 28320 AGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELD---IDANFKQTHVV---RAGA 28373

Query: 764   DAKELVGYYIEASVAGSGKW-EPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEY 822
               +  + Y  +     +  W +P +N  ++    T     T       V   N     +Y
Sbjct: 28374 SIRLFIAY--QGRPTPTAVWSKPDSNLSLRADIHTTDSFST-----LTVENCNRNDAGKY 28426

Query: 823   SQDSEAIEVKAAIA-------PPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVN 875
             +   E      +I         P PP  IT  +  R S  L W  P   GGA I  Y V 
Sbjct: 28427 TLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVE 28486

Query: 876   YREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKC 935
              RE        W+  + K  + + +K+++L E + Y F+V+A+N  G+G P  + E    
Sbjct: 28487 KRE---ASRRSWQVISEKC-TRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVA 28542

Query: 936   EEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN 995
              E     P PP  L   +  K S VL W  P H G + +TGY +++++  +  D W  + 
Sbjct: 28543 TE----QPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGS--DFW--VE 28594

Query: 996   EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDD 1055
                 K +   V  L E   Y FRV+A N AG  +P +    V+ +      ++    D  
Sbjct: 28595 AGHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIK----EPQIEPTADLT 28650

Query: 1056  GVISLNFECDKMT-----------PKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDL 1104
             G+ +    C   +           P  + +W  + +  +++ R+ + +  ++T +T KD 
Sbjct: 28651 GITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDS 28710

Query: 1105  GMDDLGIYSCDVTDTDGI 1122
                D G Y   + +T G+
Sbjct: 28711 MRGDSGRYFLTLENTAGV 28728



 Score =  196 bits (499), Expect = 1e-49
 Identities = 180/631 (28%), Positives = 266/631 (42%), Gaps = 87/631 (13%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRV--RMGEYYEQYSAY 496
             P++ W + G+     K    L     A L   +  ++D G Y++ +    GE     + +
Sbjct: 18636 PKVTWRKVGIDNVVRKGQVDLVD-TMAFLVIPNSTRDDSGKYSLTLVNPAGEK----AVF 18690

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
             V VR  D      P    D+K  +  K    +SW  P  DGGS +  Y ++K E    +W
Sbjct: 18691 VNVRVLDT-----PGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTW 18745

Query: 557   SQCNDTP-VKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKS 615
             S    TP VK   F VT L+ G  Y FRV AVN+ G G P+ V +PV A DP  +     
Sbjct: 18746 STV--TPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPLSE----- 18798

Query: 616   RPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEK 675
                                   P PP  L VTE T++   L+W PP + G   I  ++  
Sbjct: 18799 ----------------------PDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITS 18836

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
                  +   R      VK     +  L EGK Y FRV   N+ GV  P EA  V    ++
Sbjct: 18837 YREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQ 18896

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAG----SGKWEPCNNNPV 791
             L  PK    ++P + T           K  K+L    IEA V G    + KW+   +  V
Sbjct: 18897 LLPPKI---LMPEQIT----------IKAGKKL---RIEAHVYGKPHPTCKWKKGEDEVV 18940

Query: 792   KGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSE----------AIEVKAAIAPPSPP 841
               S    H      S I  ++ V       YS  +E           + V  A  PP PP
Sbjct: 18941 TSSHLAVH--KADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPP 18998

Query: 842   CDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYK 901
              DI+ +++  D+  L W  P + GG+ IT Y V   E  D   G W  A + +V++ + +
Sbjct: 18999 FDISDIDA--DACSLSWHIPLEDGGSNITNYIV---EKCDVSRGDWVTA-LASVTKTSCR 19052

Query: 902   ISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVL 961
             +  L     Y F+V A N  G+  P  ++      ++   VP  P + + ++V KD + +
Sbjct: 19053 VGKLIPGQEYIFRVRAENRFGISEP--LTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFV 19110

Query: 962   QWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRA 1021
              W  P   G +P+ GY ++ KE  +    W   N+  +++      GL EG+ Y FR+ A
Sbjct: 19111 AWDRPDSDGGSPIIGYLIERKERNSL--LWVKANDTLVRSTEYPCAGLVEGLEYSFRIYA 19168

Query: 1022  INQAGVGKPSDLAGPVVAE---TRPGTKEVV 1049
             +N+AG   PS     V A      PG  EV+
Sbjct: 19169 LNKAGSSPPSKPTEYVTARMPVDPPGKPEVI 19199



 Score =  196 bits (499), Expect = 1e-49
 Identities = 171/629 (27%), Positives = 261/629 (41%), Gaps = 81/629 (12%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             PE+ W ++ + L     ++   S     L     N+ D G + + +       + S +V 
Sbjct: 20806 PEVTWTKDNINLKNRANIENTESF--TLLIIPECNRYDTGKFVMTIENPA--GKKSGFVN 20861

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             VR  D      P   L+++  +  KD + + W  P +DGGS I  Y ++K E    S+S 
Sbjct: 20862 VRVLDT-----PGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYST 20916

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
                T      + VTGL EG  Y FRV A N+ GIG P+  +EPV A +            
Sbjct: 20917 AT-TKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASE------------ 20963

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                                P PP  L++ + T+S V L+W  P   G   I  Y +E   
Sbjct: 20964 ------------------APSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQR 21005

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
              G++ W  + T   VK     + +L EG+ Y F+V   NSAG   P E+  V +V ++  
Sbjct: 21006 KGSDQWTHITT---VKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRPV-IVKEQTM 21061

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGK----WEPCNNNPVKG 793
             +P+     +  R     +V+       AK      +E  V G  K    W+  +    + 
Sbjct: 21062 LPE-----LDLRGIYQKLVI-------AKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQT 21109

Query: 794   SRFTCHGLVTGQSYIFRVRAVNAAGLSEY--------SQDSEAIEVKAAIAPPSPPCDIT 845
              R       T  S I  +     +    Y         +  + I ++    P  P   I 
Sbjct: 21110 QRVNFE--TTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIK 21167

Query: 846   CLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNL 905
               E   D +   W  P+  GG  I+ Y V  R+        W E     V    YK + L
Sbjct: 21168 FDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTT---WVEL-ATTVIRTTYKATRL 21223

Query: 906   KENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKP 965
                + YQF+V A N  G+G P   S C     +   VPGPP + + + V KDS+ + W  
Sbjct: 21224 TTGLEYQFRVKAQNRYGVG-PGITSACI-VANYPFKVPGPPGTPQVTAVTKDSMTISWHE 21281

Query: 966   PVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQA 1025
             P+  G +P+ GY V+ KE       W+ +++A +     K  GL +G++Y FRV A N A
Sbjct: 21282 PLSDGGSPILGYHVERKERNG--ILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMA 21339

Query: 1026  GVGKPSDLAGPVVA--ETRPGTKEVVVNV 1052
             G  KPS  + P++A     P  K V +N+
Sbjct: 21340 GKSKPSKPSEPMLALDPIDPPGKPVPLNI 21368



 Score =  195 bits (496), Expect = 3e-49
 Identities = 220/853 (25%), Positives = 345/853 (40%), Gaps = 123/853 (14%)

Query: 293   NVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRA 352
             + ++H    G P P +TW + +          K  IE       L I+ CD  D  +Y  
Sbjct: 24041 SARIHIPFKGRPTPEITWSREEGEFT-----DKVQIEKGVNYTQLSIDNCDRNDAGKYIL 24095

Query: 353   SAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFD 412
                N  G  SA+ +V V    G                     P   A + E+  D  F 
Sbjct: 24096 KLENSSGSKSAFVTVKVLDTPGP--------------------PQNLAVK-EVRKDSAF- 24133

Query: 413   VSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHL 472
                            +V  P I     +++ Y      S  K    + S + +  +F   
Sbjct: 24134 ---------------LVWEPPIIDGGAKVKNYVIDKRESTRKAYANV-SSKCSKTSFKVE 24177

Query: 473   NKEDEGLYTIRVRMGEYYEQYSAYVFVRDADA-EIEGAPAAPLDVKCLEANKDYIIISWK 531
             N  +  +Y  RV M E   ++   V V   DA +    P+ P  V   + ++    + W+
Sbjct: 24178 NLTEGAIYYFRV-MAE--NEFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASLMWE 24234

Query: 532   QPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMG 591
             +P  DGGS +LGY ++    GT+ WS   ++  K     VTGL  G+ Y FRV+A N+ G
Sbjct: 24235 KPEHDGGSRVLGYVVEMQPKGTEKWSIVAES--KVCNAVVTGLSSGQEYQFRVKAYNEKG 24292

Query: 592   IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATR 651
                P  +  PV A D   +  LK     P+           +  I  G    + +    R
Sbjct: 24293 KSDPRVLGVPVIAKDLTIQPSLK----LPFN----------TYSIQAGEDLKIEIPVIGR 24338

Query: 652   SYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCF- 710
                 +SW   G+                 +   RVN E    S    +  + EG    F 
Sbjct: 24339 PRPNISWVKDGEP---------------LKQTTRVNVEETATS---TVLHIKEGNKDDFG 24380

Query: 711   --RVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTS---VVVSWEESK-- 763
                V  +NSAG    +E   V V    L+ P  P  + P R  + S   VV+SWE     
Sbjct: 24381 KYTVTATNSAGTA--TENLSVIV----LEKPGPP--VGPVRFDEVSADFVVISWEPPAYT 24432

Query: 764   DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYS 823
                ++  Y +E     +  W   +   V  +      L TG  Y FR+ A N  G S   
Sbjct: 24433 GGCQISNYIVEKRDTTTTTWHMVSAT-VARTTIKITKLKTGTEYQFRIFAENRYGKSA-P 24490

Query: 824   QDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGV 883
              DS+A+ V+     P PP         +D M++ W +P   GG +I GY++  +E    +
Sbjct: 24491 LDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSIL 24550

Query: 884   PGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVP 943
                W + N   + +  +K + L E + Y+F+V+A N+ G+G PS VSECF   +     P
Sbjct: 24551 ---WVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARD-PCDPP 24606

Query: 944   GPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVY 1003
             G P ++    + ++++ L+WK P + G + +TGY V+ K+    + +W   +   +    
Sbjct: 24607 GRPEAI---VITRNNVTLKWKKPAYDGGSKITGYIVEKKD--LPDGRWMKASFTNVLETE 24661

Query: 1004  LKVRGLKEGVSYVFRVRAINQAG-VGKPSDLAGPVVAETR---------PGTKEV-VVNV 1052
               V GL E   Y FRV A N AG   +PSD +G + A            P  K+V VV+ 
Sbjct: 24662 FTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHA 24721

Query: 1053  DDDGVISLNFECDKMTPKSEFSWSKDYVSTED-SPRLEVESKGNKTKMTFKDLGMDDLGI 1111
              +  V+  +    +  P  +  WSKD    E+ + R+E++S   KT +  KD    D G 
Sbjct: 24722 GETFVLEADI---RGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQ 24778

Query: 1112  YSCDVTDTDGIAS 1124
             Y   +++  G  S
Sbjct: 24779 YILKLSNVGGTKS 24791



 Score =  194 bits (494), Expect = 4e-49
 Identities = 217/923 (23%), Positives = 361/923 (39%), Gaps = 143/923 (15%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTL-EINGCDFEDTAQY 350
             E +K++  IAG P P ++W K+ + I   A       ++    HTL  +  C   DT QY
Sbjct: 25805 EVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDN----HTLLTVKDCIRRDTGQY 25860

Query: 351   RASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF-GVTPYGYASRFEIHFDD 409
               +  NV G  S   +  V       D+    AG    PL   G+T             +
Sbjct: 25861 VLTLKNVAGTRSVAVNCKV------LDKPGPPAG----PLEINGLTA------------E 25898

Query: 410   KFDVSFGREGET--MSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGE--RA 465
             K  +S+GR  E     +   +V   E  H    + W              T+  GE    
Sbjct: 25899 KCSLSWGRPQEDGGADIDYYIVEKRETSH----LAW--------------TICEGELQMT 25940

Query: 466   TLTFSHLNKEDEGLYTI----RVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEA 521
             +   + L K +E ++ +    +  +GE  E     V ++  D      P+ P  ++    
Sbjct: 25941 SCKVTKLLKGNEYIFRVTGVNKYGVGEPLES----VAIKALDPFT--VPSPPTSLEITSV 25994

Query: 522   NKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYI 581
              K+ + + W +P  DGGS I GY I++ E  +  W + N  PV   R   TGL EG  Y 
Sbjct: 25995 TKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYE 26054

Query: 582   FRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPP 641
             +RV A N  G+  PS  S  + A DP                             +P PP
Sbjct: 26055 YRVYAENAAGLSLPSETSPLIRAEDPV---------------------------FLPSPP 26087

Query: 642   TDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALF 700
             +   + ++ ++ + ++W  P   G   I  Y VE  ++   +W+     L  +   + + 
Sbjct: 26088 SKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTSIQSL--RGTEYTIS 26145

Query: 701   DLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE 760
              L  G  Y FRV+  N  G  +PS++++  +  ++ + P      I S    T +V +  
Sbjct: 26146 GLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFD---IDSEMRKTLIVKA-- 26200

Query: 761   ESKDAKELVGYYIEASVAGSGKWEP--CNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAG 818
                      G     +V   G+  P    + P    R   +   T       +   N   
Sbjct: 26201 ---------GASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRTSLTIENANRND 26251

Query: 819   LSEYSQDSEAIEVKAAIA-------PPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITG 871
               +Y+   + +   A++         P PP +IT  +  ++S VL W  P+  GGA +  
Sbjct: 26252 SGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKN 26311

Query: 872   YYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSE 931
             Y++  RE        W        +  +YK++NL+E  +Y F+V+  N  G+G P+   E
Sbjct: 26312 YHIEKREASKKA---WVSVTNNC-NRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKE 26367

Query: 932   CFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQW 991
               K  E     P PP  L  + + KDS+ L W  P H G + +  Y V+  E   K   W
Sbjct: 26368 GVKITE----KPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKN--W 26421

Query: 992   RGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVN 1051
               +  A  K+ +  V GL+E   Y FRV A NQAG+  P +L  PV+ + +    E+ + 
Sbjct: 26422 --VKCAVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMK 26479

Query: 1052  VDDDGVISL----NFECD---KMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDL 1104
                   + +    N + D      P  + + S+D V  + + R   E       +  K+ 
Sbjct: 26480 NFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKES 26539

Query: 1105  GMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQV 1164
                D G Y     ++ G   +++        ++ L      P  P    +  +I E+   
Sbjct: 26540 VTADAGRYEITAANSSGTTKAFI-------NIVVLDR----PGPPTGPVVISDITEESVT 26588

Query: 1165  RFWMQAEKLSGNAKVNYIFNEKE 1187
               W   +   G+   NYI  ++E
Sbjct: 26589 LKWEPPKYDGGSQVTNYILLKRE 26611



 Score =  194 bits (492), Expect = 7e-49
 Identities = 176/650 (27%), Positives = 280/650 (43%), Gaps = 84/650 (12%)

Query: 432   PEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHL---NKEDEGLYTIRVR--M 486
             P I   +P I W ++G PL  +  V      E AT T  H+   NK+D G YT+      
Sbjct: 24334 PVIGRPRPNISWVKDGEPLKQTTRVNV---EETATSTVLHIKEGNKDDFGKYTVTATNSA 24390

Query: 487   GEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFI 546
             G   E  S  V       E  G P  P  V+  E + D+++ISW+ PA  GG  I  Y +
Sbjct: 24391 GTATENLSVIVL------EKPGPPVGP--VRFDEVSADFVVISWEPPAYTGGCQISNYIV 24442

Query: 547   DKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALD 606
             +K +  T +W   + T V      +T L  G  Y FR+ A N+ G               
Sbjct: 24443 EKRDTTTTTWHMVSAT-VARTTIKITKLKTGTEYQFRIFAENRYG--------------- 24486

Query: 607   PAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRG 665
                        SAP   + ++ +    E   PGPP    VT  ++  +++ W +P    G
Sbjct: 24487 ----------KSAPLDSKAVIVQYPFKE---PGPPGTPFVTSISKDQMLVQWHEPVNDGG 24533

Query: 666   HEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSE 725
              + I Y +E+ E  +  W ++N + P++  +F    L EG  Y F+V   N  G+G+PS+
Sbjct: 24534 TKIIGYHLEQKEKNSILWVKLN-KTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSK 24592

Query: 726   ATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKW 783
              +E  V  D  D P  P  I+ +RN   +V + W++       ++ GY +E      G+W
Sbjct: 24593 VSECFVARDPCDPPGRPEAIVITRN---NVTLKWKKPAYDGGSKITGYIVEKKDLPDGRW 24649

Query: 784   EPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIAPPSPPC 842
                +   V  + FT  GLV  Q Y FRV A NAAG  SE S  S AI  +  I  P+   
Sbjct: 24650 MKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASL 24709

Query: 843   DITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKI 902
             D      ++D +V+        G   +    +  + + D V  K  +   +  +    K 
Sbjct: 24710 D----PKYKDVIVV------HAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKS 24759

Query: 903   SNLKENMVYQFQVAA------MNMAGLGAPSAVSECFKCEEWTIAVPGPPHS-LKCSEVR 955
             +  K  +V +  +        + ++ +G   ++    K     +  PGPP   LK + V 
Sbjct: 24760 TIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVK----VLDRPGPPEGPLKVTGVT 24815

Query: 956   KDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSY 1015
              +   L W PP+  G   ++ Y ++ +E       W  ++   ++ +  KV  L  G  Y
Sbjct: 24816 AEKCYLAWNPPLQDGGANISHYIIEKRETSRL--SWTQVS-TEVQALNYKVTKLLPGNEY 24872

Query: 1016  VFRVRAINQAGVGKPSDLAGPVVA------ETRPGTKEVVVNVDDDGVIS 1059
             +FRV A+N+ G+G+P + +GPV A         P T EV     D  V++
Sbjct: 24873 IFRVMAVNKYGIGEPLE-SGPVTACNPYKPPGPPSTPEVSAITKDSMVVT 24921



 Score =  192 bits (488), Expect = 2e-48
 Identities = 219/892 (24%), Positives = 362/892 (40%), Gaps = 103/892 (11%)

Query: 367   VVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKF-DVSFGREGETMSLG 425
             V+ +   G F E    +GA        +T            D K+ DV     GET  L 
Sbjct: 24677 VIARNAAGNFSEPSDSSGA--------ITARDEIDAPNASLDPKYKDVIVVHAGETFVLE 24728

Query: 426   CRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSG-ERATLTFSHLNKEDEGLYTIRV 484
               +   P      P++ W ++G  L  +     + S  ++ TL      + D G Y +++
Sbjct: 24729 ADIRGKPI-----PDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKL 24783

Query: 485   RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGY 544
                   +     V V D      G P  PL V  + A K Y+  +W  P  DGG+ I  Y
Sbjct: 24784 SNVGGTKSIPITVKVLDRP----GPPEGPLKVTGVTAEKCYL--AWNPPLQDGGANISHY 24837

Query: 545   FIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAA 604
              I+K E    SW+Q + T V+   + VT L+ G  YIFRV AVNK GIG P   S PV A
Sbjct: 24838 IIEKRETSRLSWTQVS-TEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLE-SGPVTA 24895

Query: 605   LDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQ 663
              +P +                            PGPP+   V+  T+  +V++W +P   
Sbjct: 24896 CNPYKP---------------------------PGPPSTPEVSAITKDSMVVTWARPVDD 24928

Query: 664   RGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEP 723
              G E   Y +EK +     W + N +  +   R  +  L EG SY FRV   N+AGVGEP
Sbjct: 24929 GGTEIEGYILEKRDKEGVRWTKCNKK-TLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEP 24987

Query: 724   SEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSG 781
             SE +      D L  P  P     +  + +SV ++W +        + GY +E   A + 
Sbjct: 24988 SEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAAD 25047

Query: 782   KWEPCN-NNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSP 840
             +W  C     ++G +FT   L     Y FR+ A+N+ G+ E +    ++  +  I PP  
Sbjct: 25048 EWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEI 25107

Query: 841   PCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPG---KWREA----NVK 893
               D       R  +VL          A  T   +     I G P    KW +A      +
Sbjct: 25108 ELD----ADLRKVVVL---------RASAT---LRLFVTIKGRPEPEVKWEKAEGILTDR 25151

Query: 894   AVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSE 953
             A  E     + L  + V +F     N+  L   S     F      +  P  P +L   E
Sbjct: 25152 AQIEVTSSFTMLVIDNVTRFDSGRYNLT-LENNSGSKTAF-VNVRVLDSPSAPVNLTIRE 25209

Query: 954   VRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGV 1013
             V+KDS+ L W+PP+  G   +T Y V+ +E   K   +  +     K  + ++  L+EG 
Sbjct: 25210 VKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRK--AYATITNNCTKTTF-RIENLQEGC 25266

Query: 1014  SYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVD-DDGVISLNFECDKMTPKSE 1072
             SY FRV A N+ G+G P++   PV     P     V  VD      ++ +E  +    S+
Sbjct: 25267 SYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSK 25326

Query: 1073  FSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEE 1132
              +     + T+ S +    ++    + T   L   +  ++     +  G +    +    
Sbjct: 25327 ITGYVVEMQTKGSEKWSTCTQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPV 25386

Query: 1133  LKRLLALSHEHKFP----TVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEI 1188
             + R + +    + P     V  + +L +++  KG+ +           A VN+  + + +
Sbjct: 25387 IARDIEIKPSVELPFHTFNVKAREQLKIDVPFKGRPQ-----------ATVNWRKDGQTL 25435

Query: 1189  FEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQD--GKATNHSTVVLV 1238
              E    ++++  +  +  + +++   ED GTY   + +  G  T   T++++
Sbjct: 25436 KE--TTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVL 25485



 Score =  191 bits (486), Expect = 4e-48
 Identities = 192/782 (24%), Positives = 299/782 (38%), Gaps = 153/782 (19%)

Query: 290   EKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQ 349
             E  N +L   I G P P V+W K + P+   A   +  +ES     TL +  C   D  +
Sbjct: 19996 ENSNFRLKIPIKGKPAPSVSWKKGEDPL---ATDTRVSVESSAVNTTLIVYDCQKSDAGK 20052

Query: 350   YRASAMNVKGELSAYASVVVKRYKG------EFDETRFHA-------------------- 383
             Y  +  NV G      S+ V    G      +FDE    A                    
Sbjct: 20053 YTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYI 20112

Query: 384   --------------GASTMPLSFGVTPY--GYASRFEIHFDDKFDVSFGREGETMSLGCR 427
                            ++    +F VT    G    F +  ++K+ V  G + E +     
Sbjct: 20113 LEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHP 20172

Query: 428   VVITP--------EIKHFQPEIQWY----RNGVPLSPSKWVQTLWSGERATLTFSHLNKE 475
               +          +++H    + W       G P++       L   ER +L +   NK 
Sbjct: 20173 FDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYH----LEFKERNSLLWKRANKT 20228

Query: 476   DEGLYTIRV----RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDV-------KCLEANKD 524
                +   +V       EY  +  A          +   P   LD        + +   ++
Sbjct: 20229 PIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITRN 20288

Query: 525   YIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRV 584
              + + W +P  DGG  + GY ++K ++ + SW + N   V    F VT L+EG  Y FR+
Sbjct: 20289 SVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRI 20348

Query: 585   RAVNKMG-IGFPSRVSE----------PVAALDPAEKARL-----------------KSR 616
             RA N  G I  PS  +E          P   LDP  K  L                 K  
Sbjct: 20349 RAKNTAGAISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPL 20408

Query: 617   PSAPWT---------------------------------GQIIVTEEEPS----EGI--- 636
             P + W+                                 G+  +T   P     E +   
Sbjct: 20409 PKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVT 20468

Query: 637   ---VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPV 692
                VPGPP  + ++  +     L+W PP + G   I  Y +EK E     W  V+ +  +
Sbjct: 20469 VLDVPGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSED--I 20526

Query: 693   KSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTD 752
             +S R     L +G  Y FRV   N  G GEP ++  V +V D+   P  P K   S  T 
Sbjct: 20527 QSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQSEPVKMV-DRFGPPGPPEKPEVSNVTK 20585

Query: 753   TSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFR 810
              +  VSW+   D    E+ GY++E     S +W      PV   R    GL  G +Y FR
Sbjct: 20586 NTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFR 20645

Query: 811   VRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEIT 870
             V A N AG+   S+ S+++ +K A  PP PP +    ++ + S  L W +P   GG EIT
Sbjct: 20646 VSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEIT 20705

Query: 871   GYYVNYREVIDGVPGKW-REANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAV 929
             GY V +++V D     W ++    A+    + + +L+    Y F+++A+N AG+G P+ +
Sbjct: 20706 GYVVEHQKVGDEA---WIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVI 20762

Query: 930   SE 931
              +
Sbjct: 20763 PD 20764



 Score =  190 bits (482), Expect = 1e-47
 Identities = 163/618 (26%), Positives = 264/618 (42%), Gaps = 62/618 (10%)

Query: 526   IIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVR 585
             + + W +P  DGG+ I GY +++ E+    W +CN T ++   F VT L E + Y FRV 
Sbjct: 25701 VSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVF 25760

Query: 586   AVNKM-GIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDL 644
             A N    +  PS  + P+   D  E  R+       +   I+V           G    +
Sbjct: 25761 ARNAADSVSEPSESTGPIIVKDDVEPPRVMM--DVKFRDVIVVKA---------GEVLKI 25809

Query: 645   SVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAE 704
             +   A R   V+SW                  + G E  +R  TE+ + +    L  + +
Sbjct: 25810 NADIAGRPLPVISW-----------------AKDGIEIEERARTEI-ISTDNHTLLTVKD 25851

Query: 705   GKSYCFRVRCSNSAGVGEPSEATEVTVVGDK-LDIPKAP-GKIIPSRNTDTSVVVSW-EE 761
                 C R          +    T    V  K LD P  P G +  +  T     +SW   
Sbjct: 25852 ----CIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRP 25907

Query: 762   SKDAKELVGYYI-EASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLS 820
              +D    + YYI E        W  C    ++ +      L+ G  YIFRV  VN  G+ 
Sbjct: 25908 QEDGGADIDYYIVEKRETSHLAWTICEGE-LQMTSCKVTKLLKGNEYIFRVTGVNKYGVG 25966

Query: 821   EYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVI 880
             E   +S AI+       PSPP  +      ++SM L W +P+  GG+EI+GY +  RE  
Sbjct: 25967 E-PLESVAIKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSEISGYIIERREKN 26025

Query: 881   DGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTI 940
                  +W   N K V +   K + L+E   Y+++V A N AGL  PS  S   + E+  +
Sbjct: 26026 SL---RWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAED-PV 26081

Query: 941   AVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIK 1000
              +P PP   K  +  K ++ + W  P+  G  P+TGY V+ K  K+ +  W+  +  +++
Sbjct: 26082 FLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYK--KSDDTDWK-TSIQSLR 26138

Query: 1001  NVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPG----------TKEVVV 1050
                  + GL  G  YVFRV+++N+ G   PSD + P +A+ R             K ++V
Sbjct: 26139 GTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIV 26198

Query: 1051  NVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLG 1110
                    +++ F   +  P     WSK    T+   R  V++  ++T +T ++   +D G
Sbjct: 26199 KAGASFTMTVPF---RGRPVPNVLWSKP--DTDLRTRAYVDTTDSRTSLTIENANRNDSG 26253

Query: 1111  IYSCDVTDTDGIASSYLI 1128
              Y+  + +    AS  L+
Sbjct: 26254 KYTLTIQNVLSAASLTLV 26271



 Score =  189 bits (481), Expect = 1e-47
 Identities = 203/854 (23%), Positives = 338/854 (39%), Gaps = 114/854 (13%)

Query: 294   VKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRAS 353
             V+    I G P P   W  +   I    +   Y +E+      L I  C   DT +Y+ +
Sbjct: 17528 VRFPAIIRGVPVPTAKWTTDGSEIKTDEH---YTVETDNFSSVLTIKNCLRRDTGEYQIT 17584

Query: 354   AMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF-GVTPYGYASRFEIHFDDKFD 412
               N  G  +    + V    G            T P++   VTP                
Sbjct: 17585 VSNAAGSKTVAVHLTVLDVPGP----------PTGPINILDVTP---------------- 17618

Query: 413   VSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHL 472
                    E M++  +    P+     P I +           W        +  L   HL
Sbjct: 17619 -------EHMTISWQ---PPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHL 17668

Query: 473   NKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQ 532
              K  E  Y  RVR                        P+ P      +  ++   +SW  
Sbjct: 17669 QKGCE--YVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTL 17726

Query: 533   PAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGI 592
             P  DGGSPI GY++++ EV T  W + N TP+   +F VTGL EG +Y FRV A N  G+
Sbjct: 17727 PKSDGGSPITGYYMERREV-TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGL 17785

Query: 593   GFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRS 652
               PS  S+P+ A           RP  P                 PGPP +  + + +R 
Sbjct: 17786 SKPSPSSDPIKAC----------RPIKP-----------------PGPPINPKLKDKSRE 17818

Query: 653   YVVLSWKPPGQRGHEGIMYFVEKCEA-GTENWQRVNTELPVKSPRFALFDLAEGKSYCFR 711
                L W  P   G   I+ +V +C+  GT  W R+N +  ++   F +  L EG  Y FR
Sbjct: 17819 TADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFR 17878

Query: 712   VRCSNSAGVGEPSEATEVTVVGDKLDIPKAP-----GKIIPSRNTDTSVVVSWEESKDAK 766
             ++ +N  G GEP E  E  +  D L  P+         +I  R   T  +++  + +   
Sbjct: 17879 IKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEP 17938

Query: 767   ELVGYYIEASVAGSGKWEPCNNNP-----VKGSRFTCHGLVTGQSYIFRVRAVNAAGLSE 821
             ++        +    + +   + P     +K +    HG      YI     ++A   S 
Sbjct: 17939 DITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHG-----KYI-----ISAKNSSG 17988

Query: 822   YSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVID 881
             ++Q S  + V   +  P P  ++      +++  + W+ P   GG+EIT + V YR+   
Sbjct: 17989 HAQGSAIVNV---LDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRK--- 18042

Query: 882   GVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIA 941
               P +   + V +   +    +NL  N  Y F+V A N  G+G P+  ++        I 
Sbjct: 18043 --PNQKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVG-PTIETKTPILAINPID 18099

Query: 942   VPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKN 1001
              PG P +L  ++  K  + L+W+ P + G +P   Y V+ +  K  +D W  +++ +IK 
Sbjct: 18100 RPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVE-RRLKGSDD-WERVHKGSIKE 18157

Query: 1002  VYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVIS-- 1059
              +  V    E   Y FRV+  N+ G    SD         +   ++ V+++   GV++  
Sbjct: 18158 THYMVDRCVENQIYEFRVQTKNEGG---ESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVK 18214

Query: 1060  ----LNFECD-KMTPKSEFSWSKDYVSTE--DSPRLEVESKGNKTKMTFKDLGMDDLGIY 1112
                 +  E   +  P  E +W+KD  +T+   SPR++++++ + +K +       D G Y
Sbjct: 18215 AGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKY 18274

Query: 1113  SCDVTDTDGIASSY 1126
                 T+T G   +Y
Sbjct: 18275 VVTATNTAGSFVAY 18288



 Score =  189 bits (481), Expect = 1e-47
 Identities = 170/620 (27%), Positives = 261/620 (42%), Gaps = 78/620 (12%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVR--MGEYYEQYSAY 496
             P+  W + G  + PS   Q   +   + LT  +  ++D G YTI      G   E     
Sbjct: 20409 PKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVT 20468

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
             V       ++ G P  P+++  + A K    ++W  P  DGGSPI  Y ++K E     W
Sbjct: 20469 VL------DVPGPPG-PVEISNVSAEK--ATLTWTPPLEDGGSPIKSYILEKRETSRLLW 20519

Query: 557   SQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSR 616
             +  ++  ++  R   T LI+G  YIFRV AVN  G G P + SEPV  +D       +  
Sbjct: 20520 TVVSE-DIQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQ-SEPVKMVD-------RFG 20570

Query: 617   PSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEK 675
             P                    PGPP    V+  T++   +SWK P   G   I  Y VE+
Sbjct: 20571 P--------------------PGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVER 20610

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
              E  +  W R   + PV   R  +  L EG +Y FRV   N AG+G PSEA++  ++ D 
Sbjct: 20611 REKKSLRWVRA-IKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDA 20669

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKW-EPCNNNPVK 792
                P  P     +  T  S  ++W +       E+ GY +E    G   W +      ++
Sbjct: 20670 AYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALR 20729

Query: 793   GSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRD 852
              ++F    L T + Y FR+ A+N AG+ E +   +   V+  +AP     D       R 
Sbjct: 20730 ITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAP-----DFELDAELRR 20784

Query: 853   SMVLGWKQPDKIGGAEITGYYVNYREVIDGVPG---KWREANVKAVSE------EAYKIS 903
             ++V+              G  +     I G P     W + N+   +       E++ + 
Sbjct: 20785 TLVVR------------AGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESFTLL 20832

Query: 904   NLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQW 963
              + E   Y      M +     P+     F      +  PGP  +L+ +++ KDS+ L W
Sbjct: 20833 IIPECNRYDTGKFVMTIEN---PAGKKSGF-VNVRVLDTPGPVLNLRPTDITKDSVTLHW 20888

Query: 964   KPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAIN 1023
               P+  G + +T Y V+ +EA  K   +        K  Y KV GL EG  Y FRV A N
Sbjct: 20889 DLPLIDGGSRITNYIVEKREATRK--SYSTATTKCHKCTY-KVTGLSEGCEYFFRVMAEN 20945

Query: 1024  QAGVGKPSDLAGPVVAETRP 1043
             + G+G+P++   PV A   P
Sbjct: 20946 EYGIGEPTETTEPVKASEAP 20965



 Score =  189 bits (480), Expect = 2e-47
 Identities = 175/614 (28%), Positives = 265/614 (43%), Gaps = 107/614 (17%)

Query: 462   GERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEA 521
             G ++ L      ++D G Y I         +++A      A  E+   P   LD+K +  
Sbjct: 15156 GTKSELIIKDALRKDHGRYVITAT-NSCGSKFAA------ARVEVFDVPGPVLDLKPVVT 15208

Query: 522   NKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYI 581
             N+   +++W  P  DGGS I G+ I++ +    +W Q  +T  + ++  +TGL+EG+ Y 
Sbjct: 15209 NRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIET--ERSKCDITGLLEGQEYK 15266

Query: 582   FRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPP 641
             FRV A NK G G P  +  P+ A+DP                               GPP
Sbjct: 15267 FRVIAKNKFGCGPPVEIG-PILAVDPL------------------------------GPP 15295

Query: 642   TD---LSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRF 697
             T    L+ TE T+S + L WK P   G   I  Y +EK      +++RVN  L   +  F
Sbjct: 15296 TSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRL-CPTTSF 15354

Query: 698   ALFDLAEGKSYCFRVRCSNSAGVGEPSEATEV---------------TVVGDKLDIPKAP 742
              + +L E + Y FRV+  N  G  EPS    V               +V GD + +    
Sbjct: 15355 LVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGE 15414

Query: 743   GKIIPSRNTDTSV-VVSW-------EESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGS 794
                IP+  T   +  + W       E+  DA ++    +  S A +    P      KG+
Sbjct: 15415 PVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGT 15474

Query: 795   RFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSM 854
                           + V A N  G    +   E  +       PSPP ++   +   +S 
Sbjct: 15475 --------------YTVTASNRLGSVFRNVHVEVYD------RPSPPRNLAVTDIKAESC 15514

Query: 855   VLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQ 914
              L W  P   GG+EIT Y ++ R+       +W E    AV E+ Y I  L  N  Y+F+
Sbjct: 15515 YLTWDAPLDNGGSEITHYVIDKRDA-SRKKAEWEEVTNTAV-EKRYGIWKLIPNGQYEFR 15572

Query: 915   VAAMNMAGLGAPSAVSECFKCEEWTI----AVPGPPHSLKCSEVRKDSLVLQWKPPVHSG 970
             V A+N  G+       EC K ++  I     +PGPP   K     K S+++ W PP+ +G
Sbjct: 15573 VRAVNKYGIS-----DEC-KSDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNG 15626

Query: 971   RTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLK-----VRGLKEGVSYVFRVRAINQA 1025
              +P+TGY+++ +E  +    W  ++ A I  V LK     V  L EGV Y FR  AIN A
Sbjct: 15627 GSPITGYWLEKREEGS--PYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAA 15684

Query: 1026  GVGKPSDLAGPVVA 1039
             G+G PS+ + P VA
Sbjct: 15685 GIGPPSEPSDPEVA 15698



 Score =  189 bits (480), Expect = 2e-47
 Identities = 195/781 (24%), Positives = 325/781 (41%), Gaps = 123/781 (15%)

Query: 276   APEFIIKP------RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIE 329
             A + +I+P       S++V   +++K+   I+G P+P +TW K+ +P+       +  + 
Sbjct: 23223 AKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLK---QTTRINVT 23279

Query: 330   SRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRY----KG--EFDETRFHA 383
                 + TL I     +D  QY  +  NV G+ +A   +V        KG  +FD+     
Sbjct: 23280 DSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDV---- 23335

Query: 384   GASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQW 443
              A ++ LS+    Y    +   +   K D +                             
Sbjct: 23336 SAESITLSWNPPLYTGGCQITNYIVQKRDTT----------------------------- 23366

Query: 444   YRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV---FVR 500
                      + W     +  R TL  + L    E  Y  R+     Y Q  A      V 
Sbjct: 23367 --------TTVWDVVSATVARTTLKVTKLKTGTE--YQFRIFAENRYGQSFALESDPIVA 23416

Query: 501   DADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCN 560
                 +  G P  P        +KD ++I W +P  +GGSP++GY +++ E  +  W++ N
Sbjct: 23417 QYPYKEPGPPGTPF---ATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVN 23473

Query: 561   DTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAP 620
              T +   +F    L EG  Y FRV A N +G+G  S+ SE   A DP +           
Sbjct: 23474 KTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDP---------- 23523

Query: 621   WTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAG 679
                              PG P  + V    R+ + L W  P   G   I  Y VEK +  
Sbjct: 23524 -----------------PGTPEPIMVK---RNEITLQWTKPVYDGGSMITGYIVEKRDLP 23563

Query: 680   TENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAG-VGEPSEATEVTVVGDKLDI 738
                W + +    +++ +F +  L E + Y FRV   N+AG + +PS++T      D++++
Sbjct: 23564 DGRWMKASFTNVIET-QFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVEL 23622

Query: 739   PKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEAS--VAGSGKWEPCNNNPVKGSRF 796
             P+     +  +  DT VV + E  +   ++ G  +     + G  + E      +K + F
Sbjct: 23623 PRIS---MDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDF 23679

Query: 797   TCHGLVT------GQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESF 850
                 +V       G  YI  +RA N AG   +  +   ++V     PP  P  +T + S 
Sbjct: 23680 KALLIVKDAIRIDGGQYI--LRASNVAGSKSFPVN---VKVLDRPGPPEGPVQVTGVTSE 23734

Query: 851   RDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMV 910
             + S+   W  P + GG++I+ Y V  RE        W     + V+  + K++ L E   
Sbjct: 23735 KCSLT--WSPPLQDGGSDISHYVVEKRETSRLA---WTVVASEVVTN-SLKVTKLLEGNE 23788

Query: 911   YQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSG 970
             Y F++ A+N  G+G P   +       + +  PGPP SL+ + + KDS+ + W  P   G
Sbjct: 23789 YVFRIMAVNKYGVGEPLESAPVLMKNPFVL--PGPPKSLEVTNIAKDSMTVCWNRPDSDG 23846

Query: 971   RTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKP 1030
              + + GY V+ ++      +W   N+  I ++ L+V GL E   Y FRV A N AGVG+P
Sbjct: 23847 GSEIIGYIVEKRDRSG--IRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEP 23904

Query: 1031  S 1031
             S
Sbjct: 23905 S 23905



 Score =  188 bits (478), Expect = 3e-47
 Identities = 179/629 (28%), Positives = 266/629 (42%), Gaps = 86/629 (13%)

Query: 439   PEIQWYRN-GVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
             PE++W R+ G  L  +    T        L   ++N+ D G Y + V      +  SA+V
Sbjct: 21890 PEVKWARDHGESLDKASIEST---SSYTLLIVGNVNRFDSGKYILTVENSSGSK--SAFV 21944

Query: 498   FVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
              VR  D      P  P D+K  E  K  + ++W  P +DGGS I  Y ++K E    ++S
Sbjct: 21945 NVRVLDT-----PGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYS 21999

Query: 558   ----QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARL 613
                  C+ T  K     V  L EG SY FRV A N+ GIG P+  +E V A +       
Sbjct: 22000 TVATNCHKTSWK-----VDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASER------ 22048

Query: 614   KSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YF 672
                                     P PP  +++ + TR+ V LSW+ P   G   I+ Y 
Sbjct: 22049 ------------------------PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYI 22084

Query: 673   VEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVV 732
             VE    G++ W    T   VK     +  L +G+ Y FRV   N  G+ +P + + V V+
Sbjct: 22085 VEMQTKGSDKWATCAT---VKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLS-VPVI 22140

Query: 733   GDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVK 792
                L IP A   +      +T  V++ E+ K     +G    A       W   +N P+K
Sbjct: 22141 AKDLVIPPAFKLLF-----NTFTVLAGEDLKVDVPFIGRPTPAVT-----WHK-DNVPLK 22189

Query: 793   GSRFTCHGLVTGQSYIFRVRAVNAAGLSEY-----SQDSEAIEVKAAIA--PPSPPC-DI 844
              +    +   T  + +  ++      +  Y     +   EAIE    I    P PP   +
Sbjct: 22190 QTT-RVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPV 22248

Query: 845   TCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISN 904
                E   DS+ L W  P   GG+ I  Y V  R   D     W+  +   V+    K   
Sbjct: 22249 KMDEVTADSITLSWGPPKYDGGSSINNYIVEKR---DTSTTTWQIVSA-TVARTTIKACR 22304

Query: 905   LKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWK 964
             LK    YQF++AA N    G  + ++      ++   VPGPP +   +   +DS+ +QW 
Sbjct: 22305 LKTGCEYQFRIAAENR--YGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWN 22362

Query: 965   PPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQ 1024
              P+  G + V GY ++ KE  +    W  LN+  I     K  GL+EGV Y FRV A N 
Sbjct: 22363 EPISDGGSRVIGYHLERKERNS--ILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENI 22420

Query: 1025  AGVGKPSDLAGPVVAE---TRPGTKEVVV 1050
              G+GKPS ++   VA      PG  E ++
Sbjct: 22421 VGIGKPSKVSECYVARDPCDPPGRPEAII 22449



 Score =  186 bits (473), Expect = 1e-46
 Identities = 204/782 (26%), Positives = 323/782 (41%), Gaps = 112/782 (14%)

Query: 474   KEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQP 533
             + D GLY I+V       +    V V D        P  P++    +  K  ++  W+ P
Sbjct: 14773 RPDHGLYMIKVENDHGIAKAPCTVSVLDT-------PGPPINFVFEDIRKTSVLCKWEPP 14825

Query: 534   AVDGGSPILGYFIDKCE-VGTDS-WSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMG 591
               DGGS I+ Y ++K +    DS W     T ++  ++ VT LIEG+ Y+FRVRA N+ G
Sbjct: 14826 LDDGGSEIINYTLEKKDKTKPDSEWIVVTST-LRHCKYSVTKLIEGKEYLFRVRAENRFG 14884

Query: 592   IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATR 651
              G P  VS+P+ A DP                              P  P    V + T 
Sbjct: 14885 PG-PPCVSKPLVAKDPFGP---------------------------PDAPDKPIVEDVTS 14916

Query: 652   SYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFR 711
             + +++ W  P   G   + Y++EK E  + +W RVN  L + + +  +  L EG +Y FR
Sbjct: 14917 NSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSL-LNALKANVDGLLEGLTYVFR 14975

Query: 712   VRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTS---VVVSWEES--KDAK 766
             V   N+AG G+ S  ++     D +     PG  IP R TDTS   + + WE        
Sbjct: 14976 VCAENAAGPGKFSPPSDPKTAHDPI---SPPGPPIP-RVTDTSSTTIELEWEPPAFNGGG 15031

Query: 767   ELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDS 826
             E+VGY+++  + G+ +W  C    +K  ++T   +  G  Y  RV AVNAAG      ++
Sbjct: 15032 EIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGP-PGET 15090

Query: 827   EAIEVKAAIAPPSPPCDITCLESFR---------DSMVLGWKQPDKIGGAEITGYYVNYR 877
             + + V     PP+   D++     +          ++V G   P K+   E  G     R
Sbjct: 15091 QPVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKE-EGELDKDR 15149

Query: 878   EVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEE 937
              VID         NV   SE   K +  K++   ++ + A N  G    +A  E F    
Sbjct: 15150 VVID---------NVGTKSELIIKDALRKDH--GRYVITATNSCGSKFAAARVEVFD--- 15195

Query: 938   WTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEA 997
                 VPGP   LK     +   +L W  P   G + +TG+ ++ K+AK     WR   E 
Sbjct: 15196 ----VPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKM--HTWRQPIET 15249

Query: 998   AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPG----TKEVVVNVD 1053
               +     + GL EG  Y FRV A N+ G G P ++ GP++A    G     + +     
Sbjct: 15250 --ERSKCDITGLLEGQEYKFRVIAKNKFGCGPPVEI-GPILAVDPLGPPTSPERLTYTER 15306

Query: 1054  DDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYS 1113
                 I+L+++  +    S            D P  E  +K      +F    +D+  +Y 
Sbjct: 15307 TKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYE 15366

Query: 1114  CDVTDTDGIASS-------YLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRF 1166
               V   + I  S        +I ++E+   + L    +  T+ VK+   V I        
Sbjct: 15367 FRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHI-------- 15418

Query: 1167  WMQAEKLSG--NAKVNYIFNEKEIFEGPK-----YKMHIDRNTGIIEMFMEKLQDEDEGT 1219
                   ++G    K+ +  NE  + E P       K  + R+    E+ + K   ED+GT
Sbjct: 15419 ---PADVTGLPMPKIEWSKNE-TVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGT 15474

Query: 1220  YT 1221
             YT
Sbjct: 15475 YT 15476



 Score =  186 bits (473), Expect = 1e-46
 Identities = 159/643 (24%), Positives = 266/643 (41%), Gaps = 71/643 (11%)

Query: 411   FDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFS 470
             FD    + GE++ +   V   P      P + W+++GV +     ++        +L   
Sbjct: 27965 FDGLIIKSGESLRIKALVQGRPV-----PRVTWFKDGVEIEKRMNMEITDVLGSTSLFVR 28019

Query: 471   HLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISW 530
                ++  G+YT+  +      +    V V+D   ++ G       ++      + + + W
Sbjct: 28020 DATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGP------IRFTNITGEKMTLWW 28073

Query: 531   KQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKM 590
               P  DG +PI  Y I+K E    +W+   D   +   +    LI G  Y FRV AVNK 
Sbjct: 28074 DAPLNDGCAPITHYIIEKRETSRLAWALIEDK-CEAQSYTAIKLINGNEYQFRVSAVNKF 28132

Query: 591   GIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEAT 650
             G+G P   S+PV A                   QI  T        VP  P     +  T
Sbjct: 28133 GVGRPLD-SDPVVA-------------------QIQYT--------VPDAPGIPEPSNIT 28164

Query: 651   RSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYC 709
              + + L+W +P    G E   Y +E+ E  +  W +V ++ P+   RF +  L EG  Y 
Sbjct: 28165 GNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYE 28224

Query: 710   FRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKE 767
             F V   N+AGVG  S  + +    + ++ P  P  +  +  + T+V + W +       E
Sbjct: 28225 FHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGME 28284

Query: 768   LVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSE 827
             ++GY IE   A  G W   N      +R+T   L  G+ Y FRV A+N AG  +  + + 
Sbjct: 28285 IIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTG 28344

Query: 828   AIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKW 887
              I  KA     +P  DI    +F+ + V+         GA I  +               
Sbjct: 28345 TI--KAVDRLTAPELDIDA--NFKQTHVVR-------AGASIRLFIAYQGRPTPTAVWSK 28393

Query: 888   REANVKAVSE-------EAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTI 940
              ++N+   ++           + N   N   ++ +   N +G       S+        +
Sbjct: 28394 PDSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSG-------SKSITFTVKVL 28446

Query: 941   AVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIK 1000
               PGPP  +   +V + S  L W  P+  G   +  Y V+ +EA  +   W+ ++E   +
Sbjct: 28447 DTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRR--SWQVISEKCTR 28504

Query: 1001  NVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRP 1043
              ++ KV  L EGV Y FRV A+N+ GVG+P ++  P+VA  +P
Sbjct: 28505 QIF-KVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQP 28546



 Score =  186 bits (473), Expect = 1e-46
 Identities = 215/868 (24%), Positives = 351/868 (40%), Gaps = 112/868 (12%)

Query: 274   LHAPEFIIKP---RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIES 330
             L APE  I     ++H V    +++L  +  G P P   W K    +++ A+     I +
Sbjct: 28352 LTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRAD-----IHT 28406

Query: 331   RYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPL 390
                  TL +  C+  D  +Y  +  N  G  S   +V V    G              P+
Sbjct: 28407 TDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGP-----------PGPI 28455

Query: 391   SFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPL 450
             +F     G A+                +   +  G R      I H+  E +        
Sbjct: 28456 TFKDVTRGSATLMW-------------DAPLLDGGAR------IHHYVVEKR------EA 28490

Query: 451   SPSKWVQTLWSGERATLTFSHLNKEDEGL-YTIRVRMGEYYEQYSAYVFVRDADAEIEGA 509
             S   W Q +   E+ T     +N   EG+ Y  RV     Y     Y       A  + A
Sbjct: 28491 SRRSW-QVI--SEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPA 28547

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P   LDV  ++ +K   +++W +P  DGGS I GY ++  + G+D W +   T  K   F
Sbjct: 28548 PPRRLDV--VDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHT--KQLTF 28603

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTG---QII 626
              V  L+E   Y FRV+A N  G   P      V   +P      +  P+A  TG   Q+I
Sbjct: 28604 TVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEP------QIEPTADLTGITNQLI 28657

Query: 627   VTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRV 686
               +         G P  + V  + R    ++WK    R        +++ +  +    + 
Sbjct: 28658 TCK--------AGSPFTIDVPISGRPAPKVTWKLEEMR--------LKETDRVSITTTKD 28701

Query: 687   NTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKII 746
              T L VK       D   G S  + +   N+AGV   + +  V V+G    +    G I 
Sbjct: 28702 RTTLTVK-------DSMRGDSGRYFLTLENTAGV--KTFSVTVVVIGRPGPV---TGPIE 28749

Query: 747   PSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTG 804
              S  +  S V+SW E KD    E+  Y +E   +G+  W+  N++ VK ++     L   
Sbjct: 28750 VSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSS-VKRTQIKVTHLTKY 28808

Query: 805   QSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKI 864
               Y FRV + N  G+S+   +S  I  +    PPS P          ++M + W++P   
Sbjct: 28809 MEYSFRVSSENRFGVSK-PLESAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHD 28867

Query: 865   GGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLG 924
             GG++I GY+V  +E    +   W + N     E  YK++ L E + YQF+  A+N AG+ 
Sbjct: 28868 GGSKIIGYWVEKKERNTIL---WVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVS 28924

Query: 925   APSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE- 983
               S  S     +   +  PG P   + ++V + ++ L W  P + G + V GY ++ K  
Sbjct: 28925 KASEASRPIMAQN-PVDAPGRP---EVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPV 28980

Query: 984   AKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGV-GKPSDLAGPVVA--E 1040
             ++  + +W   N   + + +  V  L EG +Y FRV A N AGV  K S+  GPV    E
Sbjct: 28981 SEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDE 29040

Query: 1041  TRPGTKEVVVNVDDDGVISLNFECDKM-------TPKSEFSWSKDYVSTEDSPRLEVESK 1093
               P   E+   +  D ++++    D +        P+ +  W+K     +   ++ ++  
Sbjct: 29041 YAPPKAELDARLHGD-LVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYT 29099

Query: 1094  GNKTKMTFKDLGMDDLGIYSCDVTDTDG 1121
             G +     K     D G Y+  V +  G
Sbjct: 29100 GKRATAVIKFCDRSDSGKYTLTVKNASG 29127



 Score =  186 bits (472), Expect = 2e-46
 Identities = 178/662 (26%), Positives = 274/662 (41%), Gaps = 105/662 (15%)

Query: 418   EGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDE 477
             EGE +S+       P      P + W+++G  +  S  +        A L      + D 
Sbjct: 14400 EGEKLSIPVPFRAVPV-----PTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADA 14454

Query: 478   GLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAV 535
             G+YTI +  ++G               + ++ G P    D+K  +  K    ++W+ P  
Sbjct: 14455 GIYTITLENKLGSA---------TASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEF 14505

Query: 536   DGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFP 595
             DGG+PIL Y +++ E G  ++        K + + V  LI    Y FRV+AVNK+G G  
Sbjct: 14506 DGGTPILHYVLERREAGRRTYIPVMSGENKLS-WTVKDLIPNGEYFFRVKAVNKVGGGEY 14564

Query: 596   SRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVV 655
               +  PV A DP +                            P PP D+ V   T   + 
Sbjct: 14565 IELKNPVIAQDPKQP---------------------------PDPPVDVEVHNPTAEAMT 14597

Query: 656   LSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRC 714
             ++WKPP   G   IM Y +EK   G E W+R N  L V    +    L EGK Y FRVR 
Sbjct: 14598 ITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHL-VPILTYTAKGLEEGKEYQFRVRA 14656

Query: 715   SNSAGVGEPSEATEVTVVGDKLDIPKA--------------------PGKIIPSRN--TD 752
              N+AG+ EPS AT  T   D +D PK                      G   P+     D
Sbjct: 14657 ENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYPTITWIKD 14716

Query: 753   TSVVVSWEESKDAKELV----GYYIE-----------ASVAGSGKWEPCNNNPVKGSRFT 797
              +V+V  E  K A  LV    G   E            S+  S K E  +   V+ S   
Sbjct: 14717 ENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGE--SQLRVRDSLRP 14774

Query: 798   CHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLG 857
              HGL       + ++  N  G+      ++A    + +  P PP +    +  + S++  
Sbjct: 14775 DHGL-------YMIKVENDHGI------AKAPCTVSVLDTPGPPINFVFEDIRKTSVLCK 14821

Query: 858   WKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAA 917
             W+ P   GG+EI  Y +  ++     P          +    Y ++ L E   Y F+V A
Sbjct: 14822 WEPPLDDGGSEIINYTLEKKDKTK--PDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRA 14879

Query: 918   MNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGY 977
              N  G G P  VS+    ++     P  P      +V  +S++++W  P  +G +P+ GY
Sbjct: 14880 ENRFGPG-PPCVSKPLVAKD-PFGPPDAPDKPIVEDVTSNSMLVKWNEPKDNG-SPILGY 14936

Query: 978   FVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPV 1037
             +++ +E  +    W  +N++ +  +   V GL EG++YVFRV A N AG GK S  + P 
Sbjct: 14937 WLEKREVNS--THWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPK 14994

Query: 1038  VA 1039
              A
Sbjct: 14995 TA 14996



 Score =  186 bits (472), Expect = 2e-46
 Identities = 178/659 (27%), Positives = 264/659 (40%), Gaps = 81/659 (12%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P + W +   PL+    V    S    TL      K D G YTI ++     ++ +  + 
Sbjct: 20012 PSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISI- 20070

Query: 499   VRDADAEIEGAPAAPLD-VKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
                   ++ G P  P   +K  E   + + + W  P  DGGS I  Y ++K +   + W 
Sbjct: 20071 ------KVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWV 20124

Query: 558   QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRP 617
              C    V+   F VT L EG  Y FRV A NK G+G   + SEP+ A  P +        
Sbjct: 20125 TCASA-VQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLK-SEPIVARHPFD-------- 20174

Query: 618   SAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKC 676
                                VP  P   ++ +     V L+W  P + G   I  Y +E  
Sbjct: 20175 -------------------VPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFK 20215

Query: 677   EAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKL 736
             E  +  W+R N + P++   F +  L EG  Y FRV   N AGVG+PS  +E  V  D +
Sbjct: 20216 ERNSLLWKRAN-KTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPI 20274

Query: 737   DIPKAPGKIIPSRNTDTSVVVSWEESK--DAKELVGYYIEASVAGSGKWEPCNNNPVKGS 794
             D P  P  I  +RN   SV + W E K     +L GY +E     S  W   N+  V   
Sbjct: 20275 DPPGKPEVINITRN---SVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPEC 20331

Query: 795   RFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDS 853
              FT   LV G  Y FR+RA N AG +S  S+ +E I  K     P+   D T     +D 
Sbjct: 20332 AFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIVLDPT----IKDG 20387

Query: 854   MVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQF 913
             + +       +    I G  +            W +A       +  +I++   + +   
Sbjct: 20388 LTIKAGDTIVLNAISILGKPLP--------KSSWSKAGKDIRPSDITQITSTPTSSMLTI 20439

Query: 914   QVAAMNMAGLGAPSAVSEC-FKCEEWTIAV---PGPPHSLKCSEVRKDSLVLQWKPPVHS 969
             + A    AG    +A +    K E   + V   PGPP  ++ S V  +   L W PP+  
Sbjct: 20440 KYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLED 20499

Query: 970   GRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGK 1029
             G +P+  Y ++ +E       W  ++E  I++       L +G  Y+FRV A+N  G G+
Sbjct: 20500 GGSPIKSYILEKRETSRL--LWTVVSE-DIQSCRHVATKLIQGNEYIFRVSAVNHYGKGE 20556

Query: 1030  P--------SDLAGPVVAETRPGTKEVVVN---------VDDDGVISLNFECDKMTPKS 1071
             P         D  GP     +P    V  N         VDD G     +  ++   KS
Sbjct: 20557 PVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKS 20615



 Score =  186 bits (471), Expect = 2e-46
 Identities = 165/626 (26%), Positives = 258/626 (41%), Gaps = 74/626 (11%)

Query: 519   LEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTP--VKFARFPVTGLIE 576
             ++  K  + + W +P  DGGS I+GYF++ C++  D W +CN  P  +    +  TGL E
Sbjct: 19199 IDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEE 19258

Query: 577   GRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGI 636
                Y FR  A   + I  PS  S+PV  L  AE    +   S      + V         
Sbjct: 19259 KAQYQFRAIARTAVNISPPSEPSDPVTIL--AENVPPRIDLSVAMKSLLTVK-------- 19308

Query: 637   VPGPPTDLSVTEATRSYVVLSWKPPGQ--RGHEGIMYFVEKCEAGTENWQRVNTELPVKS 694
               G    L  T   +    +SWK  G   +  EGI   +++     E             
Sbjct: 19309 -AGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLE------------- 19354

Query: 695   PRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTS 754
                 LF +    S  + +   NS+G      +   T+    LD P  P  +  ++     
Sbjct: 19355 ----LFSVNRKDSGDYTITAENSSG------SKSATIKLKVLDKPGPPASVKINKMYSDR 19404

Query: 755   VVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVR 812
              ++SWE   +    E+  Y ++        W   +   V  +  +   L+ G  Y FR+ 
Sbjct: 19405 AMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVSAT-VPITSCSVEKLIEGHEYQFRIC 19463

Query: 813   AVNAAGLSEYSQDSEAIEVKAAIAPPSPP--CDITCLESF-RDSMVLGWKQPDKIGGAEI 869
             A N  G+     D    E   A  P  PP  CD   + +  +D M + WK P   GG+ I
Sbjct: 19464 AENKYGVG----DPVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPI 19519

Query: 870   TGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAV 929
             TGY +  RE        W + N K + E   K + L+E   Y+F+V A+N AG G PS  
Sbjct: 19520 TGYLLEKRET---QAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDA 19576

Query: 930   SECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKED 989
             S+     +     PGPP   K  +  + S+ L W  P + G +P+ GY V++K  +A  D
Sbjct: 19577 SKAAYARDPQYP-PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVK--RADSD 19633

Query: 990   QWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDL-------------AG 1035
              W   N    ++    +V GL E   Y FRV A+N+ G   PSD+              G
Sbjct: 19634 NWVRCNLPQNLQKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEG 19693

Query: 1036  PVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGN 1095
              + A+ R   K +++     GV    +   K  P  + +WSK  V+  D   L+++S   
Sbjct: 19694 ELDADLR---KTLILRA---GVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDF 19747

Query: 1096  KTKMTFKDLGMDDLGIYSCDVTDTDG 1121
              T +  +++   D G Y   + ++ G
Sbjct: 19748 DTFLRCENVNKYDAGKYILTLENSCG 19773



 Score =  184 bits (467), Expect = 6e-46
 Identities = 185/681 (27%), Positives = 281/681 (41%), Gaps = 137/681 (20%)

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
             VF R  DA     P  P + K  + ++  + ++W +P  DGG+P+ GY ++  E   D W
Sbjct: 24992 VFYRACDALYP--PGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEW 25049

Query: 557   SQCND-TPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPS----------RVSEPVAAL 605
             + C   T ++  +F VT L E   Y FR+ A+N  G+G P+          R+  P   L
Sbjct: 25050 TTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIEL 25109

Query: 606   DPAEKARLKSRPSAPWTGQIIVTEE---------EPSEGIV------------------- 637
             D   +  +  R SA  T ++ VT +         E +EGI+                   
Sbjct: 25110 DADLRKVVVLRASA--TLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTMLVIDN 25167

Query: 638   -------------------------------PGPPTDLSVTEATRSYVVLSWKPPGQRGH 666
                                            P  P +L++ E  +  V LSW+PP   G 
Sbjct: 25168 VTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGG 25227

Query: 667   EGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSE 725
               I  Y VEK E   + +  +       +  F + +L EG SY FRV  SN  G+G P+E
Sbjct: 25228 AKITNYIVEKRETTRKAYATITNNCTKTT--FRIENLQEGCSYYFRVLASNEYGIGLPAE 25285

Query: 726   ATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE--ESKDAKELVGYYIEASVAGSGKW 783
              TE   V +    P  PG++     T  +  + WE  ES    ++ GY +E    GS KW
Sbjct: 25286 TTEPVKVSEP---PLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKW 25342

Query: 784   EPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQ-----DSEAIEVKAAIAPP 838
               C    VK    T  GL  G+ Y+FRV AVN  G S+  Q      +  IE+K ++  P
Sbjct: 25343 STCTQ--VKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELP 25400

Query: 839   SPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEE 898
                 ++   E  +  +      P K G  + T   VN+R+  DG   K     V   S +
Sbjct: 25401 FHTFNVKAREQLKIDV------PFK-GRPQAT---VNWRK--DGQTLK-ETTRVNVSSSK 25447

Query: 899   AYKISNLKENM---VYQFQVAAMNMAG-LGAPSAVSECFKCEEWTIAVPGPPHSLKCSEV 954
                  ++KE     V  +++   N AG +  P  +          +  PGPP  ++  EV
Sbjct: 25448 TVTSLSIKEASKEDVGTYELCVSNSAGSITVPITII--------VLDRPGPPGPIRIDEV 25499

Query: 955   RKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVS 1014
               DS+ + W PP + G   ++ Y V+ KE  +    W  +++ A+    +K+  L  G  
Sbjct: 25500 SCDSITISWNPPEYDGGCQISNYIVEKKETTS--TTWHIVSQ-AVARTSIKIVRLTTGSE 25556

Query: 1015  YVFRVRAINQAGVGKPSDLAGPVVAE------TRPGTKEVV------------VNVDDDG 1056
             Y FRV A N+ G    S+ +  VVAE        PGT +VV            V V+D G
Sbjct: 25557 YQFRVCAENRYGKSSYSE-SSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGG 25615

Query: 1057  VISLNFECDKMTPKSEFSWSK 1077
                + +  +    +S   WSK
Sbjct: 25616 SRVIGYHLE-YKERSSILWSK 25635



 Score =  182 bits (462), Expect = 2e-45
 Identities = 161/687 (23%), Positives = 288/687 (41%), Gaps = 62/687 (9%)

Query: 451   SPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADA-EIEGA 509
             S   WV    +  R  L++   N ++  +Y  RV  GE   ++   +     +  +I   
Sbjct: 26320 SKKAWVSVTNNCNR--LSYKVTNLQEGAIYYFRVS-GE--NEFGVGIPAETKEGVKITEK 26374

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P+ P  +     +KD + ++W +P  DGGS I+ Y ++  E G  +W +C     K    
Sbjct: 26375 PSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKC--AVAKSTHH 26432

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              V+GL E   Y FRV A N+ G+  P  +  PV   +  E   +  +             
Sbjct: 26433 VVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMK------------- 26479

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTE 689
               PS  +     ++L V       + +S KP  +         + +     +   R NTE
Sbjct: 26480 NFPSHTVYVRAGSNLKVD------IPISGKPLPK-------VTLSRDGVPLKATMRFNTE 26526

Query: 690   LPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAP-GKIIPS 748
             +  ++    L +     +  + +  +NS+G       T+  +    LD P  P G ++ S
Sbjct: 26527 ITAENLTINLKESVTADAGRYEITAANSSGT------TKAFINIVVLDRPGPPTGPVVIS 26580

Query: 749   RNTDTSVVVSWEESK--DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQS 806
               T+ SV + WE  K     ++  Y +      +  W   +   V  +      L TG+ 
Sbjct: 26581 DITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSAT-VARTMMKVMKLTTGEE 26639

Query: 807   YIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGG 866
             Y FR++A N  G+S++  DS  + VK     P PP         R+S+ +GW +P   GG
Sbjct: 26640 YQFRIKAENRFGISDHI-DSACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGG 26698

Query: 867   AEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAP 926
             + + GY++   E+ D     W++AN   +    +K++ +   ++Y+F+V A N AG+G P
Sbjct: 26699 SAVVGYHL---EMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVGKP 26755

Query: 927   SAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKA 986
             S  SE        I    PP +++ +++ K+S+ L W+ P   G + +TGY V+ ++   
Sbjct: 26756 SHPSE----PVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLP- 26810

Query: 987   KEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG-VGKPSDLAGPVVAETRPGT 1045
              + +W   +   +      + GL +   Y FRV A N  G +  PS++ GP+      G 
Sbjct: 26811 -DGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGG 26869

Query: 1046  KEVVVNVDDDGVISLNFECDKMT-------PKSEFSWSKDYVSTEDSPRLEVESKGNKTK 1098
               + + ++   V+                 P     W KD    + +  + VE+  +   
Sbjct: 26870 PVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLAS 26929

Query: 1099  MTFKDLGMDDLGIYSCDVTDTDGIASS 1125
             +  KD    + G Y   + +  G AS+
Sbjct: 26930 ILIKDADRLNSGCYELKLRNAMGSASA 26956



 Score =  181 bits (460), Expect = 4e-45
 Identities = 158/602 (26%), Positives = 244/602 (40%), Gaps = 104/602 (17%)

Query: 509   APAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFAR 568
             AP  P   K  +  K    + W  P  DGGS + GY ++  E G + W +  D  V+  +
Sbjct: 16420 APPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTK 16479

Query: 569   FPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSE----------PVAALDPAEKARL----- 613
               VTGL EG  Y FRVRAVN  GIG P  V++          P   LD + + R+     
Sbjct: 16480 LVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAG 16539

Query: 614   -----------KSRPSAPW-------------------TGQIIVTEEEPSEGI------- 636
                        K  P+  W                   +  +I   +   +G+       
Sbjct: 16540 GVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGVYSLLAKN 16599

Query: 637   ---------------VPGPP-TDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAG 679
                            VPGP  T       T     L+W  P   G   I  Y +EK E+ 
Sbjct: 16600 EAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESD 16659

Query: 680   TENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIP 739
                W  V     V      +  L +GK+Y FR+   NS G+G   E +E  V+ + + +P
Sbjct: 16660 RRAWTPVT--YTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVP 16717

Query: 740   KAPGKIIPSRNTDTSVVVSWEESK--DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFT 797
             + P  +     T  +V ++W   K     E++ Y +E+ + G+ K+    N+ +   ++T
Sbjct: 16718 ERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYT 16777

Query: 798   CHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLG 857
               GL  G +Y +RV AVN  G  + S  ++ I  K  +APP+   D      FRD + + 
Sbjct: 16778 VKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLD------FRDKLTI- 16830

Query: 858   WKQPDKIGGA-EITGYYVNYREVIDGVPG---KWREANVKAVSEEAYKISNLKENMVYQF 913
                  ++G A  +TG Y        G P     W +     + ++   I      +  + 
Sbjct: 16831 -----RVGEAFALTGRY-------SGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEK 16878

Query: 914   QVAAMNMAG----LGAPSAVSECFKCEEWTIAVPGPP-HSLKCSEVRKDSLVLQWKPPVH 968
               A  + +G    +   S  S    C+   +  PGPP   +   EV KD +V+ WKPP+ 
Sbjct: 16879 IKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLD 16938

Query: 969   SGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVG 1028
              G + +T Y ++ KE    +D W  +  A+ K    KV  L EG  Y+FR+ A N  G+ 
Sbjct: 16939 DGGSKITNYIIEKKE--VGKDVWMPVTSASAKTT-CKVSKLLEGKDYIFRIHAENLYGIS 16995

Query: 1029  KP 1030
              P
Sbjct: 16996 DP 16997



 Score =  180 bits (457), Expect = 9e-45
 Identities = 195/764 (25%), Positives = 297/764 (38%), Gaps = 127/764 (16%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYR 351
             +N+K+   + G P+P VTW K      +     +   E+      L IN C   D+  Y 
Sbjct: 21081 DNIKVEIPVLGRPKPTVTWKKGD---QILKQTQRVNFETTATSTILNINECVRSDSGPYP 21137

Query: 352   ASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKF 411
              +A N+ GE+    ++ V    G            T P+ F      +            
Sbjct: 21138 LTARNIVGEVGDVITIQVHDIPGP----------PTGPIKFDEVSSDF------------ 21175

Query: 412   DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSH 471
              V+F  +      G        I ++  E++          + WV+   +  R T   + 
Sbjct: 21176 -VTFSWDPPENDGGV------PISNYVVEMR------QTDSTTWVELATTVIRTTYKATR 21222

Query: 472   LNKEDEGLYTIRVRMGEYY---EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIII 528
             L    E  Y  RV+    Y      ++   V +   ++ G P  P   +     KD + I
Sbjct: 21223 LTTGLE--YQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTP---QVTAVTKDSMTI 21277

Query: 529   SWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVN 588
             SW +P  DGGSPILGY +++ E     W   +   V    F  +GL +G +Y FRV A N
Sbjct: 21278 SWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAEN 21337

Query: 589   KMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTE 648
               G   PS+ SEP+ ALDP +                            PG P  L++T 
Sbjct: 21338 MAGKSKPSKPSEPMLALDPIDP---------------------------PGKPVPLNITR 21370

Query: 649   ATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKS 707
              T   V L W KP    G +   Y VEK +     W + N    +    F +  L E  +
Sbjct: 21371 HT---VTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFS-NILENEFTVSGLTEDAA 21426

Query: 708   YCFRVRCSNSAG-VGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEE----- 761
             Y FRV   N+AG +  PSE ++     D ++ PK     +  +  DT ++ + E      
Sbjct: 21427 YEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIK---VDVKFKDTVILKAGEAFRLEA 21483

Query: 762   ------------SKDAKELVG-YYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYI 808
                         SKD KEL G   +E  +A     +   N   K S     G  T     
Sbjct: 21484 DVSGRPPPTMEWSKDGKELEGTAKLEIKIA-----DFSTNLVNKDSTRRDSGAYT----- 21533

Query: 809   FRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAE 868
               + A N  G +++        VK    P  P   +   E   +  VL W  P   GGA+
Sbjct: 21534 --LTATNPGGFAKH-----IFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAK 21586

Query: 869   ITGYYVNYREVIDGVPGKWREANVKA-VSEEAYKISNLKENMVYQFQVAAMNMAGLGAPS 927
             I  Y V  RE       +    NV + V     K++ L +   Y F+V A+N  G+G P 
Sbjct: 21587 IDHYIVQKRET-----SRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPL 21641

Query: 928   AVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAK 987
                       +    P PP + + + + KDS+V+ W  P   G + +  Y V+ ++   +
Sbjct: 21642 ESEPVLAVNPY--GPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQ 21699

Query: 988   EDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPS 1031
               +W   N+  + ++  KV GL EG  Y FR+ A N AG+  PS
Sbjct: 21700 --RWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPS 21741



 Score =  180 bits (457), Expect = 9e-45
 Identities = 166/615 (26%), Positives = 262/615 (42%), Gaps = 61/615 (9%)

Query: 432   PEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVR--MGEY 489
             P +   +P + W +    L  ++ V    +     L  +   + D G Y +  R  +GE 
Sbjct: 21088 PVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEV 21147

Query: 490   YEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKC 549
              +  +  V       +I G P  P  +K  E + D++  SW  P  DGG PI  Y ++  
Sbjct: 21148 GDVITIQVH------DIPGPPTGP--IKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMR 21199

Query: 550   EVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAE 609
             +  + +W +   T ++   +  T L  G  Y FRV+A N+ G+G P   S  + A  P +
Sbjct: 21200 QTDSTTWVELATTVIR-TTYKATRLTTGLEYQFRVKAQNRYGVG-PGITSACIVANYPFK 21257

Query: 610   KARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGI 669
                                        VPGPP    VT  T+  + +SW  P   G   I
Sbjct: 21258 ---------------------------VPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPI 21290

Query: 670   M-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATE 728
             + Y VE+ E     WQ V+  L V    F    L +G +Y FRV   N AG  +PS+ +E
Sbjct: 21291 LGYHVERKERNGILWQTVSKAL-VPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSE 21349

Query: 729   VTVVGDKLDIPKAPGKIIPSRNTDTSVVVSW--EESKDAKELVGYYIEASVAGSGKWEPC 786
               +  D +D    PGK +P   T  +V + W   E     ++  Y +E     +G+W   
Sbjct: 21350 PMLALDPID---PPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKA 21406

Query: 787   NNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIAPPSPPCDIT 845
             N + +  + FT  GL    +Y FRV A NAAG +S  S+ S+AI  +  +  P    D+ 
Sbjct: 21407 NFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDV- 21465

Query: 846   CLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNL 905
                 F+D+++L   +  ++  A+++G      E      GK  E   K   + A   +NL
Sbjct: 21466 ---KFKDTVILKAGEAFRL-EADVSGRPPPTMEW--SKDGKELEGTAKLEIKIADFSTNL 21519

Query: 906   KENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHS-LKCSEVRKDSLVLQWK 964
                   +    A  +            F  +   +  PGPP   L  +EV  +  VL W 
Sbjct: 21520 VNKDSTRRDSGAYTLTATNPGGFAKHIFNVK--VLDRPGPPEGPLAVTEVTSEKCVLSWF 21577

Query: 965   PPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQ 1024
             PP+  G   +  Y V  +E       W  +  + ++   LKV  L +G  Y+FRV A+N+
Sbjct: 21578 PPLDDGGAKIDHYIVQKRETSRL--AWTNV-ASEVQVTKLKVTKLLKGNEYIFRVMAVNK 21634

Query: 1025  AGVGKPSDLAGPVVA 1039
              GVG+P + + PV+A
Sbjct: 21635 YGVGEPLE-SEPVLA 21648



 Score =  179 bits (455), Expect = 1e-44
 Identities = 207/860 (24%), Positives = 335/860 (38%), Gaps = 131/860 (15%)

Query: 280   IIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEI 339
             ++K R+ T     +VKL   I+G P P + WYK+   +  +A      +E+   + ++ I
Sbjct: 26881 VVKYRAGT-----SVKLRAGISGKPAPTIEWYKDDKELQTNA---LVCVENTTDLASILI 26932

Query: 340   NGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGY 399
                D  ++  Y     N  G  SA   V +    G                     P G 
Sbjct: 26933 KDADRLNSGCYELKLRNAMGSASATIRVQILDKPG---------------------PPGG 26971

Query: 400   ASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTL 459
                F+    +K  + +    +            +I H+  E +        S   W    
Sbjct: 26972 PIEFKTVTAEKITLLWRPPADDGGA--------KITHYIVEKR------ETSRVVWSMVS 27017

Query: 460   WSGERATLTFSHLNKEDEGLYTIRV----RMGEYYEQYSAYVFVRDADAEIEGAPAAPLD 515
                E   +T + + K +E ++ +R      +GE  E  S  V  ++A     G P  P  
Sbjct: 27018 EHLEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDS--VVAKNAFVT-PGPPGIP-- 27072

Query: 516   VKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLI 575
              +  +  K+ + + W +P  DGGS I GYF++K +  +  W +     ++  R  VTGL 
Sbjct: 27073 -EVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLT 27131

Query: 576   EGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEG 635
             E   Y +RV AVN  G G  S  SE   A DP +                          
Sbjct: 27132 ENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDP------------------------- 27166

Query: 636   IVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKS 694
               PGPP  + + ++T+S + L W  P   G   +  Y VE  +   E W  V+T+  V++
Sbjct: 27167 --PGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRT 27224

Query: 695   PRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTS 754
               + + +L  G +Y FRV   N AG GEP E  E     D L+ P+    +       TS
Sbjct: 27225 TEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVA----LRTS 27280

Query: 755   VVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAV 814
             V+   +  +D + L+ +  +     +  W     N    +R++     T  S +  +  V
Sbjct: 27281 VIA--KAGEDVQVLIPF--KGRPPPTVTWRKDEKNLGSDARYSIEN--TDSSSLLTIPQV 27334

Query: 815   NAAGLSEY---------SQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIG 865
                   +Y            S  + VK  +  P+    +      R ++ L W  P   G
Sbjct: 27335 TRNDTGKYILTIENGVGEPKSSTVSVK-VLDTPAACQKLQVKHVSRGTVTLLWDPPLIDG 27393

Query: 866   GAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGA 925
             G+ I  Y +  R   D     W   + K  S  ++K+ +L E   + F+V A N  G+G 
Sbjct: 27394 GSPIINYVIEKR---DATKRTWSVVSHKC-SSTSFKLIDLSEKTPFFFRVLAENEIGIGE 27449

Query: 926   PSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAK 985
             P   +E  K  E    VP P   L   +  K S++L W  P   G + +T Y V   E K
Sbjct: 27450 PCETTEPVKAAE----VPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVV---ERK 27502

Query: 986   AKEDQ-WRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETR-- 1042
              K +Q W   +    K   ++V  LKE     FRV A N+ G+  P  + GP+  +    
Sbjct: 27503 GKGEQTWS--HAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTI-GPITVKELII 27559

Query: 1043  ---------PGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESK 1093
                      PG  +V V +  +  + L +   K  PK   SW KD +  ++S  +     
Sbjct: 27560 TPEVDLSDIPGA-QVTVRIGHNVHLELPY---KGKPKPSISWLKDGLPLKESEFVRFSKT 27615

Query: 1094  GNKTKMTFKDLGMDDLGIYS 1113
              NK  ++ K+   +  G Y+
Sbjct: 27616 ENKITLSIKNAKKEHGGKYT 27635



 Score =  179 bits (454), Expect = 2e-44
 Identities = 174/639 (27%), Positives = 266/639 (41%), Gaps = 71/639 (11%)

Query: 500   RDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQC 559
             RDA  +    P   +D+K    +K    I WK+P  DGGS I+GY +D      + W + 
Sbjct: 19875 RDA-VKASQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFL-TEENKWQRV 19932

Query: 560   NDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDP--AEKARLKSRP 617
               +     ++    L EG+ Y FRV A N+ G G PS ++  V A D   A    LK  P
Sbjct: 19933 MKS--LSLQYSAKDLTEGKEYTFRVSAENENGEGTPSEIT--VVARDDVVAPDLDLKGLP 19988

Query: 618   SAPWTGQIIVTEEEPSEGIVP--GPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEK 675
                +    +  E       +P  G P              +SWK               K
Sbjct: 19989 DLCY----LAKENSNFRLKIPIKGKPAPS-----------VSWK---------------K 20018

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
              E       RV+ E    +    ++D  +  +  + +   N AG  E +    + VVG K
Sbjct: 20019 GEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGT--ISIKVVG-K 20075

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKG 793
               IP  P K      T  ++ + W   KD    E+  Y +E   + + KW  C +  V+ 
Sbjct: 20076 PGIPTGPIKF--DEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCAS-AVQK 20132

Query: 794   SRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDS 853
             + F    L  G  Y FRV A N  G+ E    SE I  +     P  P     ++   DS
Sbjct: 20133 TTFRVTRLHEGMEYTFRVSAENKYGVGE-GLKSEPIVARHPFDVPDAPPPPNIVDVRHDS 20191

Query: 854   MVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQF 913
             + L W  P K GG+ ITGY++ ++E    +   W+ AN   +    +K++ L E + Y+F
Sbjct: 20192 VSLTWTDPKKTGGSPITGYHLEFKERNSLL---WKRANKTPIRMRDFKVTGLTEGLEYEF 20248

Query: 914   QVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTP 973
             +V A+N+AG+G PS  SE     +  I  PG P  +    + ++S+ L W  P + G   
Sbjct: 20249 RVMAINLAGVGKPSLPSEPVVALD-PIDPPGKPEVIN---ITRNSVTLIWTEPKYDGGHK 20304

Query: 974   VTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG-VGKPSD 1032
             +TGY V+ ++  +K   W   N   +      V  L EG  Y FR+RA N AG +  PS+
Sbjct: 20305 LTGYIVEKRDLPSK--SWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSE 20362

Query: 1033  LAGPVVAETR---------PGTKE-VVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVST 1082
                 ++ +           P  K+ + +   D  V++      K  PKS  SWSK     
Sbjct: 20363 STETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKS--SWSKAGKDI 20420

Query: 1083  EDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1121
               S   ++ S    + +T K     D G Y+   T+  G
Sbjct: 20421 RPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFG 20459



 Score =  179 bits (453), Expect = 2e-44
 Identities = 161/559 (28%), Positives = 239/559 (42%), Gaps = 51/559 (9%)

Query: 508   GAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFA 567
             G P +P  +   E  K  I + WK+P  +GGSPI GY I+K       + + N       
Sbjct: 15293 GPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTT 15352

Query: 568   RFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALD---PAEKARLKSRPSAPWTGQ 624
              F V  L E + Y FRV+AVN++G   PS     V   D   P  K RL  R        
Sbjct: 15353 SFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDT----- 15407

Query: 625   IIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQ 684
             I V   EP    +P   T L + +       + W     +    I    +  +   E   
Sbjct: 15408 IKVKAGEPVH--IPADVTGLPMPK-------IEWS----KNETVIEKPTDALQITKEEVS 15454

Query: 685   RVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGK 744
             R   +  +  P+    D        + V  SN  G    +   EV       D P  P  
Sbjct: 15455 RSEAKTELSIPKAVREDKGT-----YTVTASNRLGSVFRNVHVEV------YDRPSPPRN 15503

Query: 745   IIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGK--WEPCNNNPVKGSRFTCHG 800
             +  +     S  ++W+   D    E+  Y I+   A   K  WE   N  V+  R+    
Sbjct: 15504 LAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVE-KRYGIWK 15562

Query: 801   LVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQ 860
             L+    Y FRVRAVN  G+S+  + S+ + ++     P PP     L   + SM++ W  
Sbjct: 15563 LIPNGQYEFRVRAVNKYGISDECK-SDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTP 15621

Query: 861   PDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYK-----ISNLKENMVYQFQV 915
             P   GG+ ITGY++  RE  +G P  W   +   +++   K     +  L E + YQF+ 
Sbjct: 15622 PLDNGGSPITGYWLEKRE--EGSP-YWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRA 15678

Query: 916   AAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVT 975
              A+N AG+G PS  S+     +  I  PGPP   +  +  K S+ L WKPP   G +P+ 
Sbjct: 15679 MAINAAGIGPPSEPSDPEVAGD-PIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIK 15737

Query: 976   GYFVDLKEAKAKEDQWRGLNEA--AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDL 1033
             GY V+++E    +  W+ +NE    I      V  LKE   Y FRV+A+N+AG  +PSD 
Sbjct: 15738 GYIVEMQEEGTTD--WKRVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDT 15795

Query: 1034  AGPVVAETRPGTKEVVVNV 1052
              G + A       EV +++
Sbjct: 15796 TGEIPATDIQEEPEVFIDI 15814



 Score =  178 bits (452), Expect = 3e-44
 Identities = 172/622 (27%), Positives = 261/622 (41%), Gaps = 83/622 (13%)

Query: 439   PEIQWYRNGVPLS-PSKWVQTLW-----SGERATLTFSHLNKEDEGLYTIRV--RMGEYY 490
             P+I+W +N   +  P+  +Q        S  +  L+     +ED+G YT+    R+G  +
Sbjct: 15428 PKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVF 15487

Query: 491   EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCE 550
                      R+   E+   P+ P ++   +   +   ++W  P  +GGS I  Y IDK +
Sbjct: 15488 ---------RNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRD 15538

Query: 551   VGTD--SWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPA 608
                    W +  +T V+  R+ +  LI    Y FRVRAVNK GI    + S+ V   DP 
Sbjct: 15539 ASRKKAEWEEVTNTAVE-KRYGIWKLIPNGQYEFRVRAVNKYGISDECK-SDKVVIQDPY 15596

Query: 609   EKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEG 668
                                         +PGPP    V   T+  +++SW PP   G   
Sbjct: 15597 R---------------------------LPGPPGKPKVLARTKGSMLVSWTPPLDNGGSP 15629

Query: 669   IM-YFVEKCEAGTENWQRVN----TELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEP 723
             I  Y++EK E G+  W RV+    T++ +K   F +  L EG  Y FR    N+AG+G P
Sbjct: 15630 ITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPP 15689

Query: 724   SEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE-ESKD-AKELVGYYIEASVAGSG 781
             SE ++  V GD +  P  P        T +S+ + W+  +KD    + GY +E    G+ 
Sbjct: 15690 SEPSDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTT 15749

Query: 782   KWEPCNNNPVKGSRFTCHGLVTG----QSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAP 837
              W+   N P K    TC  +V      + Y FRV+AVN AG SE S  +  I        
Sbjct: 15750 DWKRV-NEPDK-LITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEE 15807

Query: 838   PSPPCDI---TCLESFRDSMVLGWKQPDKIGGAEITGYYVNY-----REVIDGVPGKWRE 889
             P    DI    CL     S +   + P  I G         +     + + DGV     +
Sbjct: 15808 PEVFIDIGAQDCLVCKAGSQI---RIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPED 15864

Query: 890   ANVK-AVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHS 948
             A ++ A +     I   K +   ++ + A N AG        +   C    + VPGPP  
Sbjct: 15865 AQLETAENSSVIIIPECKRSHTGKYSITAKNKAG-------QKTANCRVKVMDVPGPPKD 15917

Query: 949   LKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRG 1008
             LK S++ + S  L WK P   G   + GY ++ +    K   W  +N       ++ V  
Sbjct: 15918 LKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGK--AWTKVNPDCGSTTFV-VPD 15974

Query: 1009  LKEGVSYVFRVRAINQAGVGKP 1030
             L     Y FRVRA N+ G+G P
Sbjct: 15975 LLSEQQYFFRVRAENRFGIGPP 15996



 Score =  178 bits (451), Expect = 4e-44
 Identities = 171/643 (26%), Positives = 272/643 (42%), Gaps = 79/643 (12%)

Query: 438   QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
             +P I W ++G+PL  +  +    S +  TL+    +K+D G Y I V       Q +A +
Sbjct: 23258 KPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITV--ANVVGQKTASI 23315

Query: 498   FVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
              +   D      P  P  VK  + + + I +SW  P   GG  I  Y + K +  T  W 
Sbjct: 23316 EIVTLDK--PDPPKGP--VKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWD 23371

Query: 558   QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRP 617
               + T V      VT L  G  Y FR+ A N+ G  F +  S+P+ A  P ++       
Sbjct: 23372 VVSAT-VARTTLKVTKLKTGTEYQFRIFAENRYGQSF-ALESDPIVAQYPYKE------- 23422

Query: 618   SAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKC 676
                                 PGPP     T  ++  +V+ W  P   G   ++ Y +E+ 
Sbjct: 23423 --------------------PGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERK 23462

Query: 677   EAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKL 736
             E  +  W +VN  + +   +F   +L EG  Y FRV   N  GVG+ S+ +E  V  D  
Sbjct: 23463 ERNSILWTKVNKTI-IHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPC 23521

Query: 737   DIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCNNNPVKGS 794
             D P  P  I+  RN    + + W +        + GY +E      G+W   +   V  +
Sbjct: 23522 DPPGTPEPIMVKRN---EITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIET 23578

Query: 795   RFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDS 853
             +FT  GL   Q Y FRV A NAAG +S+ S  +  I  K  +  P    D      FRD+
Sbjct: 23579 QFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMD----PKFRDT 23634

Query: 854   MVLGWKQPDKIGGAEITG-------YYVNYREVIDGVPGKWREANVKA--VSEEAYKISN 904
             +V+   +  ++  A++ G       +    +E+ +    + +  + KA  + ++A +I  
Sbjct: 23635 IVVNAGETFRL-EADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDG 23693

Query: 905   LKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHS-LKCSEVRKDSLVLQW 963
                    Q+ + A N+AG       S+ F      +  PGPP   ++ + V  +   L W
Sbjct: 23694 ------GQYILRASNVAG-------SKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTW 23740

Query: 964   KPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAIN 1023
              PP+  G + ++ Y V+ +E       W  +    + N  LKV  L EG  YVFR+ A+N
Sbjct: 23741 SPPLQDGGSDISHYVVEKRETSRL--AWTVVASEVVTN-SLKVTKLLEGNEYVFRIMAVN 23797

Query: 1024  QAGVGKPSDLA-----GPVVAETRPGTKEVVVNVDDDGVISLN 1061
             + GVG+P + A      P V    P + EV     D   +  N
Sbjct: 23798 KYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWN 23840



 Score =  177 bits (449), Expect = 7e-44
 Identities = 155/641 (24%), Positives = 273/641 (42%), Gaps = 58/641 (9%)

Query: 505   EIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPV 564
             ++   P  P  +   +  ++ + +SW +P  DGGS I+ Y ++     ++ WS+C    V
Sbjct: 23126 KVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSEC--ARV 23183

Query: 565   KFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQ 624
             K  +  +T L +G  Y+FRV AVN+ G   P  ++ P+ A D   +  +K   S      
Sbjct: 23184 KSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFS------ 23237

Query: 625   IIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQ 684
                     S  +  G    + V  + R    ++W   G                  +   
Sbjct: 23238 --------SYSVQVGQDLKIEVPISGRPKPTITWTKDG---------------LPLKQTT 23274

Query: 685   RVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGK 744
             R+N    +     ++ +  +     + +  +N   VG+ + + E+  + DK D PK P K
Sbjct: 23275 RINVTDSLDLTTLSIKETHKDDGGQYGITVANV--VGQKTASIEIVTL-DKPDPPKGPVK 23331

Query: 745   IIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLV 802
                   +  S+ +SW         ++  Y ++     +  W+  +   V  +      L 
Sbjct: 23332 F--DDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSAT-VARTTLKVTKLK 23388

Query: 803   TGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPD 862
             TG  Y FR+ A N  G S ++ +S+ I  +     P PP         +DSMV+ W +P 
Sbjct: 23389 TGTEYQFRIFAENRYGQS-FALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPV 23447

Query: 863   KIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAG 922
               GG+ + GY++  +E    +   W + N   + +  +K  NL+E + Y+F+V A N+ G
Sbjct: 23448 NNGGSPVIGYHLERKERNSIL---WTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVG 23504

Query: 923   LGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLK 982
             +G  S  SEC+   +     PG P  +    V+++ + LQW  PV+ G + +TGY V+ +
Sbjct: 23505 VGKASKNSECYVARD-PCDPPGTPEPIM---VKRNEITLQWTKPVYDGGSMITGYIVEKR 23560

Query: 983   EAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG-VGKPSDLAGPVVAET 1041
             +    + +W   +   +      V GL E   Y FRV A N AG + KPSD  GP+ A+ 
Sbjct: 23561 DLP--DGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKD 23618

Query: 1042  RPGTKEVVVNVDDDGVISLN------FECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKG 1094
                   + ++      I +N       E D    P     W +     E+S R E+++  
Sbjct: 23619 EVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTD 23678

Query: 1095  NKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKR 1135
              K  +  KD    D G Y    ++  G + S+ ++ + L R
Sbjct: 23679 FKALLIVKDAIRIDGGQYILRASNVAG-SKSFPVNVKVLDR 23718



 Score =  176 bits (445), Expect = 2e-43
 Identities = 165/624 (26%), Positives = 272/624 (43%), Gaps = 67/624 (10%)

Query: 519   LEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGR 578
             ++  ++ I + W  P  DGGS I+GY I+K + G + W +CN T V   ++ VTGL  G 
Sbjct: 27864 IDVTRETITLKWNPPLRDGGSKIVGYSIEKRQ-GNERWVRCNFTDVSECQYTVTGLSPGD 27922

Query: 579   SYIFRVRAVNKMG-IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIV 637
              Y FR+ A N +G I  PS+ S  +   D      ++  P             E  +G++
Sbjct: 27923 RYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGP-------------EYFDGLI 27969

Query: 638   PGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRF 697
                   +   E+ R   ++  +P  +     + +F +    G E  +R+N E+       
Sbjct: 27970 ------IKSGESLRIKALVQGRPVPR-----VTWFKD----GVEIEKRMNMEITDVLGST 28014

Query: 698   ALF--DLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKII-PSRNTDTS 754
             +LF  D        + V   N++G    S   E+     K+ +   PGK++ P R T+ +
Sbjct: 28015 SLFVRDATRDHRGVYTVEAKNASG----SAKAEI-----KVKVQDTPGKVVGPIRFTNIT 28065

Query: 755   ---VVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIF 809
                + + W+   +     +  Y IE        W    +   +   +T   L+ G  Y F
Sbjct: 28066 GEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDK-CEAQSYTAIKLINGNEYQF 28124

Query: 810   RVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEI 869
             RV AVN  G+     DS+ +  +     P  P          +S+ L W +P+  GG+EI
Sbjct: 28125 RVSAVNKFGVGR-PLDSDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEI 28183

Query: 870   TGYYVNYREVIDGVPGKW-REANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSA 928
               Y +  RE       +W +  + + +SE  +K++ L E   Y+F V A N AG+G  S 
Sbjct: 28184 QQYILERREKKST---RWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASG 28240

Query: 929   VSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKE 988
             +S   KC E  +  PGPP  +K ++  K ++ L+W  PV  G   + GY +++   KA  
Sbjct: 28241 ISRLIKCRE-PVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEM--CKADL 28297

Query: 989   DQWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKE 1047
               W  +N EA +K  Y  V  L+ G  Y FRV AIN AG G   ++ G + A  R    E
Sbjct: 28298 GDWHKVNAEACVKTRY-TVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPE 28356

Query: 1048  VVV-------NVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMT 1100
             + +       +V   G     F   +  P     WSK    +  S R ++ +  + + +T
Sbjct: 28357 LDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKP--DSNLSLRADIHTTDSFSTLT 28414

Query: 1101  FKDLGMDDLGIYSCDVTDTDGIAS 1124
              ++   +D G Y+  V +  G  S
Sbjct: 28415 VENCNRNDAGKYTLTVENNSGSKS 28438



 Score =  175 bits (443), Expect = 4e-43
 Identities = 164/643 (25%), Positives = 264/643 (41%), Gaps = 81/643 (12%)

Query: 412   DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSH 471
             DV   R G+T+ +  RV   PE     P+I W + G  L   K V  +    R  L    
Sbjct: 17916 DVITVRVGQTIRILARVKGRPE-----PDITWTKEGKVLVREKRVDLIQDLPRVELQIKE 17970

Query: 472   LNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWK 531
               + D G Y I  +    + Q SA V V D        P    ++K     K+   ISW+
Sbjct: 17971 AVRADHGKYIISAKNSSGHAQGSAIVNVLDR-------PGPCQNLKVTNVTKENCTISWE 18023

Query: 532   QPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMG 591
              P  +GGS I  + ++  +     WS       K  R     L+    Y FRV A NK+G
Sbjct: 18024 NPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTK--RLIKANLLANNEYYFRVCAENKVG 18081

Query: 592   IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATR 651
             +G       P+ A++P ++                           PG P +L + +  +
Sbjct: 18082 VGPTIETKTPILAINPIDR---------------------------PGEPENLHIADKGK 18114

Query: 652   SYVVLSWKPPG-QRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCF 710
             ++V L W+ P    G   + Y VE+   G+++W+RV+    +K   + +    E + Y F
Sbjct: 18115 TFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKG-SIKETHYMVDRCVENQIYEF 18173

Query: 711   RVRCSNSAGVGEPSEATEVTVVGDK----LDIPKAPGKIIPSRNT---DTSV------VV 757
             RV+  N  G  +  +  EV V  D     LD+  +    + + +T   +  V       V
Sbjct: 18174 RVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEV 18233

Query: 758   SWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAA 817
             +W + KDA +L        V    + +    +  K  R        G  Y+  V A N A
Sbjct: 18234 AWTKDKDATDLTR---SPRVKIDTRADSSKFSLTKAKRSD------GGKYV--VTATNTA 18282

Query: 818   GLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYR 877
             G         A      +  P P  ++  ++   D   + W  P+  GG EI  Y +   
Sbjct: 18283 G------SFVAYATVNVLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKC 18336

Query: 878   EVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEE 937
             E    V   W   +   ++     ++ L E   Y F+V A N  G G P+         +
Sbjct: 18337 ETKRMV---WSTYSATVLTPGT-TVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTK 18392

Query: 938   WTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEA 997
             +    PG P   + ++V K+ + + W PP + G   +TGYF++ KE  +   +W  +N++
Sbjct: 18393 YD--KPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHST--RWVPVNKS 18448

Query: 998   AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAE 1040
             AI    +KV+ L     Y FRV+A N+ G+G+PS  + PVVA+
Sbjct: 18449 AIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAK 18491



 Score =  174 bits (440), Expect = 8e-43
 Identities = 163/620 (26%), Positives = 263/620 (42%), Gaps = 82/620 (13%)

Query: 438   QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
             +P I W ++G+PL  S++V+   +  + TL+  +  KE  G YT+ +            V
Sbjct: 27592 KPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITV 27651

Query: 498   FVRDADAEIEGAPAAPL-DVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
                       G P+ P   ++  E   D +I+SW  P  +GG  I  Y I+K E    +W
Sbjct: 27652 ITL-------GPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNW 27704

Query: 557   SQ-CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKS 615
                C+   V    F V  L++   Y FRVRA N+ G+                       
Sbjct: 27705 KMVCSS--VARTTFKVPNLVKDAEYQFRVRAENRYGV----------------------- 27739

Query: 616   RPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYF-VE 674
               S P    IIV + +     +PGPP    +   T   + L+W  P   G   +  F VE
Sbjct: 27740 --SQPLVSSIIVAKHQFR---IPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVE 27794

Query: 675   KCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGD 734
             K E  +  WQ+VNT  P+    +    L EG  Y FRV   NSAG+  PS+ ++ T+   
Sbjct: 27795 KKERNSILWQKVNTS-PISGREYRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLAVS 27853

Query: 735   KLDIPKAPGKIIPSRNTDTSVVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVK 792
              +D P  P  I  +R T   + + W         ++VGY IE    G+ +W  CN   V 
Sbjct: 27854 PVDPPGTPDYIDVTRET---ITLKWNPPLRDGGSKIVGYSIEKR-QGNERWVRCNFTDVS 27909

Query: 793   GSRFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIAPPSPPCDITCLESFR 851
               ++T  GL  G  Y FR+ A NA G +S  SQ S  I  +    PP     +     + 
Sbjct: 27910 ECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPI----VEFGPEYF 27965

Query: 852   DSMVLGWKQPDKIGGAEITGYYVNYREVIDGVP---GKWREANVKAVSEEAYKISNLKEN 908
             D +++             +G  +  + ++ G P     W +  V+       +I+++  +
Sbjct: 27966 DGLIIK------------SGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGS 28013

Query: 909   MVYQFQVAAMNMAGL-------GAPSAVSEC-FKCEEWTIAVPGPPHSLKCSEVRKDSLV 960
                  + A  +  G+        + SA +E   K ++    V GP   ++ + +  + + 
Sbjct: 28014 TSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGP---IRFTNITGEKMT 28070

Query: 961   LQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVR 1020
             L W  P++ G  P+T Y ++ +E       W  + +      Y  ++ L  G  Y FRV 
Sbjct: 28071 LWWDAPLNDGCAPITHYIIEKRETSRL--AWALIEDKCEAQSYTAIK-LINGNEYQFRVS 28127

Query: 1021  AINQAGVGKPSDLAGPVVAE 1040
             A+N+ GVG+P D + PVVA+
Sbjct: 28128 AVNKFGVGRPLD-SDPVVAQ 28146



 Score =  172 bits (437), Expect = 2e-42
 Identities = 226/950 (23%), Positives = 372/950 (39%), Gaps = 134/950 (14%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P++ W    + L  +  V    + +R TLT     + D G Y + +      + +S  V 
Sbjct: 28677 PKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVV 28736

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V      + G    P++V  + A     ++SW +P   GG+ I  Y ++K E GT +W  
Sbjct: 28737 VIGRPGPVTG----PIEVSSVSAES--CVLSWGEPKDGGGTEITNYIVEKRESGTTAWQL 28790

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
              N + VK  +  VT L +   Y FRV + N+ G+  P   S P+ A  P           
Sbjct: 28791 VNSS-VKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE-SAPIIAEHPF---------- 28838

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                              + P  PT   V   + + + + W+ P   G   I+ Y+VEK E
Sbjct: 28839 -----------------VPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKE 28881

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
               T  W + N ++P     + +  L EG  Y FR    N+AGV + SEA+   +  + +D
Sbjct: 28882 RNTILWVKEN-KVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVD 28940

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIE---ASVAGSGKWEPCNNNPVKGS 794
              P  P     +R+T  S++ S        ++VGY IE    S  G G+W  CN   V  +
Sbjct: 28941 APGRPEVTDVTRST-VSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDN 28999

Query: 795   RFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIAPPSPPCDITC---LESF 850
              FT   L  G +Y FRV A NAAG +S+ S+ +  +  +   APP    D      L + 
Sbjct: 29000 FFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTI 29059

Query: 851   R-------DSMVLGWKQPDKI---GGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAY 900
             R       D+ V G  +P  I   G  E+        ++ + V  ++      AV +   
Sbjct: 29060 RAGSDLVLDAAVGGKPEPKIIWTKGDKEL--------DLCEKVSLQYTGKRATAVIKFCD 29111

Query: 901   KISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLV 960
             +  + K      + +   N +G  A S + +        +  PGP   L  S V ++   
Sbjct: 29112 RSDSGK------YTLTVKNASGTKAVSVMVK-------VLDSPGPCGKLTVSRVTQEKCT 29158

Query: 961   LQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVR 1020
             L W  P   G   +T Y V+ +E       W  +        Y+  R +K    Y+FRVR
Sbjct: 29159 LAWSLPQEDGGAEITHYIVERRETSRL--NWVIVEGECPTLSYVVTRLIKNN-EYIFRVR 29215

Query: 1021  AINQAGVGKPSDLAGPVVA--------------ETRPGTKEVVVN----VDDDGVISLNF 1062
             A+N+ G G P + + P+VA              E   G + +++       D G    N+
Sbjct: 29216 AVNKYGPGVPVE-SEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNY 29274

Query: 1063  ECDKMTPKSEFSW---SKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDT 1119
               DK   KS   W   +KDYV  +            + K+T    G D    Y   VT  
Sbjct: 29275 LVDKREKKS-LRWTRVNKDYVVYD-----------TRLKVTSLMEGCD----YQFRVTAV 29318

Query: 1120  DGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKV 1179
             +   +S   +  E    ++   E  +   P  +   V+  +      W +     G   V
Sbjct: 29319 NAAGNS---EPSEASNFIS-CREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIV 29374

Query: 1180  NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVG 1239
              Y+   +E      Y++H +      E  +  L+   +  Y+F++           V V 
Sbjct: 29375 GYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQK--YSFRV---------AAVNVK 29423

Query: 1240  DVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVA-NIKKETHIVWYKD 1298
              + +  +  AE +  E I        + L   VT      L+  V+ + +    I W K 
Sbjct: 29424 GMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQ 29483

Query: 1299  EREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLV 1348
               +++     D  +    L++ + ++ DAG Y +  ++  GK KS   LV
Sbjct: 29484 GIDLASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGK-KSATVLV 29532



 Score =  169 bits (427), Expect = 3e-41
 Identities = 167/626 (26%), Positives = 253/626 (40%), Gaps = 57/626 (9%)

Query: 509   APAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFAR 568
             AP+ P  +  ++  K  + ++W +P  DGGS I GY I+    G+D W+    T VK   
Sbjct: 20964 APSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHI--TTVKGLE 21021

Query: 569   FPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVT 628
               V  L EG  Y F+V AVN  G   P R S PV   +      L  R       ++++ 
Sbjct: 21022 CVVRNLTEGEEYTFQVMAVNSAGRSAP-RESRPVIVKEQTMLPELDLRGIYQ---KLVIA 21077

Query: 629   EEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNT 688
             +         G    + +    R    ++WK               K +   +  QRVN 
Sbjct: 21078 KA--------GDNIKVEIPVLGRPKPTVTWK---------------KGDQILKQTQRVNF 21114

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAP-GKIIP 747
             E    S    + +     S  + +   N   VGE  +   + V     DIP  P G I  
Sbjct: 21115 ETTATSTILNINECVRSDSGPYPLTARNI--VGEVGDVITIQVH----DIPGPPTGPIKF 21168

Query: 748   SRNTDTSVVVSWE--ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQ 805
                +   V  SW+  E+     +  Y +E     S  W       ++ + +    L TG 
Sbjct: 21169 DEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTVIR-TTYKATRLTTGL 21227

Query: 806   SYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIG 865
              Y FRV+A N  G+      S  I        P PP         +DSM + W +P   G
Sbjct: 21228 EYQFRVKAQNRYGVGP-GITSACIVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDG 21286

Query: 866   GAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGA 925
             G+ I GY+V  +E  +G+   W+  +   V    +K S L + + Y+F+V A NMAG   
Sbjct: 21287 GSPILGYHVERKER-NGI--LWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSK 21343

Query: 926   PSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAK 985
             PS  SE     +  I  PG P  L    + + ++ L+W  P ++G   +T Y V+ ++  
Sbjct: 21344 PSKPSEPMLALD-PIDPPGKPVPLN---ITRHTVTLKWAKPEYTGGFKITSYIVEKRDLP 21399

Query: 986   AKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG-VGKPSDLAGPVVAETRPG 1044
                 +W   N + I      V GL E  +Y FRV A N AG +  PS+ +  +       
Sbjct: 21400 --NGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVE 21457

Query: 1045  TKEVVVNVD-DDGVI-----SLNFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKGNKT 1097
               ++ V+V   D VI     +   E D    P     WSKD    E + +LE++     T
Sbjct: 21458 APKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFST 21517

Query: 1098  KMTFKDLGMDDLGIYSCDVTDTDGIA 1123
              +  KD    D G Y+   T+  G A
Sbjct: 21518 NLVNKDSTRRDSGAYTLTATNPGGFA 21543



 Score =  168 bits (425), Expect = 4e-41
 Identities = 215/837 (25%), Positives = 338/837 (40%), Gaps = 135/837 (16%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESR-YGM------HTLEINGCDF 344
             E  +L C I G P P + WY+           GK +I+SR Y M      HTL +   + 
Sbjct: 30548 EAAQLSCQIVGRPLPDIKWYRF----------GKELIQSRKYKMSSDGRTHTLTVMTEEQ 30597

Query: 345   EDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFE 404
             ED   Y   A N  GE+   + ++++         +FH G    PL              
Sbjct: 30598 EDEGVYTCIATNEVGEVETSSKLLLQA------TPQFHPG---YPLK------------- 30635

Query: 405   IHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGER 464
                 +K+   +G  G T+ L    +  P      P + W+     L  S+ + T+ + E 
Sbjct: 30636 ----EKY---YGAVGSTLRLHVMYIGRPV-----PAMTWFHGQKLLQNSENI-TIENTEH 30682

Query: 465   AT-LTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDA--DAEIEGAPAAPLDVKCLEA 521
              T L   ++ +        +   G+Y  Q S      DA  D EI+  P  P     +EA
Sbjct: 30683 YTHLVMKNVQR--------KTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEA 30734

Query: 522   N-KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSY 580
               K+  +ISWK PA DGGS I  Y ++KCE    +  Q   + +      +  L E   Y
Sbjct: 30735 LLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGY 30794

Query: 581   IFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGP 640
              FRV A N  GI  P  VS  V    P EK                           PG 
Sbjct: 30795 YFRVSAQNTFGISDPLEVSSVVIIKSPFEK---------------------------PGA 30827

Query: 641   PTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFAL 699
             P   ++T  T+   V++WKPP   G   I  Y++EK E     W  V TE  ++   F++
Sbjct: 30828 PGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTE-EIRETVFSV 30886

Query: 700   FDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIP-KAPGKIIPSRNTD----TS 754
              +L EG  Y FRV+C N  G  E SE +E   +  K D+P +AP      RN +    ++
Sbjct: 30887 KNLIEGLEYEFRVKCENLGGESEWSEISE--PITPKSDVPIQAPHFKEELRNLNVRYQSN 30944

Query: 755   VVVSWEESKDAKELVGYYIEAS--VAGSGKWEPCNNNPVKGS--RFTCHGLVTGQSYIFR 810
               +  + +   K +V +Y +    +A   K+        KG   +     +    + +++
Sbjct: 30945 ATLVCKVTGHPKPIVKWYRQGKEIIADGLKY---RIQEFKGGYHQLIIASVTDDDATVYQ 31001

Query: 811   VRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEIT 870
             VRA N  G S     S  +EV A I  P     +  + + R   V+  K P   G  +  
Sbjct: 31002 VRATNQGG-SVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGE-VVSIKIPFS-GKPDPV 31058

Query: 871   GYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVS 930
               +   +++ID   G ++    ++ +   +  + ++      + V A N  G+       
Sbjct: 31059 ITWQKGQDLIDN-NGHYQVIVTRSFTSLVFP-NGVERKDAGFYVVCAKNRFGIDQ----- 31111

Query: 931   ECFKCEEWTIA-VPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKED 989
                K  E  +A VP PP  +K S+V +DS+ L W  P   G + +T Y V+  +     +
Sbjct: 31112 ---KTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVE--KCATTAE 31166

Query: 990   QWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVV 1049
             +W  + +A  +     V  L    SY FRV A N+ G+ KPS+ + P + +     K   
Sbjct: 31167 RWLRVGQA--RETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKE---DKTRA 31221

Query: 1050  VNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLE-------VESKGNKTKM 1099
             +N D++   +      K +  S     + Y+  ED  R E       VE+   KT M
Sbjct: 31222 MNYDEEVDETREVSMTKASHSSTKELYEKYMIAEDLGRGEFGIVHRCVETSSKKTYM 31278



 Score =  167 bits (423), Expect = 7e-41
 Identities = 186/737 (25%), Positives = 305/737 (41%), Gaps = 84/737 (11%)

Query: 638   PGPPTD-LSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSP 695
             PGPP   +     +   + LSW PP   G   I  Y +EK EA  + W  V++E   K  
Sbjct: 16217 PGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSE--PKEC 16274

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSV 755
              + +  L EG  Y FR+   N  G+GEP ++ E     +   +P AP K   S  T  S+
Sbjct: 16275 TYTIPKLLEGHEYVFRIMAQNKYGIGEPLDS-EPETARNLFSVPGAPDKPTVSSVTRNSM 16333

Query: 756   VVSWEESK--DAKELVGYYIEASVAGSGKWEPCNNNPVK----GSRFTCHGLVTGQSYIF 809
              V+WEE +      + GY++E     S +W+  N +P+K    G  +   GL+ G  Y F
Sbjct: 16334 TVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQF 16393

Query: 810   RVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEI 869
             RV A+NAAG+   S  S+    +  IAPP PP      +  + S  L W  P K GG+++
Sbjct: 16394 RVYAINAAGVGPASLPSDPATARDPIAPPGPPFP-KVTDWTKSSADLEWSPPLKDGGSKV 16452

Query: 870   TGYYVNYREVIDGVPGK--WREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPS 927
             TGY V Y+E      GK  W +   K V      ++ LKE   Y+F+V A+N+AG+G P 
Sbjct: 16453 TGYIVEYKE-----EGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPG 16507

Query: 928   AVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVH-----SGRTPVTGYFVDLK 982
              V++  + ++  ++   P   L  S   +D +V+     +      SG+ P T   V   
Sbjct: 16508 EVTDVIEMKDRLVS---PDLQLDASV--RDRIVVHAGGVIRIIAYVSGKPPPT---VTWN 16559

Query: 983   EAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPS------DLAGP 1036
               +    Q   +   AI +  + ++  +     V+ + A N+AG  K +      D+ GP
Sbjct: 16560 MNERTLPQEATIETTAISSSMV-IKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGP 16618

Query: 1037  VVAETRPGTKEVVVNVDDDGVISLNF--ECDKMTPKSEFSWSKDYVSTEDSPRLEVESKG 1094
             V      GT  +  N+ ++      F  E D  +P + +   K     E   R       
Sbjct: 16619 V------GTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEK----RESDRRAWTPVTY 16668

Query: 1095  NKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSEL 1154
               T+      G+     Y   +   + I     ++  E    L +      P  P   +L
Sbjct: 16669 TVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEA---LVIREPITVPERP--EDL 16723

Query: 1155  AVEILEKGQVRFWMQAEKLSGNAKV-NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQ 1213
              V+ + K  V       K  G +++ NY+   + I      K H   N  ++        
Sbjct: 16724 EVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLI---GTEKFHKVTNDNLLSRKYTVKG 16780

Query: 1214  DEDEGTYTFQLQ------DGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEY 1267
              ++  TY +++        GK +  +  +   D         +F+ +  IR  G  F   
Sbjct: 16781 LKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIRV-GEAFA-- 16837

Query: 1268  LSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKK-- 1325
                 +TG  +   K KV+         W+KDE ++  D++   K    TL + +   K  
Sbjct: 16838 ----LTGRYSGKPKPKVS---------WFKDEADVLEDDRTHIKTTPATLALEKIKAKRS 16884

Query: 1326  DAGIYEVILKDDRGKDK 1342
             D+G Y V++++  G  K
Sbjct: 16885 DSGKYCVVVENSTGSRK 16901



 Score =  167 bits (423), Expect = 7e-41
 Identities = 226/924 (24%), Positives = 354/924 (38%), Gaps = 117/924 (12%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P  +W + G  +S    + T  S     L     ++ D G Y + +       + + Y+ 
Sbjct: 30166 PICKWTKEGQDISKRAMIAT--SETHTELVIKEADRGDSGTYDLVLE--NKCGKKAVYIK 30221

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             VR   +    +P  PL+   ++     + +SW+ PA DGG+ ILGY +++ EV   +W  
Sbjct: 30222 VRVIGSP--NSPEGPLEYDDIQVRS--VRVSWRPPADDGGADILGYILERREVPKAAWYT 30277

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
               D+ V+     V GL E   Y FRV A N+ GI  P +  EPV    P           
Sbjct: 30278 I-DSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTP----------- 30325

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                    +   E PS      PP    V + T+S V LSW  P   G   +  Y++E+ E
Sbjct: 30326 -------LNPPEPPS-----NPP---EVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKE 30370

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
               T+ W R N +  + +  + +  L     Y FR+   N  G+ E S A+E  V  D  D
Sbjct: 30371 TSTDKWVRHN-KTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFD 30429

Query: 738   IPKAPGKIIPSRNTDTSVVVSWE--ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSR 795
              P  PG++     +  SV + WE  E    KE++GY++E   +G   W+  N   +K  +
Sbjct: 30430 KPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQ 30489

Query: 796   FTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMV 855
             FT  GL+    Y FRV A N  GLS   +   A+ +K  +     P         R  M 
Sbjct: 30490 FTIGGLLEATEYEFRVFAENETGLSRPRR--TAMSIKTKLTSGEAP-------GIRKEMK 30540

Query: 856   LGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQV 915
                    K+G A      +  R + D    KW     + +    YK+S+           
Sbjct: 30541 ---DVTTKLGEAAQLSCQIVGRPLPD---IKWYRFGKELIQSRKYKMSSDGRTHTLTVMT 30594

Query: 916   AAMNMAGLGAPSAVSECFKCEEWTIAV--------PGPPHSLKCSEVRKDSLVLQWKPPV 967
                   G+    A +E  + E  +  +        PG P   K       +L L     +
Sbjct: 30595 EEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLH---VM 30651

Query: 968   HSGR-TPVTGYFVDLKEAKAKE----DQWRGLNEAAIKNVYLKVRG--LKEGVSYVF-RV 1019
             + GR  P   +F   K  +  E    +         +KNV  K      K  +S VF  V
Sbjct: 30652 YIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTV 30711

Query: 1020  RAINQAGV-GKPSDLAGPVVAETRPGTKEVV---VNVDDDGVISLNFECDKMTPKSEFSW 1075
              AI    +  KP    GP+V E       V+      DD G    N+  +K   K    W
Sbjct: 30712 DAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEW 30771

Query: 1076  SKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKR 1135
                           V S  + T     +L  +    +     +T GI+     D  E+  
Sbjct: 30772 QL------------VSSAISVTTCRIVNLTENAGYYFRVSAQNTFGIS-----DPLEVSS 30814

Query: 1136  LLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKV-NYIFNEKEIFEGPKY 1194
             ++ +    + P  P K  +   + +   V  W +     G AK+ NY   ++E     K 
Sbjct: 30815 VVIIKSPFEKPGAPGKPTITA-VTKDSCVVAW-KPPASDGGAKIRNYYLEKRE----KKQ 30868

Query: 1195  KMHIDRNTGIIEMFMEKLQDEDEG-TYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQR 1253
                I   T  I   +  +++  EG  Y F++   K  N        ++ + +  +++   
Sbjct: 30869 NKWISVTTEEIRETVFSVKNLIEGLEYEFRV---KCENLGGESEWSEISEPITPKSD--- 30922

Query: 1254  QEWIRKQGPHFVEYL-SWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVD----EKH 1308
                +  Q PHF E L +  V  + N  L CKV    K   + WY+  +EI  D       
Sbjct: 30923 ---VPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPI-VKWYRQGKEIIADGLKYRIQ 30978

Query: 1309  DFKDGICTLLITEFSKKDAGIYEV 1332
             +FK G   L+I   +  DA +Y+V
Sbjct: 30979 EFKGGYHQLIIASVTDDDATVYQV 31002



 Score =  160 bits (404), Expect = 1e-38
 Identities = 162/640 (25%), Positives = 260/640 (40%), Gaps = 84/640 (13%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             PA   D+   ++ K  +I+SW +P  DGGS I  Y +++   G  +WS    +  K    
Sbjct: 27463 PAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGIS--KTCEI 27520

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              V+ L E     FRV A N+ G+      S+PV                 P T + ++  
Sbjct: 27521 EVSQLKEQSVLEFRVFAKNEKGL------SDPVTI--------------GPITVKELIIT 27560

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTE 689
              E     +PG    + +       +    KP                   + +W  +   
Sbjct: 27561 PEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKP-----------------SISW--LKDG 27601

Query: 690   LPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSE---------ATEVTVVGDKLDIPK 740
             LP+K   F  F   E K     ++ +     G+ +          A  +TV+   L  P 
Sbjct: 27602 LPLKESEFVRFSKTENK-ITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVI--TLGPPS 27658

Query: 741   AP-GKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFT 797
              P G I        SV++SW+  +D    E+  Y IE        W+   ++ V  + F 
Sbjct: 27659 KPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCSS-VARTTFK 27717

Query: 798   CHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLG 857
                LV    Y FRVRA N  G+S+    S  I  K     P PP          D M L 
Sbjct: 27718 VPNLVKDAEYQFRVRAENRYGVSQ-PLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLT 27776

Query: 858   WKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAA 917
             W  P   GG+E+TG++V  +E    +   W++ N   +S   Y+ + L E + YQF+V A
Sbjct: 27777 WDAPVYDGGSEVTGFHVEKKERNSIL---WQKVNTSPISGREYRATGLVEGLDYQFRVYA 27833

Query: 918   MNMAGLGAPSAVSECFKCEEWTIAVP--GPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVT 975
              N AGL +PS  S      ++T+AV    PP +    +V ++++ L+W PP+  G + + 
Sbjct: 27834 ENSAGLSSPSDPS------KFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIV 27887

Query: 976   GYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG-VGKPSDLA 1034
             GY ++ ++     ++W   N   +      V GL  G  Y FR+ A N  G +  PS  +
Sbjct: 27888 GYSIEKRQG---NERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSS 27944

Query: 1035  GPVVAETRPGTKEVVVNVDD---DGVISLNFECDKM------TPKSEFSWSKDYVSTEDS 1085
             G ++  TR      +V       DG+I  + E  ++       P    +W KD V  E  
Sbjct: 27945 GIIM--TRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKR 28002

Query: 1086  PRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1125
               +E+      T +  +D   D  G+Y+ +  +  G A +
Sbjct: 28003 MNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKA 28042



 Score =  159 bits (401), Expect = 3e-38
 Identities = 182/772 (23%), Positives = 309/772 (40%), Gaps = 102/772 (13%)

Query: 274   LHAPEFIIKP-RSHTVWEK--ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIES 330
             L  PE  +K   SHTV+ +   N+K+   I+G P P+VT  ++ VP+       ++  E 
Sbjct: 26471 LEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATM---RFNTEI 26527

Query: 331   RYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPL 390
                  T+ +      D  +Y  +A N  G   A+ ++VV              G  T P+
Sbjct: 26528 TAENLTINLKESVTADAGRYEITAANSSGTTKAFINIVVLD----------RPGPPTGPV 26577

Query: 391   SFG-VTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVP 449
                 +T      ++E     K+D            G +V     +K              
Sbjct: 26578 VISDITEESVTLKWE---PPKYDG-----------GSQVTNYILLKR------------E 26611

Query: 450   LSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRV--RMGEYYEQYSAYVFVRDADAEIE 507
              S + W +   +  R  +    L   +E  + I+   R G      SA V V+       
Sbjct: 26612 TSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVK-LPYTTP 26670

Query: 508   GAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFA 567
             G P+ P         ++ I + W +P  +GGS ++GY ++  +  +  W + N   ++  
Sbjct: 26671 GPPSTPW---VTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTT 26727

Query: 568   RFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIV 627
              F VT +  G  Y FRV A N  G+G PS  SEPV A+D  E                  
Sbjct: 26728 HFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACE------------------ 26769

Query: 628   TEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRV 686
                         PP ++ +T+ +++ V LSW+ P   G   I  Y VE+ +     W + 
Sbjct: 26770 ------------PPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKA 26817

Query: 687   NTELPVKSPRFALFDLAEGKSYCFRVRCSNSAG-VGEPSEAT-EVTVV----GDKLDIPK 740
             +    V   +F +  L +   Y FRV   N+ G +  PSE    +T +    G  +D+P 
Sbjct: 26818 SF-TNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPL 26876

Query: 741   APGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHG 800
                +++  R   +  + +    K A  +  Y  +  +  +     C  N    +      
Sbjct: 26877 EYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNAL--VCVENTTDLASILIKD 26934

Query: 801   LVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQ 860
                  S  + ++  NA G +     S  I V+    P  P   I       + + L W+ 
Sbjct: 26935 ADRLNSGCYELKLRNAMGSA-----SATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRP 26989

Query: 861   PDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNM 920
             P   GGA+IT Y V  RE    V   W   + + + E     + + +   Y F+V A+N 
Sbjct: 26990 PADDGGAKITHYIVEKRETSRVV---WSMVS-EHLEECIITTTKIIKGNEYIFRVRAVNK 27045

Query: 921   AGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVD 980
              G+G P  +       +     PGPP   + +++ K+S+ + W  P+  G + ++GYF++
Sbjct: 27046 YGIGEP--LESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLE 27103

Query: 981   LKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSD 1032
              ++ K+    W  + +  I++   KV GL E   Y +RV A+N AG G  S+
Sbjct: 27104 KRDKKSL--GWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSE 27153



 Score =  157 bits (397), Expect = 8e-38
 Identities = 160/604 (26%), Positives = 253/604 (41%), Gaps = 69/604 (11%)

Query: 438   QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
             Q  + W ++G  L  +  V    S    +L+    +KED G Y + V            +
Sbjct: 25423 QATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITI 25482

Query: 498   FVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
              V D        P  P  ++  E + D I ISW  P  DGG  I  Y ++K E  + +W 
Sbjct: 25483 IVLDR-------PGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWH 25535

Query: 558   QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRP 617
               +   V      +  L  G  Y FRV A N+ G    S  S  VA             P
Sbjct: 25536 IVSQA-VARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVA-----------EYP 25583

Query: 618   SAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWK-PPGQRGHEGIMYFVEKC 676
              +P                 PGPP    V  AT+S ++++W+ P    G   I Y +E  
Sbjct: 25584 FSP-----------------PGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYK 25626

Query: 677   EAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKL 736
             E  +  W + N ++ +   +  +  L EG  Y +RV   N AG+G+ S++ E     D  
Sbjct: 25627 ERSSILWSKAN-KILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPC 25685

Query: 737   DIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCNNNPVKGS 794
             D    PG+   +  T  SV + W +       ++ GY +E      G+W  CN   ++ +
Sbjct: 25686 D---PPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQET 25742

Query: 795   RFTCHGLVTGQSYIFRVRAVNAA-GLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDS 853
              F    L   Q Y FRV A NAA  +SE S+ +  I VK  + PP    D+     FRD 
Sbjct: 25743 YFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDV----KFRDV 25798

Query: 854   MVLGWKQPDKIGGAEITGY---YVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENM- 909
             +V+   +  KI  A+I G     +++ +  DG+  + R A  + +S + + +  +K+ + 
Sbjct: 25799 IVVKAGEVLKI-NADIAGRPLPVISWAK--DGIEIEER-ARTEIISTDNHTLLTVKDCIR 25854

Query: 910   --VYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHS-LKCSEVRKDSLVLQWKPP 966
                 Q+ +   N+AG       S    C+   +  PGPP   L+ + +  +   L W  P
Sbjct: 25855 RDTGQYVLTLKNVAG-----TRSVAVNCK--VLDKPGPPAGPLEINGLTAEKCSLSWGRP 25907

Query: 967   VHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG 1026
                G   +  Y V+ +E       W  + E  ++    KV  L +G  Y+FRV  +N+ G
Sbjct: 25908 QEDGGADIDYYIVEKRE--TSHLAWT-ICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYG 25964

Query: 1027  VGKP 1030
             VG+P
Sbjct: 25965 VGEP 25968



 Score =  149 bits (375), Expect = 3e-35
 Identities = 167/712 (23%), Positives = 271/712 (38%), Gaps = 127/712 (17%)

Query: 294   VKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRAS 353
             ++L   + G P P+VTW K  +  NV       ++++   M  L I     +D+ +Y  +
Sbjct: 18624 IRLFAIVRGRPAPKVTWRKVGID-NVVRKGQVDLVDT---MAFLVIPNSTRDDSGKYSLT 18679

Query: 354   AMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDV 413
              +N  GE + + +V V    G   + +      T        P         H+     +
Sbjct: 18680 LVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHY-----I 18734

Query: 414   SFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLN 473
                RE +  +      +TPE+K                 S  V  L  G       + +N
Sbjct: 18735 VEKREADRKTWS---TVTPEVK---------------KTSFHVTNLVPGNEYYFRVTAVN 18776

Query: 474   KEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQP 533
             +   G+ T               V   D  +E    P  P  ++  E  K+   ++W  P
Sbjct: 18777 EYGPGVPT----------DVPKPVLASDPLSE----PDPPRKLEVTEMTKNSATLAWLPP 18822

Query: 534   AVDGGSPILGYFID--KCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMG 591
               DGG+ I GY     + E   D W++ +   VK     VTGL EG+ Y FRV A N +G
Sbjct: 18823 LRDGGAKIDGYITSYREEEQPADRWTEYS--VVKDLSLVVTGLKEGKKYKFRVAARNAVG 18880

Query: 592   IGF---------------PSRVSEPVA-ALDPAEKARL------KSRPSAPW-------- 621
             +                 P ++  P    +   +K R+      K  P+  W        
Sbjct: 18881 VSLPREAEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVV 18940

Query: 622   -----------TGQIIVTEE-------------EPSEGI-----------VPGPPTD-LS 645
                        +  I++ ++             E S G             PGPP     
Sbjct: 18941 TSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFD 19000

Query: 646   VTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAE 704
             +++       LSW  P + G   I  Y VEKC+    +W      +   S R     L  
Sbjct: 19001 ISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVG--KLIP 19058

Query: 705   GKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE--ES 762
             G+ Y FRVR  N  G+ EP  + ++ V      +P  P     ++     + V+W+  +S
Sbjct: 19059 GQEYIFRVRAENRFGISEPLTSPKM-VAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDS 19117

Query: 763   KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEY 822
                  ++GY IE     S  W   N+  V+ + + C GLV G  Y FR+ A+N AG S  
Sbjct: 19118 DGGSPIIGYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPP 19177

Query: 823   SQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDG 882
             S+ +E +  +  + PP  P     ++  + ++ L W +P   GG++I GY+V   +    
Sbjct: 19178 SKPTEYVTARMPVDPPGKP---EVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACK---- 19230

Query: 883   VPG-KWREANV--KAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSE 931
             +PG KW   N     + +E Y  + L+E   YQF+  A     +  PS  S+
Sbjct: 19231 LPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSD 19282



 Score =  144 bits (364), Expect = 5e-34
 Identities = 192/758 (25%), Positives = 305/758 (40%), Gaps = 92/758 (12%)

Query: 638   PGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFV-EKCEAGTEN--WQRVNTELPVKS 694
             P PP +L+VT+       L+W  P   G   I ++V +K +A  +   W+ V      K 
Sbjct: 15498 PSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEK- 15556

Query: 695   PRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTS 754
              R+ ++ L     Y FRVR  N  G+ +  ++ +V V+ D   +P  PGK      T  S
Sbjct: 15557 -RYGIWKLIPNGQYEFRVRAVNKYGISDECKSDKV-VIQDPYRLPGPPGKPKVLARTKGS 15614

Query: 755   VVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPV-----KGSRFTCHGLVTGQSY 807
             ++VSW    D     + GY++E    GS  W   +  P+     KG  F    L+ G  Y
Sbjct: 15615 MLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKY 15674

Query: 808   IFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGA 867
              FR  A+NAAG+   S+ S+       I PP PP      +  + S+ LGWK P K GG+
Sbjct: 15675 QFRAMAINAAGIGPPSEPSDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGS 15734

Query: 868   EITGYYVNYREVIDGVPGKWREANV--KAVSEEAYKISNLKENMVYQFQVAAMNMAGLGA 925
              I GY V  +E  +G    W+  N   K ++     + NLKE   Y+F+V A+N AG   
Sbjct: 15735 PIKGYIVEMQE--EGTTD-WKRVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESE 15791

Query: 926   PSAVSECFKC----EEWTIAVP-GPPHSLKCSEVRKDSLVLQWKPPVHSGR-TPVTGYFV 979
             PS  +         EE  + +  G    L C    +  +     P V  GR TP + +  
Sbjct: 15792 PSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRI-----PAVIKGRPTPKSSWEF 15846

Query: 980   DLKEAKAKEDQWRGLNE-----AAIKNVYLKVRGLKEGVSYVFRVRAINQAGVG------ 1028
             D K  KA +D    + E      A  +  + +   K   +  + + A N+AG        
Sbjct: 15847 DGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRV 15906

Query: 1029  KPSDLAGP-----VVAETRPGTKEVVVNVDDDGVISLN-FECDKMTPKSEFSWSKDYVST 1082
             K  D+ GP     V   TR   +      DDDG   +  +  +K T   + +W+K     
Sbjct: 15907 KVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGK-AWTK----- 15960

Query: 1083  EDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHE 1142
                    V      T     DL  +    +     +  GI        E ++R  A    
Sbjct: 15961 -------VNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPV----ETIQRTTARDPI 16009

Query: 1143  HKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFE--GPKYKMHIDR 1200
             +  P  P+K  L + ++ K  V    +  K  G + V +   E   ++  G K +     
Sbjct: 16010 YP-PDPPIK--LKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQC 16066

Query: 1201  NTGIIEMFMEKLQDEDEG-TYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRK 1259
             N   +E     ++D  EG  Y F++   KA N + V          +  A     +  R 
Sbjct: 16067 NKRDVEELQFTVEDLVEGGEYEFRV---KAVNAAGVS---------KPSATVGPCDCQRP 16114

Query: 1260  QGPHFVEYLSW-EVTGECNVLLKCKVANIKKETHIVWYK------DEREISVDEKHDFK- 1311
               P  ++   + EV    NV +  K+  +   T + W+K      D +E  + + H  K 
Sbjct: 16115 DMPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPT-LTWFKAPPKKPDNKEPVLYDTHVNKL 16173

Query: 1312  --DGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKL 1347
               D  CTL+I +  + D G+Y +   ++ G     ++L
Sbjct: 16174 VVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRL 16211



 Score =  142 bits (357), Expect = 3e-33
 Identities = 127/419 (30%), Positives = 181/419 (43%), Gaps = 48/419 (11%)

Query: 637   VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSP 695
             VPGPP DL V++ TR    LSWK P   G + I  Y +EK     + W +VN +    S 
Sbjct: 15911 VPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCG--ST 15968

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSV 755
              F + DL   + Y FRVR  N  G+G P E  + T   D +  P  P K+     T  +V
Sbjct: 15969 TFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTV 16028

Query: 756   VVSWEESK-DAKELVGYYIEASVA----GSGK--WEPCNNNPVKGSRFTCHGLVTGQSYI 808
              +SW+  K D    V +YI   +A    G+ K  W  CN   V+  +FT   LV G  Y 
Sbjct: 16029 HLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYE 16088

Query: 809   FRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAE 868
             FRV+AVNAAG+S+ S      + +    PPS       L+ F +                
Sbjct: 16089 FRVKAVNAAGVSKPSATVGPCDCQRPDMPPS-----IDLKEFMEVE-------------- 16129

Query: 869   ITGYYVNYREVIDGVPG---KWREANVKAVSEEAYKISNLKENMVYQFQVAAM------- 918
               G  VN    I GVP     W +A  K    +   + +   N +       +       
Sbjct: 16130 -EGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRR 16188

Query: 919   NMAGLGAPSAVSECFKCEEW----TIAVPGPP-HSLKCSEVRKDSLVLQWKPPVHSGRTP 973
             +  GL   +AV+      +      +  PGPP   +K   V  D + L W PP   G + 
Sbjct: 16189 SDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSK 16248

Query: 974   VTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSD 1032
             +T Y ++ +EA  K   W  ++    +  Y  +  L EG  YVFR+ A N+ G+G+P D
Sbjct: 16249 ITNYVIEKREANRK--TWVHVSSEPKECTY-TIPKLLEGHEYVFRIMAQNKYGIGEPLD 16304



 Score =  139 bits (349), Expect = 3e-32
 Identities = 161/644 (25%), Positives = 249/644 (38%), Gaps = 133/644 (20%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDT-PVKFAR 568
             P  P  ++  ++ K  I + W +P  DGGS + GY ++  +   + W+  +    V+   
Sbjct: 27167 PGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTE 27226

Query: 569   FPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARL--------------- 613
             + V+ L  G +Y FRV AVN  G G P  ++EPV A D  E   +               
Sbjct: 27227 YVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAG 27286

Query: 614   -----------KSRPSAPW---------------------------------TGQIIVTE 629
                        +  P+  W                                 TG+ I+T 
Sbjct: 27287 EDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTI 27346

Query: 630   E----EPSEGIV-------PGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
             E    EP    V       P     L V   +R  V L W PP   G   I+ Y +EK +
Sbjct: 27347 ENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRD 27406

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
             A    W  V+ +    S  F L DL+E   + FRV   N  G+GEP E TE     +   
Sbjct: 27407 ATKRTWSVVSHKC--SSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAE--- 27461

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEESK--DAKELVGYYIEASVAGSGKWEPCNNNPVKGSR 795
             +P     +    +T TSV++SW +        +  Y +E    G   W         G  
Sbjct: 27462 VPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHA------GIS 27515

Query: 796   FTCHGLVTG---QSYI-FRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFR 851
              TC   V+    QS + FRV A N  GLS+       I VK  I   +P  D++      
Sbjct: 27516 KTCEIEVSQLKEQSVLEFRVFAKNEKGLSD-PVTIGPITVKELII--TPEVDLS------ 27566

Query: 852   DSMVLGWKQPDKIGGAEIT---GYYVNYREVIDGVPG---KWREANVKAVSEEAYKISNL 905
                         I GA++T   G+ V+      G P     W +  +     E  + S  
Sbjct: 27567 -----------DIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKT 27615

Query: 906   KENMVYQFQVAAMNMAG---LGAPSAVSECFKCEEWTIAVPGPPHS----LKCSEVRKDS 958
             +  +    + A     G   +   +AV  C      T+   GPP      ++  E++ DS
Sbjct: 27616 ENKITLSIKNAKKEHGGKYTVILDNAV--CRIAVPITVITLGPPSKPKGPIRFDEIKADS 27673

Query: 959   LVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFR 1018
             ++L W  P  +G   +T Y ++ +E    +  W+ +  +  +  + KV  L +   Y FR
Sbjct: 27674 VILSWDVPEDNGGGEITCYSIEKRE--TSQTNWKMVCSSVARTTF-KVPNLVKDAEYQFR 27730

Query: 1019  VRAINQAGVGKPSDLAGPVVAETR-----PGTKEVVVNVDDDGV 1057
             VRA N+ GV +P  ++  +VA+ +     P  K V+ NV  DG+
Sbjct: 27731 VRAENRYGVSQPL-VSSIIVAKHQFRIPGPPGKPVIYNVTSDGM 27773



 Score =  134 bits (338), Expect = 5e-31
 Identities = 127/462 (27%), Positives = 199/462 (43%), Gaps = 40/462 (8%)

Query: 638   PGPPTD-LSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSP 695
             PGPPT  + +++ T   V L W+PP   G   +  Y + K E  T  W  V+    V   
Sbjct: 26570 PGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSAT--VART 26627

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDI--PKAPGKIIPSRNTDT 753
                +  L  G+ Y FR++  N  G+ +  ++  VTV   KL    P  P     +  T  
Sbjct: 26628 MMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTV---KLPYTTPGPPSTPWVTNVTRE 26684

Query: 754   SVVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRV 811
             S+ V W E  S     +VGY++E     S  W+  N   ++ + F    +  G  Y FRV
Sbjct: 26685 SITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRV 26744

Query: 812   RAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITG 871
              A NAAG+ + S  SE +    AI    PP ++   +  ++S+ L W+QP   GG++ITG
Sbjct: 26745 YAENAAGVGKPSHPSEPV---LAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITG 26801

Query: 872   YYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAG-LGAPSAVS 930
             Y V  R++ D   G+W +A+   V+E  + IS L +N  Y+F+V A N  G +  PS V 
Sbjct: 26802 YIVERRDLPD---GRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVV 26858

Query: 931   ECFKCEEWTIAVPGPPHSLKCSEVRK--DSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKE 988
                 C + +   P     L+ +EV K      ++ +  +     P   ++ D KE +   
Sbjct: 26859 GPITCID-SYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNA 26917

Query: 989   ----DQWRGLNEAAIKNV--------YLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGP 1036
                 +    L    IK+          LK+R      S   RV+ ++     KP    GP
Sbjct: 26918 LVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILD-----KPGPPGGP 26972

Query: 1037  VVAETRPGTKEVVV--NVDDDGVISLNFECDKMTPKSEFSWS 1076
             +  +T    K  ++     DDG   +     +    S   WS
Sbjct: 26973 IEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWS 27014



 Score =  129 bits (323), Expect = 3e-29
 Identities = 123/466 (26%), Positives = 184/466 (39%), Gaps = 48/466 (10%)

Query: 502   ADAEIEG----APAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
             +D E+ G     P  P   +  +  K  I + WK PA DGGSPI GY ++  E GT  W 
Sbjct: 15693 SDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWK 15752

Query: 558   QCN--DTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKS 615
             + N  D  +      V  L E R Y FRV+AVN+ G   PS  +  + A D  E+  +  
Sbjct: 15753 RVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFI 15812

Query: 616   RPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGH---EGIMYF 672
                A          +     ++ G PT  S           SW+  G+      +G+   
Sbjct: 15813 DIGAQDCLVCKAGSQIRIPAVIKGRPTPKS-----------SWEFDGKAKKAMKDGVHDI 15861

Query: 673   VEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVV 732
              E  +  T             S    + +     +  + +   N AG    +   +V   
Sbjct: 15862 PEDAQLETAE----------NSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKV--- 15908

Query: 733   GDKLDIPKAPGKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNP 790
                +D+P  P  +  S  T  S  +SW+   D     + GY IE        W   N  P
Sbjct: 15909 ---MDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVN--P 15963

Query: 791   VKGSR-FTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLES 849
               GS  F    L++ Q Y FRVRA N  G+    +  +    +  I PP PP  +     
Sbjct: 15964 DCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLI 16023

Query: 850   FRDSMVLGWKQPDKIGGAEITGYYVNYR--EVIDGVPGKWREANVKAVSEEAYKISNLKE 907
              ++++ L WK P   GG+ +T Y V     +        WR+ N + V E  + + +L E
Sbjct: 16024 TKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVE 16083

Query: 908   NMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSE 953
                Y+F+V A+N AG+  PSA      C+      P  P S+   E
Sbjct: 16084 GGEYEFRVKAVNAAGVSKPSATVGPCDCQR-----PDMPPSIDLKE 16124



 Score =  109 bits (273), Expect = 2e-23
 Identities = 85/306 (27%), Positives = 139/306 (45%), Gaps = 18/306 (5%)

Query: 829   IEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWR 888
             ++V+    P  P   I      ++S V+ WK P   GG+ IT Y V   E  +G   +W+
Sbjct: 30715 LDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGA--EWQ 30772

Query: 889   EANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHS 948
               +  A+S    +I NL EN  Y F+V+A N  G+  P  VS     +      PG P  
Sbjct: 30773 LVS-SAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKS-PFEKPGAPGK 30830

Query: 949   LKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRG 1008
                + V KDS V+ WKPP   G   +  Y+++ +E K  +++W  +    I+     V+ 
Sbjct: 30831 PTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKK--QNKWISVTTEEIRETVFSVKN 30888

Query: 1009  LKEGVSYVFRVRAINQAGVGKPSDLAGPVVAET-----RPGTKEVVVNVDDDGVISLNFE 1063
             L EG+ Y FRV+  N  G  + S+++ P+  ++      P  KE + N++     +    
Sbjct: 30889 LIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLV 30948

Query: 1064  CDKMT--PKSEFSW---SKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTD 1118
             C K+T  PK    W    K+ ++     R++ E KG   ++    +  DD  +Y    T+
Sbjct: 30949 C-KVTGHPKPIVKWYRQGKEIIADGLKYRIQ-EFKGGYHQLIIASVTDDDATVYQVRATN 31006

Query: 1119  TDGIAS 1124
               G  S
Sbjct: 31007 QGGSVS 31012



 Score =  103 bits (256), Expect = 2e-21
 Identities = 108/504 (21%), Positives = 202/504 (40%), Gaps = 70/504 (13%)

Query: 1068 TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1127
            T   + +W+KD          ++    N   +T   +G  D G Y+C  ++  G      
Sbjct: 7238 TAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAG------ 7291

Query: 1128 IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIF--NE 1185
              ++     L +    +F    +K      I++  Q  F     K+ G+ ++  ++  +E
Sbjct: 7292 --KDSCSAQLGVQEPPRF----IKKLEPSRIVK--QDEFTRYECKIGGSPEIKVLWYKDE 7343

Query: 1186 KEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKL 1245
             EI E  K++M    +  ++E  M  L  ED G YT +  +   +  S+  L      K+
Sbjct: 7344 TEIQESSKFRMSFVDSVAVLE--MHNLSVEDSGDYTCEAHNAAGSASSSTSL------KV 7395

Query: 1246 QKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVD 1305
            ++   F+++       PH +E L        +V L+C++       H+ WYKD+RE+   
Sbjct: 7396 KEPPIFRKK-------PHPIETLK-----GADVHLECELQG-TPPFHVSWYKDKRELRSG 7442

Query: 1306 EKHDF--KDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKI 1363
            +K+    ++ + ++ I      D G Y+    +D G D     +  +A    + ++    
Sbjct: 7443 KKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDIS 7502

Query: 1364 ALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQIN 1423
             +   ++++Q+T EG +  S V +            G  +R SD +    +     LQ +
Sbjct: 7503 TVVGKEVQLQTTIEGAEPISVVWF---------KDKGEIVRESDNIWISYSENIATLQFS 7553

Query: 1424 EPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLP 1483
               P + GKY  ++             +     E +A    L+ A I EK         P
Sbjct: 7554 RVEPANAGKYTCQI------------KNDAGMQECFATLSVLEPATIVEK---------P 7592

Query: 1484 DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
            + + +  G    L C V G P     W K+ K L SD+   + F   + +   I  V+ +
Sbjct: 7593 ESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISF-FNKVSGLKIINVAPS 7651

Query: 1544 DSGKYGLVVKNKYGSETSDFTVSV 1567
            DSG Y   V+N  G ++   ++ V
Sbjct: 7652 DSGVYSFEVQNPVGKDSCTASLQV 7675



 Score = 94.0 bits (232), Expect = 1e-18
 Identities = 83/340 (24%), Positives = 135/340 (39%), Gaps = 45/340 (13%)

Query: 274   LHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKY-IIESRY 332
             + AP F  + R+  V  + N  L C + G P+P V WY+      + A+  KY I E + 
Sbjct: 30925 IQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGK--EIIADGLKYRIQEFKG 30982

Query: 333   GMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF 392
             G H L I     +D   Y+  A N  G +S  AS+ V+         + H   +   +  
Sbjct: 30983 GYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVE------VPAKIHLPKTLEGMGA 31036

Query: 393   GVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSP 452
                  G     +I F  K D                          P I W +    +  
Sbjct: 31037 VHALRGEVVSIKIPFSGKPD--------------------------PVITWQKGQDLIDN 31070

Query: 453   SKWVQTLWSGERATLTFSH-LNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPA 511
             +   Q + +    +L F + + ++D G Y +  +     +Q       +  + ++   P 
Sbjct: 31071 NGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQ-------KTVELDVADVPD 31123

Query: 512   APLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPV 571
              P  VK  + ++D + ++W +PA DGGS I  Y ++KC    + W +      +  R+ V
Sbjct: 31124 PPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQ--ARETRYTV 31181

Query: 572   TGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKA 611
               L    SY FRV A NK G+  PS  SEP    +   +A
Sbjct: 31182 INLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRA 31221



 Score = 93.6 bits (231), Expect = 1e-18
 Identities = 118/540 (21%), Positives = 205/540 (37%), Gaps = 75/540 (13%)

Query: 1050 VNVDDDGVISLNFECDKMTPKS-EFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDD 1108
            V++D     S +FEC     +    +WSKD           +   GN   +    +G  D
Sbjct: 6278 VSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGD 6337

Query: 1109 LGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWM 1168
             G Y+C  T+  G            K + +     K P   VK   A ++ ++G+    +
Sbjct: 6338 SGQYTCQATNDVG------------KDMCSAQLSVKEPPKFVKKLEASKVAKQGES---I 6382

Query: 1169 QAE-KLSGNA--KVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQ 1225
            Q E K+SG+   KV++  N+ E+ E  KY M    +  ++ +   +   ED G Y  +  
Sbjct: 6383 QLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTI--NEASAEDSGDYICEAH 6440

Query: 1226 DGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVA 1285
            +G      +  L               +   +  Q P  V  L        +V+L+C+++
Sbjct: 6441 NGVGDASCSTALT-------------VKAPPVFTQKPSPVGALKGS-----DVILQCEIS 6482

Query: 1286 NIKKETHIVWYKDEREISVDEKHDF--KDGICTLLITEFSKKDAGIYEVILKDDRGKDKS 1343
                   +VW KD +++   +K     K    +L I      D G Y     ++ G D  
Sbjct: 6483 GTPP-FEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTC 6541

Query: 1344 RLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAI 1403
               +  +     + ++     L    +++++  EG Q  S V  +++D        G  I
Sbjct: 6542 SCSVKFKEPPRFVKKLSDTSTLIGDAVELRAIVEGFQPISVV--WLKD-------RGEVI 6592

Query: 1404 RYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQ 1463
            R S+  +         LQ+  P  ++ GKY+ ++             +     E  A   
Sbjct: 6593 RESENTRISFIDNIATLQLGSPEASNSGKYICQI------------KNDAGMRECSAVLT 6640

Query: 1464 RLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHC 1523
             L+ A I EK         P+ +T+  G    L C V G P     W K+ + L++D   
Sbjct: 6641 VLEPARIIEK---------PEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKH 6691

Query: 1524 NLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALESLK 1583
            ++ F   + A   I     +D G Y   VKN  G   S+ TVSV + +     + +  LK
Sbjct: 6692 HITF-INKVASLKIPCAEMSDKGLYSFEVKNSVGK--SNCTVSVHVSDRIVPPSFIRKLK 6748



 Score = 89.7 bits (221), Expect = 2e-17
 Identities = 111/507 (21%), Positives = 197/507 (38%), Gaps = 72/507 (14%)

Query: 1066 KMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1125
            K TP  +  W KD V     P+  +  +G+ + +    +     G Y+C VT+  G    
Sbjct: 5354 KGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVG---- 5409

Query: 1126 YLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIF-- 1183
                 +    +L ++   KF    VK   A +I++ G         K++G+ ++  ++  
Sbjct: 5410 ----SDSCTTMLLVTEPPKF----VKKLEASKIVKAGDSS--RLECKIAGSPEIRVVWFR 5459

Query: 1184 NEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQD-GKATNHSTVVLVGDVF 1242
            NE E+    KY+M    +  +I+  M  L  ED G +  + Q+   +T+ ST V+V    
Sbjct: 5460 NEHELPASDKYRMTFIDSVAVIQ--MNNLSTEDSGDFICEAQNPAGSTSCSTKVIV---- 5513

Query: 1243 KKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREI 1302
                      ++  +    P  VE L         V L+C+++       +VWYKD+R++
Sbjct: 5514 ----------KEPPVFSSFPPIVETLK-----NAEVSLECELSG-TPPFEVVWYKDKRQL 5557

Query: 1303 SVDEKHDF--KDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVC 1360
               +K+    K+   ++ I      D G Y    +++ G D     +  +     + ++ 
Sbjct: 5558 RSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLN 5617

Query: 1361 KKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWL 1420
                ++    ++Q++ EG Q       +V+ LK         IR S+ ++         L
Sbjct: 5618 SLTVVAGEPAELQASIEGAQ-----PIFVQWLK----EKEEVIRESENIRITFVENVATL 5668

Query: 1421 QINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLG 1480
            Q  +  P + GKY+ ++             +     E  A    L+ A I EK       
Sbjct: 5669 QFAKAEPANAGKYICQI------------KNDGGMRENMATLMVLEPAVIVEK------- 5709

Query: 1481 GLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGV 1540
                 +T+  G+   L C V G P   V W K+ K L S       F   + +   I  V
Sbjct: 5710 --AGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSF-YNKISSLRILSV 5766

Query: 1541 STADSGKYGLVVKNKYGSETSDFTVSV 1567
               D+G Y   V+N  G  +    V V
Sbjct: 5767 ERQDAGTYTFQVQNNVGKSSCTAVVDV 5793



 Score = 89.7 bits (221), Expect = 2e-17
 Identities = 124/594 (20%), Positives = 223/594 (37%), Gaps = 84/594 (14%)

Query: 1004 LKVRGLKEGVSYVFRVRAINQAGVGKPSD---LAGPVVAETRPGTKEVVVNVDDDGVISL 1060
            L++  L    S  +   A N AG    S    +  P +   +P   E +   D      +
Sbjct: 7363 LEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGAD------V 7416

Query: 1061 NFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDT 1119
            + EC+   TP    SW KD        + ++ S+   T +   ++   D+G Y C  T+ 
Sbjct: 7417 HLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATND 7476

Query: 1120 DGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKV 1179
             G         +     +AL    +F  V   S+++  + ++ Q++       + G   +
Sbjct: 7477 VG--------SDTCVGSIALKAPPRF--VKKLSDISTVVGKEVQLQ-----TTIEGAEPI 7521

Query: 1180 NYI-FNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLV 1238
            + + F +K         + I  +  I  +   +++  + G YT Q+++          L 
Sbjct: 7522 SVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATL- 7580

Query: 1239 GDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKD 1298
                  L+     ++ E I+             VT      L+C VA    E    W+KD
Sbjct: 7581 ----SVLEPATIVEKPESIK-------------VTTGDTCTLECTVAGTP-ELSTKWFKD 7622

Query: 1299 EREISVDEKH--DFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELM 1356
             +E++ D K+   F + +  L I   +  D+G+Y   +++  GKD     L         
Sbjct: 7623 GKELTSDNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASL--------- 7673

Query: 1357 MEVCKKIALSATDLKIQSTAEGIQLYSFV----TYYVEDLKVNWSHNGSAIRYSDRVKTG 1412
             +V  +    +   K++ T  G+   S V     Y    + V+W H G+ I    + +T 
Sbjct: 7674 -QVSDRTVPPSFTRKLKET-NGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTT 7731

Query: 1413 VTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAE 1472
            +T     L +N    +D G Y               +++G   DE  A     +  +  +
Sbjct: 7732 LTDNTCALTVNMLEESDSGDYTCI----------ATNMAGS--DECSAPLTVREPPSFVQ 7779

Query: 1473 KNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRT 1532
            K         PD + +  G  +  T  V G PP  VSW K    L   D CN+  E    
Sbjct: 7780 K---------PDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLE-DSV 7829

Query: 1533 AYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALESLKGGK 1586
            A   +  V T+ SG+Y  +V N+ G  +    + +  P +  +     S++ GK
Sbjct: 7830 AELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGK 7883



 Score = 86.7 bits (213), Expect = 2e-16
 Identities = 115/512 (22%), Positives = 199/512 (38%), Gaps = 49/512 (9%)

Query: 1062 FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1121
            FEC+   P     W KD    + + R++++ +    ++      M D G Y+  V     
Sbjct: 3077 FECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYT--VVAGGN 3134

Query: 1122 IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQ--VRFWMQAEKLSGNAKV 1179
            ++++ L  E    R+ ++  E             V+++EK +  V F +  + +  +   
Sbjct: 3135 VSTAKLFVEGRDVRIRSIKKE-------------VQVIEKQRAVVEFEVNEDDVDAHWYK 3181

Query: 1180 NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVG 1239
            + I    ++ E  KY   ++R   I  MF+ + +  D G YTF        N S+V L  
Sbjct: 3182 DGIEINFQVQERHKYV--VERR--IHRMFISETRQSDAGEYTFVA----GRNRSSVTLYV 3233

Query: 1240 DVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDE 1299
            +  +  Q   E Q       +   F                 C V + + +  I WYK+E
Sbjct: 3234 NAPEPPQVLQELQPVTVQSGKPARF-----------------CAVISGRPQPKISWYKEE 3276

Query: 1300 REISVDEKHDF-KDGI-CTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMM 1357
            + +S   K  F  DG   TLL+ E   +DA +Y    K+D G   +   L  E  + +  
Sbjct: 3277 QLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSP 3336

Query: 1358 EVCKKIALSA--TDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTG 1415
            +    +   A  T L+   T+EG            DLKV+W      I+ S   +     
Sbjct: 3337 DQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFE 3396

Query: 1416 EQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNR 1475
            +   L+I E  P D+G Y     +       T +LS +A +    E  R++Q    E   
Sbjct: 3397 DTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHE--RIEQEIEMEMKA 3454

Query: 1476 ARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYF 1535
            A V+    + + +  G     TC +   P     W K  + +   D C+++  +   +  
Sbjct: 3455 APVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIR-SSKYISSL 3513

Query: 1536 TINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1567
             I      D G+Y     N+YGS +   T++V
Sbjct: 3514 EILRTQVVDCGEYTCKASNEYGSVSCTATLTV 3545



 Score = 85.1 bits (209), Expect = 5e-16
 Identities = 121/565 (21%), Positives = 222/565 (39%), Gaps = 93/565 (16%)

Query: 1036 PVVAETRPGTKEVVVNVDDDGVISLNFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKG 1094
            P V  + P   E + N +      ++ EC+   TP  E  W KD      S + ++ SK 
Sbjct: 5516 PPVFSSFPPIVETLKNAE------VSLECELSGTPPFEVVWYKDKRQLRSSKKYKIASKN 5569

Query: 1095 NKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTV----PV 1150
              T +   ++   D+G Y C   +  G  S   +   +LK       +    TV    P 
Sbjct: 5570 FHTSIHILNVDTSDIGEYHCKAQNEVG--SDTCVCTVKLKEPPRFVSKLNSLTVVAGEPA 5627

Query: 1151 KSELAVEILEKGQVRFWMQAEKL---SGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEM 1207
            + + ++E  +   V++  + E++   S N ++ ++ N                   +  +
Sbjct: 5628 ELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVEN-------------------VATL 5668

Query: 1208 FMEKLQDEDEGTYTFQLQD--GKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFV 1265
               K +  + G Y  Q+++  G   N +T++++             +    + K GP  V
Sbjct: 5669 QFAKAEPANAGKYICQIKNDGGMRENMATLMVL-------------EPAVIVEKAGPMTV 5715

Query: 1266 EYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFK--DGICTLLITEFS 1323
                    GE    L+CKVA    E  + WYKD + ++  +KH F   + I +L I    
Sbjct: 5716 ------TVGE-TCTLECKVAGTP-ELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVE 5767

Query: 1324 KKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYS 1383
            ++DAG Y   ++++ GK  S   +VD + + +     +++  +   L      E     S
Sbjct: 5768 RQDAGTYTFQVQNNVGKS-SCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGS 5826

Query: 1384 FVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTG 1443
                    + V W H  + I    + +T  +     LQ+N    +D G Y          
Sbjct: 5827 ------SPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCV------- 5873

Query: 1444 HQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGD 1503
                 +++G   DE  A     +  +  ++         P+ + +  GK +  T  + G 
Sbjct: 5874 ---AANVAGS--DECRAVLTVQEPPSFVKE---------PEPLEVLPGKNVTFTSVIRGT 5919

Query: 1504 PPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDF 1563
            PP +V+W +  + L   D CN+ FE    A   +  +  + SG+Y  VV N  G   +  
Sbjct: 5920 PPFKVNWFRGARELVKGDRCNIYFE-DTVAELELFNIDISQSGEYTCVVSNNAGQ--ASC 5976

Query: 1564 TVSVFIPEEEARMAAL--ESLKGGK 1586
            T  +F+ E  A +  L   S++ GK
Sbjct: 5977 TTRLFVKEPAAFLKRLSDHSVEPGK 6001



 Score = 82.0 bits (201), Expect = 4e-15
 Identities = 131/602 (21%), Positives = 222/602 (36%), Gaps = 83/602 (13%)

Query: 969  SGRTPVT-GYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGV 1027
            +G  P++  +F D +E  A E      ++      +L++  L+   S  +   A N+AG 
Sbjct: 4699 AGSHPISIQWFKDDQEISASEKYKFSFHD---NTAFLEISQLEGTDSGTYTCSATNKAGH 4755

Query: 1028 GKPSD---LAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTED 1084
             + S    +  P     +P +++V  N      + L        P +   W KD      
Sbjct: 4756 NQCSGHLTVKEPPYFVEKPQSQDVNPNTR----VQLKALVGGTAPMT-IKWFKDNKELHS 4810

Query: 1085 SPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHK 1144
                 V      T +        D G Y C +++  G A+S        K  L +    +
Sbjct: 4811 GAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATS--------KATLFVKEPPQ 4862

Query: 1145 FPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMH-IDRNTG 1203
            F    +K    V +L  GQ   +      +   +V++  +  EI    K+ +  ID   G
Sbjct: 4863 F----IKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFID---G 4915

Query: 1204 IIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPH 1263
            +    +   + E+ GTY  + ++   T   ++ L                     K+ P 
Sbjct: 4916 LATFQISGARVENSGTYVCEARNDAGTASCSIELKV-------------------KEPPT 4956

Query: 1264 FVEYLS-WEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKD--GICTLLIT 1320
            F+  L   EV    +V L+C+V        + W K+ REI   +K+   D   +  L IT
Sbjct: 4957 FIRELKPVEVVKYSDVELECEVTGTPP-FEVTWLKNNREIRSSKKYTLTDRVSVFNLHIT 5015

Query: 1321 EFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQ 1380
            +    D G Y+ I+ ++ G      ++   A KE    + KKI  + T LK  +T +   
Sbjct: 5016 KCDPSDTGEYQCIVSNEGGSCSCSTRV---ALKEPPSFI-KKIENTTTVLKSSATFQSTV 5071

Query: 1381 LYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDG 1440
              S        + + W  +   +   D V          LQI        G+Y  +    
Sbjct: 5072 AGS------PPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQA--- 5122

Query: 1441 KTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNV 1500
                      +    +  YA     + A I EK ++         V + E   + L C V
Sbjct: 5123 ---------KNESGVERCYAFLLVQEPAQIVEKAKS---------VDVTEKDPMTLECVV 5164

Query: 1501 WGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSET 1560
             G P  +V WLK+ K +    + ++ FE    A F I  V   DSG+Y   V+N +GS +
Sbjct: 5165 AGTPELKVKWLKDGKQIVPSRYFSMSFE-NNVASFRIQSVMKQDSGQYTFKVENDFGSSS 5223

Query: 1561 SD 1562
             D
Sbjct: 5224 CD 5225



 Score = 82.0 bits (201), Expect = 4e-15
 Identities = 112/536 (20%), Positives = 205/536 (38%), Gaps = 86/536 (16%)

Query: 1048 VVVNVDDDGVISLNFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGM 1106
            V V+V D    S + +C    TP+   SW K       +   ++  + N   + F  + +
Sbjct: 7970 VKVSVGD----SASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDI 8025

Query: 1107 DDLGIYSCDVTDTDG--IASSYL-IDEEELKRLLALSHEHKFPTV--PVKSELAVEILEK 1161
            +D G Y C   ++ G   AS++L + E++L    +        TV  PV  + A+   E 
Sbjct: 8026 NDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEP 8085

Query: 1162 GQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYT 1221
              V ++   + L  +  V   F +               NT  + +F        + + T
Sbjct: 8086 ISVSWYKDGKPLKDSPNVQTSFLD---------------NTATLNIFKTDRSLAGQYSCT 8130

Query: 1222 FQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSW--EVTGECNVL 1279
                 G A++ + ++L                     K  P F   L+    V GE +  
Sbjct: 8131 ATNPIGSASSSARLILTEG------------------KNPPFFDIRLAPVDAVVGE-SAD 8171

Query: 1280 LKCKVANIKKETHIVWYKDEREISVDEKHD--FKDGICTLLITEFSKKDAGIYEVILKDD 1337
             +C V   +    + W KD REI    K+   + +    L + +  K D+G Y     ++
Sbjct: 8172 FECHVTGTQP-IKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNE 8230

Query: 1338 RGKDKS------RLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVED 1391
             GKD        + +L+  +F + + E  ++        K++    G Q           
Sbjct: 8231 VGKDSCTAQLNIKERLIPPSFTKRLSETVEET--EGNSFKLEGRVAGSQ----------P 8278

Query: 1392 LKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLS 1451
            + V W  N   I+ +   +       + LQ+ +   ND G Y  ++ +           +
Sbjct: 8279 ITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSND----------A 8328

Query: 1452 GQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWL 1511
            G A   +    +  K+  + +++   V        T+ EG+ + L+C+V G  P  + WL
Sbjct: 8329 GSALCTSSIVIKEPKKPPVFDQHLTPV--------TVSEGEYVQLSCHVQGSEPIRIQWL 8380

Query: 1512 KNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1567
            K  + +   D C+  F +G TA   +  V+ ADSG Y     N  GS+T+   V++
Sbjct: 8381 KAGREIKPSDRCSFSFASG-TAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTI 8435



 Score = 78.6 bits (192), Expect = 5e-14
 Identities = 110/511 (21%), Positives = 199/511 (38%), Gaps = 76/511 (14%)

Query: 1068 TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1127
            +P+ +  W KD    ++S +  +    +   +   +L ++D G Y+C+  +  G ASS  
Sbjct: 7332 SPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASS-- 7389

Query: 1128 IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1187
                      + S + K P +  K    +E L+   V    + +  +    V++  +++E
Sbjct: 7390 ----------STSLKVKEPPIFRKKPHPIETLKGADVHLECELQG-TPPFHVSWYKDKRE 7438

Query: 1188 IFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNH-STVVLVGDVFKKLQ 1246
            +  G KYK  I     +  + +  +   D G Y       KATN   +   VG +     
Sbjct: 7439 LRSGKKYK--IMSENFLTSIHILNVDAADIGEY-----QCKATNDVGSDTCVGSI----- 7486

Query: 1247 KEAEFQRQEWIRKQGPHFVEYLS--WEVTGECNVLLKCKVANIKKETHIVWYKDEREISV 1304
                        K  P FV+ LS    V G+  V L+  +    +   +VW+KD+ EI  
Sbjct: 7487 ----------ALKAPPRFVKKLSDISTVVGK-EVQLQTTIEG-AEPISVVWFKDKGEIVR 7534

Query: 1305 DEKH---DFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCK 1361
            +  +    + + I TL  +     +AG Y   +K+D G        + E F  L +    
Sbjct: 7535 ESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAG--------MQECFATLSVLEPA 7586

Query: 1362 KIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQ 1421
             I      +K+ +T +   L   V     +L   W  +G  +   ++ K     +   L+
Sbjct: 7587 TIVEKPESIKV-TTGDTCTLECTVA-GTPELSTKWFKDGKELTSDNKYKISFFNKVSGLK 7644

Query: 1422 INEPTPNDKGKYVMELFD--GKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVL 1479
            I    P+D G Y  E+ +  GK     ++ +S +    ++   ++LK+            
Sbjct: 7645 IINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFT--RKLKET----------- 7691

Query: 1480 GGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTING 1539
             GL        G ++ + C V+G PP  VSW      ++S            T   T+N 
Sbjct: 7692 NGL-------SGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTL-TDNTCALTVNM 7743

Query: 1540 VSTADSGKYGLVVKNKYGSETSDFTVSVFIP 1570
            +  +DSG Y  +  N  GS+     ++V  P
Sbjct: 7744 LEESDSGDYTCIATNMAGSDECSAPLTVREP 7774



 Score = 77.8 bits (190), Expect = 8e-14
 Identities = 58/224 (25%), Positives = 109/224 (48%), Gaps = 17/224 (7%)

Query: 157   ERIKEAAAYIAQRNLLASEEGITTSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTA 216
             E +K++AA   +++++  E  IT + Q++   +T A  ++ +++ S    Q    + + A
Sbjct: 33006 EEVKKSAATSLEKSIVHEE--ITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIA 33063

Query: 217   SRQSVV----SKQATSALQQEETSEKKSRKVVIREKAER-----LSLRKTLEETET--YH 265
                 V       + T++ +         + + I++ + R       + KT E      Y 
Sbjct: 33064 GATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYD 33123

Query: 266   AKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGK 325
               L+++ L  AP FI +PRS  + E +NV   C I+G P P + W+KN +PI++ +N   
Sbjct: 33124 LTLSKE-LSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVS- 33181

Query: 326   YIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVV 369
               I     +++LEI      D+ +Y   A N +G+ SA AS++V
Sbjct: 33182 --ISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV 33223



 Score = 76.3 bits (186), Expect = 2e-13
 Identities = 110/529 (20%), Positives = 204/529 (38%), Gaps = 79/529 (14%)

Query: 1068 TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGI----A 1123
            TP  E  W KD  +   SP   +    NK  +   +L + D G+YSC  ++  G     A
Sbjct: 3577 TPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQA 3636

Query: 1124 SSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIF 1183
               +ID+    + L           PV+S +  ++  + QV    +  K++    V +  
Sbjct: 3637 ELIIIDKPHFIKELE----------PVQSAINKKVHLECQVD---EDRKVT----VTWSK 3679

Query: 1184 NEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFK 1243
            + +++  G  YK+  +     +E+ + KL+D      T   + G ++  +TV +      
Sbjct: 3680 DGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTV------ 3733

Query: 1244 KLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREIS 1303
                    +   +++K  P ++      + GE +  L CK+        + W+K+ +E+S
Sbjct: 3734 -------REPPSFVKKVDPSYL-----MLPGE-SARLHCKLKG-SPVIQVTWFKNNKELS 3779

Query: 1304 VDE--KHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCK 1361
                 +  F +    L IT+   +D+G Y     +D G D    ++V +     +  +  
Sbjct: 3780 ESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEP 3839

Query: 1362 KIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQ 1421
               +  T+  +Q    G              +++W  +   IR S + +       + L+
Sbjct: 3840 ADIVRGTNALLQCEVSG----------TGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLE 3889

Query: 1422 INEPTPNDKGKY--VMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVL 1479
            I      D G+Y  V+    GK G   T                 LK+     K      
Sbjct: 3890 IFSFNSADVGEYECVVANEVGKCGCMAT---------------HLLKEPPTFVKK----- 3929

Query: 1480 GGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTING 1539
              + D++ +  G+ + L   V G  P  V+W+K ++ +  D    + F  G  A   I  
Sbjct: 3930 --VDDLIAL-GGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNG-VAVLIIPD 3985

Query: 1540 VSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALESLKGGKKA 1588
            V  +  GKY  + +N+ GS+TS   + V  P +    A L  +  G  A
Sbjct: 3986 VQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERAELIQVTAGDPA 4034



 Score = 75.5 bits (184), Expect = 4e-13
 Identities = 114/537 (21%), Positives = 192/537 (35%), Gaps = 87/537 (16%)

Query: 1068 TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS-- 1125
            TP+   SW K++     +P  +++ K N   +    +   D+G YSC   ++ G  +S  
Sbjct: 7046 TPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSA 7105

Query: 1126 -YLIDEEELKRLLA--LSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYI 1182
              +I   +L    A  L   H+    PV  E  +   E  QV ++     L  +A +   
Sbjct: 7106 VLVIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTS 7165

Query: 1183 FNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVF 1242
            F            +H      I++     +     G Y     +   T  S+  L+    
Sbjct: 7166 F------------VHNVATLQILQTDQSHI-----GQYNCSASNPLGTASSSAKLILS-- 7206

Query: 1243 KKLQKEAEFQRQEWIRKQGPHFVEYLSWEVT---GECNVLLKCKVANIKKETHIVWYKDE 1299
                             + P F +     V    GE     KC V        I W KD 
Sbjct: 7207 ---------------EHEVPPFFDLKPVSVDLALGESGTF-KCHVTGTAP-IKITWAKDN 7249

Query: 1300 REISV--DEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKL-VDEA---FK 1353
            REI    + K    +   TL + +  K DAG Y     +  GKD    +L V E     K
Sbjct: 7250 REIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPPRFIK 7309

Query: 1354 ELM-MEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTG 1412
            +L    + K+   +  + KI  + E              +KV W  + + I+ S + +  
Sbjct: 7310 KLEPSRIVKQDEFTRYECKIGGSPE--------------IKVLWYKDETEIQESSKFRMS 7355

Query: 1413 VTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAE 1472
                   L+++  +  D G Y  E  +       +  L             ++K+  I  
Sbjct: 7356 FVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSL-------------KVKEPPIFR 7402

Query: 1473 KNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRT 1532
            K         P  +   +G  ++L C + G PP  VSW K+++ L S     +  E   T
Sbjct: 7403 KK--------PHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLT 7454

Query: 1533 AYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALESLKGGKKAK 1589
            +   +N V  AD G+Y     N  GS+T   ++++  P    +  +  S   GK+ +
Sbjct: 7455 SIHILN-VDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQ 7510



 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 104/533 (19%), Positives = 203/533 (38%), Gaps = 97/533 (18%)

Query: 1062  FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1121
             F C+  T  ++  W ++  +  DS +  +  K     +  +D  +DD   Y+  +T+  G
Sbjct: 12659 FNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRG 12718

Query: 1122  ----IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNA 1177
                  A++ +++EE+L+ +            P+K    +E +EK  V FW +  +L  N 
Sbjct: 12719 ENVKSAANLIVEEEDLRIV-----------EPLKD---IETMEKKSVTFWCKVNRL--NV 12762

Query: 1178  KVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVL 1237
              + +  N +E+    +    +D+   ++ +  +     DEG Y       K+     ++ 
Sbjct: 12763 TLKWTKNGEEVPFDNRVSYRVDKYKHMLTI--KDCGFPDEGEYIVTAGQDKSVAELLII- 12819

Query: 1238  VGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECN-VLLKCKVANIKKETHIVWY 1296
                                  +    FVE+L  +   E +  +  C+++  +++ ++ WY
Sbjct: 12820 ---------------------EAPTEFVEHLEDQTVTEFDDAVFSCQLS--REKANVKWY 12856

Query: 1297  KDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKE-- 1354
             ++ REI   +K+ F+             KD  I+ +I+KD R  D+       E  K   
Sbjct: 12857 RNGREIKEGKKYKFE-------------KDGSIHRLIIKDCRLDDECEYACGVEDRKSRA 12903

Query: 1355  --LMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTG 1412
                + E+  +I     D+     A G  +        + ++V W  N   +   D+ +  
Sbjct: 12904 RLFVEEIPVEIIRPPQDIL---EAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMM 12960

Query: 1413  VTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAE 1472
               G+   LQI +  P D+G+Y     D                 EA A+ +      I  
Sbjct: 12961 SEGKIHRLQICDIKPRDQGEYRFIAKD----------------KEARAKLELAAAPKIKT 13004

Query: 1473  KNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRT 1532
              ++  V         +  GK L +       P  E  W K  + L++     +   A +T
Sbjct: 13005 ADQDLV---------VDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTK---TIDTTAEQT 13052

Query: 1533  AYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVF-IPEEEARMAALESLKG 1584
             + F I      D G+Y +V++NK+G       + V  +P     +   E+  G
Sbjct: 13053 S-FRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDG 13104



 Score = 72.0 bits (175), Expect = 4e-12
 Identities = 88/403 (21%), Positives = 162/403 (40%), Gaps = 63/403 (15%)

Query: 1172 KLSGNA--KVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQ-LQDGK 1228
            KL G+   +V +  N KE+ E    +M+   +  I+++   K+  ED G+Y+ + + D  
Sbjct: 3760 KLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKV--EDSGSYSCEAVNDVG 3817

Query: 1229 ATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLS-WEVTGECNVLLKCKVANI 1287
            + + ST +++                    K+ P F++ L   ++    N LL+C+V+  
Sbjct: 3818 SDSCSTEIVI--------------------KEPPSFIKTLEPADIVRGTNALLQCEVSGT 3857

Query: 1288 KKETHIVWYKDEREISVDEKHDF---KDGICTLLITEFSKKDAGIYEVILKDDRGKDKSR 1344
                 I W+KD+++I   +K+     K  +C L I  F+  D G YE ++ ++ GK    
Sbjct: 3858 GP-FEISWFKDKKQIRSSKKYRLFSQKSLVC-LEIFSFNSADVGEYECVVANEVGKCGCM 3915

Query: 1345 LKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIR 1404
               + +     + +V   IAL    + +Q+   G           E + V W      IR
Sbjct: 3916 ATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGS----------EPISVTWMKGQEVIR 3965

Query: 1405 YSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQR 1464
               ++K   +     L I +   +  GKY   L + + G Q +V            E   
Sbjct: 3966 EDGKIKMSFSNGVAVLIIPDVQISFGGKYTC-LAENEAGSQTSV-----------GELIV 4013

Query: 1465 LKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCN 1524
             + A I E+          +++ +  G    L   V G P  +  W K+ + L +     
Sbjct: 4014 KEPAKIIER---------AELIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKYR 4064

Query: 1525 LKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1567
            + F+    A          DSG+Y   + N+ GS + + T +V
Sbjct: 4065 ISFK-NNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTV 4106



 Score = 71.6 bits (174), Expect = 6e-12
 Identities = 116/505 (22%), Positives = 186/505 (36%), Gaps = 60/505 (11%)

Query: 1074 SWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEEL 1133
            SW KD    +DSP ++     N   +          G YSC  T+  G ASS        
Sbjct: 8089 SWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASS-------- 8140

Query: 1134 KRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPK 1193
               L L+     P   ++  LA      G+   +      +   KV++  + +EI  G K
Sbjct: 8141 SARLILTEGKNPPFFDIR--LAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGGK 8198

Query: 1194 YKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQR 1253
            Y++    N+  + +   K+   D G YT    +    +  T              A+   
Sbjct: 8199 YQISYLENSAHLTVL--KVDKGDSGQYTCYAVNEVGKDSCT--------------AQLNI 8242

Query: 1254 QEWIRKQGPHFVEYLSWEV--TGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHD-- 1309
            +E  R   P F + LS  V  T   +  L+ +VA  +  T + WYK+  EI      +  
Sbjct: 8243 KE--RLIPPSFTKRLSETVEETEGNSFKLEGRVAGSQPIT-VAWYKNNIEIQPTSNCEIT 8299

Query: 1310 FKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATD 1369
            FK+    L + +    DAG+Y   + +D G       +V        ++  KK  +    
Sbjct: 8300 FKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIV--------IKEPKKPPVFDQH 8351

Query: 1370 LKIQSTAEG--IQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTP 1427
            L   + +EG  +QL   V    E +++ W   G  I+ SDR           L++ +   
Sbjct: 8352 LTPVTVSEGEYVQLSCHVQGS-EPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAK 8410

Query: 1428 NDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGL----- 1482
             D G YV           K  +++G    ++    +     A A K +A V G L     
Sbjct: 8411 ADSGDYVC----------KASNVAGSDTTKSKVTIKDKPAVAPATK-KAAVDGRLFFVSE 8459

Query: 1483 PDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVST 1542
            P  + + E         V GDP P V W K +    +        + G  A   I   + 
Sbjct: 8460 PQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTK 8519

Query: 1543 ADSGKYGLVVKNKYGSETSDFTVSV 1567
             DSG Y  V  N++G   S+  + V
Sbjct: 8520 TDSGLYRCVAFNEHGEIESNVNLQV 8544



 Score = 71.2 bits (173), Expect = 7e-12
 Identities = 110/519 (21%), Positives = 189/519 (36%), Gaps = 92/519 (17%)

Query: 1068 TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG--IASS 1125
            TP  E  W KD     +S + ++ SK   T +   +L   D+G Y C  T+  G    S 
Sbjct: 6484 TPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSC 6543

Query: 1126 YLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAE----KLSGNAKVNY 1181
             +  +E  + +  LS         V+    VE  +   V  W++      + S N ++++
Sbjct: 6544 SVKFKEPPRFVKKLSDTSTLIGDAVELRAIVEGFQPISV-VWLKDRGEVIRESENTRISF 6602

Query: 1182 IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDV 1241
            I N                   I  + +   +  + G Y  Q+++       + VL    
Sbjct: 6603 IDN-------------------IATLQLGSPEASNSGKYICQIKNDAGMRECSAVLT--- 6640

Query: 1242 FKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDERE 1301
                      +    I K  P  V       TG     L+C V     E    W+KD RE
Sbjct: 6641 --------VLEPARIIEKPEPMTV------TTGN-PFALECVVTGTP-ELSAKWFKDGRE 6684

Query: 1302 ISVDEKHD--FKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRL------KLVDEAFK 1353
            +S D KH   F + + +L I      D G+Y   +K+  GK    +      ++V  +F 
Sbjct: 6685 LSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFI 6744

Query: 1354 ELMMEVCKKIALSAT-DLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTG 1412
              + +V   +  S   + ++  +A               + V W  +G+ I    + ++ 
Sbjct: 6745 RKLKDVNAILGASVVLECRVSGSAP--------------ISVGWFQDGNEIVSGPKCQSS 6790

Query: 1413 VTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAE 1472
             +     L ++   P+D G Y               +++G   DE  A     +  +  +
Sbjct: 6791 FSENVCTLNLSLLEPSDTGIYTCV----------AANVAGS--DECSAVLTVQEPPSFEQ 6838

Query: 1473 KNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRT 1532
                      PD V +  G +L  T  + G PP +V W K  + L   + CN+  E   T
Sbjct: 6839 T---------PDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVT 6889

Query: 1533 AYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPE 1571
                +  V   +SG Y  +V N  GS  +  T  +F+ E
Sbjct: 6890 E-LELFEVQPLESGDYSCLVTNDAGS--ASCTTHLFVKE 6925



 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 86/395 (21%), Positives = 145/395 (36%), Gaps = 50/395 (12%)

Query: 1179 VNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLV 1238
            V++   + ++   P+Y+ +   N  +  +   K+   D G YT + ++   T  S  V  
Sbjct: 6110 VSWYKGDTKLRPTPEYRTYFTNN--VATLVFNKVNINDSGEYTCKAENSIGTASSKTV-- 6165

Query: 1239 GDVFKKLQKEAEFQRQEWIRKQGPHFVEYLS-WEVTGECNVLLKCKVANIKKETHIVWYK 1297
                        F+ QE  R+  P F   L   E T    V L C++ N      + WY+
Sbjct: 6166 ------------FRIQE--RQLPPSFARQLKDIEQTVGLPVTLTCRL-NGSAPIQVCWYR 6210

Query: 1298 DEREISVDE--KHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKEL 1355
            D   +  DE  +  F D + TL I +     +G Y     +  G   S  +L     K+ 
Sbjct: 6211 DGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKS 6270

Query: 1356 MMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTG 1415
                 K +++           E       VT   + +++ WS +   IR          G
Sbjct: 6271 PFFDIKPVSIDVI------AGESADFECHVTG-AQPMRITWSKDNKEIRPGGNYTITCVG 6323

Query: 1416 EQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNR 1475
                L+I +    D G+Y           Q T D+            + +  A ++ K  
Sbjct: 6324 NTPHLRILKVGKGDSGQYTC---------QATNDVG-----------KDMCSAQLSVKEP 6363

Query: 1476 ARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYF 1535
             + +  L      ++G+++ L C + G P  +VSW +N+  L      N+ F     A  
Sbjct: 6364 PKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSF-INSVALL 6422

Query: 1536 TINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIP 1570
            TIN  S  DSG Y     N  G  +    ++V  P
Sbjct: 6423 TINEASAEDSGDYICEAHNGVGDASCSTALTVKAP 6457



 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 67/296 (22%), Positives = 117/296 (39%), Gaps = 27/296 (9%)

Query: 1282  CKVANIKKETHIVWYKDEREISVDEKHD--FKDGICTLLITEFSKKDAGIYEVILKDDRG 1339
             CK+ N  + T + WY   R++   EK++  ++DG+  L + + +K D G Y   + +D G
Sbjct: 31589 CKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYG 31648

Query: 1340  KDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHN 1399
             +D S  +L  +  +E+    C++     T  KI+   + ++L      +   L    ++ 
Sbjct: 31649 EDSSYAELFVKGVREVYDYYCRR-----TMKKIKRRTDTMRLLERPPEFTLPLYNKTAYV 31703

Query: 1400  GSAIRYSDRVKTGVTGEQIWLQINE---PTPNDKGKYVMELFDGKTGHQKTVDLSGQAYD 1456
             G  +R+   +         W +  +   P  NDK KY  E    K  +Q T++      D
Sbjct: 31704 GENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDK-KYTFE--SDKGLYQLTINSVTTDDD 31760

Query: 1457  EAYAEFQRLKQAAIAEKNRARVLGGLPDV--------------VTIQEGKALNLTCNVWG 1502
               Y    R K    + K +  V    P                   QEG+++     V G
Sbjct: 31761 AEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSG 31820

Query: 1503  DPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGS 1558
              PPP + W K+ + L+   +  +  E        I      D+G Y +   N  GS
Sbjct: 31821 IPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGS 31876



 Score = 69.7 bits (169), Expect = 2e-11
 Identities = 102/489 (20%), Positives = 180/489 (36%), Gaps = 79/489 (16%)

Query: 1069 PKSEFSWSKDYVSTEDSPRLE-VESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1127
            P  E  W K+ V  E S R+     + N  ++  +D+  +D         +  G  SS+ 
Sbjct: 2105 PDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHA 2164

Query: 1128 IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1187
                + K+L+  + E +      K  +A             + E      KV +  +  E
Sbjct: 2165 FLLVQAKQLITFTQELQDVVAKEKDTMAT-----------FECETSEPFVKVKWYKDGME 2213

Query: 1188 IFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQK 1247
            + EG KY+MH DR    + +      D ++ +    ++D      + +++ G V + +++
Sbjct: 2214 VHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVL-VEDENVKTTAKLIVEGAVVEFVKE 2272

Query: 1248 EAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVA--NIKKETHIVWYKDEREISVD 1305
              + +  E                 +GE    L+C V+  NI+ +    WY ++ E+  +
Sbjct: 2273 LQDIEVPE---------------SYSGE----LECIVSPENIEGK----WYHNDVELKSN 2309

Query: 1306 EKHDF--KDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKI 1363
             K+    + G   L + + +K+D G Y  ++  D  K   +LK+       L        
Sbjct: 2310 GKYTITSRRGRQNLTVKDVTKEDQGEYSFVI--DGKKTTCKLKMKPRPIAILQ------- 2360

Query: 1364 ALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQIN 1423
                  L  Q   EG  +   V   +E ++  W  +G  ++ SDRV   +  +   L I 
Sbjct: 2361 -----GLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIE 2415

Query: 1424 EPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLP 1483
            + T  D G Y   +          + LS       Y+                 V+  L 
Sbjct: 2416 DMTKEDAGNYSFTI--------PALGLSTSGRVSVYS---------------VDVITPLK 2452

Query: 1484 DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
            DV  I+  KA+ L C V       V W  N++ +  DD        G      IN    +
Sbjct: 2453 DVNVIEGTKAV-LECKVSVPDVTSVKWYLNDEQIKPDDRVQ-AIVKGTKQRLVINRTHAS 2510

Query: 1544 DSGKYGLVV 1552
            D G Y L+V
Sbjct: 2511 DEGPYKLIV 2519



 Score = 69.7 bits (169), Expect = 2e-11
 Identities = 121/559 (21%), Positives = 206/559 (36%), Gaps = 117/559 (20%)

Query: 1072  EFSWSKDYVSTEDSPRLEVESKGNKT-KMTFKDLGMDDLGIYSCDVTDTDGIASSYL--- 1127
             E +W KD    +++   +     + T ++   +L   D G Y C+++   G + + L   
Sbjct: 32748 EVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFM 32807

Query: 1128  -------------------IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWM 1168
                                 D++  +  +    E K P       + V  L+   V    
Sbjct: 32808 GQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDS 32867

Query: 1169  QAE---KLSGNAKVNYIFNE--KEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQ 1223
              A+   K +G  +   I+ +  K I +G KYK+  D+    +E+   K    D G YT  
Sbjct: 32868 VAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEI--HKTDTSDSGLYTCT 32925

Query: 1224  LQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCK 1283
             +++   +  S+  L      K  K+ E Q+              +S + T E   +   K
Sbjct: 32926 VKNSAGSVSSSCKLT----IKAIKDTEAQK--------------VSTQKTSE---ITPQK 32964

Query: 1284  VANIKKETHIVWYKDER----EISVDEKHDFKDGICTLLITEFSKKDAG-------IYEV 1332
              A +++E      + E     E    EK   K+    +LI+E  KK A        ++E 
Sbjct: 32965 KAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEE 33024

Query: 1333  ILKDDRGKDKSRLKLVDEAFKELMME------VCKKIALSATDLKIQSTAEGIQLYSFVT 1386
             I K  +  ++ R     +AF   M        V K     ATD+K               
Sbjct: 33025 ITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGATDVK--------------- 33069

Query: 1387  YYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKG--KYVMELFDGKTGH 1444
                      W  NG  +  S+  + GV+G    L I + +  D+G    + +  +G    
Sbjct: 33070 ---------WVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKC 33120

Query: 1445  QKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDP 1504
             Q  + LS +  D           A I++          P    I EG+ +  TC + G+P
Sbjct: 33121 QYDLTLSKELSDAP---------AFISQ----------PRSQNINEGQNVLFTCEISGEP 33161

Query: 1505  PPEVSWLKNEKALASDDHCNLKFEAGRTAY-FTINGVSTADSGKYGLVVKNKYGSETSDF 1563
              PE+ W KN   ++     N+     R  Y   I   S +DSGKY +  KN  G  ++  
Sbjct: 33162 SPEIEWFKNNLPISISS--NVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATA 33219

Query: 1564  TVSVF-IPEEEARMAALES 1581
             ++ V  + EE +R   L +
Sbjct: 33220 SLMVLPLVEEPSREVVLRT 33238



 Score = 68.2 bits (165), Expect = 6e-11
 Identities = 91/360 (25%), Positives = 148/360 (41%), Gaps = 39/360 (10%)

Query: 175  EEGITTSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEE 234
            E  I  S  +T  K+ +A+  S+A K + + K  T     T  R               +
Sbjct: 831  EASIAGSAIATLQKELSAT--SSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPD 888

Query: 235  TSEKKSRKVVIREKAERLSLRKTLEET-ETYH---AKLNEDHLLHAP-EFIIKP------ 283
            T + ++   V +E    ++     EE  E  H   AK+ E   + AP E  + P      
Sbjct: 889  TYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSG 948

Query: 284  -RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGC 342
             ++ TV E E+V L C I+G+P P VTWY+    I    +   + I  + G+  L I   
Sbjct: 949  LKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSID---FQITFQSGIARLMIREA 1005

Query: 343  DFEDTAQYRASAMNVKGEL--SAYASVVVKR----------YKGEFDETRFHAGASTMPL 390
              ED+ ++  SA+N  G +  S Y +V V             K   +E RF      +  
Sbjct: 1006 FAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMT 1065

Query: 391  SFGVT--PYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGV 448
               +T    G       +F  K  V    EG ++  GC+V   P     +P + W ++GV
Sbjct: 1066 DTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNP-----KPHVYWKKSGV 1120

Query: 449  PLSPSKWVQTLWSGE--RATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEI 506
            PL+     +  ++ +     L  S    +D G YTI VR  ++ E  ++   + +AD E+
Sbjct: 1121 PLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVR-NKHGETSASASLLEEADYEL 1179



 Score = 67.4 bits (163), Expect = 1e-10
 Identities = 62/233 (26%), Positives = 93/233 (39%), Gaps = 35/233 (15%)

Query: 251   RLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTW 310
             R +++K    T+T         L   PEF +   + T +  ENV+   +I   PEP VTW
Sbjct: 31670 RRTMKKIKRRTDTMRL------LERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTW 31723

Query: 311   YKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
             YK+   I    N  KY  ES  G++ L IN    +D A+Y   A N  GE S  A + V 
Sbjct: 31724 YKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVT 31783

Query: 371   RYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVI 430
              +    D T         P+                F      +  +EG+++    RV  
Sbjct: 31784 LHPPPTDST-------LRPM----------------FKRLLANAECQEGQSVCFEIRVSG 31820

Query: 431   TPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSG-ERATLTFSHLNKEDEGLYTI 482
              P      P ++W ++G PLS    ++ +  G +   L       ED G Y +
Sbjct: 31821 IP-----PPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRV 31868



 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 110/549 (20%), Positives = 203/549 (36%), Gaps = 91/549 (16%)

Query: 1036  PVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGN 1095
             P V  T+P   + V    ++G  ++  EC+     ++  W K+      S + E+ + G 
Sbjct: 12283 PPVEFTKPLEDQTV----EEGATAV-LECEVSRENAKVKWFKNGTEILKSKKYEIVADGR 12337

Query: 1096  KTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELA 1155
               K+   D   +D+  Y+CD  D     +  ++                 P V     L 
Sbjct: 12338 VRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVP----------------PHVEFLRPLT 12381

Query: 1156  -VEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQD 1214
              +++ EK   RF  + E    NAKV +  +  EI +G KY   I     +  + + K   
Sbjct: 12382 DLQVREKEMARF--ECELSRENAKVKWFKDGAEIKKGKKY--DIISKGAVRILVINKCLL 12437

Query: 1215  EDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTG 1274
             +DE  Y+ +++  + +   TV         L++EA F +               + EV+ 
Sbjct: 12438 DDEAEYSCEVRTARTSGMLTV---------LEEEAVFTK------------NLANIEVSE 12476

Query: 1275  ECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVIL 1334
                + L C+V+  K    ++WYK + EI    +++        ++TE  K+   I    L
Sbjct: 12477 TDTIKLVCEVS--KPGAEVIWYKGDEEIIETGRYE--------ILTEGRKRILVIQNAHL 12526

Query: 1335  KDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKV 1394
              +D G    RL       K  + E+  +      +L+I    EG +     +   E   V
Sbjct: 12527 -EDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEI---LEGEKAEFVCSISKESFPV 12582

Query: 1395  NWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQA 1454
              W  +   +   D+      G++  L + + T  D G YV+ +   +     TV      
Sbjct: 12583 QWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTV------ 12636

Query: 1455  YDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNE 1514
                                 + R++  L D   ++E + +   C V      +  W +NE
Sbjct: 12637 ------------------IEKLRIVVPLKD-TRVKEQQEVVFNCEV-NTEGAKAKWFRNE 12676

Query: 1515  KALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEA 1574
             +A+  D    +  +        I      D   Y + + N  G E      ++ + EE+ 
Sbjct: 12677 EAI-FDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRG-ENVKSAANLIVEEEDL 12734

Query: 1575  RMAALESLK 1583
             R+  +E LK
Sbjct: 12735 RI--VEPLK 12741



 Score = 65.9 bits (159), Expect = 3e-10
 Identities = 121/586 (20%), Positives = 216/586 (36%), Gaps = 86/586 (14%)

Query: 996  EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDD 1055
            E  I  + + +  LK+  +YV    A N+AG    S  +  V     P     V  VD  
Sbjct: 3695 EDKIATLEIPLAKLKDSGTYV--CTASNEAG---SSSCSATVTVREPPS---FVKKVDPS 3746

Query: 1056 GVI----SLNFECD-KMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLG 1110
             ++    S    C  K +P  + +W K+     +S  + +    ++  +   D+ ++D G
Sbjct: 3747 YLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSG 3806

Query: 1111 IYSCDVTD---TDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFW 1167
             YSC+  +   +D  ++  +I E               P   +K+    +I+ +G     
Sbjct: 3807 SYSCEAVNDVGSDSCSTEIVIKE---------------PPSFIKTLEPADIV-RGTNALL 3850

Query: 1168 MQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDG 1227
                  +G  ++++  ++K+I    KY++   ++   +E+F     D  E       + G
Sbjct: 3851 QCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVG 3910

Query: 1228 KATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVT-GECNVLLKCKVAN 1286
            K    +T +L                     K+ P FV+ +   +  G   V L+  V  
Sbjct: 3911 KCGCMATHLL---------------------KEPPTFVKKVDDLIALGGQTVTLQAAVRG 3949

Query: 1287 IKKETHIVWYKDEREISVDE--KHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSR 1344
              +   + W K +  I  D   K  F +G+  L+I +      G Y  + +++ G   S 
Sbjct: 3950 -SEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTS- 4007

Query: 1345 LKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIR 1404
                     EL+++   KI   A    IQ TA       +      +LK  W  +G  + 
Sbjct: 4008 -------VGELIVKEPAKIIERAE--LIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLV 4058

Query: 1405 YSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQR 1464
             S + +         L+      +D G+Y  E+   + G   + + +    D   A F  
Sbjct: 4059 ASKKYRISFKNNVAQLKFYSAELHDSGQYTFEI-SNEVG-SSSCETTFTVLDRDIAPF-- 4114

Query: 1465 LKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCN 1524
                             L +V ++  G    L C + G  P  VSW K+ K +A+ D   
Sbjct: 4115 -------------FTKPLRNVDSVVNG-TCRLDCKIAGSLPMRVSWFKDGKEIAASDRYR 4160

Query: 1525 LKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIP 1570
            + F  G TA   I  V   D+G +     N  GS+ S   + V  P
Sbjct: 4161 IAFVEG-TASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEP 4205



 Score = 65.5 bits (158), Expect = 4e-10
 Identities = 62/235 (26%), Positives = 100/235 (42%), Gaps = 13/235 (5%)

Query: 142   SGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITTSKQSTASKQTTASKQSTASKQ 201
             S RQ+ V+ IT+ EEE   E + + AQR   +S   +   ++S +       +  +   +
Sbjct: 32235 SRRQREVTEITEIEEEY--EISKH-AQRESSSSASRLLRRRRSLSPTYIELMRPVSELIR 32291

Query: 202   STAS-----KQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKVVIREKAERLSLRK 256
             S        +  T  R  T  R    S    S+ +     E+ +R  +        +  K
Sbjct: 32292 SRPQPAEEYEDDTERRSPTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALK 32351

Query: 257   TLEETETYHAKLNEDH--LLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQ 314
             T + +E  +  L++    L HAP   ++ RSH V   +N +   ++   P   V WY N 
Sbjct: 32352 TQKTSERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNG 32411

Query: 315   VPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVV 369
             V +       K    +  G+ TLEI  C  +D+  YRA   N KGE S YA++ V
Sbjct: 32412 VELQ---ESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDV 32463



 Score = 64.7 bits (156), Expect = 7e-10
 Identities = 81/390 (20%), Positives = 142/390 (36%), Gaps = 58/390 (14%)

Query: 1186 KEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKL 1245
            KE+    KYK+        +++    +   D G Y+F++Q+    +  T  L        
Sbjct: 7624 KELTSDNKYKISFFNKVSGLKII--NVAPSDSGVYSFEVQNPVGKDSCTASL-------- 7673

Query: 1246 QKEAEFQRQEWIRKQGPHFVEYLSWEVTG--ECNVLLKCKVANIKKETHIVWYKDEREIS 1303
                    Q   R   P F   L  E  G    +V+++CKV        + W+ +  EIS
Sbjct: 7674 --------QVSDRTVPPSFTRKLK-ETNGLSGSSVVMECKVYG-SPPISVSWFHEGNEIS 7723

Query: 1304 VDEKHD--FKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCK 1361
               K+     D  C L +    + D+G Y  I  +  G D+    L        + +   
Sbjct: 7724 SGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPDP 7783

Query: 1362 KIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQ 1421
               L+ T++   S  +G   +S          V+W    S +   DR    +      L+
Sbjct: 7784 MDVLTGTNVTFTSIVKGTPPFS----------VSWFKGSSELVPGDRCNVSLEDSVAELE 7833

Query: 1422 INEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEF-QRLKQAAIAEKNRARVLG 1480
            + +   +  G+Y   + +       T  L    Y +A A+F +RL               
Sbjct: 7834 LFDVDTSQSGEYTCIVSNEAGKASCTTHL----YIKAPAKFVKRLND------------- 7876

Query: 1481 GLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGV 1540
                  +I++GK L L     G PP  V+W KN   +     CN+     ++A   I   
Sbjct: 7877 -----YSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNIT-TTEKSAILEIPSS 7930

Query: 1541 STADSGKYGLVVKNKYGSETSDFTVSVFIP 1570
            +  D+G+Y   ++N  G ++    + +  P
Sbjct: 7931 TVEDAGQYNCYIENASGKDSCSAQILILEP 7960



 Score = 64.3 bits (155), Expect = 9e-10
 Identities = 79/374 (21%), Positives = 143/374 (38%), Gaps = 61/374 (16%)

Query: 1193 KYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQD--GKATNHSTVVLVGDVFKKLQKEAE 1250
            KY++    N   ++ +  +L D   G YTF++ +  G ++  +T  ++            
Sbjct: 4062 KYRISFKNNVAQLKFYSAELHDS--GQYTFEISNEVGSSSCETTFTVLD----------- 4108

Query: 1251 FQRQEWIRKQGPHFVEYL---SWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEK 1307
                   R   P F + L      V G C   L CK+A       + W+KD +EI+  ++
Sbjct: 4109 -------RDIAPFFTKPLRNVDSVVNGTCR--LDCKIAG-SLPMRVSWFKDGKEIAASDR 4158

Query: 1308 HD--FKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIAL 1365
            +   F +G  +L I      DAG +     +  G   S   L+ +     + +   K  L
Sbjct: 4159 YRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPGSKDVL 4218

Query: 1366 SATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEP 1425
              + + ++ST +G             L + W      +         V+G   ++   E 
Sbjct: 4219 PGSAVCLKSTFQGST----------PLTIRWFKGNKEL---------VSGGSCYIT-KEA 4258

Query: 1426 TPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDV 1485
              +    Y+++  D  T   K  +++G    E  A     + A   EK     L      
Sbjct: 4259 LESSLELYLVKTSDSGTYTCKVSNVAGGV--ECSANLFVKEPATFVEKLEPSQL------ 4310

Query: 1486 VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADS 1545
              +++G A  L C V G PP +++W  N++ +       + F    TA   +  V   DS
Sbjct: 4311 --LKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSF-VESTAVLRLTDVGIEDS 4367

Query: 1546 GKYGLVVKNKYGSE 1559
            G+Y    +N+ GS+
Sbjct: 4368 GEYMCEAQNEAGSD 4381



 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 114/567 (20%), Positives = 201/567 (35%), Gaps = 78/567 (13%)

Query: 1014 SYVFRVRAINQAGVGKPSDLAGPVVAETR--PGTKEVVVNVDDDGVISLNFECDKMTPKS 1071
            +Y F+V    Q  VGK S  A   V++    P     + N       S   EC K+   S
Sbjct: 5773 TYTFQV----QNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILEC-KVAGSS 5827

Query: 1072 EFS--WSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLID 1129
              S  W  +        + +     N   +    L   D+G Y+C   +  G        
Sbjct: 5828 PISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAG-------- 5879

Query: 1130 EEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNA--KVNYIFNEKE 1187
             +E + +L +     F    VK    +E+L    V F      + G    KVN+    +E
Sbjct: 5880 SDECRAVLTVQEPPSF----VKEPEPLEVLPGKNVTF---TSVIRGTPPFKVNWFRGARE 5932

Query: 1188 IFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQK 1247
            + +G +  ++ +     +E+F   +     G YT  + +       T  L       +++
Sbjct: 5933 LVKGDRCNIYFEDTVAELELF--NIDISQSGEYTCVVSNNAGQASCTTRLF------VKE 5984

Query: 1248 EAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEK 1307
             A F     +++   H VE       G+  +L       +     + W KD   I+  EK
Sbjct: 5985 PAAF-----LKRLSDHSVE------PGKSIILESTYTGTL--PISVTWKKDGFNITTSEK 6031

Query: 1308 HDF--KDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIAL 1365
             +    +  C L I   +K+DAG Y   ++++ G+D     +        + E+    A 
Sbjct: 6032 CNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAA 6091

Query: 1366 SATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEP 1425
                + +Q    G            ++ V+W    + +R +   +T  T     L  N+ 
Sbjct: 6092 VGDSVSLQCQVAG----------TPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKV 6141

Query: 1426 TPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDV 1485
              ND G+Y            K  +  G A  +     Q  +       + AR L  +   
Sbjct: 6142 NINDSGEYTC----------KAENSIGTASSKTVFRIQERQ----LPPSFARQLKDIEQT 6187

Query: 1486 VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADS 1545
            V    G  + LTC + G  P +V W ++   L  D++    F     A   I     + S
Sbjct: 6188 V----GLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSF-VDNVATLKILQTDLSHS 6242

Query: 1546 GKYGLVVKNKYGSETSDFTVSVFIPEE 1572
            G+Y     N  G+ +S   ++   P++
Sbjct: 6243 GQYSCSASNPLGTASSSARLTAREPKK 6269



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 105/531 (19%), Positives = 200/531 (37%), Gaps = 98/531 (18%)

Query: 1051 NVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLG 1110
            N++     + +FEC+         W K+ V  E S + ++  +G   ++   +   +D  
Sbjct: 2890 NIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSA 2949

Query: 1111 IYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQA 1170
             Y+  V   D ++++  +    +  +L   +  +  T+  +    V +  +G    W++ 
Sbjct: 2950 EYTF-VCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFE----VTVNYEGISYKWLK- 3003

Query: 1171 EKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKAT 1230
                         N  EI    K +M   + T  + +    +   D   YTF    GKAT
Sbjct: 3004 -------------NGVEIKSTDKCQMRTKKLTHSLNI--RNVHFGDAADYTFVA--GKAT 3046

Query: 1231 NHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKE 1290
            + +T+ +         +  EF++         H  +    +V  +   + +C+V+  + +
Sbjct: 3047 STATLYVEA-------RHIEFRK---------HIKDI---KVLEKKRAMFECEVS--EPD 3085

Query: 1291 THIVWYKDEREISVDEKHDFKDG--ICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLV 1348
              + W KD++E+ + ++   +    +  LLI      DAG Y V+     G + S  KL 
Sbjct: 3086 ITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVA----GGNVSTAKLF 3141

Query: 1349 DEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVE------DLKVNWSHNGSA 1402
             E                  D++I+S  + +Q+       VE      D+  +W  +G  
Sbjct: 3142 VEG----------------RDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIE 3185

Query: 1403 IRYS--DRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYA 1460
            I +   +R K  V      + I+E   +D G+Y      G+     T+ ++     +   
Sbjct: 3186 INFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA--GRNRSSVTLYVNAPEPPQVLQ 3243

Query: 1461 EFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASD 1520
            E Q                      VT+Q GK       + G P P++SW K E+ L++ 
Sbjct: 3244 ELQP---------------------VTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTG 3282

Query: 1521 DHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPE 1571
              C    +        I      D+  Y    KN YG  T+  ++SV +PE
Sbjct: 3283 FKCKFLHDGQEYTLLLIEAF-PEDAAVYTCEAKNDYGVATTSASLSVEVPE 3332



 Score = 62.4 bits (150), Expect = 3e-09
 Identities = 101/468 (21%), Positives = 186/468 (39%), Gaps = 77/468 (16%)

Query: 977   YFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGP 1036
             +F D  E K K  ++  +++ A++ + +    L +   Y   VR    +G+         
Sbjct: 12406 WFKDGAEIK-KGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLT------- 12457

Query: 1037  VVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNK 1096
             V+ E    TK +  N++     ++   C+   P +E  W K      ++ R E+ ++G K
Sbjct: 12458 VLEEEAVFTKNLA-NIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRK 12516

Query: 1097  TKMTFKDLGMDDLGIYSCDVTD--TDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSEL 1154
               +  ++  ++D G Y+C +    TDG    + +  E + +   L               
Sbjct: 12517 RILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNL--------------- 12561

Query: 1155  AVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQD 1214
               EILE  +  F     K S    V +  ++K +  G KY +  D    ++ +    LQD
Sbjct: 12562 --EILEGEKAEFVCSISKES--FPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQD 12617

Query: 1215  EDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTG 1274
                GTY   +   +A  H TV+    +   L+     ++QE                   
Sbjct: 12618 M--GTYVVMVGAARAAAHLTVIEKLRIVVPLKDTRVKEQQE------------------- 12656

Query: 1275  ECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDF--KDGICTLLITEFSKKDAGIYEV 1332
                V+  C+V    +     W+++E  I    K+    KD + TL I +    D   Y V
Sbjct: 12657 ---VVFNCEVNT--EGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNV 12711

Query: 1333  ILKDDRGKD-KSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVED 1391
              L + RG++ KS   L+ E     ++E  K I             E ++  S VT++ + 
Sbjct: 12712 SLTNHRGENVKSAANLIVEEEDLRIVEPLKDI-------------ETMEKKS-VTFWCKV 12757

Query: 1392  LKVN----WSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVM 1435
              ++N    W+ NG  + + +RV   V   +  L I +    D+G+Y++
Sbjct: 12758 NRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIV 12805



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 102/499 (20%), Positives = 176/499 (35%), Gaps = 65/499 (13%)

Query: 1075 WSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELK 1134
            W +D V   D   L+     N   +      +   G YSC  ++  G ASS         
Sbjct: 6208 WYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASS--------S 6259

Query: 1135 RLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKY 1194
              L      K P   +K  ++++++      F       +   ++ +  + KEI  G  Y
Sbjct: 6260 ARLTAREPKKSPFFDIK-PVSIDVIAGESADFECHVTG-AQPMRITWSKDNKEIRPGGNY 6317

Query: 1195 KMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQ 1254
             +    NT  + +   K+   D G YT Q  +    +  +  L      K  K+ E  + 
Sbjct: 6318 TITCVGNTPHLRIL--KVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASK- 6374

Query: 1255 EWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHD--FKD 1312
              + KQG               ++ L+CK++    E  + W++++ E+    K++  F +
Sbjct: 6375 --VAKQGE--------------SIQLECKISG-SPEIKVSWFRNDSELHESWKYNMSFIN 6417

Query: 1313 GICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKI 1372
             +  L I E S +D+G Y     +  G       L  +A      +     AL  +D+ +
Sbjct: 6418 SVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGALKGSDVIL 6477

Query: 1373 QSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGK 1432
            Q    G   +  V          W  +   +R S + K         L I     +D G+
Sbjct: 6478 QCEISGTPPFEVV----------WVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGE 6527

Query: 1433 YVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGK 1492
            Y          H K  +  G        +F          K   R +  L D  T+  G 
Sbjct: 6528 Y----------HCKATNEVGSDTCSCSVKF----------KEPPRFVKKLSDTSTL-IGD 6566

Query: 1493 ALNLTCNVWGDPPPEVSWLKNE-KALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLV 1551
            A+ L   V G  P  V WLK+  + +   ++  + F     A   +     ++SGKY   
Sbjct: 6567 AVELRAIVEGFQPISVVWLKDRGEVIRESENTRISF-IDNIATLQLGSPEASNSGKYICQ 6625

Query: 1552 VKNKYGSETSDFTVSVFIP 1570
            +KN  G       ++V  P
Sbjct: 6626 IKNDAGMRECSAVLTVLEP 6644



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 63/288 (21%), Positives = 114/288 (39%), Gaps = 96/288 (33%)

Query: 1393  KVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKY--VMELFDGKTGHQKTVDL 1450
             +V W HNG  ++ S ++    T   + L+I +   +D G Y  V   + G+     T+D+
Sbjct: 32404 EVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDV 32463

Query: 1451  SGQAYD----------------------EAYA--EFQR---------------------- 1464
             +G  Y                       EAYA   F++                      
Sbjct: 32464 TGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRE 32523

Query: 1465  ------------LKQAAIAEKN--------------RARVLGGLPDVVTIQEGKALNLTC 1498
                         +K AA+ EK+               AR+L   P  +T+ EG++   +C
Sbjct: 32524 SLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTK-PRSMTVYEGESARFSC 32582

Query: 1499  NVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAY---FTINGVSTADSGKYGLVVKNK 1555
             +  G+P P V+WL+  + L++    + + +   T Y   F I+ V  +D G Y +VV+N 
Sbjct: 32583 DTDGEPVPTVTWLRKGQVLST----SARHQVTTTKYKSTFEISSVQASDEGNYSVVVENS 32638

Query: 1556  YGSETSDFTVSV--------------FIPEEEARMAALESLKGGKKAK 1589
              G + ++FT+++               +   E R+ + E++K  K+ K
Sbjct: 32639 EGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVK 32686



 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 102/522 (19%), Positives = 181/522 (34%), Gaps = 66/522 (12%)

Query: 1068 TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG--IASS 1125
            TP    SW KD      S R  +      T +   +  ++D   YSC + +  G  I  +
Sbjct: 6953 TPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEA 7012

Query: 1126 YLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNE 1185
             +   E    +  L H       P   +  V+   + ++ ++ +  KL            
Sbjct: 7013 LVSVLEPPYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLR----------- 7061

Query: 1186 KEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKL 1245
                  P YKM    N  +  + + K+   D G Y+ +  +      S+ VL   V K  
Sbjct: 7062 ----SAPAYKMQFKNN--VASLVINKVDHSDVGEYSCKADNSVGAVASSAVL---VIKAR 7112

Query: 1246 QKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVD 1305
            +    F R    + +  H  E L + V  EC +       N  +   + WYKD   +  D
Sbjct: 7113 KLPPFFAR----KLKDVH--ETLGFPVAFECRI-------NGSEPLQVSWYKDGVLLKDD 7159

Query: 1306 E--KHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKI 1363
               +  F   + TL I +  +   G Y     +  G   S  KL+    +       K +
Sbjct: 7160 ANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPV 7219

Query: 1364 ALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQIN 1423
            ++   DL +  +      +         +K+ W+ +   IR     K  +      L + 
Sbjct: 7220 SV---DLALGESG----TFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVL 7272

Query: 1424 EPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLP 1483
            +    D G+Y             T   S  A  ++ +       A +  +   R +  L 
Sbjct: 7273 KVGKGDAGQY-------------TCYASNIAGKDSCS-------AQLGVQEPPRFIKKLE 7312

Query: 1484 DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
                +++ +     C + G P  +V W K+E  +       + F     A   ++ +S  
Sbjct: 7313 PSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSF-VDSVAVLEMHNLSVE 7371

Query: 1544 DSGKYGLVVKNKYGSETSDFTVSVFIPE-EEARMAALESLKG 1584
            DSG Y     N  GS +S  ++ V  P     +   +E+LKG
Sbjct: 7372 DSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKG 7413



 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 43/130 (33%), Positives = 67/130 (51%), Gaps = 10/130 (7%)

Query: 940   IAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAI 999
             I VPGP  +L+ +E     + L W+ P+  G + + GY V+ ++ K K   W    + A 
Sbjct: 13087 IDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKT--WVLATDRA- 13143

Query: 1000  KNVYLKVRGL-KEGVSYVFRVRAINQAGVGKPSDLAGPVVAETR-----PGTKEVVVNVD 1053
             ++    V GL K GV Y+FRV A N+ G G+P +   PV A ++     P     + +V+
Sbjct: 13144 ESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVN 13203

Query: 1054  DDGVISLNFE 1063
               GV SL +E
Sbjct: 13204 RFGV-SLTWE 13212



 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 103/508 (20%), Positives = 188/508 (37%), Gaps = 43/508 (8%)

Query: 1069 PKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLI 1128
            P+ + SW K+        + +    G +  +   +   +D  +Y+C+  +  G+A++   
Sbjct: 3266 PQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSAS 3325

Query: 1129 DEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQ-VRFWMQAEKLSGNAKVNYIFNEKE 1187
               E+  +++   E       + + L   +  +GQ  RF  Q      + KV++   +K+
Sbjct: 3326 LSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARF--QCRVSGTDLKVSWYSKDKK 3383

Query: 1188 IFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQK 1247
            I     ++M    +T  +E+   +   EDEGTYTF   +      ST  L  +  + +  
Sbjct: 3384 IKPSRFFRMTQFEDTYQLEI--AEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILH 3441

Query: 1248 EAEFQRQEWIRKQGPHFVEYLS-WEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDE 1306
            E   Q  E   K  P     +   EV         C++ +        W+K  REI   +
Sbjct: 3442 ERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQS-APNVRFQWFKAGREIYESD 3500

Query: 1307 KHDFKDG--ICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKL-VDEAFKELMMEVCKKI 1363
            K   +    I +L I      D G Y     ++ G       L V EA+    +   K +
Sbjct: 3501 KCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSL 3560

Query: 1364 -ALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQI 1422
                    K   T  G  +          ++  W  +G+A+  S   +      +  L++
Sbjct: 3561 TTFVGKAAKFICTVTGTPV----------IETIWQKDGAALSPSPNWRISDAENKHILEL 3610

Query: 1423 NEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGL 1482
            +  T  D+G Y                 S +A ++  A+  + +   I + +  + L  +
Sbjct: 3611 SNLTIQDRGVY-----------------SCKASNKFGADICQAELIIIDKPHFIKELEPV 3653

Query: 1483 PDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVST 1542
               +     K ++L C V  D    V+W K+ + L       + FE  + A   I     
Sbjct: 3654 QSAI----NKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFE-DKIATLEIPLAKL 3708

Query: 1543 ADSGKYGLVVKNKYGSETSDFTVSVFIP 1570
             DSG Y     N+ GS +   TV+V  P
Sbjct: 3709 KDSGTYVCTASNEAGSSSCSATVTVREP 3736



 Score = 58.5 bits (140), Expect = 5e-08
 Identities = 93/508 (18%), Positives = 193/508 (37%), Gaps = 82/508 (16%)

Query: 1074 SWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEEL 1133
            +W KD     +   + +  + N   +    + +   G Y C   +  GI        +  
Sbjct: 4518 TWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGI--------QRC 4569

Query: 1134 KRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVN--YIFNEKEIFEG 1191
              LL++    K P    +  +++++ +       +   K SG  ++   +  + +E+  G
Sbjct: 4570 SALLSV----KEPATITEEAVSIDVTQGDPATLQV---KFSGTKEITAKWFKDGQELTLG 4622

Query: 1192 PKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDG------KATNHSTVVLVGDVFKKL 1245
             KYK+ +     I+++     + +D G YTF++Q+       KA  +   +++   F K 
Sbjct: 4623 SKYKISVTDTVSILKII--STEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKK 4680

Query: 1246 QKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVD 1305
             K+ +  +  +I                      L+C VA       I W+KD++EIS  
Sbjct: 4681 LKKMDSIKGSFID---------------------LECIVAG-SHPISIQWFKDDQEISAS 4718

Query: 1306 EKHDFK--DGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKI 1363
            EK+ F   D    L I++    D+G Y     +  G ++    L  +     + +   + 
Sbjct: 4719 EKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQD 4778

Query: 1364 ALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIR-YSDRVKTGVTGEQIWLQI 1422
                T +++++   G    + + ++ ++ ++   H+G+A   + D   T        L++
Sbjct: 4779 VNPNTRVQLKALVGGTAPMT-IKWFKDNKEL---HSGAARSVWKDDTSTS-------LEL 4827

Query: 1423 NEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGL 1482
                  D G Y+ +L +            G A            +A +  K   + +   
Sbjct: 4828 FAAKATDSGTYICQLSNDV----------GTA----------TSKATLFVKEPPQFIKKP 4867

Query: 1483 PDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVST 1542
              V+ ++ G++    C + G P   VSW  +   + +     + F  G  A F I+G   
Sbjct: 4868 SPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDG-LATFQISGARV 4926

Query: 1543 ADSGKYGLVVKNKYGSETSDFTVSVFIP 1570
             +SG Y    +N  G+ +    + V  P
Sbjct: 4927 ENSGTYVCEARNDAGTASCSIELKVKEP 4954



 Score = 57.8 bits (138), Expect = 8e-08
 Identities = 180/935 (19%), Positives = 342/935 (36%), Gaps = 189/935 (20%)

Query: 706  KSYCFRVRCSNSAGVGEPSEATEVTVVGDK----LDIPKAPGKIIPSRNTDTS------- 754
            +S   +  C+ +  +G  S +  + +   K     DI  AP   +   + D         
Sbjct: 8121 RSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQ 8180

Query: 755  -VVVSWEESKDAKELV--GYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRV 811
             + VSW  +KD++E+   G Y  + +  S        +     ++TC+            
Sbjct: 8181 PIKVSW--AKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCY------------ 8226

Query: 812  RAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITG 871
             AVN  G    +     + +K  + PPS    ++  E+  ++    +K   ++ G++   
Sbjct: 8227 -AVNEVGKDSCTAQ---LNIKERLIPPSFTKRLS--ETVEETEGNSFKLEGRVAGSQ--- 8277

Query: 872  YYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSE 931
                       +   W + N++       +I+     +V Q + A MN AGL        
Sbjct: 8278 ----------PITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGL-------- 8319

Query: 932  CFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQW--KPPVHSGR-TPVT---GYFVDLK-EA 984
                  +T  V     S  C+     S+V++   KPPV     TPVT   G +V L    
Sbjct: 8320 ------YTCKVSNDAGSALCTS----SIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHV 8369

Query: 985  KAKED---QW-----------RGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGV--- 1027
            +  E    QW           R     A     L++R + +  S  +  +A N AG    
Sbjct: 8370 QGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTT 8429

Query: 1028 -GKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFE------CDKMT----------PK 1070
              K +    P VA   P TK+  V    DG +    E       +K T          P 
Sbjct: 8430 KSKVTIKDKPAVA---PATKKAAV----DGRLFFVSEPQSIRVVEKTTATFIAKVGGDPI 8482

Query: 1071 SEFSWSKD-YVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL-- 1127
                W+K  +       R+ +  KG++ K+  +D    D G+Y C   +  G   S +  
Sbjct: 8483 PNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNL 8542

Query: 1128 -IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEK 1186
             +DE + +  +           P        IL+KG      + E++     +  +    
Sbjct: 8543 QVDERKKQEKIEGDLRAMLKKTP--------ILKKGAG----EEEEID----IMELLKNV 8586

Query: 1187 EIFEGPKY-KMH-IDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKK 1244
            +  E  KY +M+ I    G+++ F    Q ++E T+  ++++ + +            K+
Sbjct: 8587 DPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRLEIEEIERSERDE--------KE 8638

Query: 1245 LQKEAEFQRQEWIRKQGPHFVEYLSWE-VTGECNVLLKCKVANIKKETHIVWYKDEREIS 1303
             ++   F +Q   + +    ++ +  + V  + + + +  +     E  + WYK   ++ 
Sbjct: 8639 FEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDAVFEIDIKINYPEIKLSWYKGTEKLE 8698

Query: 1304 VDEKHDFK-DGIC-TLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCK 1361
              +K +   DG   TL +     KD G Y ++        K  L +++ A++  + +V  
Sbjct: 8699 PSDKFEISIDGDRHTLRVKNCQLKDQGNYRLVCGPHIASAK--LTVIEPAWERHLQDVTL 8756

Query: 1362 KIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQ 1421
            K              EG        + V ++K  W  NG  ++   R KT V  +   L 
Sbjct: 8757 K--------------EGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRHKTEVEHKVHKLT 8802

Query: 1422 INEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGG 1481
            I +    D+G+Y  +  D +T  +  ++       E     +R++               
Sbjct: 8803 IADVRAEDQGQYTCKYEDLETSAELRIEA------EPIQFTKRIQN-------------- 8842

Query: 1482 LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1541
                + + E ++    C V  D    V+W K    L      N + + GR  Y TI+ V+
Sbjct: 8843 ----IVVSEHQSATFECEVSFD-DAIVTWYKGPTELTESQKYNFRND-GRCHYMTIHNVT 8896

Query: 1542 TADSGKYGLVVKNKYGSETSDFTVSVFIPEEEARM 1576
              D G Y ++ + +   E    T  +++  +E ++
Sbjct: 8897 PDDEGVYSVIARLEPRGEARS-TAELYLTTKEIKL 8930



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 57/235 (24%), Positives = 100/235 (42%), Gaps = 27/235 (11%)

Query: 1370  LKIQSTAEGIQLYSFVTYYVEDLK-VNWSHNGSAIRYSDRVKTGVTGEQIW-LQINEPTP 1427
             LK +++ E  +L   V   V   K V W  +G  ++ +   +   + +  + L+IN  T 
Sbjct: 32724 LKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTE 32783

Query: 1428  NDKGKYVMELFDGKTGHQKT-VDLSGQAY----------DEAYAEFQRLKQAAIAEKNRA 1476
             +D+G+YV E+  G+ G  KT +   GQA+           E     Q+  ++ +  K   
Sbjct: 32784 SDQGEYVCEI-SGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEP 32842

Query: 1477  R----------VLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLK 1526
             +          ++ GL D  T+             G+P P   W K+ KA+       L 
Sbjct: 32843 KAPEPISSKPVIVTGLQD-TTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLS 32901

Query: 1527  FEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV-FIPEEEARMAALE 1580
              + G   +  I+   T+DSG Y   VKN  GS +S   +++  I + EA+  + +
Sbjct: 32902 EDKG-GFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQ 32955



 Score = 57.0 bits (136), Expect = 1e-07
 Identities = 96/519 (18%), Positives = 188/519 (36%), Gaps = 75/519 (14%)

Query: 1059 SLNFECDKMTPKSEFS--WSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDV 1116
            S++ EC K++     S  W KD      S +  +        +   +L ++D   Y+C V
Sbjct: 5253 SIHMEC-KVSGSLPISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKV 5311

Query: 1117 TDT--DGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLS 1174
            ++   D   S  L  +E    L+    +   P     S +  + + KG   F        
Sbjct: 5312 SNVAGDDACSGILTVKEPPSFLVKPGRQQAIP----DSTVEFKAILKGTPPF-------- 5359

Query: 1175 GNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHST 1234
               K+ +  ++ E+  GPK  + ++ +T  + ++   +     G YT  + +   ++  T
Sbjct: 5360 ---KIKWFKDDVELVSGPKCFIGLEGSTSFLNLY--SVDASKTGQYTCHVTNDVGSDSCT 5414

Query: 1235 VVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIV 1294
             +L+     K  K+ E  +   I K G               +  L+CK+A    E  +V
Sbjct: 5415 TMLLVTEPPKFVKKLEASK---IVKAGD--------------SSRLECKIAG-SPEIRVV 5456

Query: 1295 WYKDEREISVDEKH--DFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAF 1352
            W+++E E+   +K+   F D +  + +   S +D+G +    ++  G      K++ +  
Sbjct: 5457 WFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEP 5516

Query: 1353 KELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTG 1412
                        L   ++ ++    G   +  V          W  +   +R S + K  
Sbjct: 5517 PVFSSFPPIVETLKNAEVSLECELSGTPPFEVV----------WYKDKRQLRSSKKYKIA 5566

Query: 1413 VTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAE 1472
                   + I     +D G+Y  +    + G    V                     +  
Sbjct: 5567 SKNFHTSIHILNVDTSDIGEYHCKA-QNEVGSDTCV-------------------CTVKL 5606

Query: 1473 KNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLK-NEKALASDDHCNLKFEAGR 1531
            K   R +  L + +T+  G+   L  ++ G  P  V WLK  E+ +   ++  + F    
Sbjct: 5607 KEPPRFVSKL-NSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITF-VEN 5664

Query: 1532 TAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIP 1570
             A         A++GKY   +KN  G   +  T+ V  P
Sbjct: 5665 VATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEP 5703



 Score = 57.0 bits (136), Expect = 1e-07
 Identities = 52/212 (24%), Positives = 80/212 (37%), Gaps = 43/212 (20%)

Query: 273  LLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRY 332
            +L  P F+ +     V   ++  L C +AG PE  V+WYK    +        Y +  R 
Sbjct: 7957 ILEPPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTT---YKMHFRN 8013

Query: 333  GMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF 392
             + TL  N  D  D+ +Y   A N  GE+SA   + V+                      
Sbjct: 8014 NVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQ---------------------- 8051

Query: 393  GVTPYGYASRFEIHFDDKFDVSFGREGETM--SLGCRVVITPEIKHFQP-EIQWYRNGVP 449
                           + K   SF R+   +  ++G  VV    I   +P  + WY++G P
Sbjct: 8052 ---------------EQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKP 8096

Query: 450  LSPSKWVQTLWSGERATLTFSHLNKEDEGLYT 481
            L  S  VQT +    ATL     ++   G Y+
Sbjct: 8097 LKDSPNVQTSFLDNTATLNIFKTDRSLAGQYS 8128



 Score = 55.8 bits (133), Expect = 3e-07
 Identities = 75/381 (19%), Positives = 137/381 (35%), Gaps = 56/381 (14%)

Query: 1195 KMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTV-VLVGDVFKKLQKEAEFQR 1253
            K HI     +  + +   +  D+G Y+F++++    ++ TV V V D             
Sbjct: 6690 KHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSD------------- 6736

Query: 1254 QEWIRKQGPHFVEYLSWEVTG--ECNVLLKCKVANIKKETHIVWYKDEREISVDEK--HD 1309
                R   P F+  L  +V      +V+L+C+V+       + W++D  EI    K    
Sbjct: 6737 ----RIVPPSFIRKLK-DVNAILGASVVLECRVSG-SAPISVGWFQDGNEIVSGPKCQSS 6790

Query: 1310 FKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATD 1369
            F + +CTL ++     D GIY  +  +  G D+    L  +              L    
Sbjct: 6791 FSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSVEVLPGMS 6850

Query: 1370 LKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPND 1429
            L   S   G   +          KV W      +   +     +      L++ E  P +
Sbjct: 6851 LTFTSVIRGTPPF----------KVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLE 6900

Query: 1430 KGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQ 1489
             G Y   + +       T  L              +K+ A   K  A          +++
Sbjct: 6901 SGDYSCLVTNDAGSASCTTHLF-------------VKEPATFVKRLADF--------SVE 6939

Query: 1490 EGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYG 1549
             G  + L     G PP  VSW+K+E  ++  + C++     ++    I   +  D  +Y 
Sbjct: 6940 TGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITM-TEKSTILEILESTIEDYAQYS 6998

Query: 1550 LVVKNKYGSETSDFTVSVFIP 1570
             +++N+ G +  +  VSV  P
Sbjct: 6999 CLIENEAGQDICEALVSVLEP 7019



 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 98/507 (19%), Positives = 176/507 (34%), Gaps = 83/507 (16%)

Query: 1074 SWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEEL 1133
            SW KD      S R  +        +    + M+D G ++C  T++ G   S        
Sbjct: 4145 SWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDS-------- 4196

Query: 1134 KRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPK 1193
               L +     F T P   ++       G         + S    + +    KE+  G  
Sbjct: 4197 SGALIVQEPPSFVTKPGSKDVL-----PGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGS 4251

Query: 1194 YKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQR 1253
              +  +     +E+++ K  D   GTYT ++ +          + G V        E   
Sbjct: 4252 CYITKEALESSLELYLVKTSDS--GTYTCKVSN----------VAGGV--------ECSA 4291

Query: 1254 QEWIRKQGPHFVEYLSWEVTGECNVLLK--------CKVANIKKETHIVWYKDEREISVD 1305
              ++ K+   FVE L      E + LLK        CKV        I W+ ++REI   
Sbjct: 4292 NLFV-KEPATFVEKL------EPSQLLKKGDATQLACKVTGTPP-IKITWFANDREIKES 4343

Query: 1306 EKH--DFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKI 1363
             KH   F +    L +T+   +D+G Y    +++ G D     ++ +       E     
Sbjct: 4344 SKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKPIE 4403

Query: 1364 ALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQIN 1423
             L   D+ + +   G   +          ++ W  + + +R   + KT +    + LQI 
Sbjct: 4404 VLKEYDVMLLAEVAGTPPF----------EITWFKDNTILRSGRKYKTFIQDHLVSLQIL 4453

Query: 1424 EPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLP 1483
            +    D G+Y   +   + G                     +  A +  +     +  + 
Sbjct: 4454 KFVAADAGEYQCRV-TNEVG-------------------SSICSARVTLREPPSFIKKIE 4493

Query: 1484 DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
               +++ G A      + G  P  V+WLK+   +  DD+  + FE    A   ++G+   
Sbjct: 4494 STSSLRGGTAA-FQATLKGSLPITVTWLKDSDEITEDDNIRMTFE-NNVASLYLSGIEVK 4551

Query: 1544 DSGKYGLVVKNKYGSETSDFTVSVFIP 1570
              GKY    KN  G +     +SV  P
Sbjct: 4552 HDGKYVCQAKNDAGIQRCSALLSVKEP 4578



 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 53/229 (23%), Positives = 89/229 (38%), Gaps = 40/229 (17%)

Query: 273  LLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRY 332
            L   P FI K  + T   K +     ++AG P   +TW K+   ++   N     ++S  
Sbjct: 5044 LKEPPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDS-- 5101

Query: 333  GMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF 392
             + TL+I   D   + +Y   A N  G    YA ++V+      ++ +          S 
Sbjct: 5102 -VATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIVEKAK----------SV 5150

Query: 393  GVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSP 452
             VT                      E + M+L C V  TPE+K     ++W ++G  + P
Sbjct: 5151 DVT----------------------EKDPMTLECVVAGTPELK-----VKWLKDGKQIVP 5183

Query: 453  SKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRD 501
            S++    +    A+     + K+D G YT +V          AY+ V D
Sbjct: 5184 SRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLD 5232



 Score = 55.1 bits (131), Expect = 5e-07
 Identities = 92/500 (18%), Positives = 192/500 (38%), Gaps = 81/500 (16%)

Query: 1068 TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1127
            TP  + +W  +    ++S +  +    +   +   D+G++D G Y C+  +  G      
Sbjct: 4326 TPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAG------ 4379

Query: 1128 IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNA--KVNYIFNE 1185
               +    ++ +     F     K    +E+L++  V   M   +++G    ++ +  + 
Sbjct: 4380 --SDHCSSIVIVKESPYF----TKEFKPIEVLKEYDV---MLLAEVAGTPPFEITWFKDN 4430

Query: 1186 KEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQD--GKATNHSTVVLVGDVFK 1243
              +  G KYK  I  +  ++ + + K    D G Y  ++ +  G +   + V L      
Sbjct: 4431 TILRSGRKYKTFIQDH--LVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTL------ 4482

Query: 1244 KLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIV--WYKDERE 1301
                           ++ P F++ +  E T           A +K    I   W KD  E
Sbjct: 4483 ---------------REPPSFIKKI--ESTSSLRGGTAAFQATLKGSLPITVTWLKDSDE 4525

Query: 1302 ISVDE--KHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEV 1359
            I+ D+  +  F++ + +L ++    K  G Y    K+D G  +    L   + KE     
Sbjct: 4526 ITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALL---SVKEPATIT 4582

Query: 1360 CKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIW 1419
             + +++  T    Q     +Q+    T   +++   W  +G  +    + K  VT     
Sbjct: 4583 EEAVSIDVT----QGDPATLQVKFSGT---KEITAKWFKDGQELTLGSKYKISVTDTVSI 4635

Query: 1420 LQINEPTPNDKGKYVMELFD--GKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRAR 1477
            L+I      D G+Y  E+ +  G++  +  +++       ++ +  +LK+          
Sbjct: 4636 LKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTK--KLKKM--------- 4684

Query: 1478 VLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTI 1537
                  D +   +G  ++L C V G  P  + W K+++ +++ +     F    TA+  I
Sbjct: 4685 ------DSI---KGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFH-DNTAFLEI 4734

Query: 1538 NGVSTADSGKYGLVVKNKYG 1557
            + +   DSG Y     NK G
Sbjct: 4735 SQLEGTDSGTYTCSATNKAG 4754



 Score = 54.7 bits (130), Expect = 7e-07
 Identities = 100/495 (20%), Positives = 186/495 (37%), Gaps = 92/495 (18%)

Query: 1062  FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1121
             FEC+     ++  W KD    +   + ++ SKG    +      +DD   YSC+V     
Sbjct: 12393 FECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTART 12452

Query: 1122  IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNY 1181
                  +++EE                V  K+   +E+ E   ++   +  K    A+V +
Sbjct: 12453 SGMLTVLEEE---------------AVFTKNLANIEVSETDTIKLVCEVSK--PGAEVIW 12495

Query: 1182  IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQL----QDGKATNHSTVVL 1237
                ++EI E  +Y++  +    I  + ++    ED G Y  +L     DGK   H     
Sbjct: 12496 YKGDEEIIETGRYEILTEGRKRI--LVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAA- 12552

Query: 1238  VGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYK 1297
                              E+I K  P  +E L  E          C ++  K+   + W +
Sbjct: 12553 -----------------EFISK--PQNLEILEGE-----KAEFVCSIS--KESFPVQWKR 12586

Query: 1298  DEREISVDEKHD-FKDG-ICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKEL 1355
             D++ +   +K+D   DG    L++ + + +D G Y V++   R    + L ++++     
Sbjct: 12587 DDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARA--AAHLTVIEKL---- 12640

Query: 1356  MMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTG 1415
                   +I +   D +++   E +      T   E  K  W  N  AI  S +       
Sbjct: 12641 ------RIVVPLKDTRVKEQQEVVFNCEVNT---EGAKAKWFRNEEAIFDSSKYIILQKD 12691

Query: 1416  EQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAA--IAEK 1473
                 L+I +   +D+  Y + L    T H+                 + +K AA  I E+
Sbjct: 12692 LVYTLRIRDAHLDDQANYNVSL----TNHRG----------------ENVKSAANLIVEE 12731

Query: 1474  NRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTA 1533
                R++  L D+ T+ E K++   C V       + W KN + +  D+  + + +  +  
Sbjct: 12732 EDLRIVEPLKDIETM-EKKSVTFWCKV-NRLNVTLKWTKNGEEVPFDNRVSYRVDKYK-H 12788

Query: 1534  YFTINGVSTADSGKY 1548
               TI      D G+Y
Sbjct: 12789 MLTIKDCGFPDEGEY 12803



 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 1482  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1541
             +P+ +TI+ GK L +  +V+G P P   W K E  + +  H  +  +A  ++   I  V+
Sbjct: 18904 MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAV-HKADSSSILIIKDVT 18962

Query: 1542  TADSGKYGLVVKNKYGSETSDFTVSV 1567
               DSG Y L  +N  G++T    V V
Sbjct: 18963 RKDSGYYSLTAENSSGTDTQKIKVVV 18988



 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 44/192 (22%), Positives = 83/192 (43%), Gaps = 30/192 (15%)

Query: 180   TSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKK 239
             T   + +S + T+  ++++S +   S Q T +R+S +S +   S +  SA  +E++ E  
Sbjct: 32491 TEAYAVSSFKKTSEMEASSSVREVKS-QMTETRESLSSYEHSASAEMKSAALEEKSLE-- 32547

Query: 240   SRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCS 299
                    EK+    ++ TL                 A   + KPRS TV+E E+ +  C 
Sbjct: 32548 -------EKSTTRKIKTTL-----------------AARILTKPRSMTVYEGESARFSCD 32583

Query: 300   IAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKG 359
               G P P VTW +    ++  A   ++ + +     T EI+     D   Y     N +G
Sbjct: 32584 TDGEPVPTVTWLRKGQVLSTSA---RHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEG 32640

Query: 360   ELSAYASVVVKR 371
             +  A  ++ +++
Sbjct: 32641 KQEAEFTLTIQK 32652



 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 1/84 (1%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
             D +TI+ G+A  LT    G P P+VSW K+E  +  DD  ++K      A   I     +
Sbjct: 16826 DKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIK-AKRS 16884

Query: 1544  DSGKYGLVVKNKYGSETSDFTVSV 1567
             DSGKY +VV+N  GS      V+V
Sbjct: 16885 DSGKYCVVVENSTGSRKGFCQVNV 16908



 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 47/166 (28%), Positives = 72/166 (43%), Gaps = 9/166 (5%)

Query: 1407  DRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQ--- 1463
             +R      G+  WL+ N    +D    V  L +G T   + +  +        +E     
Sbjct: 28976 ERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPV 29035

Query: 1464  --RLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDD 1521
               R + A    +  AR+ G   D+VTI+ G  L L   V G P P++ W K +K L   +
Sbjct: 29036 TCRDEYAPPKAELDARLHG---DLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCE 29092

Query: 1522  HCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1567
               +L++  G+ A   I     +DSGKY L VKN  G++     V V
Sbjct: 29093 KVSLQY-TGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKV 29137



 Score = 52.0 bits (123), Expect = 5e-06
 Identities = 47/205 (22%), Positives = 81/205 (39%), Gaps = 38/205 (18%)

Query: 277  PEFIIKPRSHT-VWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMH 335
            P + I+P  H      E   L C + G PE R++WYK    +    +   Y ++ +  + 
Sbjct: 7019 PPYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLR---SAPAYKMQFKNNVA 7075

Query: 336  TLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVT 395
            +L IN  D  D  +Y   A N  G +++ A +V+K  K                    + 
Sbjct: 7076 SLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARK--------------------LP 7115

Query: 396  PYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKW 455
            P+      ++H    F V+F          CR+  +  +     ++ WY++GV L     
Sbjct: 7116 PFFARKLKDVHETLGFPVAF---------ECRINGSEPL-----QVSWYKDGVLLKDDAN 7161

Query: 456  VQTLWSGERATLTFSHLNKEDEGLY 480
            +QT +    ATL     ++   G Y
Sbjct: 7162 LQTSFVHNVATLQILQTDQSHIGQY 7186



 Score = 51.6 bits (122), Expect = 6e-06
 Identities = 101/517 (19%), Positives = 179/517 (34%), Gaps = 70/517 (13%)

Query: 1059 SLNFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVT 1117
            S  FEC    TPK   SW  D        +  +               +++ G Y C+  
Sbjct: 4878 STTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEAR 4937

Query: 1118 DTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNA 1177
            +  G AS  +  E ++K       E K   V   S++ +E    G   F           
Sbjct: 4938 NDAGTASCSI--ELKVKEPPTFIRELKPVEVVKYSDVELECEVTGTPPF----------- 4984

Query: 1178 KVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQ-DGKATNHSTVV 1236
            +V ++ N +EI    KY +  DR   +  + + K    D G Y   +  +G + + ST V
Sbjct: 4985 EVTWLKNNREIRSSKKYTL-TDR-VSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRV 5042

Query: 1237 LVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTG-ECNVLLKCKVANIKKETHIVW 1295
             +                    K+ P F++ +    T  + +   +  VA       I W
Sbjct: 5043 AL--------------------KEPPSFIKKIENTTTVLKSSATFQSTVAG-SPPISITW 5081

Query: 1296 YKDEREISVDEKH--DFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFK 1353
             KD++ +  D+     F D + TL I       +G Y    K++ G        V+  + 
Sbjct: 5082 LKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESG--------VERCYA 5133

Query: 1354 ELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGV 1413
             L+++   +I   A  + +  T +       V     +LKV W  +G  I  S       
Sbjct: 5134 FLLVQEPAQIVEKAKSVDV--TEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSF 5191

Query: 1414 TGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEK 1473
                   +I      D G+Y  ++ +         D    + D       +    +  +K
Sbjct: 5192 ENNVASFRIQSVMKQDSGQYTFKVEN---------DFGSSSCDAYLRVLDQNIPPSFTKK 5242

Query: 1474 NRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTA 1533
                 L  +  V+    G ++++ C V G  P    W K+ K +++     L     R+ 
Sbjct: 5243 -----LTKMDKVL----GSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHE-RSV 5292

Query: 1534 YFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIP 1570
               +N +   D+  Y   V N  G +     ++V  P
Sbjct: 5293 SLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEP 5329



 Score = 51.6 bits (122), Expect = 6e-06
 Identities = 124/579 (21%), Positives = 217/579 (37%), Gaps = 83/579 (14%)

Query: 1003 YLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNF 1062
            +L++  + +G S  +  +A N   VGK    A   V E     K++  +       S+  
Sbjct: 6327 HLRILKVGKGDSGQYTCQATND--VGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQL 6384

Query: 1063 ECD-KMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1121
            EC    +P+ + SW ++     +S +  +    +   +T  +   +D G Y C+  +  G
Sbjct: 6385 ECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVG 6444

Query: 1122 IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNA--KV 1179
             AS             + +   K P V  +    V  L+   V   +Q E +SG    +V
Sbjct: 6445 DASC------------STALTVKAPPVFTQKPSPVGALKGSDVI--LQCE-ISGTPPFEV 6489

Query: 1180 NYIFNEKEIFEGPKYKM---HIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVV 1236
             ++ + K++    K+K+   H D +  I+      L+  D G Y       KATN     
Sbjct: 6490 VWVKDRKQVRNSKKFKITSKHFDTSLHILN-----LEASDVGEYHC-----KATNE---- 6535

Query: 1237 LVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWY 1296
             VG          +F       K+ P FV+ LS   T   + +    +    +   +VW 
Sbjct: 6536 -VGS--DTCSCSVKF-------KEPPRFVKKLSDTSTLIGDAVELRAIVEGFQPISVVWL 6585

Query: 1297 KDEREI---SVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFK 1353
            KD  E+   S + +  F D I TL +      ++G Y   +K+D G  +    L      
Sbjct: 6586 KDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLT----- 6640

Query: 1354 ELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGV 1413
              ++E  + I     +    +T     L   VT   E L   W  +G  +    +     
Sbjct: 6641 --VLEPARII--EKPEPMTVTTGNPFALECVVTGTPE-LSAKWFKDGRELSADSKHHITF 6695

Query: 1414 TGEQIWLQINEPTPNDKGKYVMELFD--GKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIA 1471
              +   L+I     +DKG Y  E+ +  GK+    +V +S +    ++            
Sbjct: 6696 INKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSF------------ 6743

Query: 1472 EKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGR 1531
                   +  L DV  I  G ++ L C V G  P  V W ++   + S   C   F +  
Sbjct: 6744 -------IRKLKDVNAIL-GASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSF-SEN 6794

Query: 1532 TAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIP 1570
                 ++ +  +D+G Y  V  N  GS+     ++V  P
Sbjct: 6795 VCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEP 6833



 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 78/375 (20%), Positives = 132/375 (35%), Gaps = 84/375 (22%)

Query: 184  STASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKV 243
            +T +K+    K++         ++S   R     R      +A +A++ +   + +S + 
Sbjct: 1970 TTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEE 2029

Query: 244  VIREKAERLSLRKTLEETETYHAKLNEDHLL----------------HAPEFIIKPRSHT 287
            ++R+  + L L  T E TE     L E+  +                 AP+   + +S T
Sbjct: 2030 LLRKTKDEL-LHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQT 2088

Query: 288  VWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDT 347
            V +  +      + G P+P   WYKN V I        Y  E    +  L I     ED+
Sbjct: 2089 VGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPED--NVCELVIRDVTAEDS 2146

Query: 348  AQYRASAMNVKGELSAYASVVVKRYK-------------GEFDETRFHAGASTMPLSFGV 394
            A     A+N+ GE S++A ++V+  +              E D        ++ P    V
Sbjct: 2147 ASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPF---V 2203

Query: 395  TPYGYASRFEIHFDDKFDVSFGR-----------------------EGETMSLGCRVVIT 431
                Y    E+H  DK+ +   R                       E E +    ++++ 
Sbjct: 2204 KVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVE 2263

Query: 432  PEIKHFQPEIQ------------------------WYRNGVPL-SPSKWVQTLWSGERAT 466
              +  F  E+Q                        WY N V L S  K+  T   G R  
Sbjct: 2264 GAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRG-RQN 2322

Query: 467  LTFSHLNKEDEGLYT 481
            LT   + KED+G Y+
Sbjct: 2323 LTVKDVTKEDQGEYS 2337



 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 55/227 (24%), Positives = 79/227 (34%), Gaps = 39/227 (17%)

Query: 261  TETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVH 320
            T +  A+L       +P F IKP S  V   E+    C + G    R+TW K+   I   
Sbjct: 6255 TASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPG 6314

Query: 321  ANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETR 380
             N   Y I        L I      D+ QY   A N  G+    A + VK          
Sbjct: 6315 GN---YTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKE--------- 6362

Query: 381  FHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPE 440
                           P  +  + E            ++GE++ L C++  +PEIK     
Sbjct: 6363 ---------------PPKFVKKLEAS-------KVAKQGESIQLECKISGSPEIK----- 6395

Query: 441  IQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMG 487
            + W+RN   L  S      +    A LT +  + ED G Y      G
Sbjct: 6396 VSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNG 6442



 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 59/299 (19%), Positives = 114/299 (38%), Gaps = 36/299 (12%)

Query: 1277  NVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDG--ICTLLITEFSKKDAGIYEVIL 1334
             NVL  C+++  +    I W+K+   IS+           + +L I   S  D+G Y +  
Sbjct: 33150 NVLFTCEISG-EPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKA 33208

Query: 1335  KDDRGKDKSR-----LKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYV 1389
             K+ RG+  +      L LV+E  +E+++          T L+   +++ +Q+ +      
Sbjct: 33209 KNFRGQCSATASLMVLPLVEEPSREVVLRTS-----GDTSLQGSFSSQSVQMSAS----- 33258

Query: 1390  EDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVD 1449
                        S   +S    + +T  +      +   + +  +V        G      
Sbjct: 33259 -------KQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQ 33311

Query: 1450  LSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVS 1509
             L             ++ +A I  +     +  LP  ++I EGK L + C   G+P PEV+
Sbjct: 33312 LESST--------SKMLKAGI--RGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVT 33361

Query: 1510  WLKNEKALASDDHCNLKFE-AGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1567
             W    + + S +      E         I  V   D G Y L + N++GS+++   + +
Sbjct: 33362 WSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 33420



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 42/157 (26%), Positives = 69/157 (43%), Gaps = 20/157 (12%)

Query: 217  SRQS-VVSKQATSALQQEETSEK---KSRKVVIREKAERLSLRKTLEETETYHAKLNEDH 272
            SR S +++ +AT+    + TS     K  K ++ E+++    RK L+  E      +E  
Sbjct: 1769 SRDSGIITCRATNKYGTDHTSATLIVKDEKSLV-EESQLPEGRKGLQRIEELERMAHEGA 1827

Query: 273  LL---------HAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANP 323
            L            P+ ++ P    V E E  +  C + G+P+P+V WY N   I      
Sbjct: 1828 LTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKR- 1886

Query: 324  GKYIIESRY-GMHTLEINGCDFEDTAQYRASAMNVKG 359
                   RY G+H L+I  C   DT + + +A N +G
Sbjct: 1887 ----FRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEG 1919



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 30/94 (31%), Positives = 42/94 (44%), Gaps = 3/94 (3%)

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
            P FI + +   V +  +V+L C + G P   VTW KN   I    +  KY +  R  +  
Sbjct: 4955 PTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIR---SSKKYTLTDRVSVFN 5011

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
            L I  CD  DT +Y+    N  G  S    V +K
Sbjct: 5012 LHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALK 5045



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 93/463 (20%), Positives = 166/463 (35%), Gaps = 72/463 (15%)

Query: 1018  RVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSK 1077
             RV A+  +   K + L G        G  +    V+ D VI    +C+     +   W K
Sbjct: 11999 RVEAMGMSSEAKLTVLEGDPYFT---GKLQDYTGVEKDEVI---LQCEISKADAPVKWFK 12052

Query: 1078  DYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLL 1137
             D    + S    +++ G K  +  K     D+G Y+CD   TD  +    I++ E+K + 
Sbjct: 12053 DGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCD-CGTDKTSGKLDIEDREIKLVR 12111

Query: 1138  ALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMH 1197
              L               +VE++E    RF  + E    +   N+    + + + P     
Sbjct: 12112 PLH--------------SVEVMETETARF--ETEISEDDIHANWKLKGEALLQTP--DCE 12153

Query: 1198  IDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTV-VLVGDVFKKLQKEAEFQRQEW 1256
             I     I  + +   + +  G   FQ  + K++ H  V   V  + + L+          
Sbjct: 12154 IKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVT------- 12206

Query: 1257  IRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICT 1316
                            VT        C+++   ++  + WY   +++   +K         
Sbjct: 12207 ---------------VTAGETATFDCELS--YEDIPVEWYLKGKKLEPSDK--------- 12240

Query: 1317  LLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSAT-DLKIQST 1375
                    + +  ++ + L+D + +D   ++L  + FK       K+  +  T  L+ Q+ 
Sbjct: 12241 ----VVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKPLEDQTV 12296

Query: 1376  AEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVM 1435
              EG           E+ KV W  NG+ I  S + +    G    L I++ TP D   Y  
Sbjct: 12297 EEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTC 12356

Query: 1436  ELFDGKTGHQKTVDLSGQAYDEAYAEFQR-LKQAAIAEKNRAR 1477
             +  D KT     V          + EF R L    + EK  AR
Sbjct: 12357 DAKDFKTSCNLNV-------VPPHVEFLRPLTDLQVREKEMAR 12392



 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 56/244 (22%), Positives = 92/244 (37%), Gaps = 39/244 (15%)

Query: 273  LLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRY 332
            +L     + KP S  V   +   L C++AG PE    W+K+   +    +  KY I    
Sbjct: 7582 VLEPATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKEL---TSDNKYKISFFN 7638

Query: 333  GMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF 392
             +  L+I      D+  Y     N  G+ S  AS+ V                 T+P S 
Sbjct: 7639 KVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQV--------------SDRTVPPS- 7683

Query: 393  GVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSP 452
                          F  K   + G  G ++ + C+V  +P I      + W+  G  +S 
Sbjct: 7684 --------------FTRKLKETNGLSGSSVVMECKVYGSPPI-----SVSWFHEGNEISS 7724

Query: 453  SKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAA 512
             +  QT  +     LT + L + D G YT         ++ SA + VR+  + ++     
Sbjct: 7725 GRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQ--KPD 7782

Query: 513  PLDV 516
            P+DV
Sbjct: 7783 PMDV 7786



 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 109/563 (19%), Positives = 209/563 (37%), Gaps = 91/563 (16%)

Query: 1025 AGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNF-ECDKMTPKSEFSWSKDYVSTE 1083
            A V    + +  +  +  P  ++   +V+    +SL F    + TP  +  W K      
Sbjct: 6816 ANVAGSDECSAVLTVQEPPSFEQTPDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELV 6875

Query: 1084 DSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIAS--SYLIDEEE---LKRLLA 1138
                  +  +   T++   ++   + G YSC VT+  G AS  ++L  +E    +KRL  
Sbjct: 6876 PGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLAD 6935

Query: 1139 LSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHI 1198
             S E   P V       +E    G           +    V++I +E  I +  +  + +
Sbjct: 6936 FSVETGSPIV-------LEATYTG-----------TPPISVSWIKDEYLISQSERCSITM 6977

Query: 1199 DRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIR 1258
               + I+E+    ++D  + +   + + G+    + V ++                    
Sbjct: 6978 TEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVL-------------------- 7017

Query: 1259 KQGPHFVEYLSW--EVTGECNVLLKCKVANIKKETHIVWYKDEREI--SVDEKHDFKDGI 1314
             + P+F+E L     V GE    L+CKV     E  I WYK+  ++  +   K  FK+ +
Sbjct: 7018 -EPPYFIEPLEHVEAVIGE-PATLQCKVDGTP-EIRISWYKEHTKLRSAPAYKMQFKNNV 7074

Query: 1315 CTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEA------FKELMMEVCKKIALS-A 1367
             +L+I +    D G Y     +  G   S   LV +A      F   + +V + +    A
Sbjct: 7075 ASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLPPFFARKLKDVHETLGFPVA 7134

Query: 1368 TDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTP 1427
             + +I  +              E L+V+W  +G  ++    ++T        LQI +   
Sbjct: 7135 FECRINGS--------------EPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQ 7180

Query: 1428 NDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVT 1487
            +  G+Y          +    +  G A   A        +  ++E          P  V 
Sbjct: 7181 SHIGQY----------NCSASNPLGTASSSA--------KLILSEHEVPPFFDLKPVSVD 7222

Query: 1488 IQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGK 1547
            +  G++    C+V G  P +++W K+ + +    +  +      TA  T+  V   D+G+
Sbjct: 7223 LALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTL-VENTATLTVLKVGKGDAGQ 7281

Query: 1548 YGLVVKNKYGSETSDFTVSVFIP 1570
            Y     N  G ++    + V  P
Sbjct: 7282 YTCYASNIAGKDSCSAQLGVQEP 7304



 Score = 49.3 bits (116), Expect = 3e-05
 Identities = 96/436 (22%), Positives = 168/436 (38%), Gaps = 62/436 (14%)

Query: 1004 LKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFE 1063
            L +R +    S    V+AIN AG             +    T+E+   V  +      FE
Sbjct: 2136 LVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFE 2195

Query: 1064 CDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIA 1123
            C+   P  +  W KD +   +  +  + S      ++   +   D   YSC + + + + 
Sbjct: 2196 CETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVK 2255

Query: 1124 SSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILE--KGQVRFWMQAEKLSGNAKVNY 1181
            ++         +L+      +F    VK    +E+ E   G++   +  E + G     +
Sbjct: 2256 TT--------AKLIVEGAVVEF----VKELQDIEVPESYSGELECIVSPENIEG----KW 2299

Query: 1182 IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDV 1241
              N+ E+    KY   I    G   + ++ +  ED+G Y+F + DGK T           
Sbjct: 2300 YHNDVELKSNGKYT--ITSRRGRQNLTVKDVTKEDQGEYSFVI-DGKKTT---------- 2346

Query: 1242 FKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVL-LKCKVANIKKETHIVWYKDER 1300
              KL+          ++ +    ++ LS +   E +++ L+ KV+   +    VW KD +
Sbjct: 2347 -CKLK----------MKPRPIAILQGLSDQKVCEGDIVQLEVKVS--LESVEGVWMKDGQ 2393

Query: 1301 EIS-VDEKHDFKDGIC-TLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMME 1358
            E+   D  H   D     LLI + +K+DAG Y   +         R+ +         ++
Sbjct: 2394 EVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYS-------VD 2446

Query: 1359 VCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDL-KVNWSHNGSAIRYSDRVKTGVTGEQ 1417
            V        T LK  +  EG +        V D+  V W  N   I+  DRV+  V G +
Sbjct: 2447 V-------ITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTK 2499

Query: 1418 IWLQINEPTPNDKGKY 1433
              L IN    +D+G Y
Sbjct: 2500 QRLVINRTHASDEGPY 2515



 Score = 48.9 bits (115), Expect = 4e-05
 Identities = 115/564 (20%), Positives = 203/564 (35%), Gaps = 88/564 (15%)

Query: 994   LNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVD 1053
             L E   + + ++   L++  +Y  R+ +    G  K  +LA   ++  +P   E++    
Sbjct: 12511 LTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFIS--KPQNLEILEGEK 12568

Query: 1054  DDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYS 1113
              + V S++ E   +       W +D  + E   + +V + G K  +  KD  + D+G Y 
Sbjct: 12569 AEFVCSISKESFPV------QWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYV 12622

Query: 1114  CDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKL 1173
               V      A   +I++  +              VP+K      + E+ +V F    E  
Sbjct: 12623 VMVGAARAAAHLTVIEKLRI-------------VVPLKD---TRVKEQQEVVF--NCEVN 12664

Query: 1174  SGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHS 1233
             +  AK  +  NE+ IF+  KY   I +   +  + +     +D+  Y   L + +  N  
Sbjct: 12665 TEGAKAKWFRNEEAIFDSSKYI--ILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVK 12722

Query: 1234  TVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHI 1293
             +   +    + L+     +  E + K+   F     W      NV LK            
Sbjct: 12723 SAANLIVEEEDLRIVEPLKDIETMEKKSVTF-----WCKVNRLNVTLK------------ 12765

Query: 1294  VWYKDEREISVDEKHDFKDGICTLLIT--EFSKKDAGIYEVILKDDRGKDKSRLKLVDEA 1351
              W K+  E+  D +  ++      ++T  +    D G Y V      G+DKS  +L    
Sbjct: 12766 -WTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTA----GQDKSVAEL---- 12816

Query: 1352  FKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKT 1411
                L++E   +      D   Q+  E            E   V W  NG  I+   + K 
Sbjct: 12817 ---LIIEAPTEFVEHLED---QTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKF 12870

Query: 1412  GVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIA 1471
                G    L I +   +D+ +Y   + D K+  +  V       +E   E  R  Q  + 
Sbjct: 12871 EKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFV-------EEIPVEIIRPPQDILE 12923

Query: 1472  EKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGR 1531
                         DVV + E   LN           EV WL+N   +   D   +  E G+
Sbjct: 12924 APG--------ADVVFLAE---LN-------KDKVEVQWLRNNMVVVQGDKHQMMSE-GK 12964

Query: 1532  TAYFTINGVSTADSGKYGLVVKNK 1555
                  I  +   D G+Y  + K+K
Sbjct: 12965 IHRLQICDIKPRDQGEYRFIAKDK 12988



 Score = 48.9 bits (115), Expect = 4e-05
 Identities = 44/200 (22%), Positives = 83/200 (41%), Gaps = 11/200 (5%)

Query: 1388  YVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKT 1447
             Y +  +V W      +  S++ +         L + + T  D G Y  ++ +        
Sbjct: 31594 YDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSY 31653

Query: 1448  VDLSGQAYDEAYAEFQRLKQAAIAEK-NRARVLGGLPDVV------TIQEGKALNLTCNV 1500
              +L  +   E Y  + R     I  + +  R+L   P+        T   G+ +     +
Sbjct: 31654 AELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTI 31713

Query: 1501  WGDPPPEVSWLKN-EKALASDDHCNLKFEAGRTAY-FTINGVSTADSGKYGLVVKNKYGS 1558
                P P V+W K+ +K    D+     FE+ +  Y  TIN V+T D  +Y +V +NKYG 
Sbjct: 31714 TVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGE 31773

Query: 1559  ET--SDFTVSVFIPEEEARM 1576
             ++  +  TV++  P  ++ +
Sbjct: 31774 DSCKAKLTVTLHPPPTDSTL 31793



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 49/207 (23%), Positives = 79/207 (38%), Gaps = 35/207 (16%)

Query: 276 APEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMH 335
           AP F    +S  V E         I+G+P P V+W+++   I+    PG  I  S  G  
Sbjct: 5   APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD-GRA 63

Query: 336 TLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVT 395
            L I      ++ +Y   A N  G+ ++ A ++VK              A T P      
Sbjct: 64  KLTIPAVTKANSGRYSLKATNGSGQATSTAELLVK--------------AETAP------ 103

Query: 396 PYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKW 455
                     +F  +      R+G  + L  RV   P      P +++YR+G  +  S  
Sbjct: 104 ---------PNFVQRLQSMTVRQGSQVRLQVRVTGIP-----TPVVKFYRDGAEIQSSLD 149

Query: 456 VQTLWSGERATLTFSHLNKEDEGLYTI 482
            Q    G+  +L  +    ED G Y++
Sbjct: 150 FQISQEGDLYSLLIAEAYPEDSGTYSV 176



 Score = 48.1 bits (113), Expect = 7e-05
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query: 1479  LGGLPDVVTI-QEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTI 1537
             L GLPD+  + +E     L   + G P P VSW K E  LA+D   +++  A  T    +
Sbjct: 19984 LKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTT-LIV 20042

Query: 1538  NGVSTADSGKYGLVVKNKYGSETSDFTVSV 1567
                  +D+GKY + +KN  G++    ++ V
Sbjct: 20043 YDCQKSDAGKYTITLKNVAGTKEGTISIKV 20072



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 4/95 (4%)

Query: 277  PEFIIK-PRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMH 335
            P F+ K   S+ +   E+ +LHC + G P  +VTW+KN   ++       Y + S     
Sbjct: 3737 PSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSE---A 3793

Query: 336  TLEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
             L+I     ED+  Y   A+N  G  S    +V+K
Sbjct: 3794 ILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIK 3828



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 112/499 (22%), Positives = 178/499 (35%), Gaps = 92/499 (18%)

Query: 1062  FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1121
             FEC+       F W K         R E+   G K  M  K    +D   Y  +  D   
Sbjct: 11859 FECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKH- 11917

Query: 1122  IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNY 1181
              +   +I+   LK L            P+K    V   EK    F    E    N +V +
Sbjct: 11918 TSGKLIIEGIRLKFL-----------TPLKD---VTAKEKESAVF--TVELSHDNIRVKW 11961

Query: 1182  IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDV 1241
               N++ +       M  +  T  I    + L  +D      +   G ++     VL GD 
Sbjct: 11962 FKNDQRLHTTRSVSMQDEGKTHSIT--FKDLSIDDTSQIRVEAM-GMSSEAKLTVLEGDP 12018

Query: 1242  F--KKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDE 1299
             +   KLQ     ++ E                      V+L+C+++  K +  + W+KD 
Sbjct: 12019 YFTGKLQDYTGVEKDE----------------------VILQCEIS--KADAPVKWFKDG 12054

Query: 1300  REISVDEKHDFK-DGICTLLITEFS-KKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMM 1357
             +EI   +    K DG   +LI + + K D G Y      D G DK+  KL D   +E+  
Sbjct: 12055 KEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC----DCGTDKTSGKL-DIEDREI-- 12107

Query: 1358  EVCKKIALSATDLKIQSTAEGIQLYSFVTYYVE-DLKVNWSHNGSAIRYSDRVKTGVTGE 1416
                 K+      +++  T    +   F T   E D+  NW   G A+             
Sbjct: 12108 ----KLVRPLHSVEVMET----ETARFETEISEDDIHANWKLKGEAL------------- 12146

Query: 1417  QIWLQINEPTPNDKGK-YVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNR 1475
                LQ  +    ++GK + + L + +      VD   QA +   +   R+K   I     
Sbjct: 12147 ---LQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDF--QAANVKSSAHLRVKPRVIG---- 12197

Query: 1476  ARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYF 1535
               +L  L D VT+  G+     C +  +  P V W    K L   D    + E G+    
Sbjct: 12198 --LLRPLKD-VTVTAGETATFDCELSYEDIP-VEWYLKGKKLEPSDKVVPRSE-GKVHTL 12252

Query: 1536  TINGVSTADSGKYGLVVKN 1554
             T+  V   D+G+  L  K+
Sbjct: 12253 TLRDVKLEDAGEVQLTAKD 12271



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 2/95 (2%)

Query: 1486  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADS 1545
             V  + G+ + +     G PPP V+W K+EK L SD   +++     ++  TI  V+  D+
Sbjct: 27281 VIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIE-NTDSSSLLTIPQVTRNDT 27339

Query: 1546  GKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALE 1580
             GKY L ++N  G E    TVSV + +  A    L+
Sbjct: 27340 GKYILTIENGVG-EPKSSTVSVKVLDTPAACQKLQ 27373



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 7/122 (5%)

Query: 1448  VDLSGQA-YDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPP 1506
             V++ G + Y E+ AE + +++  I +   A     L   VTI+ G +L L  +V G PPP
Sbjct: 29420 VNVKGMSEYSESIAEIEPVERIEIPDLELA---DDLKKTVTIRAGASLRLMVSVSGRPPP 29476

Query: 1507  EVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVS 1566
              ++W K    LAS    +        +   ++ V+  D+GKY +  +N+ G +++   V 
Sbjct: 29477 VITWSKQGIDLASRAIID---TTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVK 29533

Query: 1567  VF 1568
             V+
Sbjct: 29534 VY 29535



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 152/790 (19%), Positives = 286/790 (36%), Gaps = 153/790 (19%)

Query: 901  KISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLV 960
            KIS  K    Y+  +A   +A L     +S     ++ T +V  P  ++K SE R     
Sbjct: 820  KISVPKTEHGYEASIAGSAIATL--QKELSATSSAQKITKSVKAP--TVKPSETR----- 870

Query: 961  LQWKPPVHSGRTPVTGY-FVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRV 1019
                  V +  TP+  + F D  +    E       E  +      VR  +  V +    
Sbjct: 871  ------VRAEPTPLPQFPFADTPDTYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREA 924

Query: 1020 RAINQAGVGKPSDLAGPVVAETR-PGTKEVVVNVDDDGVISLNFECD-KMTPKSEFSWSK 1077
            +    A V  P ++  PV   T   G K V V   +    S+  EC     P    +W +
Sbjct: 925  KVTETARVPAPVEI--PVTPPTLVSGLKNVTVIEGE----SVTLECHISGYPSPTVTWYR 978

Query: 1078 DYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS--YL---IDEE- 1131
            +    E S   ++  +    ++  ++   +D G ++C   +  G  S+  YL   + EE 
Sbjct: 979  EDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEF 1038

Query: 1132 -------------ELKRLL----------ALSHEHKFPTVP-----VKSELAVEILEKGQ 1163
                         E KR +          +L+ E   P  P     +   +  +++E G 
Sbjct: 1039 EKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGS 1098

Query: 1164 VRFWMQAEKLSGNAKVNYIFNEKEI--FEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYT 1221
            V F  Q   + GN K +  + +  +    G +YK+  ++ TG  ++ +     +D G YT
Sbjct: 1099 VVFGCQ---VGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYT 1155

Query: 1222 FQLQDGKATNHSTVVLVGD----VFKKLQKEAEFQRQEWIRKQGPHFVE------YLSWE 1271
              +++      ++  L+ +    +  K Q+E  +Q Q     Q P   E      Y  +E
Sbjct: 1156 IVVRNKHGETSASASLLEEADYELLMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYE 1215

Query: 1272 VTGECN-VLLKCKVANIKKETHIV-WYKDEREISVDEKHDFKDGICTLLITEFSKKDAGI 1329
               E    L++ K+A   K+T +V  Y +++E  +     F++ +   +     K     
Sbjct: 1216 KEYEKEQALIRKKMA---KDTVVVRTYVEDQEFHISS---FEERLIKEIEYRIIKTTL-- 1267

Query: 1330 YEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQS----TAEGIQLYSFV 1385
             E +L++D G++K  + + +    E           S  D +I++       G+  +  +
Sbjct: 1268 -EELLEED-GEEKMAVDISESEAVE-----------SGFDSRIKNYRILEGMGVTFHCKM 1314

Query: 1386 TYYVEDLKVNWSHNGSAIRYSDRVKTGVTGE-QIWLQINEPTPNDKGKYVM--------E 1436
            + Y    K+ W  +G  I++ +R +     + +  L+I    P D+G Y           
Sbjct: 1315 SGYPLP-KIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNA 1373

Query: 1437 LFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNR--------------------- 1475
            +  GK   +    L    Y        R++  +    +R                     
Sbjct: 1374 ICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMS 1433

Query: 1476 -ARVLGGL---------------------PDVVTIQEGKALNLTCNVWGDPPPEVSWLKN 1513
             AR+  G                      P      EG+       V G P PE  W  +
Sbjct: 1434 PARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHD 1493

Query: 1514 EKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEE 1573
             + + +D    +  +   T    I   + +DSG++ +V +N+ G  +    ++V   E +
Sbjct: 1494 GQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQ 1553

Query: 1574 ARMAALESLK 1583
             +   +E LK
Sbjct: 1554 VKPMFVEKLK 1563



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 30/95 (31%), Positives = 44/95 (46%), Gaps = 4/95 (4%)

Query: 277  PEFIIKPR-SHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMH 335
            P FI K   S  V + E  +  C I G PE +V WYK++  I   +      ++S   + 
Sbjct: 7305 PRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDS---VA 7361

Query: 336  TLEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
             LE++    ED+  Y   A N  G  S+  S+ VK
Sbjct: 7362 VLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVK 7396



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 41/205 (20%), Positives = 77/205 (37%), Gaps = 33/205 (16%)

Query: 1262  PHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFK---DGICTLL 1318
             P   ++L  E + E   L     +++ +   + WYKD +++  +    F    DG   L 
Sbjct: 32718 PKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELK 32777

Query: 1319  ITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTA-- 1376
             I   ++ D G Y   +  + G  K+ L+ + +AFK +  +V K      +D K   +   
Sbjct: 32778 INNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVT 32837

Query: 1377  --------EGIQLYSFVTYYVEDLKVN--------------------WSHNGSAIRYSDR 1408
                     E I     +   ++D  V+                    W+ +G AI    +
Sbjct: 32838 RKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGK 32897

Query: 1409  VKTGVTGEQIWLQINEPTPNDKGKY 1433
              K        +L+I++   +D G Y
Sbjct: 32898 YKLSEDKGGFFLEIHKTDTSDSGLY 32922



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 64/306 (20%), Positives = 122/306 (39%), Gaps = 34/306 (11%)

Query: 184   STASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKV 243
             S++ K T  + + T +++ +  K S  + Q  A  Q  +S++A  + + + +  K   K+
Sbjct: 32934 SSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKL 32993

Query: 244   VIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGW 303
              ++E+A ++ +    EE +   A   E  ++H  E I K    T    E V+ H  I   
Sbjct: 32994 ALKEEASKVLIS---EEVKKSAATSLEKSIVH--EEITK----TSQASEEVRTHAEIKA- 33043

Query: 304   PEPRVTWYKNQVPINVHANPGKYIIESRYGMHT---LEINGCDFEDTAQYRASAMNVKGE 360
                    +  Q+ IN      + ++++     T     +NG +  ++ +YR         
Sbjct: 33044 -------FSTQMSIN---EGQRLVLKANIAGATDVKWVLNGVELTNSEEYRYG------- 33086

Query: 361   LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGE 420
             +S     +  +     DE      + T     G+    Y         D          +
Sbjct: 33087 VSGSDQTLTIKQASHRDEGILTCISKTKE---GIVKCQYDLTLSKELSDAPAFISQPRSQ 33143

Query: 421   TMSLGCRVVITPEIK-HFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGL 479
              ++ G  V+ T EI     PEI+W++N +P+S S  V    S    +L   + +  D G 
Sbjct: 33144 NINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGK 33203

Query: 480   YTIRVR 485
             YTI+ +
Sbjct: 33204 YTIKAK 33209



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 46/190 (24%), Positives = 78/190 (41%), Gaps = 28/190 (14%)

Query: 1396 WSHNGSAI--RYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQ 1453
            W H+G  I   Y+ +V     G Q  L I   TP+D G++ +   +       +V L+ +
Sbjct: 1490 WFHDGQQIVNDYTHKVVIKEDGTQS-LIIVPATPSDSGEWTVVAQNRAGRSSISVILTVE 1548

Query: 1454 AYDEAYAEF--QRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWL 1511
            A +        ++LK                   V I+EG  L +     G+P P++ WL
Sbjct: 1549 AVEHQVKPMFVEKLKN------------------VNIKEGSRLEMKVRATGNPNPDIVWL 1590

Query: 1512 KNEKALASDDHCNLKFEAGR-TAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFI- 1569
            KN   +    +  ++ E  +  A   I+   + DS  Y     NK G +T+   V+V + 
Sbjct: 1591 KNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVE 1650

Query: 1570 ---PEEEARM 1576
               PE E ++
Sbjct: 1651 FAEPEPERKL 1660



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 28/95 (29%), Positives = 49/95 (51%), Gaps = 4/95 (4%)

Query: 277  PEFIIKPRSHTVWEK-ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMH 335
            P+F+ K  +  V ++ E+++L C I+G PE +V+W++N   ++      KY +     + 
Sbjct: 6364 PKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELH---ESWKYNMSFINSVA 6420

Query: 336  TLEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
             L IN    ED+  Y   A N  G+ S   ++ VK
Sbjct: 6421 LLTINEASAEDSGDYICEAHNGVGDASCSTALTVK 6455



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 60/252 (23%), Positives = 86/252 (34%), Gaps = 40/252 (15%)

Query: 266  AKLNEDHLLHAPEFIIKPRSHTVWEKE--NVKLHCSIAGWPEPRVTWYKNQVPINVHANP 323
            A+LN    L  P F  K  S TV E E  + KL   +AG     V WYKN + I   +N 
Sbjct: 8238 AQLNIKERLIPPSFT-KRLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSN- 8295

Query: 324  GKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHA 383
                I  +     L++      D   Y     N  G     +S+V+K  K          
Sbjct: 8296 --CEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPK---------- 8343

Query: 384  GASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQW 443
                 P+                FD         EGE + L C V  +  I+     IQW
Sbjct: 8344 ---KPPV----------------FDQHLTPVTVSEGEYVQLSCHVQGSEPIR-----IQW 8379

Query: 444  YRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDAD 503
             + G  + PS      ++   A L    + K D G Y  +       +   + V ++D  
Sbjct: 8380 LKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKP 8439

Query: 504  AEIEGAPAAPLD 515
            A       A +D
Sbjct: 8440 AVAPATKKAAVD 8451



 Score = 45.4 bits (106), Expect = 4e-04
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 8/97 (8%)

Query: 277  PEFIIK-PRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPG--KYIIESRYG 333
            P+F+ K   S  V   ++ +L C IAG PE RV W++N+     H  P   KY +     
Sbjct: 5423 PKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNE-----HELPASDKYRMTFIDS 5477

Query: 334  MHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
            +  +++N    ED+  +   A N  G  S    V+VK
Sbjct: 5478 VAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVK 5514



 Score = 45.4 bits (106), Expect = 4e-04
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 5/65 (7%)

Query: 419  GETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEG 478
            G+++SL C+V  TPEI      + WY+    L P+   +T ++   ATL F+ +N  D G
Sbjct: 6093 GDSVSLQCQVAGTPEIT-----VSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSG 6147

Query: 479  LYTIR 483
             YT +
Sbjct: 6148 EYTCK 6152



 Score = 44.7 bits (104), Expect = 7e-04
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 5/91 (5%)

Query: 1486 VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASD--DHCNLKFEAGRTAYFTINGVSTA 1543
            V + EG       ++ G P PEVSW ++ + +++       + F  GR A  TI  V+ A
Sbjct: 15   VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR-AKLTIPAVTKA 73

Query: 1544 DSGKYGLVVKNKYGSETSDFTVSVFIPEEEA 1574
            +SG+Y L   N  G  TS  T  + +  E A
Sbjct: 74   NSGRYSLKATNGSGQATS--TAELLVKAETA 102



 Score = 44.7 bits (104), Expect = 7e-04
 Identities = 72/366 (19%), Positives = 128/366 (34%), Gaps = 61/366 (16%)

Query: 136  YMVPIFSGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITTSKQSTASKQTTASKQ 195
            + V  F G ++ V G  D      ++  A +   N+  S+ G  T   S  + Q + + +
Sbjct: 5922 FKVNWFRGARELVKG--DRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTR 5979

Query: 196  STASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKVVIREKAERLSLR 255
                K+  A  +  +       +  ++    T  L    T +K    +   EK   ++  
Sbjct: 5980 LFV-KEPAAFLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTE 6038

Query: 256  KTL---------EETETYHAKLNED----------HLLHAPEFIIKPRSHTVWEKENVKL 296
            KT           +   Y  ++  +            L  P F+ +         ++V L
Sbjct: 6039 KTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSL 6098

Query: 297  HCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMN 356
             C +AG PE  V+WYK    +        Y   +   + TL  N  +  D+ +Y   A N
Sbjct: 6099 QCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNN---VATLVFNKVNINDSGEYTCKAEN 6155

Query: 357  VKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFG 416
              G  S+              +T F      +P SF       A + +       D+   
Sbjct: 6156 SIGTASS--------------KTVFRIQERQLPPSF-------ARQLK-------DIE-- 6185

Query: 417  REGETMSLGCRVVITPEIKHFQP-EIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKE 475
                  ++G  V +T  +    P ++ WYR+GV L   + +QT +    ATL     +  
Sbjct: 6186 -----QTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLS 6240

Query: 476  DEGLYT 481
              G Y+
Sbjct: 6241 HSGQYS 6246



 Score = 44.7 bits (104), Expect = 7e-04
 Identities = 51/263 (19%), Positives = 95/263 (36%), Gaps = 51/263 (19%)

Query: 278  EFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYI-IESRYGMHT 336
            +F+ +   +++ + + + L  +  G P   VTW KN     ++  P +   I +      
Sbjct: 7869 KFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKN----GINVTPSQRCNITTTEKSAI 7924

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTP 396
            LEI     ED  QY     N  G+ S  A +++                          P
Sbjct: 7925 LEIPSSTVEDAGQYNCYIENASGKDSCSAQILILE-----------------------PP 7961

Query: 397  YGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWV 456
            Y         F  + +      G++ SL C++  TPEI      + WY+    L P+   
Sbjct: 7962 Y---------FVKQLEPVKVSVGDSASLQCQLAGTPEIG-----VSWYKGDTKLRPTTTY 8007

Query: 457  QTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDAD---------AEIE 507
            +  +    ATL F+ ++  D G Y  +          S ++ V++            +++
Sbjct: 8008 KMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQ 8067

Query: 508  GAPAAPLDVKCLEANKDYIIISW 530
                 P+   C  +  + I +SW
Sbjct: 8068 ETVGLPVVFDCAISGSEPISVSW 8090



 Score = 44.7 bits (104), Expect = 7e-04
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
             DV+T++ G+ + +   V G P P+++W K  K L  +   +L  +  R     I     A
Sbjct: 17916 DVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVE-LQIKEAVRA 17974

Query: 1544  DSGKYGLVVKNKYGSETSDFTVSV 1567
             D GKY +  KN  G       V+V
Sbjct: 17975 DHGKYIISAKNSSGHAQGSAIVNV 17998



 Score = 44.7 bits (104), Expect = 7e-04
 Identities = 29/86 (33%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 1482  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1541
             L  VV ++    L L   + G P PEV W K E  L   D   ++  +  T    I+ V+
Sbjct: 25113 LRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT--DRAQIEVTSSFTM-LVIDNVT 25169

Query: 1542  TADSGKYGLVVKNKYGSETSDFTVSV 1567
               DSG+Y L ++N  GS+T+   V V
Sbjct: 25170 RFDSGRYNLTLENNSGSKTAFVNVRV 25195



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 56/255 (21%), Positives = 97/255 (38%), Gaps = 41/255 (16%)

Query: 238  KKSRKVVIREKAERLSLRKTLEETE---TYHAKLNEDHLL------HAPEFIIKPRSHTV 288
            ++  K V+  +  R+ + +T +      T+ A  N   +         P+ + + +  TV
Sbjct: 3191 QERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTV 3250

Query: 289  WEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTA 348
               +  +    I+G P+P+++WYK +  ++      K++ + +   +TL +     ED A
Sbjct: 3251 QSGKPARFCAVISGRPQPKISWYKEEQLLST-GFKCKFLHDGQ--EYTLLLIEAFPEDAA 3307

Query: 349  QYRASAMNVKG--ELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIH 406
             Y   A N  G    SA  SV V        E   +  A   PL   VT  G  +RF+  
Sbjct: 3308 VYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQ-- 3365

Query: 407  FDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERAT 466
                               CRV  T        ++ WY     + PS++ +     +   
Sbjct: 3366 -------------------CRVSGT------DLKVSWYSKDKKIKPSRFFRMTQFEDTYQ 3400

Query: 467  LTFSHLNKEDEGLYT 481
            L  +    EDEG YT
Sbjct: 3401 LEIAEAYPEDEGTYT 3415



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 110/529 (20%), Positives = 206/529 (38%), Gaps = 75/529 (14%)

Query: 1068 TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1127
            TP+ +  W KD      S +  +  K N  ++ F    + D G Y+ ++++  G +SS  
Sbjct: 4043 TPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVG-SSSCE 4101

Query: 1128 IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNA--KVNYIFNE 1185
                 L R +A      F T P+++   V+ +  G  R      K++G+   +V++  + 
Sbjct: 4102 TTFTVLDRDIA-----PFFTKPLRN---VDSVVNGTCRLDC---KIAGSLPMRVSWFKDG 4150

Query: 1186 KEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKL 1245
            KEI    +Y++     T  +E+   ++   D G +T +  +   +  S+  L+      +
Sbjct: 4151 KEIAASDRYRIAFVEGTASLEII--RVDMNDAGNFTCRATNSVGSKDSSGALI------V 4202

Query: 1246 QKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDERE-ISV 1304
            Q+   F     + K G       S +V     V LK         T I W+K  +E +S 
Sbjct: 4203 QEPPSF-----VTKPG-------SKDVLPGSAVCLKSTFQGSTPLT-IRWFKGNKELVSG 4249

Query: 1305 DEKHDFKDGICTLLITEFSK-KDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKI 1363
               +  K+ + + L     K  D+G Y   + +  G  +    L    F +      +K+
Sbjct: 4250 GSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANL----FVKEPATFVEKL 4305

Query: 1364 ALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQIN 1423
              S    ++    +  QL   VT     +K+ W  N   I+ S + +         L++ 
Sbjct: 4306 EPS----QLLKKGDATQLACKVTG-TPPIKITWFANDREIKESSKHRMSFVESTAVLRLT 4360

Query: 1424 EPTPNDKGKYVMELF-DGKTGHQKTVDLSGQA--YDEAYAEFQRLKQAAIAEKNRARVLG 1480
            +    D G+Y+ E   +  + H  ++ +  ++  + + +   + LK+             
Sbjct: 4361 DVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKPIEVLKEY------------ 4408

Query: 1481 GLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGV 1540
               DV+ + E         V G PP E++W K+   L S       F         I   
Sbjct: 4409 ---DVMLLAE---------VAGTPPFEITWFKDNTILRSGRKYK-TFIQDHLVSLQILKF 4455

Query: 1541 STADSGKYGLVVKNKYGSETSDFTVSVFIPEE-EARMAALESLKGGKKA 1588
              AD+G+Y   V N+ GS      V++  P     ++ +  SL+GG  A
Sbjct: 4456 VAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGGTAA 4504



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 51/214 (23%), Positives = 80/214 (37%), Gaps = 51/214 (23%)

Query: 278  EFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTL 337
            + + K +S  V EK+ + L C +AG PE +V W K+          GK I+ SRY   + 
Sbjct: 5142 QIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKD----------GKQIVPSRYFSMSF 5191

Query: 338  EINGCDF-------EDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPL 390
            E N   F       +D+ QY     N  G  S  A + V                    L
Sbjct: 5192 ENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRV--------------------L 5231

Query: 391  SFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPL 450
               + P          F  K        G ++ + C+V  +  I       QW+++G  +
Sbjct: 5232 DQNIPP---------SFTKKLTKMDKVLGSSIHMECKVSGSLPIS-----AQWFKDGKEI 5277

Query: 451  SPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRV 484
            S S   + +      +L  ++L  ED   YT +V
Sbjct: 5278 STSAKYRLVCHERSVSLEVNNLELEDTANYTCKV 5311



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 53/230 (23%), Positives = 86/230 (37%), Gaps = 47/230 (20%)

Query: 294  VKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRAS 353
            V   C I G    +V+WYK+ V +   AN     +   + + TL+I   D     QY  S
Sbjct: 7133 VAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFV---HNVATLQILQTDQSHIGQYNCS 7189

Query: 354  AMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDV 413
            A N  G  S+ A +++  ++              +P  F + P               D+
Sbjct: 7190 ASNPLGTASSSAKLILSEHE--------------VPPFFDLKPV------------SVDL 7223

Query: 414  SFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLN 473
            + G  G   +  C V  T  IK     I W ++   + P    +       ATLT   + 
Sbjct: 7224 ALGESG---TFKCHVTGTAPIK-----ITWAKDNREIRPGGNYKMTLVENTATLTVLKVG 7275

Query: 474  KEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANK 523
            K D G YT           Y++ +  +D+ +   G    P  +K LE ++
Sbjct: 7276 KGDAGQYTC----------YASNIAGKDSCSAQLGVQEPPRFIKKLEPSR 7315



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 83/367 (22%), Positives = 145/367 (39%), Gaps = 60/367 (16%)

Query: 1085  SPRLEVESKGNKTKMTFKDLGMDDLG--IYSCDVTDTDGIASSYLIDEEELKRLLALSHE 1142
             SP  E++++G K  +T   + +D  G  +Y      T  I +   + E EL         
Sbjct: 11439 SPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILT---VKEIELDF------- 11488

Query: 1143  HKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNT 1202
                  VP+K    V + E+ Q RF      L+  A V +      I    K+ +  D   
Sbjct: 11489 ----AVPLKD---VTVPERRQARFECV---LTREANVIWSKGPDIIKSSDKFDIIADGKK 11538

Query: 1203  GIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGP 1262
              I+   +   Q +DEG YT +++ GK T  S  + V  +  K     E Q  +       
Sbjct: 11539 HIL--VINDSQFDDEGVYTAEVE-GKKT--SARLFVTGIRLKFMSPLEDQTVK------- 11586

Query: 1263  HFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEF 1322
                        GE    + C++++ K   H+VW+K++ ++             T+LI+  
Sbjct: 11587 ----------EGETATFV-CELSHEKM--HVVWFKNDAKLHTSR---------TVLISSE 11624

Query: 1323  SKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLY 1382
              K      + +  DD  + K+++K +    +  ++E      +   D K     + I L 
Sbjct: 11625 GKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHD-KTAVEKDEITLK 11683

Query: 1383  SFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKT 1442
               V+   +D+ V W  +G  I  S +      G +  L+I +    DKG+YV +    KT
Sbjct: 11684 CEVS---KDVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKT 11740

Query: 1443  GHQKTVD 1449
                 TV+
Sbjct: 11741 KANVTVE 11747



 Score = 43.5 bits (101), Expect = 0.002
 Identities = 99/525 (18%), Positives = 179/525 (34%), Gaps = 73/525 (13%)

Query: 1068 TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1127
            +P    SW  +        + +     N   +T   L   D G Y+C  T+  G      
Sbjct: 7708 SPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAG------ 7761

Query: 1128 IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1187
               +E    L +     F    V+    +++L    V F     K +    V++     E
Sbjct: 7762 --SDECSAPLTVREPPSF----VQKPDPMDVLTGTNVTF-TSIVKGTPPFSVSWFKGSSE 7814

Query: 1188 IFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKA--TNHSTVVLVGDVFKKL 1245
            +  G +  + ++ +   +E+F        E T     + GKA  T H  +       K+L
Sbjct: 7815 LVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRL 7874

Query: 1246 QKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVD 1305
               +       I K  P  +E  ++  T   +V  K    N+              I+  
Sbjct: 7875 NDYS-------IEKGKPLILEG-TFTGTPPISVTWKKNGINVTPSQRC-------NITTT 7919

Query: 1306 EKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDK--SRLKLVDEAFKELMMEVCKKI 1363
            EK         L I   + +DAG Y   +++  GKD   +++ +++  +    +E  K  
Sbjct: 7920 EKS------AILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVS 7973

Query: 1364 ALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQIN 1423
               +  L+ Q                 ++ V+W    + +R +   K         L  N
Sbjct: 7974 VGDSASLQCQLAG------------TPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFN 8021

Query: 1424 EPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLP 1483
            +   ND G+Y+ +            ++S   +     + Q+L  +   +    +   GLP
Sbjct: 8022 QVDINDSGEYICK------AENSVGEVSASTF--LTVQEQKLPPSFSRQLRDVQETVGLP 8073

Query: 1484 DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
             V            C + G  P  VSW K+ K L    +    F    TA   I     +
Sbjct: 8074 VV----------FDCAISGSEPISVSWYKDGKPLKDSPNVQTSF-LDNTATLNIFKTDRS 8122

Query: 1544 DSGKYGLVVKNKYGSETSD----FTVSVFIPEEEARMAALESLKG 1584
             +G+Y     N  GS +S      T     P  + R+A ++++ G
Sbjct: 8123 LAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVG 8167



 Score = 43.5 bits (101), Expect = 0.002
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 1482  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEA-GRTAYFTINGV 1540
             L  V+T++ G  + L   V G P PEV+W K++ A        +K +    ++ F++   
Sbjct: 18207 LSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKA 18266

Query: 1541  STADSGKYGLVVKNKYGSETSDFTVSV 1567
               +D GKY +   N  GS  +  TV+V
Sbjct: 18267 KRSDGGKYVVTATNTAGSFVAYATVNV 18293



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 30/116 (25%), Positives = 51/116 (43%), Gaps = 5/116 (4%)

Query: 1456  DEAYAEFQRLKQAAIAEKNR----ARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWL 1511
             D  Y+E +    + I ++ +    A + G    ++T + G    +   + G P P+V+W 
Sbjct: 28623 DAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWK 28682

Query: 1512  KNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1567
               E  L   D  ++     RT   T+      DSG+Y L ++N  G +T   TV V
Sbjct: 28683 LEEMRLKETDRVSITTTKDRTT-LTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVV 28737



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 62/262 (23%), Positives = 104/262 (39%), Gaps = 55/262 (20%)

Query: 225  QATSALQQEETSEKKSRKVVIREKAERLSLRKTLEETETY-HAKLNEDHLLHAPEFIIKP 283
            QA   L+Q +  E    ++   E++ER    K  EE  ++   +L++      P  +IK 
Sbjct: 8608 QAFELLKQSQEEETHRLEIEEIERSERDE--KEFEELVSFIQQRLSQTE----PVTLIKD 8661

Query: 284  -RSHTVWEKENVKLHCSIA-GWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEING 341
              + TV +  +      I   +PE +++WYK    +       K+ I      HTL +  
Sbjct: 8662 IENQTVLKDNDAVFEIDIKINYPEIKLSWYKGTEKLEPS---DKFEISIDGDRHTLRVKN 8718

Query: 342  CDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYAS 401
            C  +D   YR     V G   A A + V                        + P     
Sbjct: 8719 CQLKDQGNYRL----VCGPHIASAKLTV------------------------IEP----- 8745

Query: 402  RFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWS 461
             +E H  D   V+  +EG+T ++ C+  + P +K      +W+RNG  L P    +T   
Sbjct: 8746 AWERHLQD---VTL-KEGQTCTMTCQFSV-PNVKS-----EWFRNGRILKPQGRHKTEVE 8795

Query: 462  GERATLTFSHLNKEDEGLYTIR 483
             +   LT + +  ED+G YT +
Sbjct: 8796 HKVHKLTIADVRAEDQGQYTCK 8817



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 22/84 (26%), Positives = 35/84 (41%), Gaps = 1/84 (1%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
             D + +  G+   L  +V G P P + WL+ +K +     C +K      A   +      
Sbjct: 23633 DTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIK-NTDFKALLIVKDAIRI 23691

Query: 1544  DSGKYGLVVKNKYGSETSDFTVSV 1567
             D G+Y L   N  GS++    V V
Sbjct: 23692 DGGQYILRASNVAGSKSFPVNVKV 23715



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 1/94 (1%)

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
            P F+ K ++  + E   +++     G P P + W KN   I  H  P K  IE   G   
Sbjct: 1556 PMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYP-KIRIEGTKGEAA 1614

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
            L+I+    +D+A Y A+A+N  G  +    V V+
Sbjct: 1615 LKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVE 1648



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 29/95 (30%), Positives = 42/95 (44%), Gaps = 4/95 (4%)

Query: 277  PEFIIKPRSHTVWEK-ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMH 335
            P+FI KP    V    ++    C I G P+ RV+WY +   I      G   I+   G+ 
Sbjct: 4861 PQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFID---GLA 4917

Query: 336  TLEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
            T +I+G   E++  Y   A N  G  S    + VK
Sbjct: 4918 TFQISGARVENSGTYVCEARNDAGTASCSIELKVK 4952



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 72/365 (19%), Positives = 133/365 (36%), Gaps = 62/365 (16%)

Query: 124   LSGEEKENLPSDYMVPIFSGRQKHVSGITDTEEERIKE----AAAYIAQRNLLASEEGIT 179
             L G++ E  PSD +VP   G+  H   + D + E   E    A  +    NL   E  + 
Sbjct: 12230 LKGKKLE--PSDKVVPRSEGKV-HTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVE 12286

Query: 180   TSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKK 239
              +K           +  T  + +TA  +   SR++   +      +   + + E  ++ +
Sbjct: 12287 FTKPL---------EDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGR 12337

Query: 240   SRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCS 299
              RK+VI +      ++    + + +    N + +    EF+       V EKE  +  C 
Sbjct: 12338 VRKLVIHDCTPE-DIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFECE 12396

Query: 300   IAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKG 359
             ++     +V W+K+   I       KY I S+  +  L IN C  +D A+Y       + 
Sbjct: 12397 LSR-ENAKVKWFKDGAEIK---KGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTAR- 12451

Query: 360   ELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREG 419
               S   +V+        +E  F    + + +S                          E 
Sbjct: 12452 -TSGMLTVLE-------EEAVFTKNLANIEVS--------------------------ET 12477

Query: 420   ETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGL 479
             +T+ L C      E+     E+ WY+    +  +   + L  G +  L   + + ED G 
Sbjct: 12478 DTIKLVC------EVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGN 12531

Query: 480   YTIRV 484
             Y  R+
Sbjct: 12532 YNCRL 12536



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 26/84 (30%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
             D++ I EG+ L++       P P VSW K+ K + + D   +K +   +A+  +     A
Sbjct: 14395 DIIVI-EGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKND-HISAHLEVPKSVRA 14452

Query: 1544  DSGKYGLVVKNKYGSETSDFTVSV 1567
             D+G Y + ++NK GS T+   V V
Sbjct: 14453 DAGIYTITLENKLGSATASINVKV 14476



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 50/209 (23%), Positives = 82/209 (39%), Gaps = 25/209 (11%)

Query: 286   HTVWEKE-NVKLHCSIAGWPEP-RVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCD 343
             H V E+  +VK  C I  + +  +VTWY     +    N  KY I    G+  L +    
Sbjct: 31576 HAVGEEGGHVKYVCKIENYDQSTQVTWYFG---VRQLENSEKYEITYEDGVAILYVKDIT 31632

Query: 344   FEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASR- 402
               D   YR   +N  GE S+YA + VK  +  +D   ++   +   +           R 
Sbjct: 31633 KLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYD---YYCRRTMKKIKRRTDTMRLLERP 31689

Query: 403   --FEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSP----SKWV 456
               F +   +K        GE +  G  + + PE     P + WY++G  + P     K+ 
Sbjct: 31690 PEFTLPLYNK----TAYVGENVRFGVTITVHPE-----PHVTWYKSGQKIKPGDNDKKYT 31740

Query: 457   QTLWSGERATLTFSHLNKEDEGLYTIRVR 485
                  G    LT + +  +D+  YT+  R
Sbjct: 31741 FESDKG-LYQLTINSVTTDDDAEYTVVAR 31768



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
             D + +  G++  +  +++G P P + W+K ++ L++     +K     T+  ++      
Sbjct: 22551 DTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATS-LSVKDAVRV 22609

Query: 1544  DSGKYGLVVKNKYGSETSDFTVSV 1567
             DSG Y L  KN  G  +    V V
Sbjct: 22610 DSGNYILKAKNVAGERSVTVNVKV 22633



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 29/96 (30%), Positives = 42/96 (43%), Gaps = 5/96 (5%)

Query: 290   EKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQ 349
             E ++V     ++G P P + W K+  P+++   P   II      + L I     EDT  
Sbjct: 31808 EGQSVCFEIRVSGIPPPTLKWEKDGQPLSL--GPNIEIIHEGLDYYALHIRDTLPEDTGY 31865

Query: 350   YRASAMNVKGELSAYASVVVKRY---KGEFDETRFH 382
             YR +A N  G  S  A + V+R    K EF     H
Sbjct: 31866 YRVTATNTAGSTSCQAHLQVERLRYKKQEFKSKEEH 31901



 Score = 41.2 bits (95), Expect = 0.008
 Identities = 55/214 (25%), Positives = 82/214 (38%), Gaps = 51/214 (23%)

Query: 278  EFIIKPRSHTVWEKENVK--------LHCSIAGWPEPRVTWYKNQVPINVHANPGK-YII 328
            E II  + H + E E V+        L C +    +  VTW K+   +     PGK Y I
Sbjct: 3637 ELIIIDKPHFIKELEPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLP----PGKDYKI 3692

Query: 329  ESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTM 388
                 + TLEI     +D+  Y  +A N  G  S  A+V V+                  
Sbjct: 3693 CFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVRE----------------- 3735

Query: 389  PLSFGVTPYGYASRFEIHFDDKFDVSFGR-EGETMSLGCRVVITPEIKHFQPEIQWYRNG 447
            P SF                 K D S+    GE+  L C++  +P I     ++ W++N 
Sbjct: 3736 PPSFV---------------KKVDPSYLMLPGESARLHCKLKGSPVI-----QVTWFKNN 3775

Query: 448  VPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYT 481
              LS S  V+  +    A L  + +  ED G Y+
Sbjct: 3776 KELSESNTVRMYFVNSEAILDITDVKVEDSGSYS 3809



 Score = 41.2 bits (95), Expect = 0.008
 Identities = 30/121 (24%), Positives = 54/121 (44%), Gaps = 14/121 (11%)

Query: 419  GETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEG 478
            GET +L C+V  TPE+      ++WY++G  L+ S+  +  +  + ++L    + ++D G
Sbjct: 5718 GETCTLECKVAGTPELS-----VEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAG 5772

Query: 479  LYTIRVRMGEYYEQYSAYVFVRDADA---------EIEGAPAAPLDVKCLEANKDYIIIS 529
             YT +V+        +A V V D               G   A   ++C  A    I ++
Sbjct: 5773 TYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVA 5832

Query: 530  W 530
            W
Sbjct: 5833 W 5833



 Score = 41.2 bits (95), Expect = 0.008
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 1/81 (1%)

Query: 1487  TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSG 1546
             +IQ G+ L +   V G P P +SW+K+ + L      N++  A  T      G +  D G
Sbjct: 24322 SIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEG-NKDDFG 24380

Query: 1547  KYGLVVKNKYGSETSDFTVSV 1567
             KY +   N  G+ T + +V V
Sbjct: 24381 KYTVTATNSAGTATENLSVIV 24401



 Score = 40.8 bits (94), Expect = 0.011
 Identities = 104/521 (19%), Positives = 194/521 (37%), Gaps = 76/521 (14%)

Query: 1059 SLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTD 1118
            ++ FE         + W K+ V  + + + ++ +K     +  +++   D    + D T 
Sbjct: 2985 TITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGD----AADYTF 3040

Query: 1119 TDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAK 1178
              G A+S      E + +    H        +K    +++LEK +  F  + E    +  
Sbjct: 3041 VAGKATSTATLYVEARHIEFRKH--------IKD---IKVLEKKRAMF--ECEVSEPDIT 3087

Query: 1179 VNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLV 1238
            V ++ +++E+    + K  I +   +  + +   +  D G YT  +  G  +     V  
Sbjct: 3088 VQWMKDDQELQITDRIK--IQKEKYVHRLLIPSTRMSDAGKYTV-VAGGNVSTAKLFVEG 3144

Query: 1239 GDV-FKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYK 1297
             DV  + ++KE +      I KQ                  +++ +V     + H  WYK
Sbjct: 3145 RDVRIRSIKKEVQV-----IEKQ----------------RAVVEFEVNEDDVDAH--WYK 3181

Query: 1298 DEREIS--VDEKHDF--KDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFK 1353
            D  EI+  V E+H +  +  I  + I+E  + DAG Y  +     G+++S + L   A +
Sbjct: 3182 DGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA----GRNRSSVTLYVNAPE 3237

Query: 1354 --ELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKT 1411
              +++ E+      S    +  +   G              K++W      +    + K 
Sbjct: 3238 PPQVLQELQPVTVQSGKPARFCAVISGRP----------QPKISWYKEEQLLSTGFKCKF 3287

Query: 1412 GVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIA 1471
               G++  L + E  P D   Y  E  +       +  LS +   E  +  Q +     A
Sbjct: 3288 LHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEV-PEVVSPDQEMPVYPPA 3346

Query: 1472 EKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNL-KFEAG 1530
                  ++  L D VT  EG+     C V G    +VSW   +K +       + +FE  
Sbjct: 3347 ------IITPLQDTVT-SEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFED- 3397

Query: 1531 RTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPE 1571
             T    I      D G Y  V  N  G  +S   +S+  PE
Sbjct: 3398 -TYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPE 3437



 Score = 40.8 bits (94), Expect = 0.011
 Identities = 49/257 (19%), Positives = 89/257 (34%), Gaps = 50/257 (19%)

Query: 233  EETSEKKSRKVVIREKAERLSLRKT-LEETETYHAKLNEDH----------LLHAPEFII 281
            +E S     ++V  E++  L +    LE+T  Y  K++             +   P F++
Sbjct: 5275 KEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLV 5334

Query: 282  KPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEING 341
            KP          V+    + G P  ++ W+K+ V +    +  K  I        L +  
Sbjct: 5335 KPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVEL---VSGPKCFIGLEGSTSFLNLYS 5391

Query: 342  CDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYAS 401
             D   T QY     N  G  S    ++V                          P  +  
Sbjct: 5392 VDASKTGQYTCHVTNDVGSDSCTTMLLV------------------------TEPPKFVK 5427

Query: 402  RFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWS 461
            + E            + G++  L C++  +PEI+     + W+RN   L  S   +  + 
Sbjct: 5428 KLEAS-------KIVKAGDSSRLECKIAGSPEIR-----VVWFRNEHELPASDKYRMTFI 5475

Query: 462  GERATLTFSHLNKEDEG 478
               A +  ++L+ ED G
Sbjct: 5476 DSVAVIQMNNLSTEDSG 5492



 Score = 40.8 bits (94), Expect = 0.011
 Identities = 40/166 (24%), Positives = 64/166 (38%), Gaps = 21/166 (12%)

Query: 1396  WSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAY 1455
             W  +GS IR S + +    G+   L I +   +D G+Y   L  G      T  L     
Sbjct: 11151 WMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKL----- 11205

Query: 1456  DEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEK 1515
                           + E+   R +  L + VT+ +G+ L L+C +  +   +V W K+ K
Sbjct: 11206 --------------VVEELPVRFVKTLEEEVTVVKGQPLYLSCEL--NKERDVVWRKDGK 11249

Query: 1516  ALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETS 1561
              +       +    G     TIN     D+G Y + V+N    E S
Sbjct: 11250 IVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECS 11295



 Score = 40.8 bits (94), Expect = 0.011
 Identities = 61/309 (19%), Positives = 119/309 (38%), Gaps = 50/309 (16%)

Query: 1047  EVVVNVDDDGVISLN---FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKD 1103
             E V +++D  V   +   F C     K+   W ++    ++  + + E  G+  ++  KD
Sbjct: 12824 EFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKD 12883

Query: 1104  LGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVK-SELAVEILEKG 1162
               +DD   Y+C V D    A  ++ +                  +PV+      +ILE  
Sbjct: 12884 CRLDDECEYACGVEDRKSRARLFVEE------------------IPVEIIRPPQDILEAP 12925

Query: 1163  QVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTF 1222
                    AE      +V ++ N   + +G K++M  +    I  + +  ++  D+G Y F
Sbjct: 12926 GADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGK--IHRLQICDIKPRDQGEYRF 12983

Query: 1223  QLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKC 1282
               +D +A     +     +     K A+   Q+ +   G      + ++           
Sbjct: 12984 IAKDKEARAKLELAAAPKI-----KTAD---QDLVVDVGKPLTMVVPYD----------- 13024

Query: 1283  KVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDK 1342
               A  K E    W+K+   +S  +  D      +  I E  K D G Y+++L++  GK +
Sbjct: 13025 --AYPKAEAE--WFKENEPLST-KTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAE 13079

Query: 1343  S--RLKLVD 1349
                 LK++D
Sbjct: 13080 GFINLKVID 13088



 Score = 40.4 bits (93), Expect = 0.014
 Identities = 52/250 (20%), Positives = 85/250 (34%), Gaps = 51/250 (20%)

Query: 252  LSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWY 311
            +S   TL  TE Y            P F+ +P+S T +  +  K  C++ G P     W 
Sbjct: 3537 VSCTATLTVTEAY-----------PPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQ 3585

Query: 312  KNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKR 371
            K+   ++   N   + I      H LE++    +D   Y   A N  G     A +++  
Sbjct: 3586 KDGAALSPSPN---WRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELII-- 3640

Query: 372  YKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVIT 431
                 D+  F            + P   A   ++H + + D              +V +T
Sbjct: 3641 ----IDKPHFIK---------ELEPVQSAINKKVHLECQVDED-----------RKVTVT 3676

Query: 432  PEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYE 491
                       W ++G  L P K  +  +  + ATL       +D G Y           
Sbjct: 3677 -----------WSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSS 3725

Query: 492  QYSAYVFVRD 501
              SA V VR+
Sbjct: 3726 SCSATVTVRE 3735



 Score = 40.4 bits (93), Expect = 0.014
 Identities = 51/252 (20%), Positives = 86/252 (34%), Gaps = 46/252 (18%)

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
            P F+ KP S  V     V L  +  G     + W+K    +    + G   I       +
Sbjct: 4206 PSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKEL---VSGGSCYITKEALESS 4262

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTP 396
            LE+      D+  Y     NV G +   A++ VK                         P
Sbjct: 4263 LELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKE------------------------P 4298

Query: 397  YGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWV 456
              +  + E            ++G+   L C+V  TP IK     I W+ N   +  S   
Sbjct: 4299 ATFVEKLE-------PSQLLKKGDATQLACKVTGTPPIK-----ITWFANDREIKESSKH 4346

Query: 457  QTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDV 516
            +  +    A L  + +  ED G Y    +     +  S+ V V++       +P    + 
Sbjct: 4347 RMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKE-------SPYFTKEF 4399

Query: 517  KCLEANKDYIII 528
            K +E  K+Y ++
Sbjct: 4400 KPIEVLKEYDVM 4411



 Score = 40.4 bits (93), Expect = 0.014
 Identities = 29/85 (34%), Positives = 37/85 (43%), Gaps = 3/85 (3%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVST- 1542
             D V ++ G+A  L  +V G PPP + W K+ K L       +K     T    +N  ST 
Sbjct: 21469 DTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTN--LVNKDSTR 21526

Query: 1543  ADSGKYGLVVKNKYGSETSDFTVSV 1567
              DSG Y L   N  G     F V V
Sbjct: 21527 RDSGAYTLTATNPGGFAKHIFNVKV 21551



 Score = 40.4 bits (93), Expect = 0.014
 Identities = 36/155 (23%), Positives = 63/155 (40%), Gaps = 16/155 (10%)

Query: 1414  TGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEK 1473
             +G+  W + N+    DK   +  L +         +   + + E      R ++ A++ K
Sbjct: 30472 SGDSAWKKSNKERIKDKQFTIGGLLEA-------TEYEFRVFAENETGLSRPRRTAMSIK 30524

Query: 1474  NRARVLGGLPDV------VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKF 1527
              +    G  P +      VT + G+A  L+C + G P P++ W +  K L       +  
Sbjct: 30525 TKL-TSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSS 30583

Query: 1528  EAGRTAYFTINGVSTADSGKYGLVVKNKYGS-ETS 1561
             + GRT   T+      D G Y  +  N+ G  ETS
Sbjct: 30584 D-GRTHTLTVMTEEQEDEGVYTCIATNEVGEVETS 30617



 Score = 40.0 bits (92), Expect = 0.018
 Identities = 112/546 (20%), Positives = 188/546 (34%), Gaps = 108/546 (19%)

Query: 1014 SYVFRVRAINQAGVGKPSDLAGPVVAETRP-----GTKEVVVNVDDDGVISLNFECDKMT 1068
            +Y F + A+  +  G+ S  +  V+   +      GTK V+             EC    
Sbjct: 2424 NYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVL-------------ECKVSV 2470

Query: 1069 PK-SEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1127
            P  +   W  +    +   R++   KG K ++        D G Y   V     + ++  
Sbjct: 2471 PDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIV---GRVETNCN 2527

Query: 1128 IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1187
            +  E++K +  L       T  V  E  VE+   G    W               F +KE
Sbjct: 2528 LSVEKIKIIRGLRDLTCTETQNVVFE--VELSHSGIDVLWN--------------FKDKE 2571

Query: 1188 IFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQK 1247
            I    KYK  I+ +  I ++ +  +  +DEG YTF   +   +   TV   G + K L  
Sbjct: 2572 IKPSSKYK--IEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVA-GGAISKPLTD 2628

Query: 1248 EAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEK 1307
            +   + QE                       + +C+VAN   ++   W +D + + +   
Sbjct: 2629 QTVAESQE----------------------AVFECEVAN--PDSKGEWLRDGKHLPLTNN 2664

Query: 1308 -HDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALS 1366
                 DG    LI   +K D  I E   K    K  ++LK+  EA          KI  +
Sbjct: 2665 IRSESDGHKRRLIIAATKLD-DIGEYTYKVATSKTSAKLKV--EAV---------KIKKT 2712

Query: 1367 ATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPT 1426
              +L +  T + +         V+   V W  NG  +  +++    V G    L+I    
Sbjct: 2713 LKNLTVTETQDAVFTVELTHPNVKG--VQWIKNGVVLESNEKYAISVKGTIYSLRIKNCA 2770

Query: 1427 PNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVV 1486
              D+  Y   L  G+ G    +                ++   I +K         P  V
Sbjct: 2771 IVDESVYGFRL--GRLGASARL---------------HVETVKIIKK---------PKDV 2804

Query: 1487 TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSG 1546
            T  E   +    +V  D  P V W      +   D   L  E  +     +  +S +D+G
Sbjct: 2805 TALENATVAFEVSVSHDTVP-VKWFHKSVEIKPSDKHRLVSER-KVHKLMLQNISPSDAG 2862

Query: 1547 KYGLVV 1552
            +Y  VV
Sbjct: 2863 EYTAVV 2868



 Score = 40.0 bits (92), Expect = 0.018
 Identities = 26/94 (27%), Positives = 42/94 (44%), Gaps = 3/94 (3%)

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
            P F  KP      +  +V L C + G P   V+WYK++  +    +  KY I S   + +
Sbjct: 7399 PIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELR---SGKKYKIMSENFLTS 7455

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
            + I   D  D  +Y+  A N  G  +   S+ +K
Sbjct: 7456 IHILNVDAADIGEYQCKATNDVGSDTCVGSIALK 7489



 Score = 40.0 bits (92), Expect = 0.018
 Identities = 41/193 (21%), Positives = 67/193 (34%), Gaps = 36/193 (18%)

Query: 292  ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYR 351
            E+    C + G    +V+W K+   I    + GKY I        L +   D  D+ QY 
Sbjct: 8168 ESADFECHVTGTQPIKVSWAKDSREIR---SGGKYQISYLENSAHLTVLKVDKGDSGQYT 8224

Query: 352  ASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKF 411
              A+N  G+ S  A + +K                       + P  +  R     ++  
Sbjct: 8225 CYAVNEVGKDSCTAQLNIKE---------------------RLIPPSFTKRLSETVEE-- 8261

Query: 412  DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSH 471
                  EG +  L  RV  +  I      + WY+N + + P+   +  +      L    
Sbjct: 8262 -----TEGNSFKLEGRVAGSQPI-----TVAWYKNNIEIQPTSNCEITFKNNTLVLQVRK 8311

Query: 472  LNKEDEGLYTIRV 484
                D GLYT +V
Sbjct: 8312 AGMNDAGLYTCKV 8324



 Score = 40.0 bits (92), Expect = 0.018
 Identities = 29/86 (33%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 1482  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1541
             L  VVTI+    L L   + G P PEV W ++     S D  +++  +  T    +  V+
Sbjct: 21866 LRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGE--SLDKASIESTSSYTLLI-VGNVN 21922

Query: 1542  TADSGKYGLVVKNKYGSETSDFTVSV 1567
               DSGKY L V+N  GS+++   V V
Sbjct: 21923 RFDSGKYILTVENSSGSKSAFVNVRV 21948



 Score = 40.0 bits (92), Expect = 0.018
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 1482  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1541
             L  ++ I+ G +L L   + G P PEV W K +  +   D   +   +  T+   ++ V+
Sbjct: 22948 LRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIR--DAAIIDVTSSFTS-LVLDNVN 23004

Query: 1542  TADSGKYGLVVKNKYGSETSDFTVSV 1567
               DSGKY L ++N  G++++  TV V
Sbjct: 23005 RYDSGKYTLTLENSSGTKSAFVTVRV 23030



 Score = 40.0 bits (92), Expect = 0.018
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 7/82 (8%)

Query: 1488  IQEGKALNLTCNVWGDPPPEVSWLKNEK--ALASDDHCNLKFEAGRTAYFTINGVSTADS 1545
             ++ G ++ L     G P P   W K +   +L +D H    F        T+   +  D+
Sbjct: 28369 VRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTTDSFST-----LTVENCNRNDA 28423

Query: 1546  GKYGLVVKNKYGSETSDFTVSV 1567
             GKY L V+N  GS++  FTV V
Sbjct: 28424 GKYTLTVENNSGSKSITFTVKV 28445



 Score = 39.7 bits (91), Expect = 0.023
 Identities = 34/135 (25%), Positives = 52/135 (38%), Gaps = 9/135 (6%)

Query: 245   IREKAERLSL-----RKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENV-KLHC 298
             I EK  ++S      +KT E T T   +      + +   I+     T    ++V K   
Sbjct: 32814 IHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAV 32873

Query: 299   SIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVK 358
                G P P   W K+   I      GKY +    G   LEI+  D  D+  Y  +  N  
Sbjct: 32874 KATGEPRPTAIWTKDGKAIT---QGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSA 32930

Query: 359   GELSAYASVVVKRYK 373
             G +S+   + +K  K
Sbjct: 32931 GSVSSSCKLTIKAIK 32945



 Score = 39.3 bits (90), Expect = 0.031
 Identities = 36/157 (22%), Positives = 63/157 (40%), Gaps = 10/157 (6%)

Query: 1415  GEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKN 1474
             G   W+   EP    K + V  L +GK    +   L+ Q   +     + ++     E  
Sbjct: 13630 GSDKWVACGEPVAETKME-VTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAP 13688

Query: 1475  R----ARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAG 1530
                   ++L GL    T++ G  + L   V G P P+++W K +  L  D    ++    
Sbjct: 13689 EIFLDVKLLAGL----TVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIE-NVP 13743

Query: 1531  RTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1567
             + +  TI     +D+G Y +   N  G  T+   V+V
Sbjct: 13744 KKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 13780



 Score = 39.3 bits (90), Expect = 0.031
 Identities = 46/191 (24%), Positives = 78/191 (40%), Gaps = 11/191 (5%)

Query: 180   TSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKK 239
             TS Q + S Q   S Q +ASKQ  +    ++S  S+ +     S  A S    +E+  + 
Sbjct: 33242 TSLQGSFSSQ---SVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEM 33298

Query: 240   SRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCS 299
             S    +      +S    LE + +   K     +   P+    P   ++ E + + + C+
Sbjct: 33299 SSSSFMG-----ISNMTQLESSTSKMLKAGIRGI--PPKIEALPSDISIDEGKVLTVACA 33351

Query: 300   IAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKG 359
               G P P VTW      I+     G++ IE+   + TL I     +D   Y  S  N  G
Sbjct: 33352 FTGEPTPEVTWSCGGRKIH-SQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFG 33410

Query: 360   ELSAYASVVVK 370
               SA  ++ ++
Sbjct: 33411 SDSATVNIHIR 33421



 Score = 38.9 bits (89), Expect = 0.040
 Identities = 54/228 (23%), Positives = 97/228 (42%), Gaps = 27/228 (11%)

Query: 144  RQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITTSKQSTASKQT-----TASKQSTA 198
            R KH  G T      ++EA   +    L+ S++ +    Q TA  Q      TA     +
Sbjct: 1159 RNKH--GETSASASLLEEADYEL----LMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYS 1212

Query: 199  SKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKVVIREKAERLSLRKTL 258
              +    K+    R+  A    VV     + ++ +E       + +I+E   R+ ++ TL
Sbjct: 1213 EYEKEYEKEQALIRKKMAKDTVVVR----TYVEDQEFHISSFEERLIKEIEYRI-IKTTL 1267

Query: 259  EET------ETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYK 312
            EE       E     ++E   + +  F  + +++ + E   V  HC ++G+P P++ WYK
Sbjct: 1268 EELLEEDGEEKMAVDISESEAVESG-FDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYK 1326

Query: 313  NQVPINVHANPGKYIIE-SRYGMHTLEINGCDFEDTAQYRASAMNVKG 359
            +   I    +  +Y ++  + G  +L I     ED   Y A A N+KG
Sbjct: 1327 DGKRIK---HGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKG 1371



 Score = 38.9 bits (89), Expect = 0.040
 Identities = 63/315 (20%), Positives = 110/315 (34%), Gaps = 43/315 (13%)

Query: 171  LLASEEGITTSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSA- 229
            +L  +EGI T+  S        S +      +     +        SR   +S ++ S  
Sbjct: 1354 VLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRS 1413

Query: 230  -LQQEETSEKKSRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTV 288
             ++        +R    R    R+S  + LEET+      ++   L+ P F++KP S   
Sbjct: 1414 PIRMSPARMSPARMSPARMSPARMSPGRRLEETDE-----SQLERLYKPVFVLKPVSFKC 1468

Query: 289  WEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTA 348
             E +  +    + G P P   W+ +   I V+    K +I+   G  +L I      D+ 
Sbjct: 1469 LEGQTARFDLKVVGRPMPETFWFHDGQQI-VNDYTHKVVIKED-GTQSLIIVPATPSDSG 1526

Query: 349  QYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFD 408
            ++   A N  G  S    + V+  + +                  V P          F 
Sbjct: 1527 EWTVVAQNRAGRSSISVILTVEAVEHQ------------------VKPM---------FV 1559

Query: 409  DKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGER--AT 466
            +K      +EG  + +  R    P      P+I W +N   + P K+ +    G +  A 
Sbjct: 1560 EKLKNVNIKEGSRLEMKVRATGNP-----NPDIVWLKNSDIIVPHKYPKIRIEGTKGEAA 1614

Query: 467  LTFSHLNKEDEGLYT 481
            L       +D   YT
Sbjct: 1615 LKIDSTVSQDSAWYT 1629



 Score = 38.9 bits (89), Expect = 0.040
 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 3/94 (3%)

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
            P F  KP      +  +V L C I+G P   V W K++  +    N  K+ I S++   +
Sbjct: 6458 PVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVR---NSKKFKITSKHFDTS 6514

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
            L I   +  D  +Y   A N  G  +   SV  K
Sbjct: 6515 LHILNLEASDVGEYHCKATNEVGSDTCSCSVKFK 6548



 Score = 38.5 bits (88), Expect = 0.052
 Identities = 51/214 (23%), Positives = 73/214 (34%), Gaps = 41/214 (19%)

Query: 272  HLL-HAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIES 330
            HLL   P F+ K         + V L  ++ G     VTW K Q  I      GK  +  
Sbjct: 3918 HLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIR---EDGKIKMSF 3974

Query: 331  RYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPL 390
              G+  L I         +Y   A N  G  ++   ++VK                    
Sbjct: 3975 SNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKE------------------- 4015

Query: 391  SFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPL 450
                 P     R E+       V+    G+  +L   V  TPE+K      +WY++G PL
Sbjct: 4016 -----PAKIIERAEL-----IQVT---AGDPATLEYTVAGTPELKP-----KWYKDGRPL 4057

Query: 451  SPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRV 484
              SK  +  +    A L F      D G YT  +
Sbjct: 4058 VASKKYRISFKNNVAQLKFYSAELHDSGQYTFEI 4091



 Score = 38.5 bits (88), Expect = 0.052
 Identities = 43/205 (20%), Positives = 75/205 (36%), Gaps = 39/205 (19%)

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
            P F +KP S  +   E+    C + G    ++TW K+   I    N    ++E+   +  
Sbjct: 7212 PFFDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTV 7271

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTP 396
            L++      D  QY   A N+ G+ S  A + V+                         P
Sbjct: 7272 LKVGK---GDAGQYTCYASNIAGKDSCSAQLGVQE------------------------P 7304

Query: 397  YGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWV 456
              +  + E            ++ E     C++  +PEIK     + WY++   +  S   
Sbjct: 7305 PRFIKKLE-------PSRIVKQDEFTRYECKIGGSPEIK-----VLWYKDETEIQESSKF 7352

Query: 457  QTLWSGERATLTFSHLNKEDEGLYT 481
            +  +    A L   +L+ ED G YT
Sbjct: 7353 RMSFVDSVAVLEMHNLSVEDSGDYT 7377



 Score = 38.5 bits (88), Expect = 0.052
 Identities = 76/371 (20%), Positives = 137/371 (36%), Gaps = 83/371 (22%)

Query: 231   QQEETSEKKSRKVVIREKAERLSLRK--TLEETETYHAKLNEDH------LLHAPEFIIK 282
             + ++T E   +  VI +  +R+ + K  TL++  TY   +          ++     ++ 
Sbjct: 12586 RDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIVVP 12645

Query: 283   PRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGC 342
              +   V E++ V  +C +      +  W++N+  I    +  KYII  +  ++TL I   
Sbjct: 12646 LKDTRVKEQQEVVFNCEV-NTEGAKAKWFRNEEAI---FDSSKYIILQKDLVYTLRIRDA 12701

Query: 343   DFEDTAQYRASAMNVKGE-LSAYASVVVKR------------YKGEFDETRFHAGASTMP 389
               +D A Y  S  N +GE + + A+++V+                E     F    + + 
Sbjct: 12702 HLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLN 12761

Query: 390   LSFGVTPYGYASRFEIHFD-------DKF-------DVSFGREGETM-------SLGCRV 428
             ++   T  G     E+ FD       DK+       D  F  EGE +       S+   +
Sbjct: 12762 VTLKWTKNGE----EVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELL 12817

Query: 429   VI---TPEIKHFQPE--------------------IQWYRNGVPLSPSKWVQTLWSGERA 465
             +I   T  ++H + +                    ++WYRNG  +   K  +    G   
Sbjct: 12818 IIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIH 12877

Query: 466   TLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLD------VKCL 519
              L       +DE  Y      G    +  A +FV +   EI   P   L+      V   
Sbjct: 12878 RLIIKDCRLDDECEYA----CGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLA 12933

Query: 520   EANKDYIIISW 530
             E NKD + + W
Sbjct: 12934 ELNKDKVEVQW 12944



 Score = 38.5 bits (88), Expect = 0.052
 Identities = 27/105 (25%), Positives = 47/105 (44%), Gaps = 5/105 (4%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKAL--ASDDHCNLKFEAGRTAYFTINGVS 1541
             D + ++ G+ +++  +V G P P++ W KNE  +   +D     K E  R+   T   + 
Sbjct: 15406 DTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIP 15465

Query: 1542  TA---DSGKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALESLK 1583
              A   D G Y +   N+ GS   +  V V+      R  A+  +K
Sbjct: 15466 KAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIK 15510



 Score = 38.1 bits (87), Expect = 0.068
 Identities = 27/122 (22%), Positives = 55/122 (45%), Gaps = 7/122 (5%)

Query: 1436 ELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALN 1495
            +L +G+ G Q+  +L   A++ A       ++    EK +  ++   P+ V + EG+   
Sbjct: 1805 QLPEGRKGLQRIEELERMAHEGALTGVTTDQK----EKQKPDIVL-YPEPVRVLEGETAR 1859

Query: 1496 LTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNK 1555
              C V G P P+V+W  N + +       ++++     Y  I    + D+G+  +  +N 
Sbjct: 1860 FRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG--IHYLDIVDCKSYDTGEVKVTAENP 1917

Query: 1556 YG 1557
             G
Sbjct: 1918 EG 1919



 Score = 38.1 bits (87), Expect = 0.068
 Identities = 36/174 (20%), Positives = 69/174 (39%), Gaps = 20/174 (11%)

Query: 1062  FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1121
             F C+    K    W K+      S  + + S+G   K+  K++ +DD+      V +   
Sbjct: 11593 FVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSS 11652

Query: 1122  IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNY 1181
              A   +++ +             + TV +  + AV   EK ++    +  K   +  V +
Sbjct: 11653 TAQLKVLEAD------------PYFTVKLHDKTAV---EKDEITLKCEVSK---DVPVKW 11694

Query: 1182  IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTV 1235
               + +EI   PKY +  D    I++  ++K   +D+G Y       K   + TV
Sbjct: 11695 FKDGEEIVPSPKYSIKADGLRRILK--IKKADLKDKGEYVCDCGTDKTKANVTV 11746



 Score = 37.7 bits (86), Expect = 0.089
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 3/78 (3%)

Query: 293  NVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRA 352
            ++ + C ++G       W+K+   I+  A   KY +       +LE+N  + EDTA Y  
Sbjct: 5253 SIHMECKVSGSLPISAQWFKDGKEISTSA---KYRLVCHERSVSLEVNNLELEDTANYTC 5309

Query: 353  SAMNVKGELSAYASVVVK 370
               NV G+ +    + VK
Sbjct: 5310 KVSNVAGDDACSGILTVK 5327



 Score = 37.7 bits (86), Expect = 0.089
 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 1/83 (1%)

Query: 1485  VVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTAD 1544
             +V  + G  + +   V G P P V+W K ++ L      N +  A  T    IN    +D
Sbjct: 21074 LVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATST-ILNINECVRSD 21132

Query: 1545  SGKYGLVVKNKYGSETSDFTVSV 1567
             SG Y L  +N  G      T+ V
Sbjct: 21133 SGPYPLTARNIVGEVGDVITIQV 21155



 Score = 37.7 bits (86), Expect = 0.089
 Identities = 18/77 (23%), Positives = 36/77 (46%)

Query: 1491  GKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGL 1550
             G+ +++     G P P ++W K +  + ++ H  +      T+    NGV   D+G Y +
Sbjct: 31042 GEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVV 31101

Query: 1551  VVKNKYGSETSDFTVSV 1567
               KN++G +     + V
Sbjct: 31102 CAKNRFGIDQKTVELDV 31118



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 25/94 (26%), Positives = 39/94 (41%), Gaps = 3/94 (3%)

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
            P F   P      +   V L C ++G P   V WYK++  +    +  KY I S+    +
Sbjct: 5517 PVFSSFPPIVETLKNAEVSLECELSGTPPFEVVWYKDKRQLR---SSKKYKIASKNFHTS 5573

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
            + I   D  D  +Y   A N  G  +   +V +K
Sbjct: 5574 IHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLK 5607



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 21/84 (25%), Positives = 33/84 (39%), Gaps = 3/84 (3%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
             D + +  G  + +   V G PPP V+W  NE+ L  +           ++   I     +
Sbjct: 16532 DRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIE---TTAISSSMVIKNCQRS 16588

Query: 1544  DSGKYGLVVKNKYGSETSDFTVSV 1567
               G Y L+ KN+ G       V V
Sbjct: 16589 HQGVYSLLAKNEAGERKKTIIVDV 16612



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 1482  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1541
             +  ++T++ G  + L   V+G P P VSW K+   L   +   +  +        +  V+
Sbjct: 19301 MKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQR-NLCTLELFSVN 19359

Query: 1542  TADSGKYGLVVKNKYGSETSDFTVSV 1567
               DSG Y +  +N  GS+++   + V
Sbjct: 19360 RKDSGDYTITAENSSGSKSATIKLKV 19385



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 20/79 (25%), Positives = 35/79 (44%), Gaps = 1/79 (1%)

Query: 1487  TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSG 1546
             ++Q G+ L +   + G P P ++W K+   L      N+      T   +I      D G
Sbjct: 23240 SVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTT-LSIKETHKDDGG 23298

Query: 1547  KYGLVVKNKYGSETSDFTV 1565
             +YG+ V N  G +T+   +
Sbjct: 23299 QYGITVANVVGQKTASIEI 23317



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 3/84 (3%)

Query: 1486  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADS 1545
             + +  G+ + L   + G PPP  SW      L   +   ++    + A  TI   +  D+
Sbjct: 29748 IHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHT-KVAKLTIRETTIRDT 29806

Query: 1546  GKYGLVVKNKYGSETSDFTVSVFI 1569
             G+Y L +KN  G  T+  T+ V I
Sbjct: 29807 GEYTLELKNVTG--TTSETIKVII 29828



 Score = 37.0 bits (84), Expect = 0.15
 Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 8/93 (8%)

Query: 1482  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLK-------NEKALASDDHCNLKFEAGRTAY 1534
             L + + ++EG  +N+   + G P P ++W K       N++ +  D H N K     T  
Sbjct: 16122 LKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVN-KLVVDDTCT 16180

Query: 1535  FTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1567
               I     +D+G Y +   N  G+ + +  ++V
Sbjct: 16181 LVIPQSRRSDTGLYTITAVNNLGTASKEMRLNV 16213



 Score = 37.0 bits (84), Expect = 0.15
 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 19/86 (22%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKN-----EKA----LASDDHCNLKFEAGRTAY 1534
             DV+ ++ G+ L +  ++ G P P +SW K+     E+A    +++D+H  L         
Sbjct: 25797 DVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLL--------- 25847

Query: 1535  FTINGVSTADSGKYGLVVKNKYGSET 1560
              T+      D+G+Y L +KN  G+ +
Sbjct: 25848 -TVKDCIRRDTGQYVLTLKNVAGTRS 25872



 Score = 36.6 bits (83), Expect = 0.20
 Identities = 99/530 (18%), Positives = 188/530 (35%), Gaps = 110/530 (20%)

Query: 1046  KEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLG 1105
             K++++   +    S  FEC      +  +W KD  +  +SP+    + G   K+   D+ 
Sbjct: 11122 KDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQ 11181

Query: 1106  MDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVP-VKSELAVEILEKGQV 1164
             + D G Y+C                     +L L ++ K  T   V  EL V  ++  + 
Sbjct: 11182 LSDAGEYTC---------------------VLRLGNKEKTSTAKLVVEELPVRFVKTLEE 11220

Query: 1165  RFW-MQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGII--------EMFMEKLQDE 1215
                 ++ + L  + ++N    E+++      K+ +++   I+         + +    D 
Sbjct: 11221 EVTVVKGQPLYLSCELN---KERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDT 11277

Query: 1216  DEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGE 1275
             D GTYT  +++      S+ V V +V +           +W+ K            V  +
Sbjct: 11278 DAGTYTVTVENANNLECSSCVKVVEVIR-----------DWLVK------PIRDQHVKPK 11320

Query: 1276  CNVLLKCKVANIKKETHIVWYKDEREISV---DEKHDFKDG-ICTLLITEFSKKDAGIYE 1331
                +  C +A  K   +I W+K   EI     D+    +DG    L I     +D   Y 
Sbjct: 11321 GTAIFACDIA--KDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYA 11378

Query: 1332  VILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLY-----SFVT 1386
             V ++  R                       K+ L   ++++    E + +Y     SF  
Sbjct: 11379 VEIEGKR--------------------YPAKLTLGEREVELLKPIEDVTIYEKESASFDA 11418

Query: 1387  YYVE-DLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQ 1445
                E D+   W   G  +R S   +    G + +L +++   +  G+ + +  +  T   
Sbjct: 11419 EISEADIPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAIT--- 11475

Query: 1446  KTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPP 1505
              T  L+ +  +  +A    LK   + E+ +AR      + V  +E               
Sbjct: 11476 -TAILTVKEIELDFA--VPLKDVTVPERRQARF-----ECVLTREA-------------- 11513

Query: 1506  PEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNK 1555
               V W K    + S D  ++    G+     IN     D G Y   V+ K
Sbjct: 11514 -NVIWSKGPDIIKSSDKFDI-IADGKKHILVINDSQFDDEGVYTAEVEGK 11561



 Score = 36.2 bits (82), Expect = 0.26
 Identities = 27/96 (28%), Positives = 40/96 (41%), Gaps = 4/96 (4%)

Query: 279  FIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQ-VPINVHANPGKYIIESRYGMHTL 337
            F+ +P+S  V EK        + G P P V W K +   +N     G+  I  +     L
Sbjct: 8456 FVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLN---QGGRVFIHQKGDEAKL 8512

Query: 338  EINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYK 373
            EI      D+  YR  A N  GE+ +  ++ V   K
Sbjct: 8513 EIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERK 8548



 Score = 36.2 bits (82), Expect = 0.26
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 293   NVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRA 352
             ++++   I G P P VTW K+ + +   AN     IE+      L I  C+  DT ++  
Sbjct: 20793 SIRIFVPIKGRPAPEVTWTKDNINLKNRAN-----IENTESFTLLIIPECNRYDTGKFVM 20847

Query: 353   SAMNVKGELSAYASVVV 369
             +  N  G+ S + +V V
Sbjct: 20848 TIENPAGKKSGFVNVRV 20864



 Score = 36.2 bits (82), Expect = 0.26
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 2/85 (2%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKAL-ASDDHCNLKFEAGRTAYFTINGVST 1542
             DV+ +  G+   L  ++ G P P+V W K+ K L  +     +K    +T     + + T
Sbjct: 24715 DVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRT 24774

Query: 1543  ADSGKYGLVVKNKYGSETSDFTVSV 1567
              D G+Y L + N  G+++   TV V
Sbjct: 24775 -DGGQYILKLSNVGGTKSIPITVKV 24798



 Score = 35.8 bits (81), Expect = 0.34
 Identities = 24/94 (25%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 277 PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
           P F+ + +S TV +   V+L   + G P P V +Y++   I    +   + I     +++
Sbjct: 104 PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLD---FQISQEGDLYS 160

Query: 337 LEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
           L I     ED+  Y  +A N  G  ++ A ++V+
Sbjct: 161 LLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 35.8 bits (81), Expect = 0.34
 Identities = 38/153 (24%), Positives = 61/153 (39%), Gaps = 11/153 (7%)

Query: 221   VVSKQATSALQQEETSEKKSRKVVIREKA-ERLSLRKTLEETETYHAKLNEDHLLHAPEF 279
             V   +  +  + E T  ++ +    R KA  R    K    TE   A   ++    APE 
Sbjct: 13635 VACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQE----APEI 13690

Query: 280   IIKPR---SHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
              +  +     TV     ++L  ++ G PEP++TW K  +   +     +  IE+     T
Sbjct: 13691 FLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADM---ILKQDKRITIENVPKKST 13747

Query: 337   LEINGCDFEDTAQYRASAMNVKGELSAYASVVV 369
             + I      DT  Y   A+NV G  +A   V V
Sbjct: 13748 VTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 13780



 Score = 35.8 bits (81), Expect = 0.34
 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
             +VV  + G ++ L   + G P P + W K++K L ++    ++      A   I      
Sbjct: 26880 EVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVE-NTTDLASILIKDADRL 26938

Query: 1544  DSGKYGLVVKNKYGSETSDFTVSV 1567
             +SG Y L ++N  GS ++   V +
Sbjct: 26939 NSGCYELKLRNAMGSASATIRVQI 26962



 Score = 35.4 bits (80), Expect = 0.44
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
             D + I+ G++L +   V G P P V+W K+   +    +  +    G T+ F +   +  
Sbjct: 27966 DGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLF-VRDATRD 28024

Query: 1544  DSGKYGLVVKNKYGSETSDFTVSV 1567
               G Y +  KN  GS  ++  V V
Sbjct: 28025 HRGVYTVEAKNASGSAKAEIKVKV 28048



 Score = 35.0 bits (79), Expect = 0.58
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 439 PEIQWYRNGVPLSPS--KWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAY 496
           PE+ W+R+G  +S S    VQ  +S  RA LT   + K + G Y+++   G      +A 
Sbjct: 35  PEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAE 94

Query: 497 VFVR 500
           + V+
Sbjct: 95  LLVK 98



 Score = 35.0 bits (79), Expect = 0.58
 Identities = 51/247 (20%), Positives = 100/247 (40%), Gaps = 40/247 (16%)

Query: 14  DLSYRNKDVRST------VSHYQREKKRSAVYTQGSTAYSSRSSAAHRRESEAFRRASAS 67
           +L  R K+V +T      V+H Q  K+    +           SAA  +E E       +
Sbjct: 490 ELKSRTKEVITTKQEQMHVTHEQIRKETEKTFVPKVVI-----SAAKAKEQETRISEEIT 544

Query: 68  SSQQQASQHALSSEVSRKAASAYDYGSSHGLTDSSLLLDDYSSKLSPKPKRAKHSLLSGE 127
             Q+Q +Q A+  E    AAS     ++             S+KL   P          +
Sbjct: 545 KKQKQVTQEAIRQETEITAASMVVVATAK------------STKLETVP--------GAQ 584

Query: 128 EKENLPSDYMVPIFSGRQKHVSGITDTEEERIKEAAAYIAQRNLLA-SEEGITTSKQSTA 186
           E+     D M       +K +     T   ++  A   + +++L++   EGITT ++   
Sbjct: 585 EETTTQQDQM---HLSYEKIMKETRKTVVPKVIVATPKVKEQDLVSRGREGITTKREQVQ 641

Query: 187 SKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKVVIR 246
             Q    K++  +  ST +  +  +++    +++++  + T A +QE+  +    KV + 
Sbjct: 642 ITQEKMRKEAEKTALSTIAVATAKAKE----QETILRTRETMATRQEQI-QVTHGKVDVG 696

Query: 247 EKAERLS 253
           +KAE ++
Sbjct: 697 KKAEAVA 703



 Score = 35.0 bits (79), Expect = 0.58
 Identities = 43/207 (20%), Positives = 77/207 (37%), Gaps = 20/207 (9%)

Query: 171  LLASEEGITTSKQS-----TASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQ 225
            LL+ +E  T ++++     T     T   + + +K+ TA         +  S+  +    
Sbjct: 4572 LLSVKEPATITEEAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTD 4631

Query: 226  ATSALQQEETSEKKSRKVV--IREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKP 283
              S L+   T +K S +    ++    R S +          A++N   L+  P F  K 
Sbjct: 4632 TVSILKIISTEKKDSGEYTFEVQNDVGRSSCK----------ARINVLDLIIPPSFTKKL 4681

Query: 284  RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCD 343
            +     +   + L C +AG     + W+K+   I+      KY          LEI+  +
Sbjct: 4682 KKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASE---KYKFSFHDNTAFLEISQLE 4738

Query: 344  FEDTAQYRASAMNVKGELSAYASVVVK 370
              D+  Y  SA N  G       + VK
Sbjct: 4739 GTDSGTYTCSATNKAGHNQCSGHLTVK 4765



 Score = 35.0 bits (79), Expect = 0.58
 Identities = 17/75 (22%), Positives = 35/75 (46%), Gaps = 1/75 (1%)

Query: 1486  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADS 1545
             + ++ G  +     + G P P   W  +   + +D+H  ++ +   ++  TI      D+
Sbjct: 17520 LVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETD-NFSSVLTIKNCLRRDT 17578

Query: 1546  GKYGLVVKNKYGSET 1560
             G+Y + V N  GS+T
Sbjct: 17579 GEYQITVSNAAGSKT 17593



 Score = 35.0 bits (79), Expect = 0.58
 Identities = 23/84 (27%), Positives = 35/84 (41%), Gaps = 3/84 (3%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYR 351
             E++++   + G P PRVTW+K+ V I    N     I    G  +L +     +    Y 
Sbjct: 27974 ESLRIKALVQGRPVPRVTWFKDGVEIEKRMN---MEITDVLGSTSLFVRDATRDHRGVYT 28030

Query: 352   ASAMNVKGELSAYASVVVKRYKGE 375
               A N  G   A   V V+   G+
Sbjct: 28031 VEAKNASGSAKAEIKVKVQDTPGK 28054



 Score = 34.7 bits (78), Expect = 0.76
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 3/76 (3%)

Query: 295  KLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASA 354
            +L C IAG    RV+W+K+   I   A   +Y I    G  +LEI   D  D   +   A
Sbjct: 4131 RLDCKIAGSLPMRVSWFKDGKEI---AASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRA 4187

Query: 355  MNVKGELSAYASVVVK 370
             N  G   +  +++V+
Sbjct: 4188 TNSVGSKDSSGALIVQ 4203



 Score = 34.7 bits (78), Expect = 0.76
 Identities = 44/195 (22%), Positives = 66/195 (33%), Gaps = 37/195 (18%)

Query: 287  TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
            TV   E   L C +AG PE  V WYK+     +  +  K+       + +L I   + +D
Sbjct: 5714 TVTVGETCTLECKVAGTPELSVEWYKDG---KLLTSSQKHKFSFYNKISSLRILSVERQD 5770

Query: 347  TAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIH 406
               Y     N  G+ S  A V V                     S    P  +  R +  
Sbjct: 5771 AGTYTFQVQNNVGKSSCTAVVDV---------------------SDRAVPPSFTRRLK-- 5807

Query: 407  FDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERAT 466
                   + G  G +  L C+V  +  I      + W+     +      QT +S    T
Sbjct: 5808 ------NTGGVLGASCILECKVAGSSPI-----SVAWFHEKTKIVSGAKYQTTFSDNVCT 5856

Query: 467  LTFSHLNKEDEGLYT 481
            L  + L+  D G YT
Sbjct: 5857 LQLNSLDSSDMGNYT 5871



 Score = 34.7 bits (78), Expect = 0.76
 Identities = 22/86 (25%), Positives = 37/86 (43%), Gaps = 1/86 (1%)

Query: 1482  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1541
             L   + ++ G  + L   V G PPP+++W K    L      ++K       +     V+
Sbjct: 19699 LRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIK-STDFDTFLRCENVN 19757

Query: 1542  TADSGKYGLVVKNKYGSETSDFTVSV 1567
               D+GKY L ++N  G +     V V
Sbjct: 19758 KYDAGKYILTLENSCGKKEYTIVVKV 19783



 Score = 34.3 bits (77), Expect = 0.99
 Identities = 41/195 (21%), Positives = 77/195 (39%), Gaps = 19/195 (9%)

Query: 1293 IVWYKDEREISVDE----KHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLV 1348
            + W++D + IS       +  F DG   L I   +K ++G Y +   +  G+  S  +L+
Sbjct: 37   VSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELL 96

Query: 1349 ---DEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRY 1405
               + A    +  +        + +++Q    GI     V +Y          +G+ I+ 
Sbjct: 97   VKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPT-PVVKFY---------RDGAEIQS 146

Query: 1406 SDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQR- 1464
            S   +    G+   L I E  P D G Y +   +       T +L  Q  +E  A+  + 
Sbjct: 147  SLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKT 206

Query: 1465 -LKQAAIAEKNRARV 1478
             +  A I+E  + R+
Sbjct: 207  IVSTAQISESRQTRI 221



 Score = 34.3 bits (77), Expect = 0.99
 Identities = 25/94 (26%), Positives = 43/94 (45%), Gaps = 7/94 (7%)

Query: 1481  GLPDVVTIQEGKALNLTCNVWGDPPPEVSWL---KNEKALASDDHC---NLKFE-AGRTA 1533
             G  D +  + G  + +   + G P P+ SW    K +KA+    H    + + E A  ++
Sbjct: 15815 GAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSS 15874

Query: 1534  YFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1567
                I     + +GKY +  KNK G +T++  V V
Sbjct: 15875 VIIIPECKRSHTGKYSITAKNKAGQKTANCRVKV 15908



 Score = 34.3 bits (77), Expect = 0.99
 Identities = 21/83 (25%), Positives = 39/83 (46%), Gaps = 5/83 (6%)

Query: 1486  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAG-RTAYFTINGVSTAD 1544
             + ++ G +  +     G P PE++W + E          ++ E G      +I+     D
Sbjct: 24034 IVVRAGGSARIHIPFKGRPTPEITWSREEGEFTD----KVQIEKGVNYTQLSIDNCDRND 24089

Query: 1545  SGKYGLVVKNKYGSETSDFTVSV 1567
             +GKY L ++N  GS+++  TV V
Sbjct: 24090 AGKYILKLENSSGSKSAFVTVKV 24112



 Score = 33.9 bits (76), Expect = 1.3
 Identities = 26/87 (29%), Positives = 33/87 (37%), Gaps = 10/87 (11%)

Query: 1486  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASD----DHCNLKFEAGRTAYFTINGVS 1541
             + I  GK L +   V G P P   W K E  L  D    D+   K E        I    
Sbjct: 15114 IQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSE------LIIKDAL 15167

Query: 1542  TADSGKYGLVVKNKYGSETSDFTVSVF 1568
               D G+Y +   N  GS+ +   V VF
Sbjct: 15168 RKDHGRYVITATNSCGSKFAAARVEVF 15194



 Score = 33.5 bits (75), Expect = 1.7
 Identities = 31/109 (28%), Positives = 54/109 (49%), Gaps = 4/109 (3%)

Query: 1262 PHFVEYL-SWEVTGECNVLLKCKVANIKKETHIVWYKDEREI--SVDEKHDFKDGICTLL 1318
            P+FV+ L S  V     V L+ +V  I     + +Y+D  EI  S+D +   +  + +LL
Sbjct: 104  PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPV-VKFYRDGAEIQSSLDFQISQEGDLYSLL 162

Query: 1319 ITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSA 1367
            I E   +D+G Y V   +  G+  S  +L+ +  +E+  +  K I  +A
Sbjct: 163  IAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIVSTA 211



 Score = 33.5 bits (75), Expect = 1.7
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 5/67 (7%)

Query: 418  EGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDE 477
            EG    L C+V + P++      ++WY N   + P   VQ +  G +  L  +  +  DE
Sbjct: 2458 EGTKAVLECKVSV-PDVT----SVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDE 2512

Query: 478  GLYTIRV 484
            G Y + V
Sbjct: 2513 GPYKLIV 2519



 Score = 33.1 bits (74), Expect = 2.2
 Identities = 22/94 (23%), Positives = 40/94 (42%), Gaps = 3/94 (3%)

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
            P FI       +    N  L C ++G     ++W+K++  I    +  KY + S+  +  
Sbjct: 3831 PSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIR---SSKKYRLFSQKSLVC 3887

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
            LEI   +  D  +Y     N  G+    A+ ++K
Sbjct: 3888 LEIFSFNSADVGEYECVVANEVGKCGCMATHLLK 3921



 Score = 33.1 bits (74), Expect = 2.2
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 3/80 (3%)

Query: 1488  IQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGK 1547
             I+ G  L L+  + G P P+V+W K ++   +    ++     +     I   +  D G 
Sbjct: 17230 IKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGSK---LEIRNAAHEDGGI 17286

Query: 1548  YGLVVKNKYGSETSDFTVSV 1567
             Y L V+N  GS+T    V V
Sbjct: 17287 YSLTVENPAGSKTVSVKVLV 17306



 Score = 33.1 bits (74), Expect = 2.2
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 13/87 (14%)

Query: 1486  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAG--RTAYFT---INGV 1540
             + ++ G ++ +   + G P PEV+W K        D+ NLK  A    T  FT   I   
Sbjct: 20786 LVVRAGLSIRIFVPIKGRPAPEVTWTK--------DNINLKNRANIENTESFTLLIIPEC 20837

Query: 1541  STADSGKYGLVVKNKYGSETSDFTVSV 1567
             +  D+GK+ + ++N  G ++    V V
Sbjct: 20838 NRYDTGKFVMTIENPAGKKSGFVNVRV 20864



 Score = 32.7 bits (73), Expect = 2.9
 Identities = 38/176 (21%), Positives = 75/176 (42%), Gaps = 16/176 (9%)

Query: 1069 PKSEFSWSKD--YVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSY 1126
            P  E SW +D   +ST   P +++     + K+T   +   + G YS   T+  G A+S 
Sbjct: 33   PVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATS- 91

Query: 1127 LIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEK 1186
                 EL     L      P   V+   ++ + +  QVR  ++   +     V +  +  
Sbjct: 92   ---TAEL-----LVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIP-TPVVKFYRDGA 142

Query: 1187 EIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQD--GKATNHSTVVLVGD 1240
            EI     ++  I +   +  + + +   ED GTY+    +  G+AT+ + +++ G+
Sbjct: 143  EIQSSLDFQ--ISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGE 196



 Score = 32.7 bits (73), Expect = 2.9
 Identities = 43/204 (21%), Positives = 67/204 (32%), Gaps = 47/204 (23%)

Query: 278  EFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTL 337
            + I KP+  T  E   V    S++    P V W+   V I       K+ + S   +H L
Sbjct: 2796 KIIKKPKDVTALENATVAFEVSVSHDTVP-VKWFHKSVEIKPS---DKHRLVSERKVHKL 2851

Query: 338  EINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPY 397
             +      D  +Y A    V G+L   A + V+                           
Sbjct: 2852 MLQNISPSDAGEYTA----VVGQLECKAKLFVET-------------------------- 2881

Query: 398  GYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQ 457
                   +H           E +T S  C      E+ HF     W +NGV +  S+  +
Sbjct: 2882 -------LHITKTMKNIEVPETKTASFEC------EVSHFNVPSMWLKNGVEIEMSEKFK 2928

Query: 458  TLWSGERATLTFSHLNKEDEGLYT 481
             +  G+   L   + + ED   YT
Sbjct: 2929 IVVQGKLHQLIIMNTSTEDSAEYT 2952



 Score = 32.3 bits (72), Expect = 3.7
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 3/80 (3%)

Query: 1488  IQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGK 1547
             ++ G +  +T    G P P V W K +  L +  + +      RT+  TI   +  DSGK
Sbjct: 26198 VKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDT--TDSRTS-LTIENANRNDSGK 26254

Query: 1548  YGLVVKNKYGSETSDFTVSV 1567
             Y L ++N   + +    V V
Sbjct: 26255 YTLTIQNVLSAASLTLVVKV 26274



 Score = 32.0 bits (71), Expect = 4.9
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 5/45 (11%)

Query: 418  EGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSG 462
            EGET    CRV   P     QP++ WY NG  +  SK  +  + G
Sbjct: 1854 EGETARFRCRVTGYP-----QPKVNWYLNGQLIRKSKRFRVRYDG 1893



 Score = 32.0 bits (71), Expect = 4.9
 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 3/74 (4%)

Query: 296  LHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAM 355
            L  ++AG PE +  WYK+  P+       KY I  +  +  L+    +  D+ QY     
Sbjct: 4036 LEYTVAGTPELKPKWYKDGRPL---VASKKYRISFKNNVAQLKFYSAELHDSGQYTFEIS 4092

Query: 356  NVKGELSAYASVVV 369
            N  G  S   +  V
Sbjct: 4093 NEVGSSSCETTFTV 4106



 Score = 32.0 bits (71), Expect = 4.9
 Identities = 23/89 (25%), Positives = 36/89 (40%), Gaps = 17/89 (19%)

Query: 1486  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALA-------SDDHCNLKFEAGRTAYFTIN 1538
             + +++G  + LT  + G P P   W K  + ++       S+ H  L           I 
Sbjct: 30146 IFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTEL----------VIK 30195

Query: 1539  GVSTADSGKYGLVVKNKYGSETSDFTVSV 1567
                  DSG Y LV++NK G +     V V
Sbjct: 30196 EADRGDSGTYDLVLENKCGKKAVYIKVRV 30224



 Score = 31.6 bits (70), Expect = 6.4
 Identities = 44/203 (21%), Positives = 71/203 (34%), Gaps = 46/203 (22%)

Query: 278   EFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTL 337
             +F+      TV E E     C ++   +  V W+KN   ++        +I S    H L
Sbjct: 11575 KFMSPLEDQTVKEGETATFVCELSH-EKMHVVWFKNDAKLHTSRT---VLISSEGKTHKL 11630

Query: 338   EINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPY 397
             E+     +D +Q +A       ELS+ A + V                          PY
Sbjct: 11631 EMKEVTLDDISQIKAQVK----ELSSTAQLKVLE----------------------ADPY 11664

Query: 398   GYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQ 457
                  F +   DK  V    E + ++L C V     +K       W+++G  + PS    
Sbjct: 11665 -----FTVKLHDKTAV----EKDEITLKCEVSKDVPVK-------WFKDGEEIVPSPKYS 11708

Query: 458   TLWSGERATLTFSHLNKEDEGLY 480
                 G R  L     + +D+G Y
Sbjct: 11709 IKADGLRRILKIKKADLKDKGEY 11731



 Score = 31.2 bits (69), Expect = 8.3
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 8/88 (9%)

Query: 1502 GDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTIN-GVS-TADSGKYGLVVKNKYGSE 1559
            GDP   V WL + K L + +   +  E G   Y +++ GV+ + DSG       NKYG  
Sbjct: 1730 GDPTMVVEWLHDGKPLEAANRLRMINEFG---YCSLDYGVAYSRDSGIITCRATNKYG-- 1784

Query: 1560 TSDFTVSVFIPEEEARMAALESLKGGKK 1587
             +D T +  I ++E  +     L  G+K
Sbjct: 1785 -TDHTSATLIVKDEKSLVEESQLPEGRK 1811



 Score = 31.2 bits (69), Expect = 8.3
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 6/60 (10%)

Query: 419   GETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEG 478
             GET +  C      E+ +    ++WY  G  L PS  V     G+  TLT   +  ED G
Sbjct: 12210 GETATFDC------ELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAG 12263



 Score = 31.2 bits (69), Expect = 8.3
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 6/88 (6%)

Query: 1502  GDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETS 1561
             G P P  +W   +K L + D   +K      A   I+    +D G Y L ++N+  + + 
Sbjct: 13420 GYPRPTATWCFGDKVLETGDRVKMK-TLSAYAELVISPSERSDKGIYTLKLENRVKTISG 13478

Query: 1562  DFTVSVFIPEEEARMAALESLKGGKKAK 1589
             +  V+V      AR +A + LK G   K
Sbjct: 13479 EIDVNVI-----ARPSAPKELKFGDITK 13501



 Score = 31.2 bits (69), Expect = 8.3
 Identities = 24/91 (26%), Positives = 38/91 (41%), Gaps = 7/91 (7%)

Query: 1496  LTCNVWGDPPPEVSWLKNEKALASDDHCNLKFE----AGRTAYFTINGVSTADSGKYGLV 1551
             L C V G P P V W +  K + +D    LK+      G      I  V+  D+  Y + 
Sbjct: 30947 LVCKVTGHPKPIVKWYRQGKEIIAD---GLKYRIQEFKGGYHQLIIASVTDDDATVYQVR 31003

Query: 1552  VKNKYGSETSDFTVSVFIPEEEARMAALESL 1582
               N+ GS +   ++ V +P +      LE +
Sbjct: 31004 ATNQGGSVSGTASLEVEVPAKIHLPKTLEGM 31034


>gi|110349717 titin isoform novex-2 [Homo sapiens]
          Length = 27118

 Score =  266 bits (679), Expect = 2e-70
 Identities = 184/627 (29%), Positives = 295/627 (47%), Gaps = 50/627 (7%)

Query: 510  PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
            P  P  ++  +  KD + ++W +P  DGGSPI GY++++ +  TD W +CN  PVK   +
Sbjct: 7578 PGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTY 7637

Query: 570  PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
             V GL   + Y FRV A N  G G PS+ +EP+   DP +          PW        
Sbjct: 7638 RVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPID---------PPWP------- 7681

Query: 630  EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGI-MYFVEKCEAGTENWQRVNT 688
                    PG PT   V +  ++ V L+W  P   G   I  Y +E  + GT+ W RV  
Sbjct: 7682 --------PGKPT---VKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAE 7730

Query: 689  ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPS 748
             +P  + +  L  L EG+ Y FRVR  N AG  EPSE ++  +  +KL  P  P  +   
Sbjct: 7731 GVP--TTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVI 7788

Query: 749  RNTDTSVVVSW--EESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQS 806
              T  +  + W   E      +  Y +E        W+  +   VK ++ T   L  G  
Sbjct: 7789 NITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTT-VKDTKCTVTPLTEGSL 7847

Query: 807  YIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGG 866
            Y+FRV A NA G S+Y++  +++  K     P PP  +  ++  +  + L W+ P   GG
Sbjct: 7848 YVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGG 7907

Query: 867  AEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAP 926
              I  Y +  +E +     +W +A   A  +  ++++++ E    QFQV A N AG+G P
Sbjct: 7908 RPIQRYVIEKKERLG---TRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHP 7964

Query: 927  SAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKA 986
            S  +E    E+ T + P PP  L  ++  +  + + WKPP  +G +P+ GY V++     
Sbjct: 7965 SEPTEILSIEDPT-SPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEM--CPV 8021

Query: 987  KEDQWRGLNEAAIKNVYLKV-RGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA---ETR 1042
              ++W  +N   IK++  KV  G+     YV RVRA+N  GV +PS+++  VVA   + +
Sbjct: 8022 GTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCK 8081

Query: 1043 P----GTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTK 1098
            P     T +++V   +   I + F   +  P    SW KD    + S RL +++      
Sbjct: 8082 PTIDLETHDIIVIEGEKLSIPVPF---RAVPVPTVSWHKDGKEVKASDRLTMKNDHISAH 8138

Query: 1099 MTFKDLGMDDLGIYSCDVTDTDGIASS 1125
            +        D GIY+  + +  G A++
Sbjct: 8139 LEVPKSVRADAGIYTITLENKLGSATA 8165



 Score =  251 bits (642), Expect = 3e-66
 Identities = 187/627 (29%), Positives = 290/627 (46%), Gaps = 56/627 (8%)

Query: 438  QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
            +P+I W +  + L   K +      +++T+T     + D G Y I         + +A V
Sbjct: 7414 EPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAV--NVCGRATAVV 7471

Query: 498  FVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
             V   D      P  P      +   +  +++W  P  DGGS I  Y +++    ++ W 
Sbjct: 7472 EVNVLDK-----PGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWH 7526

Query: 558  QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAA---LDPAEKARLK 614
            + + T VK   F  T LI  + YIFRV A N  G+G P + S P+ A    DP       
Sbjct: 7527 KLSST-VKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQAS-PITAKYQFDP------- 7577

Query: 615  SRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFV 673
                                   PGPPT L  ++ T+  V L+W  P   G   I  Y+V
Sbjct: 7578 -----------------------PGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWV 7614

Query: 674  EKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVG 733
            E+ +  T+ W R N ++PVK   + +  L   K Y FRV   N AG G+PS++TE  ++ 
Sbjct: 7615 ERLDPDTDKWVRCN-KMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIK 7673

Query: 734  DKLDIPKAPGKIIPSRNTDTSVVVSW--EESKDAKELVGYYIEASVAGSGKWEPCNNNPV 791
            D +D P  PGK        TSV ++W   E     ++  Y IE    G+ +W       V
Sbjct: 7674 DPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEG-V 7732

Query: 792  KGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFR 851
              ++    GL+ GQ Y FRVRAVN AG SE S+ S+ +  +  + PPSPP  +  +   +
Sbjct: 7733 PTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITK 7792

Query: 852  DSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVY 911
            ++  L W  P+K GG+ IT Y V  R+V       W+  +   V +    ++ L E  +Y
Sbjct: 7793 NTADLKWTVPEKDGGSPITNYIVEKRDV---RRKGWQTVDT-TVKDTKCTVTPLTEGSLY 7848

Query: 912  QFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGR 971
             F+VAA N  G    + + +    ++ T   PGPP++L   +V K  + L+W+PP + G 
Sbjct: 7849 VFRVAAENAIGQSDYTEIEDSVLAKD-TFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGG 7907

Query: 972  TPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPS 1031
             P+  Y ++ KE      +W    + A  +   +V  + EG    F+VRA N+AGVG PS
Sbjct: 7908 RPIQRYVIEKKERLG--TRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPS 7965

Query: 1032 DLAGPVVAE--TRPGTKEVVVNVDDDG 1056
            +    +  E  T P +  + ++V D G
Sbjct: 7966 EPTEILSIEDPTSPPSPPLDLHVTDAG 7992



 Score =  226 bits (577), Expect = 1e-58
 Identities = 198/661 (29%), Positives = 274/661 (41%), Gaps = 96/661 (14%)

Query: 417   REGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKED 476
             R G TM L   V   P      P+I W +  V L     +    +     L   ++NK D
Sbjct: 13401 RAGVTMRLYVPVKGRPP-----PKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYD 13455

Query: 477   EGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVD 536
              G Y + +      ++Y+  V V D        P  P++V   E +KD   ++W+ P +D
Sbjct: 13456 AGKYILTLENSCGKKEYTIVVKVLDT-------PGPPVNVTVKEISKDSAYVTWEPPIID 13508

Query: 537   GGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPS 596
             GGSPI+ Y + K +    SWS    T      F V  L EG+SY FRV A N+ GIG P 
Sbjct: 13509 GGSPIINYVVQKRDAERKSWSTVT-TECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPG 13567

Query: 597   RVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVL 656
                + V A                                 PGP  DL V   ++S   +
Sbjct: 13568 ETRDAVKASQ------------------------------TPGPVVDLKVRSVSKSSCSI 13597

Query: 657   SWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSN 716
              WK P   G   I+ +V         WQRV   L   S +++  DL EGK Y FRV   N
Sbjct: 13598 GWKKPHSDGGSRIIGYVVDFLTEENKWQRVMKSL---SLQYSAKDLTEGKEYTFRVSAEN 13654

Query: 717   SAGVGEPSEATEVT---VVGDKLDIPKAPGKIIPSRNTDT-----------SVVVSWEES 762
               G G PSE T V    VV   LD+   P     ++               +  VSW++ 
Sbjct: 13655 ENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKG 13714

Query: 763   KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEY 822
             +D        +      S +    N   +    + C     G+   + +   N AG  E 
Sbjct: 13715 EDP-------LATDTRVSVESSAVNTTLIV---YDCQKSDAGK---YTITLKNVAGTKEG 13761

Query: 823   SQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDG 882
             +     I +K    P  P   I   E   ++M L W  P   GG+EIT Y +  R   D 
Sbjct: 13762 T-----ISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKR---DS 13813

Query: 883   VPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCE----EW 938
             V  KW      AV +  ++++ L E M Y F+V+A N  G+G      E  K E      
Sbjct: 13814 VNNKWVTC-ASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVG------EGLKSEPIVARH 13866

Query: 939   TIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAA 998
                VP  P      +VR DS+ L W  P  +G +P+TGY ++ KE  +    W+  N+  
Sbjct: 13867 PFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSL--LWKRANKTP 13924

Query: 999   IKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA--ETRPGTKEVVVNVDDDG 1056
             I+    KV GL EG+ Y FRV AIN AGVGKPS  + PVVA     P  K  V+N+  + 
Sbjct: 13925 IRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITRNS 13984

Query: 1057  V 1057
             V
Sbjct: 13985 V 13985



 Score =  224 bits (571), Expect = 5e-58
 Identities = 170/614 (27%), Positives = 266/614 (43%), Gaps = 55/614 (8%)

Query: 429  VITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGE 488
            ++ P   + +P   W      L     V+       A L  S   + D+G+YT+++    
Sbjct: 7109 ILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKL---- 7164

Query: 489  YYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDK 548
               +        + D  +   P+AP ++K  +  KD + ++W+ P  DGGSP+ GY ++K
Sbjct: 7165 ---ENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEK 7221

Query: 549  CEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPA 608
             EV   +W++  D  V    F V  L++G+ Y+F+V A NK G G P+ V EPV    PA
Sbjct: 7222 REVSRKTWTKVMDF-VTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPA 7280

Query: 609  EKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEG 668
                                        VP PP ++   + T + + L+W PP   G   
Sbjct: 7281 ---------------------------TVPDPPENVKWRDRTANSIFLTWDPPKNDGGSR 7313

Query: 669  IM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEAT 727
            I  Y VE+C  G++ W  V    PV   +  +  L EGK Y +RV+  N  G  +PS  T
Sbjct: 7314 IKGYIVERCPRGSDKW--VACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPT 7371

Query: 728  EVTVVGDKLDIPK--APGKIIPSRNTDTSVVVSWEESKDAK-ELVGYYIEASVAGSGKWE 784
            E     D  + P+     K++          +    +   K E    + +A +       
Sbjct: 7372 EEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKR 7431

Query: 785  PCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDI 844
                N  K S  T        +  + + AVN  G     + +  +EV   +  P PP   
Sbjct: 7432 ITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCG-----RATAVVEVN-VLDKPGPPAAF 7485

Query: 845  TCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISN 904
               +   +S +L W  P   GG++IT Y V  R     V   W + +   V +  +K + 
Sbjct: 7486 DITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEV---WHKLS-STVKDTNFKATK 7541

Query: 905  LKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWK 964
            L  N  Y F+VAA NM G+G P   S      ++    PGPP  L+ S++ KD++ L W 
Sbjct: 7542 LIPNKEYIFRVAAENMYGVGEPVQASPI--TAKYQFDPPGPPTRLEPSDITKDAVTLTWC 7599

Query: 965  PPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQ 1024
             P   G +P+TGY+V+  +     D+W   N+  +K+   +V+GL     Y FRV A N 
Sbjct: 7600 EPDDDGGSPITGYWVERLDPDT--DKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENL 7657

Query: 1025 AGVGKPSDLAGPVV 1038
            AG GKPS    P++
Sbjct: 7658 AGPGKPSKSTEPIL 7671



 Score =  221 bits (564), Expect = 3e-57
 Identities = 186/596 (31%), Positives = 260/596 (43%), Gaps = 91/596 (15%)

Query: 478  GLYTIRVRMGEYY----EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQP 533
            G Y  RVR    Y    E  S  V ++D    + G P  P   K L   K  +++SW  P
Sbjct: 9262 GQYEFRVRAVNKYGISDECKSDKVVIQDP-YRLPGPPGKP---KVLARTKGSMLVSWTPP 9317

Query: 534  AVDGGSPILGYFIDKCEVGTDSWSQCNDTPV-----KFARFPVTGLIEGRSYIFRVRAVN 588
              +GGSPI GY+++K E G+  WS+ +  P+     K   F V  L+EG  Y FR  A+N
Sbjct: 9318 LDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAIN 9377

Query: 589  KMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTE 648
              GIG PS  S+P  A DP                              PGPP+   V +
Sbjct: 9378 AAGIGPPSEPSDPEVAGDPI---------------------------FPPGPPSCPEVKD 9410

Query: 649  ATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNT-ELPVKSPRFALFDLAEGK 706
             T+S + L WKPP + G   I  Y VE  E GT +W+RVN  +  + +    + +L E +
Sbjct: 9411 KTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCECVVPNLKELR 9470

Query: 707  SYCFRVRCSNSAGVGEPSEATE-----------------------VTVVGDKLDIPKAPG 743
             Y FRV+  N AG  EPS+ T                        V   G ++ IP    
Sbjct: 9471 KYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPA--- 9527

Query: 744  KIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVT 803
             +I  R T  S   SWE    AK+ +   +   +    + E   N+ V      C    T
Sbjct: 9528 -VIKGRPTPKS---SWEFDGKAKKAMKDGVH-DIPEDAQLETAENSSVIIIP-ECKRSHT 9581

Query: 804  GQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDK 863
            G+   + + A N AG    +   + ++V      P PP D+   +  R S  L WK PD 
Sbjct: 9582 GK---YSITAKNKAGQKTANCRVKVMDV------PGPPKDLKVSDITRGSCRLSWKMPDD 9632

Query: 864  IGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 923
             GG  I GY +  R  IDG    W + N    S   + + +L     Y F+V A N  G+
Sbjct: 9633 DGGDRIKGYVIEKR-TIDGKA--WTKVNPDCGST-TFVVPDLLSEQQYFFRVRAENRFGI 9688

Query: 924  GAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDL-- 981
            G P    +     +  I  P PP  LK   + K+++ L WKPP + G +PVT Y V+   
Sbjct: 9689 GPPVETIQRTTARD-PIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLA 9747

Query: 982  -KEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGP 1036
                  K++ WR  N+  ++ +   V  L EG  Y FRV+A+N AGV KPS   GP
Sbjct: 9748 WDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGP 9803



 Score =  221 bits (563), Expect = 4e-57
 Identities = 182/641 (28%), Positives = 273/641 (42%), Gaps = 85/641 (13%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P  P  ++     KD + + W +P  DGGS I+GY ++K +     W +CN   +   R 
Sbjct: 17514 PGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRL 17573

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              VTGL E   Y FRV A N  G+G PS  +    A DP  K                   
Sbjct: 17574 RVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFK------------------- 17614

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNT 688
                     PGPPT+  + + T++ + L+W KP    G E + Y VE C+A  E WQ V  
Sbjct: 17615 --------PGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVTP 17666

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIP--------- 739
             +  ++  RF +  L E + Y  RV   N  G+GE +         DKL+ P         
Sbjct: 17667 QTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELR 17726

Query: 740   -----KAPGKI---IPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPV 791
                  +A G     IP +   T  +    E  +  + V   IE  V           N  
Sbjct: 17727 KGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTDKV--QIEKGV-----------NYT 17773

Query: 792   KGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFR 851
             + S   C     G+ YI ++   N++G       S  + VK  +  P PP ++   E  +
Sbjct: 17774 QLSIDNCDRNDAGK-YILKLE--NSSG-----SKSAFVTVKV-LDTPGPPQNLAVKEVRK 17824

Query: 852   DSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKA-VSEEAYKISNLKENMV 910
             DS  L W+ P   GGA++  Y ++ RE       +   ANV +  S+ ++K+ NL E  +
Sbjct: 17825 DSAFLVWEPPIIDGGAKVKNYVIDKREST-----RKAYANVSSKCSKTSFKVENLTEGAI 17879

Query: 911   YQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSG 970
             Y F+V A N  G+G P    +  K  E     P PP  +  ++V + S  L W+ P H G
Sbjct: 17880 YYFRVMAENEFGVGVPVETVDAVKAAE----PPSPPGKVTLTDVSQTSASLMWEKPEHDG 17935

Query: 971   RTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKP 1030
              + V GY V+++      ++W  + E+ + N    V GL  G  Y FRV+A N+ G   P
Sbjct: 17936 GSRVLGYVVEMQPKGT--EKWSIVAESKVCNAV--VTGLSSGQEYQFRVKAYNEKGKSDP 17991

Query: 1031  SDLAGPVVAET---RPGTKEVVVNVDDDGVISLNFECDKM-TPKSEFSWSKDYVSTEDSP 1086
               L  PV+A+    +P  K             L  E   +  P+   SW KD    + + 
Sbjct: 17992 RVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTT 18051

Query: 1087  RLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1127
             R+ VE     T +  K+   DD G Y+   T++ G A+  L
Sbjct: 18052 RVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENL 18092



 Score =  219 bits (557), Expect = 2e-56
 Identities = 209/852 (24%), Positives = 345/852 (40%), Gaps = 99/852 (11%)

Query: 287   TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
             T+    +++L  S++G P P +TW K  + +   A     II++      L ++  +  D
Sbjct: 23152 TIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRA-----IIDTTESYSLLIVDKVNRYD 23206

Query: 347   TAQYRASAMNVKGELSAYASVVVKRYKGEFDETRF-HAGASTMPLSFGVTPYGYASRFEI 405
               +Y   A N  G+ SA   V V    G     +       ++ +++ +      +    
Sbjct: 23207 AGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNN 23266

Query: 406   HFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERA 465
             +  +K + +  R  +T++  C   +             YR          +  L  G   
Sbjct: 23267 YIVEKREAAM-RAFKTVTTKCSKTL-------------YR----------ISGLVEG--- 23299

Query: 466   TLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDY 525
               T  +     E +Y I    GE  E   A +        +   P  P  ++ ++  K  
Sbjct: 23300 --TMYYFRVLPENIYGI----GEPCETSDAVL--------VSEVPLVPAKLEVVDVTKST 23345

Query: 526   IIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVR 585
             + ++W++P  DGGS + GY ++ C+ GT+ W +            VT L EG  Y+FR+R
Sbjct: 23346 VTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIR 23405

Query: 586   AVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLS 645
             A N+ G+  P      V   D      L+  P+       + T  + +  +  G P +L 
Sbjct: 23406 AQNEKGVSEPRETVTAVTVQD------LRVLPTID-----LSTMPQKTIHVPAGRPVELV 23454

Query: 646   VTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEG 705
             +  A R     SW   G +  E                +RV  E   K  +  + +    
Sbjct: 23455 IPIAGRPPPAASWFFAGSKLRES---------------ERVTVETHTKVAKLTIRETTIR 23499

Query: 706   KSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE--ESK 763
              +  + +   N  G    SE  +V ++ DK   P  P KI       TS+ +SWE  E  
Sbjct: 23500 DTGEYTLELKNVTGT--TSETIKVIIL-DKPGPPTGPIKI--DEIDATSITISWEPPELD 23554

Query: 764   DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYS 823
                 L GY +E   A    W P + + V  S F    L  G  Y+FRV A N  G+  Y 
Sbjct: 23555 GGAPLSGYVVEQRDAHRPGWLPVSES-VTRSTFKFTRLTEGNEYVFRVAATNRFGIGSYL 23613

Query: 824   QDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGV 883
             Q SE IE +++I  P PP  +   +  RD M L W  P+  GG+++TGY V  +EV    
Sbjct: 23614 Q-SEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEV---R 23669

Query: 884   PGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVP 943
               +W   N   V+   Y+ + L E + Y+ +V A+N  G G PS  S+     +  IA P
Sbjct: 23670 ADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMD-PIAPP 23728

Query: 944   GPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVY 1003
             G P + + ++  + S+ L W  P   G + VTGY ++++  K  + +W   N    K   
Sbjct: 23729 GKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQ--KVDQHEWTKCNTTPTKIRE 23786

Query: 1004  LKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVN--------VDDD 1055
               +  L +G  Y FRV A N  G G+P+++ G V         +  ++        V   
Sbjct: 23787 YTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQG 23846

Query: 1056  GVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCD 1115
             GVI L     K  P     W+K+    + S R  + +    T++  K+    D G Y   
Sbjct: 23847 GVIRLTIPI-KGKPFPICKWTKE--GQDISKRAMIATSETHTELVIKEADRGDSGTYDLV 23903

Query: 1116  VTDTDGIASSYL 1127
             + +  G  + Y+
Sbjct: 23904 LENKCGKKAVYI 23915



 Score =  218 bits (554), Expect = 5e-56
 Identities = 175/618 (28%), Positives = 260/618 (42%), Gaps = 69/618 (11%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P + W ++G  L P++ ++        TL    +N++D G YTI        +  +  + 
Sbjct: 13020 PTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLK 13079

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V D        P  P  VK  +   D  ++SW+ P  DGGS I  Y +DK E    +W+Q
Sbjct: 13080 VLDK-------PGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQ 13132

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
              + T V      V  LIEG  Y FR+ A NK G+G P   +EP  A +P +         
Sbjct: 13133 VSAT-VPITSCSVEKLIEGHEYQFRICAENKYGVGDPV-FTEPAIAKNPYDP-------- 13182

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                                PG      ++  T+ ++ +SWKPP   G   I  Y +EK E
Sbjct: 13183 -------------------PGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRE 13223

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
                 NW +VN + P+         L EG  Y FRV   N AG G+PS+A++     D   
Sbjct: 13224 TQAVNWTKVNRK-PIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQY 13282

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCN-NNPVKGS 794
              P  P        T +SV +SW +        ++GY +E   A S  W  CN    ++ +
Sbjct: 13283 PPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKT 13342

Query: 795   RFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSM 854
             RF   GL+    Y FRV AVN  G S+ S   +    K  + PP    D       R ++
Sbjct: 13343 RFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELD----ADLRKTL 13398

Query: 855   VLGWKQPDKIGGAEITGYYVNYREVIDGVPG---KWREANVKAVSEEAYKISNLKENMVY 911
             +L              G  +     + G P     W + NV         I +   +   
Sbjct: 13399 ILR------------AGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFL 13446

Query: 912   QFQVAAMNMAGLGAPSAVSECFKCEEWTIAV-----PGPPHSLKCSEVRKDSLVLQWKPP 966
             + +      AG    +  + C K +E+TI V     PGPP ++   E+ KDS  + W+PP
Sbjct: 13447 RCENVNKYDAGKYILTLENSCGK-KEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPP 13505

Query: 967   VHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG 1026
             +  G +P+  Y V  ++A+ K   W  +     K  + +V  L+EG SY FRV A N+ G
Sbjct: 13506 IIDGGSPIINYVVQKRDAERK--SWSTVTTECSKTSF-RVANLEEGKSYFFRVFAENEYG 13562

Query: 1027  VGKPSDLAGPVVAETRPG 1044
             +G P +    V A   PG
Sbjct: 13563 IGDPGETRDAVKASQTPG 13580



 Score =  216 bits (550), Expect = 1e-55
 Identities = 195/731 (26%), Positives = 300/731 (41%), Gaps = 100/731 (13%)

Query: 339   INGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYG 398
             + G    DT +YR SA+N+ G+            K E      H                
Sbjct: 10473 VKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLH---------------- 10516

Query: 399   YASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQT 458
                   + F DK  +   R GE  +L  R    P+     P++ W+++   +        
Sbjct: 10517 ------LDFRDKLTI---RVGEAFALTGRYSGKPK-----PKVSWFKDEADVLEDDRTHI 10562

Query: 459   LWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKC 518
               +     L      + D G Y + V       +    V V D      G P  P+    
Sbjct: 10563 KTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRP----GPPVGPVSFD- 10617

Query: 519   LEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGR 578
              E  KDY++ISWK P  DGGS I  Y I+K EVG D W        K     V+ L+EG+
Sbjct: 10618 -EVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAK-TTCKVSKLLEGK 10675

Query: 579   SYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVP 638
              YIFR+ A N  GI      S+P+ +     K R +                      VP
Sbjct: 10676 DYIFRIHAENLYGI------SDPLVSDSMKAKDRFR----------------------VP 10707

Query: 639   GPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFA 698
               P    VTE T+   +++W  P   G     Y +EK E  ++ W RV  +      +F 
Sbjct: 10708 DAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKRETMSKRWARVTKDPIHPYTKFR 10767

Query: 699   LFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVS 758
             + DL EG  Y FRV   N  G+G+PS  ++     D +  P  P        T  SV ++
Sbjct: 10768 VPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLT 10827

Query: 759   WEESK--DAKELVGYYIEASVAGSGKWEPCNNNP--VKGSRFTCHGLVTGQSYIFRVRAV 814
             W+  +     +++GY +E    G  +W   N+ P     +++   GL  GQ+Y FRV AV
Sbjct: 10828 WQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVLAV 10887

Query: 815   NAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYV 874
             NAAG S+ +   E + VK  + PP    D            +  +Q  K+G        +
Sbjct: 10888 NAAGESDPAHVPEPVLVKDRLEPPELILDAN----------MAREQHIKVGDT------L 10931

Query: 875   NYREVIDGVP---GKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPS---- 927
                 +I GVP     W++ +  A ++    ++ +   +  + + AA    G+ + +    
Sbjct: 10932 RLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGSKL--EIRNAAHEDGGIYSLTVENP 10989

Query: 928   AVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAK 987
             A S+    +   +  PGPP  L+ SE+RKDS  L WK P+  G + +T Y V+ ++  + 
Sbjct: 10990 AGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASA 11049

Query: 988   EDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAET---RPG 1044
               QW  L+  + K  +   + L EG  Y+FRV A NQ G G   +   P+ A      PG
Sbjct: 11050 --QWSPLSATSKKKSHF-AKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPG 11106

Query: 1045  TKEVVVNVDDD 1055
               + + +VD D
Sbjct: 11107 PPKDLHHVDVD 11117



 Score =  216 bits (550), Expect = 1e-55
 Identities = 178/625 (28%), Positives = 265/625 (42%), Gaps = 65/625 (10%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P AP   +     KD +I+ W++PA DGGS ILGY ++K +     W++C+   +   R 
Sbjct: 16432 PDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRL 16491

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              VTGLIE   Y FRV A N  G+  PS  S    A DP  K                   
Sbjct: 16492 RVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACDPIYK------------------- 16532

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNT 688
                     PGPP +  V + TRS V LSW KP    G E   Y VEKC+     W     
Sbjct: 16533 --------PGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTP 16584

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAP-----G 743
                +      +  L E   Y FR+   N AGVGE ++     +V +KL+ P         
Sbjct: 16585 PTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELR 16644

Query: 744   KIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVT 803
             KII  R   +  +    + +   E+    ++  +  +   +         S FT   L  
Sbjct: 16645 KIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVT-------SSFTSLVLDN 16697

Query: 804   GQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDK 863
                Y      +    L   S    A      +  PSPP ++   E  +DS+ + W+ P  
Sbjct: 16698 VNRYDSGKYTLT---LENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLL 16754

Query: 864   IGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 923
              GG++I  Y V  RE       K   A V    + ++KI  L+E   Y F+V A N  G+
Sbjct: 16755 DGGSKIKNYIVEKREATR----KSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGI 16810

Query: 924   GAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE 983
             G P+  ++  K  E    VP PP  +   +V ++S+ L W  P H G + +  Y V++ +
Sbjct: 16811 GLPAQTADPIKVAE----VPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEM-Q 16865

Query: 984   AKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA---- 1039
             AK  E +W     A +K++   +  L +G  Y+FRV A+N+ G   P  LA P+VA    
Sbjct: 16866 AKHSE-KWSEC--ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLV 16922

Query: 1040  ---ETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNK 1096
                + +P      V V  D  I +        PK   +W+KD +  + + R+ V    + 
Sbjct: 16923 IEPDVKPAFSSYSVQVGQDLKIEVPI---SGRPKPTITWTKDGLPLKQTTRINVTDSLDL 16979

Query: 1097  TKMTFKDLGMDDLGIYSCDVTDTDG 1121
             T ++ K+   DD G Y   V +  G
Sbjct: 16980 TTLSIKETHKDDGGQYGITVANVVG 17004



 Score =  213 bits (541), Expect = 2e-54
 Identities = 192/700 (27%), Positives = 285/700 (40%), Gaps = 118/700 (16%)

Query: 523   KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIF 582
             KD++ +SWK PA DGGSPI GY ++K E    +W++ N  P+       TGL EG  Y F
Sbjct: 13196 KDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEF 13255

Query: 583   RVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPT 642
             RV A+NK G G PS  S+   A DP                              PGPP 
Sbjct: 13256 RVTAINKAGPGKPSDASKAAYARDPQYP---------------------------PGPPA 13288

Query: 643   DLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFD 701
                V + TRS V LSW  P   G   I+ Y VE   A ++NW R N    ++  RF +  
Sbjct: 13289 FPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTG 13348

Query: 702   LAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEE 761
             L E   Y FRV   N  G  +PS+                    +P ++    +++  E 
Sbjct: 13349 LMEDTQYQFRVYAVNKIGYSDPSD--------------------VPDKHYPKDILIPPEG 13388

Query: 762   SKDA---KELV---GYYIEASVAGSGK------WEPCNNN-------PVKGSRFT----C 798
               DA   K L+   G  +   V   G+      W   N N        +K + F     C
Sbjct: 13389 ELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRC 13448

Query: 799   HGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGW 858
               +    +  + +   N+ G  EY+     I VK  +  P PP ++T  E  +DS  + W
Sbjct: 13449 ENVNKYDAGKYILTLENSCGKKEYT-----IVVKV-LDTPGPPVNVTVKEISKDSAYVTW 13502

Query: 859   KQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAM 918
             + P   GG+ I  Y V  R   D     W     +  S+ +++++NL+E   Y F+V A 
Sbjct: 13503 EPPIIDGGSPIINYVVQKR---DAERKSWSTVTTEC-SKTSFRVANLEEGKSYFFRVFAE 13558

Query: 919   NMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYF 978
             N  G+G P    +  K  +     PGP   LK   V K S  + WK P   G + + GY 
Sbjct: 13559 NEYGIGDPGETRDAVKASQ----TPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYV 13614

Query: 979   VDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVV 1038
             VD      +E++W+ + ++   ++    + L EG  Y FRV A N+ G G PS++   VV
Sbjct: 13615 VDFL---TEENKWQRVMKSL--SLQYSAKDLTEGKEYTFRVSAENENGEGTPSEIT--VV 13667

Query: 1039  AETRPGTKEVVVNVDDDGVISL--------NFECD---KMTPKSEFSWSKDYVSTEDSPR 1087
             A        V  ++D  G+  L        NF      K  P    SW K         R
Sbjct: 13668 ARD----DVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTR 13723

Query: 1088  LEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPT 1147
             + VES    T +   D    D G Y+  + +  G     +         + +  +   PT
Sbjct: 13724 VSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTI--------SIKVVGKPGIPT 13775

Query: 1148  VPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1187
              P+K +   E+  +     W   +   G+   NYI  +++
Sbjct: 13776 GPIKFD---EVTAEAMTLKWAPPKDDGGSEITNYILEKRD 13812



 Score =  213 bits (541), Expect = 2e-54
 Identities = 293/1258 (23%), Positives = 492/1258 (39%), Gaps = 198/1258 (15%)

Query: 273   LLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRY 332
             L+  P F +   + TV   E++K+     G P P VTW+K+ VP+       +   ES  
Sbjct: 15839 LVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLK---QTTRVNAESTE 15895

Query: 333   GMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKG------EFDETRFHAGAS 386
                 L I     ED   Y     N  GE     +V+V    G      + DE      A 
Sbjct: 15896 NNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVT----AD 15951

Query: 387   TMPLSFGVTPYGYASRFEIHFDDKFDVSF-------GREGETMSLGCRVVITPEIK---- 435
             ++ LS+G   Y   S    +  +K D S             T    CR+    E +    
Sbjct: 15952 SITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFRIA 16011

Query: 436   -----------HFQPEIQWYRNGVPLSPSKWVQTLWSG---------------------- 462
                        + +P +  Y   VP  P   V TL S                       
Sbjct: 16012 AENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYH 16071

Query: 463   ----ERATLTFSHLNKE------------DEGL-YTIRVR------MGEYYEQYSAYVFV 499
                 ER ++ +  LNK             +EG+ Y  RV       +G+  +    YV  
Sbjct: 16072 LERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYV-A 16130

Query: 500   RDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQC 559
             RD   +  G P A +        ++ + + WK+P  DGGS I GY ++K E+    W + 
Sbjct: 16131 RDP-CDPPGRPEAII------VTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKA 16183

Query: 560   NDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGI-GFPSRVSEPVAALDPAEKARLKSRPS 618
             + T +    F VTGL+E   Y FRV A N  G+   PS  +  + A D  +  R+   P 
Sbjct: 16184 SFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPK 16243

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEA 678
                T  +   E    +  + G P              + W    Q               
Sbjct: 16244 YKDTIVVHAGESFKVDADIYGKPIP-----------TIQWIKGDQE-------------- 16278

Query: 679   GTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDI 738
                N  R+  +    +   ++ D     S  + ++  N AG         VTV    LD 
Sbjct: 16279 -LSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAG------ERSVTVNVKVLDR 16331

Query: 739   PKAP-GKIIPSRNTDTSVVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSR 795
             P  P G ++ S  T     ++W+        +++ Y +E        W   + N V+   
Sbjct: 16332 PGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDAN-VQTLS 16390

Query: 796   FTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPC-DITCLESFRDSM 854
                  L+ G  Y FR+ AVN  G+ E  +    +     + P +P   ++T +   +DSM
Sbjct: 16391 CKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVT--KDSM 16448

Query: 855   VLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQ 914
             ++ W++P   GG+EI GY +  R+  +G+  +W   + + + E   +++ L EN  Y+F+
Sbjct: 16449 IVVWERPASDGGSEILGYVLEKRDK-EGI--RWTRCHKRLIGELRLRVTGLIENHDYEFR 16505

Query: 915   VAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPV 974
             V+A N AGL  PS  S   K  +  I  PGPP++ K  ++ + S+ L W  P++ G   +
Sbjct: 16506 VSAENAAGLSEPSPPSAYQKACD-PIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEI 16564

Query: 975   TGYFVDLKEAKAKEDQWRGLNE-AAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDL 1033
              GY V+  +    E  W        I    ++V  L E   Y FR+ AIN+AGVG+ +D+
Sbjct: 16565 QGYIVEKCDVSVGE--WTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADV 16622

Query: 1034  AGPVVAETRPGTKEV--------VVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDS 1085
              GP++ E +    ++        ++N+   G + L F   K  P  E  W K      D+
Sbjct: 16623 PGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRL-FVPIKGRPTPEVKWGKVDGEIRDA 16681

Query: 1086  PRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKF 1145
               ++V S  + T +   ++   D G Y+  + ++ G  S+++       R+L        
Sbjct: 16682 AIIDVTS--SFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFV-----TVRVL------DT 16728

Query: 1146  PTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKV-NYIFNEKEIFEGPKYKMHIDRNTGI 1204
             P+ PV   L V  + K  V    +   L G +K+ NYI  ++E     K    +  N   
Sbjct: 16729 PSPPV--NLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATR--KSYAAVVTNCHK 16784

Query: 1205  IEMFMEKLQDEDEG-TYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPH 1263
                 +++LQ   EG +Y F++    A N   + L       + K AE           P 
Sbjct: 16785 NSWKIDQLQ---EGCSYYFRV---TAENEYGIGLPAQTADPI-KVAEV----------PQ 16827

Query: 1264  FVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTL--LITE 1321
                 ++ +     +V L          + I+ Y  E +    EK      + +L  +IT 
Sbjct: 16828 PPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVITN 16887

Query: 1322  FSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSA------TDLKIQST 1375
              ++ +  ++ V+  +++G+   R   V    K+L++E   K A S+       DLKI+  
Sbjct: 16888 LTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVP 16947

Query: 1376  AEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKY 1433
               G    +          + W+ +G  ++ + R+    + +   L I E   +D G+Y
Sbjct: 16948 ISGRPKPT----------ITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQY 16995



 Score =  213 bits (541), Expect = 2e-54
 Identities = 172/632 (27%), Positives = 276/632 (43%), Gaps = 62/632 (9%)

Query: 505   EIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPV 564
             ++   P  P  V  ++  ++   I W++P  DGGS I GY ++    G++ WS C  T V
Sbjct: 18986 KVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTC--TQV 19043

Query: 565   KFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQ 624
             K     ++GL  G  Y+FRV AVN+ G   P ++  PV A D      +K     P+   
Sbjct: 19044 KTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARD----IEIKPSVELPFHTF 19099

Query: 625   IIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQ 684
              +   E+            + V    R    ++W+  GQ                 +   
Sbjct: 19100 NVKAREQ----------LKIDVPFKGRPQATVNWRKDGQT---------------LKETT 19134

Query: 685   RVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGK 744
             RVN          ++ + ++     + +  SNSAG    S    +T++   LD P  PG 
Sbjct: 19135 RVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAG----SITVPITII--VLDRPGPPGP 19188

Query: 745   IIPSRNTDTSVVVSWE--ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLV 802
             I     +  S+ +SW   E     ++  Y +E     S  W    +  V  +      L 
Sbjct: 19189 IRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWH-IVSQAVARTSIKIVRLT 19247

Query: 803   TGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPD 862
             TG  Y FRV A N  G S YS +S A+  +   +PP PP     + + + +M++ W+ P 
Sbjct: 19248 TGSEYQFRVCAENRYGKSSYS-ESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPV 19306

Query: 863   KIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAG 922
               GG+ + GY++ Y+E    +   W +AN   +++   K+S L E ++Y+++V A N+AG
Sbjct: 19307 NDGGSRVIGYHLEYKERSSIL---WSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAG 19363

Query: 923   LGAPSAVSECFK-CEEWTIAVP-GPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVD 980
             +G      +C K CE      P  PP   + + + + S+ L+W  P + G   +TGY V+
Sbjct: 19364 IG------KCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVE 19417

Query: 981   LKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQA-GVGKPSDLAGPVVA 1039
              +E    + +W   N   I+  Y +V  L E   Y FRV A N A  V +PS+  GP++ 
Sbjct: 19418 RRE--LPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIV 19475

Query: 1040  ETRPGTKEVVVNVDDDGVI------SLNFECD-KMTPKSEFSWSKDYVSTEDSPRLEVES 1092
             +       V+++V    VI       L    D    P    SW+KD +  E+  R E+ S
Sbjct: 19476 KDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIIS 19535

Query: 1093  KGNKTKMTFKDLGMDDLGIYSCDVTDTDGIAS 1124
               N T +T KD    D G Y   + +  G  S
Sbjct: 19536 TDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRS 19567



 Score =  211 bits (538), Expect = 3e-54
 Identities = 175/691 (25%), Positives = 307/691 (44%), Gaps = 71/691 (10%)

Query: 513   PLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVT 572
             P +V+  + +K+ + +SW+QPA DGGS I GY +++ ++    W++ + T V   +F ++
Sbjct: 20466 PRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIIS 20525

Query: 573   GLIEGRSYIFRVRAVNKMG-IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEE 631
             GL +   Y FRV A N +G I  PS V  P+  +D              + G +I    E
Sbjct: 20526 GLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDS-------------YGGPVIDLPLE 20572

Query: 632   PSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELP 691
              +E +     T + +         +S KP        I ++ +  E  T     V     
Sbjct: 20573 YTEVVKYRAGTSVKLRAG------ISGKPAPT-----IEWYKDDKELQTNALVCVENTTD 20621

Query: 692   VKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRN- 750
             + S    + D     S C+ ++  N+ G      +   T+    LD P  PG  I  +  
Sbjct: 20622 LAS--ILIKDADRLNSGCYELKLRNAMG------SASATIRVQILDKPGPPGGPIEFKTV 20673

Query: 751   TDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYI 808
             T   + + W    D    ++  Y +E        W   + + ++    T   ++ G  YI
Sbjct: 20674 TAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEH-LEECIITTTKIIKGNEYI 20732

Query: 809   FRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAE 868
             FRVRAVN  G+ E   +S+++  K A   P PP      +  ++SM + W +P   GG++
Sbjct: 20733 FRVRAVNKYGIGE-PLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSD 20791

Query: 869   ITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSA 928
             I+GY++  R   D     W +   + + +   K++ L EN  YQ++V A+N AG G  S 
Sbjct: 20792 ISGYFLEKR---DKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSE 20848

Query: 929   VSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKE 988
              SE +K  +  I  PGPP  ++ ++  K S+ L W  PV+ G + VTGY V++++ +  E
Sbjct: 20849 PSEFYKAAD-PIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGE--E 20905

Query: 989   DQWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKE 1047
             ++W  ++ +  ++     V  LK GV+Y FRV A+N AG G+P ++  PV A+      E
Sbjct: 20906 EEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPE 20965

Query: 1048  ----------VVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKT 1097
                       V+    +D  + + F   K  P    +W KD  +     R  +E+  + +
Sbjct: 20966 IDLDVALRTSVIAKAGEDVQVLIPF---KGRPPPTVTWRKDEKNLGSDARYSIENTDSSS 21022

Query: 1098  KMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVE 1157
              +T   +  +D G Y   + +  G   S  +  + L             T     +L V+
Sbjct: 21023 LLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVL------------DTPAACQKLQVK 21070

Query: 1158  ILEKGQVRFWMQAEKLSGNAK-VNYIFNEKE 1187
              + +G V        + G +  +NY+  +++
Sbjct: 21071 HVSRGTVTLLWDPPLIDGGSPIINYVIEKRD 21101



 Score =  208 bits (529), Expect = 4e-53
 Identities = 198/729 (27%), Positives = 309/729 (42%), Gaps = 80/729 (10%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P  P  +  ++  ++ + +SW++P  DGGS ILGY ++    G+D W+ C    VK    
Sbjct: 15744 PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATC--ATVKVTEA 15801

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALD----PAEKARLKSRPSAPWTGQI 625
              +TGLI+G  Y FRV A N+ GI  P ++S PV A D    PA K           T  +
Sbjct: 15802 TITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFN-------TFTV 15854

Query: 626   IVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQR 685
             +  E+   +    G PT             ++W                K     +   R
Sbjct: 15855 LAGEDLKVDVPFIGRPTP-----------AVTW---------------HKDNVPLKQTTR 15888

Query: 686   VNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKI 745
             VN E    +    + D        + V+ +NSAG  E  E   V V+ DK   P  P K+
Sbjct: 15889 VNAESTENNSLLTIKDACREDVGHYVVKLTNSAG--EAIETLNVIVL-DKPGPPTGPVKM 15945

Query: 746   IPSRNTDTSVVVSWEESK--DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVT 803
                  T  S+ +SW   K      +  Y +E     +  W+  +    + +   C  L T
Sbjct: 15946 --DEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACR-LKT 16002

Query: 804   GQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDK 863
             G  Y FR+ A N  G S Y  +SE    +     P PP       S RDSM + W +P  
Sbjct: 16003 GCEYQFRIAAENRYGKSTYL-NSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPIS 16061

Query: 864   IGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 923
              GG+ + GY++  +E    +   W + N   + +  +K + L+E + Y+F+V+A N+ G+
Sbjct: 16062 DGGSRVIGYHLERKERNSIL---WVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGI 16118

Query: 924   GAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE 983
             G PS VSEC+   +     PG P ++    V ++S+ LQWK P + G + +TGY V+ KE
Sbjct: 16119 GKPSKVSECYVARD-PCDPPGRPEAII---VTRNSVTLQWKKPTYDGGSKITGYIVEKKE 16174

Query: 984   AKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGV-GKPSDLAGPVVA--E 1040
                 E +W   +   I + + +V GL E   Y FRV A N AGV  +PS+  G + A  E
Sbjct: 16175 LP--EGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDE 16232

Query: 1041  TRPGTKEVVVNVDDDGVISL--NFECDKMT---PKSEFSWSKDYVSTEDSPRLEVESKGN 1095
               P    +     D  V+    +F+ D      P     W K      ++ RLE++S   
Sbjct: 16233 VDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDF 16292

Query: 1096  KTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELA 1155
              T ++ KD    D G Y     +  G   S  ++ + L R          P  P    + 
Sbjct: 16293 ATSLSVKDAVRVDSGNYILKAKNVAG-ERSVTVNVKVLDR----------PGPPEGPVVI 16341

Query: 1156  VEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDE 1215
               +  +     W    +  G+  +NYI   +E          +D N   +   + KL + 
Sbjct: 16342 SGVTAEKCTLAWKPPLQDGGSDIINYIVERRE--TSRLVWTVVDANVQTLSCKVTKLLEG 16399

Query: 1216  DEGTYTFQL 1224
             +E  YTF++
Sbjct: 16400 NE--YTFRI 16406



 Score =  207 bits (527), Expect = 7e-53
 Identities = 166/636 (26%), Positives = 271/636 (42%), Gaps = 72/636 (11%)

Query: 510  PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
            P  PL+V   + N+  + ++W+ P  DGG+ I  Y I+  +  +  W        +    
Sbjct: 6886 PGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSA 6945

Query: 570  PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
             VT ++EG+ Y FRVRA N++G+G PS  +  V   DP E+                   
Sbjct: 6946 TVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIER------------------- 6986

Query: 630  EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNT 688
                    P PP +L+ ++ T+S V L W+PP + G   I+ Y +E+CE G +NW R N 
Sbjct: 6987 --------PSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNM 7038

Query: 689  ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPS 748
            +L V    + +  L +G  Y +RV   N AGV +PSE        D    P         
Sbjct: 7039 KL-VPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEP--------- 7088

Query: 749  RNTDTSVVVSWEESKDAKE-LVGYYIEASVAGSGKWEP----CNNNPV--KGSRFTCHGL 801
                    +     KD  E +V   I   V  +G   P    C  + V   G R     L
Sbjct: 7089 -------TMDLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTL 7141

Query: 802  VTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKA-----AIAPPSPPCDITCLESFRDSMVL 856
                  +      +  G+     ++    +        IA PS P ++   +  +DS+ L
Sbjct: 7142 SAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHL 7201

Query: 857  GWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVA 916
             W+ PD  GG+ +TGY V  REV       W +  +  V++  + + +L +   Y F+V 
Sbjct: 7202 TWEPPDDDGGSPLTGYVVEKREVSRKT---WTKV-MDFVTDLEFTVPDLVQGKEYLFKVC 7257

Query: 917  AMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTG 976
            A N  G G P+ V E          VP PP ++K  +   +S+ L W PP + G + + G
Sbjct: 7258 ARNKCGPGEPAYVDEPVNMST-PATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKG 7316

Query: 977  YFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGP 1036
            Y V+        D+W    E  +    ++V GL+EG  Y +RV+A+N+ G  KPS     
Sbjct: 7317 YIVE--RCPRGSDKWVACGEP-VAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEE 7373

Query: 1037 VVAETRPGTKEVVVNVDDDGVISLN----FECDKMT---PKSEFSWSKDYVSTEDSPRLE 1089
            + A       E+ ++V     +++      E        P+ + +W+K  +  +   R+ 
Sbjct: 7374 IQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRIT 7433

Query: 1090 VESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1125
            +E+   K+ +T  D    D G Y  +  +  G A++
Sbjct: 7434 IENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATA 7469



 Score =  207 bits (527), Expect = 7e-53
 Identities = 186/678 (27%), Positives = 300/678 (44%), Gaps = 67/678 (9%)

Query: 523   KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIF 582
             ++ + + WK+PA DGGS I GY ++K ++    W + + T V    F V+GL+E + Y F
Sbjct: 18311 RNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEF 18370

Query: 583   RVRAVNKMG-IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPP 641
             RV A N  G    PS  S  + A D  +       P       +   E    E  + G P
Sbjct: 18371 RVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKP 18430

Query: 642   TDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFD 701
                 V           W   G+         +E+  A      R+  +  ++     + D
Sbjct: 18431 IPDVV-----------WSKDGKE--------LEETAA------RMEIKSTIQKTTLVVKD 18465

Query: 702   LAEGKSYCFRVRCSNSAGVGEPSEATEVTV-VGDKLDIPKAPGKIIPSRNTDTSVVVSWE 760
                     + ++ SN  G    +++  +TV V D+   P+ P K+  +  T     ++W 
Sbjct: 18466 CIRTDGGQYILKLSNVGG----TKSIPITVKVLDRPGPPEGPLKV--TGVTAEKCYLAWN 18519

Query: 761   ES-KDAKELVGYYI-EASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAG 818
                +D    + +YI E        W   +   V+   +    L+ G  YIFRV AVN  G
Sbjct: 18520 PPLQDGGANISHYIIEKRETSRLSWTQVSTE-VQALNYKVTKLLPGNEYIFRVMAVNKYG 18578

Query: 819   LSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYRE 878
             + E   +S  +       PP PP         +DSMV+ W +P   GG EI GY +  R+
Sbjct: 18579 IGE-PLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRD 18637

Query: 879   VIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEW 938
               +GV  +W + N K +++   +++ L E   Y+F+VAA N AG+G PS  S  ++  + 
Sbjct: 18638 K-EGV--RWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACD- 18693

Query: 939   TIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN-EA 997
              +  PGPP + K ++  + S+ L W  P++ G  PV GY V++KEA A  D+W       
Sbjct: 18694 ALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAA--DEWTTCTPPT 18751

Query: 998   AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGV 1057
              ++     V  LKE   Y FR+ AIN  GVG+P+ L G VVA+ R    E+ ++ D   V
Sbjct: 18752 GLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKV 18811

Query: 1058  ISLN-------FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLG 1110
             + L        F   K  P+ E  W K      D  ++EV S  + T +   ++   D G
Sbjct: 18812 VVLRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTS--SFTMLVIDNVTRFDSG 18869

Query: 1111  IYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQA 1170
              Y+  + +  G  ++++       R+L        P+ PV   L +  ++K  V    + 
Sbjct: 18870 RYNLTLENNSGSKTAFV-----NVRVL------DSPSAPV--NLTIREVKKDSVTLSWEP 18916

Query: 1171  EKLSGNAKV-NYIFNEKE 1187
               + G AK+ NYI  ++E
Sbjct: 18917 PLIDGGAKITNYIVEKRE 18934



 Score =  207 bits (526), Expect = 8e-53
 Identities = 224/876 (25%), Positives = 354/876 (40%), Gaps = 114/876 (13%)

Query: 274   LHAPEFIIKP---RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIES 330
             L  PE I+     R   +   + ++L   I G P P+VTW K          P K  I+ 
Sbjct: 10908 LEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKED-----RDAPTKARIDV 10962

Query: 331   RYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPL 390
                   LEI     ED   Y  +  N  G  +    V+V    G              P 
Sbjct: 10963 TPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGP-------------PR 11009

Query: 391   SFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPL 450
                V+            + + D  +    E +  G  V+    ++              +
Sbjct: 11010 DLEVS------------EIRKDSCYLTWKEPLDDGGSVITNYVVERRD-----------V 11046

Query: 451   SPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGA- 509
             + ++W     + ++ +    HLN+ ++ L+ +         QY    FV +    I+   
Sbjct: 11047 ASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAE-----NQYGRGPFV-ETPKPIKALD 11100

Query: 510   ----PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVK 565
                 P  P D+  ++ +K  + + W +P  DGGSPI GY ++  E GT  W +     V 
Sbjct: 11101 PLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKT--VT 11158

Query: 566   FARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQI 625
                  VTGL +G++Y FRV+A N +G+G P           P E       PS     ++
Sbjct: 11159 NLECVVTGLQQGKTYRFRVKAENIVGLGLPDTTI-------PIECQEKLVPPSVELDVKL 11211

Query: 626   IVTEEEPSEGIVPGPPTDLSVTEATRSYVV--LSWKPPGQRGHEGIMYFVEKCEAGTENW 683
             I       EG+V    T +      R   V    W   G        Y VE     T+N+
Sbjct: 11212 I-------EGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVE-----TDNF 11259

Query: 684   QRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAP- 742
               V   L +K+      D  E     +++  SN+AG    + A  +TV    LD+P  P 
Sbjct: 11260 SSV---LTIKN--CLRRDTGE-----YQITVSNAAG--SKTVAVHLTV----LDVPGPPT 11303

Query: 743   GKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHG 800
             G I     T   + +SW+  KD     ++ Y +E        W   ++   K      H 
Sbjct: 11304 GPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPH- 11362

Query: 801   LVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQ 860
             L  G  Y+FRVRA N  G+     DS     K   +PPSPP      +   ++  + W  
Sbjct: 11363 LQKGCEYVFRVRAENKIGVGP-PLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTL 11421

Query: 861   PDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNM 920
             P   GG+ ITGYY+  REV     GKW   N   +++  ++++ L E   Y+F+V A N+
Sbjct: 11422 PKSDGGSPITGYYMERREVT----GKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENL 11477

Query: 921   AGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVD 980
             AGL  PS  S+  K     I  PGPP + K  +  +++  L W  P+  G +P+ GY V+
Sbjct: 11478 AGLSKPSPSSDPIKACR-PIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVE 11536

Query: 981   LKEAKAKEDQWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA 1039
              +  K    QW  +N +  I+    +V GL EG  Y FR++A N  G G+P +LA  V+A
Sbjct: 11537 CQ--KPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIA 11594

Query: 1040  ETRPGTKEVVVNVDDDGVISLN-------FECDKMTPKSEFSWSKDYVSTEDSPRLEVES 1092
             +      EV ++V    VI++            K  P+ + +W+K+        R+++  
Sbjct: 11595 KDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQ 11654

Query: 1093  KGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLI 1128
                + ++  K+    D G Y     ++ G A    I
Sbjct: 11655 DLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAI 11690



 Score =  205 bits (522), Expect = 2e-52
 Identities = 185/707 (26%), Positives = 292/707 (41%), Gaps = 122/707 (17%)

Query: 494  SAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGT 553
            +A  FV+ AD  IE  P+ P+++   +  +  + + W+ P  DGGSPILGY I++CE G 
Sbjct: 6973 AATPFVKVADP-IE-RPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGK 7030

Query: 554  DSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARL 613
            D+W +CN   V    + VTGL +G  Y++RV A NK G+  PS +  P+ A D   +  +
Sbjct: 7031 DNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTM 7090

Query: 614  K-------------------------SRPSAPW--------TGQ-------------IIV 627
                                       RP+A W        TG              +I 
Sbjct: 7091 DLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVIS 7150

Query: 628  TEEEPSEGIV----------------------PGPPTDLSVTEATRSYVVLSWKPPGQRG 665
              E   +GI                       P  P +L   + T+  V L+W+PP   G
Sbjct: 7151 PSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDG 7210

Query: 666  HEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPS 724
               +  Y VEK E   + W +V     V    F + DL +GK Y F+V   N  G GEP+
Sbjct: 7211 GSPLTGYVVEKREVSRKTWTKVMDF--VTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPA 7268

Query: 725  EATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGK 782
               E   +     +P  P  +     T  S+ ++W+  K+     + GY +E    GS K
Sbjct: 7269 YVDEPVNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDK 7328

Query: 783  WEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPC 842
            W  C   PV  ++    GL  G+ Y +RV+A+N  G S+ S+ +E  E++A     +P  
Sbjct: 7329 WVAC-GEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTE--EIQAVDTQEAP-- 7383

Query: 843  DITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPG---KWREANVKAVSEEA 899
                 E F D  +L        G     G  +     + G P     W +A++    ++ 
Sbjct: 7384 -----EIFLDVKLLA-------GLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKR 7431

Query: 900  YKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKC----EEWTIAVPGPPHSLKCSEVR 955
              I N+ +        +  +  G     AV+ C +     E   +  PGPP +   ++V 
Sbjct: 7432 ITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVT 7491

Query: 956  KDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSY 1015
             +S +L W PP   G + +T Y V+ +   +  + W  L+ + +K+   K   L     Y
Sbjct: 7492 NESCLLTWNPPRDDGGSKITNYVVERRATDS--EVWHKLS-STVKDTNFKATKLIPNKEY 7548

Query: 1016 VFRVRAINQAGVGKPSDLAGPVVAETR---PG----------TKEVVV----NVDDDGVI 1058
            +FRV A N  GVG+P   A P+ A+ +   PG          TK+ V       DDDG  
Sbjct: 7549 IFRVAAENMYGVGEPVQ-ASPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGS 7607

Query: 1059 SL-NFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDL 1104
             +  +  +++ P ++  W +            V+   NK K  F+ L
Sbjct: 7608 PITGYWVERLDPDTD-KWVRCNKMPVKDTTYRVKGLTNKKKYRFRVL 7653



 Score =  205 bits (522), Expect = 2e-52
 Identities = 228/940 (24%), Positives = 353/940 (37%), Gaps = 152/940 (16%)

Query: 288   VWEKENVKLHCSIAGWPEPRVTWYK-------NQVPINVHANPGKYIIESRYGMHTLEIN 340
             V E  NV +   I G P P +TW+K       N+ P+    +  K +++      TL I 
Sbjct: 9823  VEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTC---TLVIP 9879

Query: 341   GCDFEDTAQYRASAMNVKGELSAYASV-VVKRYKGEFDETRFHA-GASTMPLSFGVTPYG 398
                  DT  Y  +A+N  G  S    + V+ R        +F +  A  M LS+      
Sbjct: 9880  QSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDD 9939

Query: 399   YASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQT 458
               S+   +  +K      RE    +                               WV  
Sbjct: 9940  GGSKITNYVIEK------REANRKT-------------------------------WVHV 9962

Query: 459   LWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGA------PAA 512
                 +  T T   L +  E ++ I  +        + Y      D+E E A      P A
Sbjct: 9963  SSEPKECTYTIPKLLEGHEYVFRIMAQ--------NKYGIGEPLDSEPETARNLFSVPGA 10014

Query: 513   PLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKF----AR 568
             P         ++ + ++W++P  DGGSP+ GY+++  +  +  W + N  P+K       
Sbjct: 10015 PDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVS 10074

Query: 569   FPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVT 628
             + VTGLIEG  Y FRV A+N  G+G  S  S+P  A DP           AP        
Sbjct: 10075 YKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPI----------AP-------- 10116

Query: 629   EEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVN 687
                      PGPP    VT+ T+S   L W PP + G   +  Y VE  E G E W++  
Sbjct: 10117 ---------PGPPFP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEK-G 10165

Query: 688   TELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIP 747
              +  V+  +  +  L EG  Y FRVR  N AG+GEP E T+V  + D+L        + P
Sbjct: 10166 KDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRL--------VSP 10217

Query: 748   SRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKW---------EPCNNNPVKGSRFTC 798
                 D SV             +  Y+      +  W         E         S    
Sbjct: 10218 DLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVI 10277

Query: 799   HGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGW 858
                      ++ + A N AG  + +   + ++V   +  P    ++T      +S  L W
Sbjct: 10278 KNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLT-----NESCKLTW 10332

Query: 859   KQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAM 918
               P+  GG+ IT Y +  RE        W         + A  +  L +   Y F++AA 
Sbjct: 10333 FSPEDDGGSPITNYVIEKRE---SDRRAWTPVTYTVTRQNA-TVQGLIQGKAYFFRIAAE 10388

Query: 919   NMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYF 978
             N  G+G     SE     E  I VP  P  L+  EV K+++ L W PP + G + +  Y 
Sbjct: 10389 NSIGMGPFVETSEALVIRE-PITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYV 10447

Query: 979   VDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVV 1038
             ++ +     E   +  N+  +   Y  V+GLKEG +Y +RV A+N  G GKPS    P+ 
Sbjct: 10448 LESRLI-GTEKFHKVTNDNLLSRKYT-VKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPIT 10505

Query: 1039  AETRPGTKEVVVNVDDDGVISLNFECDKMT------PKSEFSWSKDYVSTEDSPRLEVES 1092
              +       + ++  D   I +  E   +T      PK + SW KD     +  R  +++
Sbjct: 10506 CKDELAPPTLHLDFRDKLTIRVG-EAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKT 10564

Query: 1093  KGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSY----LIDEEELKRLLALSHEHKFPTV 1148
                   +        D G Y   V ++ G    +    ++D                P  
Sbjct: 10565 TPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDR---------------PGP 10609

Query: 1149  PVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEI 1188
             PV      E+ +   V  W       G+   NYI  +KE+
Sbjct: 10610 PVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEV 10649



 Score =  205 bits (521), Expect = 3e-52
 Identities = 203/858 (23%), Positives = 332/858 (38%), Gaps = 114/858 (13%)

Query: 287   TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
             TV   + ++L   + G P P V W K++   ++  +P +  I++R       +      D
Sbjct: 11907 TVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSP-RVKIDTRADSSKFSLTKAKRSD 11965

Query: 347   TAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIH 406
               +Y  +A N  G   AYA+V V    G     +                          
Sbjct: 11966 GGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKI------------------------- 12000

Query: 407   FDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERAT 466
                  DVS  R        C V   P       EIQ Y     L   +  + +WS   AT
Sbjct: 12001 ----VDVSSDR--------CTVCWDPPEDDGGCEIQNYI----LEKCETKRMVWSTYSAT 12044

Query: 467   L-----TFSHLNKEDEGLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCL 519
             +     T + L + +E ++ +R   ++G      S  V  +    +    P  P   +  
Sbjct: 12045 VLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYDK----PGRPDPPEVT 12100

Query: 520   EANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRS 579
             + +K+ + + W  P  DGG  I GYF++K E  +  W   N + +   R  V  L+    
Sbjct: 12101 KVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHE 12160

Query: 580   YIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPG 639
             Y FRV+A N++GIG PS  S PV A DP E                            PG
Sbjct: 12161 YQFRVKAENEIGIGEPSLPSRPVVAKDPIEP---------------------------PG 12193

Query: 640   PPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCE------AGTENWQRVNTELPVK 693
             PPT+  V + T+  + L W  P   G   I+ +V +        +  E W+R N    + 
Sbjct: 12194 PPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLV 12253

Query: 694   SPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGD-----KLDIPKAPGKIIPS 748
                F +  L E + Y FRV   N  G+G P+E  E     +     ++D+  +  K++  
Sbjct: 12254 RKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVIV 12313

Query: 749   RNTDTSVVVSWEESKDAKELVGYYIEA-SVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSY 807
             R      + +    + A ++    +   +V   G+ +  +                  S 
Sbjct: 12314 RAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAF----LVIPNSTRDDSG 12369

Query: 808   IFRVRAVNAAGLSEYSQDSEAIEVKAAIAP-PSPPCDITCLESFRDSMVLGWKQPDKIGG 866
              + +  VN AG        +A+ V   +   P P  D+   +  + S  + W  P+  GG
Sbjct: 12370 KYSLTLVNPAG-------EKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGG 12422

Query: 867   AEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAP 926
             +++T Y V  RE       K        V + ++ ++NL     Y F+V A+N  G G P
Sbjct: 12423 SQVTHYIVEKREA----DRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVP 12478

Query: 927   SAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKA 986
             + V +     +  ++ P PP  L+ +E+ K+S  L W PP+  G   + GY    +E + 
Sbjct: 12479 TDVPKPVLASD-PLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQ 12537

Query: 987   KEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTK 1046
               D+W     + +K++ L V GLKEG  Y FRV A N  GV  P +  G   A+ +    
Sbjct: 12538 PADRWT--EYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPP 12595

Query: 1047  EVVV--NVDDDGVISLNFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKD 1103
             ++++   +       L  E      P     W K       S  L V    + + +  KD
Sbjct: 12596 KILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKD 12655

Query: 1104  LGMDDLGIYSCDVTDTDG 1121
             +   D G YS    ++ G
Sbjct: 12656 VTRKDSGYYSLTAENSSG 12673



 Score =  205 bits (521), Expect = 3e-52
 Identities = 227/934 (24%), Positives = 381/934 (40%), Gaps = 151/934 (16%)

Query: 287   TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
             T+    ++ L  ++ G PEP++ W K    +++     K  ++      T  I  CD  D
Sbjct: 22753 TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCE---KVSLQYTGKRATAVIKFCDRSD 22809

Query: 347   TAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIH 406
             + +Y  +  N  G  +    V V    G                     P G  +   + 
Sbjct: 22810 SGKYTLTVKNASGTKAVSVMVKVLDSPG---------------------PCGKLTVSRVT 22848

Query: 407   FDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERAT 466
               +K  +++    E            EI H+  E +        S   WV  +  GE  T
Sbjct: 22849 -QEKCTLAWSLPQEDGGA--------EITHYIVERR------ETSRLNWV--IVEGECPT 22891

Query: 467   LTF--SHLNKEDEGLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEAN 522
             L++  + L K +E ++ +R   + G      S  +  R++   I   P  P +V      
Sbjct: 22892 LSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFT-IPSPPGIPEEVG---TG 22947

Query: 523   KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCN-DTPVKFARFPVTGLIEGRSYI 581
             K++III W +P  DGG+ I  Y +DK E  +  W++ N D  V   R  VT L+EG  Y 
Sbjct: 22948 KEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQ 23007

Query: 582   FRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPP 641
             FRV AVN  G   PS  S  ++  +P+                             PGPP
Sbjct: 23008 FRVTAVNAAGNSEPSEASNFISCREPS---------------------------YTPGPP 23040

Query: 642   TDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALF 700
             +   V + T+  + L+W KP    G + + Y +E  E  T+ W RV+T   +++  F + 
Sbjct: 23041 SAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVP 23100

Query: 701   DLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE 760
             DL  G+ Y FRV   N  G+ E SE+       ++++IP                    E
Sbjct: 23101 DLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIP------------------DLE 23142

Query: 761   ESKDAKELV----GYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLV-TGQSY-IFRVRAV 814
              + D K+ V    G  +   V+ SG+  P      +G       ++ T +SY +  V  V
Sbjct: 23143 LADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSLLIVDKV 23202

Query: 815   NAAGLSEYSQDSE-------AIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGA 867
             N     +Y+ ++E       A  +      P P   +   E  RDS+ + W+ P   GGA
Sbjct: 23203 NRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGA 23262

Query: 868   EITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPS 927
              +  Y V  RE        ++    K  S+  Y+IS L E  +Y F+V   N+ G+G P 
Sbjct: 23263 PVNNYIVEKRE---AAMRAFKTVTTKC-SKTLYRISGLVEGTMYYFRVLPENIYGIGEPC 23318

Query: 928   AVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAK 987
               S+     E    VP  P  L+  +V K ++ L W+ P++ G + +TGY   L+  KA 
Sbjct: 23319 ETSDAVLVSE----VPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYV--LEACKAG 23372

Query: 988   EDQWRGLNEAAIKNVYLK--VRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAE----- 1040
              ++W  +    +K   L+  V  L EG  Y+FR+RA N+ GV +P +    V  +     
Sbjct: 23373 TERW--MKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLRVL 23430

Query: 1041  ------TRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKG 1094
                   T P   +  ++V     + L        P +  SW        +S R+ VE+  
Sbjct: 23431 PTIDLSTMP---QKTIHVPAGRPVELVIPIAGRPPPAA-SWFFAGSKLRESERVTVETHT 23486

Query: 1095  NKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSEL 1154
                K+T ++  + D G Y+ ++ +  G  S       E  +++ L      PT P+K   
Sbjct: 23487 KVAKLTIRETTIRDTGEYTLELKNVTGTTS-------ETIKVIILDKPGP-PTGPIK--- 23535

Query: 1155  AVEILEKGQVRFWMQAEKLSGNAKVN-YIFNEKE 1187
              ++ ++   +    +  +L G A ++ Y+  +++
Sbjct: 23536 -IDEIDATSITISWEPPELDGGAPLSGYVVEQRD 23568



 Score =  204 bits (519), Expect = 6e-52
 Identities = 185/698 (26%), Positives = 293/698 (41%), Gaps = 86/698 (12%)

Query: 508   GAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFA 567
             G P  P + +     KD +++ W  P  DGGS I+ Y +++ +     W +CN   +   
Sbjct: 15348 GPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDL 15407

Query: 568   RFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIV 627
             R+ V+GL EG  Y FR+ A N  GI  PS  S    A D   K                 
Sbjct: 15408 RYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFK----------------- 15450

Query: 628   TEEEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRV 686
                       PGPP +  V + +RS + ++W KP    G E   Y VE      + WQ V
Sbjct: 15451 ----------PGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIV 15500

Query: 687   NTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKII 746
                  +K+  + +  L E + Y  R+   NS G+GEP+      V G     PKA  +++
Sbjct: 15501 TPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPA-----LVPGT----PKAEDRML 15551

Query: 747   PSR---NTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVT 803
             P     + D   VV+       +  V   I+   A   KW   +   +  +        T
Sbjct: 15552 PPEIELDADLRKVVTIRACCTLRLFVP--IKGRPAPEVKWARDHGESLDKASIES----T 15605

Query: 804   GQSYIFRVRAVNAAGLSEY------SQDSEAIEVKAAIAP-PSPPCDITCLESFRDSMVL 856
                 +  V  VN     +Y      S  S++  V   +   P PP D+   E  + S+ L
Sbjct: 15606 SSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTL 15665

Query: 857   GWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVA 916
              W  P   GG++I  Y V  RE       K          + ++K+  L+E   Y F+V 
Sbjct: 15666 TWDPPLLDGGSKIKNYIVEKRESTR----KAYSTVATNCHKTSWKVDQLQEGCSYYFRVL 15721

Query: 917   AMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTG 976
             A N  G+G P+  +E  K  E     P PP  +   +V ++S+ L W+ P H G + + G
Sbjct: 15722 AENEYGIGLPAETAESVKASER----PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILG 15777

Query: 977   YFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGP 1036
             Y V+++   +  D+W     A +K     + GL +G  Y FRV A N+ G+  P  L+ P
Sbjct: 15778 YIVEMQTKGS--DKWATC--ATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVP 15833

Query: 1037  VVAETR--PGTKEVVVNV-----DDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLE 1089
             V+A+    P   +++ N       +D  + + F   + TP    +W KD V  + + R+ 
Sbjct: 15834 VIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPF-IGRPTPA--VTWHKDNVPLKQTTRVN 15890

Query: 1090  VESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVP 1149
              ES  N + +T KD   +D+G Y   +T++ G A        E   ++ L      PT P
Sbjct: 15891 AESTENNSLLTIKDACREDVGHYVVKLTNSAGEAI-------ETLNVIVLDKPGP-PTGP 15942

Query: 1150  VKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1187
             VK +   E+        W   +   G++  NYI  +++
Sbjct: 15943 VKMD---EVTADSITLSWGPPKYDGGSSINNYIVEKRD 15977



 Score =  204 bits (519), Expect = 6e-52
 Identities = 178/675 (26%), Positives = 276/675 (40%), Gaps = 94/675 (13%)

Query: 405   IHFDDKF-DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGE 463
             +  D KF DV   + GE + +   +   P      P I W ++G+ +      + + +  
Sbjct: 19484 VMMDVKFRDVIVVKAGEVLKINADIAGRP-----LPVISWAKDGIEIEERARTEIISTDN 19538

Query: 464   RATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANK 523
                LT     + D G Y + ++        +    V D      G PA PL++  L A K
Sbjct: 19539 HTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKP----GPPAGPLEINGLTAEK 19594

Query: 524   DYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFR 583
                 +SW +P  DGG+ I  Y ++K E    +W+ C +  ++     VT L++G  YIFR
Sbjct: 19595 --CSLSWGRPQEDGGADIDYYIVEKRETSHLAWTIC-EGELQMTSCKVTKLLKGNEYIFR 19651

Query: 584   VRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTD 643
             V  VNK G+G P   S  + ALDP                             VP PPT 
Sbjct: 19652 VTGVNKYGVGEPLE-SVAIKALDPFT---------------------------VPSPPTS 19683

Query: 644   LSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDL 702
             L +T  T+  + L W +P    G E   Y +E+ E  +  W RVN + PV   R     L
Sbjct: 19684 LEITSVTKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKK-PVYDLRVKSTGL 19742

Query: 703   AEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES 762
              EG  Y +RV   N+AG+  PSE + +    D + +P  P K     +  T++ ++W + 
Sbjct: 19743 REGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKP 19802

Query: 763   --KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLS 820
                    + GY +E   +    W+  +   ++G+ +T  GL TG  Y+FRV++VN  G S
Sbjct: 19803 LFDGGAPITGYTVEYKKSDDTDWK-TSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGAS 19861

Query: 821   EYSQDSEAIEVKAAIAPPSPPCD--------------ITCLESFRDSMV--LGWKQPDKI 864
             + S  S+    K     P    D               T    FR   V  + W +PD  
Sbjct: 19862 DPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDT- 19920

Query: 865   GGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLG 924
                      +  R  +D              S  +  I N   N   ++ +   N+    
Sbjct: 19921 --------DLRTRAYVDTTD-----------SRTSLTIENANRNDSGKYTLTIQNVLSAA 19961

Query: 925   APSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEA 984
             + + V +        +  PGPP ++   +V K+S VL W  P + G  PV  Y ++ +EA
Sbjct: 19962 SLTLVVK-------VLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKREA 20014

Query: 985   KAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPG 1044
               K   W  +     +  Y KV  L+EG  Y FRV   N+ GVG P++    V    +P 
Sbjct: 20015 SKK--AWVSVTNNCNRLSY-KVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVKITEKPS 20071

Query: 1045  TKEV--VVNVDDDGV 1057
               E   V ++  D V
Sbjct: 20072 PPEKLGVTSISKDSV 20086



 Score =  204 bits (519), Expect = 6e-52
 Identities = 179/742 (24%), Positives = 308/742 (41%), Gaps = 84/742 (11%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P  P + +  +  +  + ++W  P  +GGS + GY I+  +V    W++CN TP K   +
Sbjct: 23728 PGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREY 23787

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              +T L +G  Y FRV A N  G G P+ V   V   +  E    +              +
Sbjct: 23788 TLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYE-------------LD 23834

Query: 630   EEPSEGIV--PGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVN 687
             E   EGI    G    L++    + + +  W   GQ   +  M    +           +
Sbjct: 23835 ERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSE----------TH 23884

Query: 688   TELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAP-GKII 746
             TEL +K       +   G S  + +   N  G  + +   +V V+G     P +P G + 
Sbjct: 23885 TELVIK-------EADRGDSGTYDLVLENKCG--KKAVYIKVRVIGS----PNSPEGPLE 23931

Query: 747   PSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTG 804
                    SV VSW    D    +++GY +E        W   ++  V+G+     GL   
Sbjct: 23932 YDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSR-VRGTSLVVKGLKEN 23990

Query: 805   QSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDIT-CLESFRDSMVLGWKQPDK 863
               Y FRV A N  G+S+  +  E +  K  + PP PP +    L+  + S+ L W +P  
Sbjct: 23991 VEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKD 24050

Query: 864   IGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 923
              GG+ +TGYY+  +E       KW   N   ++   Y ++ L  +  YQF++ A N  GL
Sbjct: 24051 DGGSRVTGYYIERKETSTD---KWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGL 24107

Query: 924   GAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE 983
                S  SE   C++     P  P  L+   + KDS+ LQW+ P   G   + GY+V+ ++
Sbjct: 24108 SETSPASEPVVCKD-PFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQ 24166

Query: 984   AKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPV----VA 1039
               + +  W+  N+  IK+    + GL E   Y FRV A N+ G+ +P   A  +     +
Sbjct: 24167 --SGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTS 24224

Query: 1040  ETRPGTKEVVVNVDDDGVISLNFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKGNKTK 1098
                PG ++ + +V      +    C  +  P  +  W +       S + ++ S G    
Sbjct: 24225 GEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHT 24284

Query: 1099  MTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVK------- 1151
             +T      +D G+Y+C       IA++ + + E   +LL  +     P  P+K       
Sbjct: 24285 LTVMTEEQEDEGVYTC-------IATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAV 24337

Query: 1152  -SELAVEILEKGQ---VRFWMQAEKLSGNAKVNYIFNEKEI-----------FEGPKYKM 1196
              S L + ++  G+      W   +KL  N++   I N +                 KYK+
Sbjct: 24338 GSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKV 24397

Query: 1197  HIDRNTGIIEMFME-KLQDEDE 1217
              +    G ++  ++ ++QD+ +
Sbjct: 24398 QLSNVFGTVDAILDVEIQDKPD 24419



 Score =  204 bits (518), Expect = 7e-52
 Identities = 183/705 (25%), Positives = 300/705 (42%), Gaps = 98/705 (13%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVK-FAR 568
             P AP      E  KD  +++W +P  DGG PI  Y ++K E  +  W++    P+  + +
Sbjct: 10707 PDAPDQPIVTEVTKDSALVTWNKPH-DGGKPITNYILEKRETMSKRWARVTKDPIHPYTK 10765

Query: 569   FPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVT 628
             F V  L+EG  Y FRV A N++GIG PS  S+PV A DP  K                  
Sbjct: 10766 FRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAK------------------ 10807

Query: 629   EEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVN 687
                      P PP +    + T + V L+W+PP   G   I+ Y VE  + G E W+R N
Sbjct: 10808 ---------PSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRAN 10858

Query: 688   TELPVKSP--RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKI 745
                P   P  ++ +  L +G++Y FRV   N+AG  +P+   E  +V D+L+ P+     
Sbjct: 10859 -HTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPE----- 10912

Query: 746   IPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSG------KWEPCNNN-PVK------ 792
                      +++    +++    VG  +  S    G       W+  + + P K      
Sbjct: 10913 ---------LILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVT 10963

Query: 793   --GSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAP-PSPPCDITCLES 849
               GS+            I+ +   N AG       S+ + VK  +   P PP D+   E 
Sbjct: 10964 PVGSKLEIRNAAHEDGGIYSLTVENPAG-------SKTVSVKVLVLDKPGPPRDLEVSEI 11016

Query: 850   FRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENM 909
              +DS  L WK+P   GG+ IT Y V  R+V      +W   +  +  ++++   +L E  
Sbjct: 11017 RKDSCYLTWKEPLDDGGSVITNYVVERRDVASA---QWSPLSATS-KKKSHFAKHLNEGN 11072

Query: 910   VYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHS 969
              Y F+VAA N  G G      +  K  +  +  PGPP  L   +V K  + L W  P   
Sbjct: 11073 QYLFRVAAENQYGRGPFVETPKPIKALD-PLHPPGPPKDLHHVDVDKTEVSLVWNKPDRD 11131

Query: 970   GRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGK 1029
             G +P+TGY V+ +E   ++  W  +    + N+   V GL++G +Y FRV+A N  G+G 
Sbjct: 11132 GGSPITGYLVEYQEEGTQD--W--IKFKTVTNLECVVTGLQQGKTYRFRVKAENIVGLGL 11187

Query: 1030  PSDLAGPVVAETR--PGTKEVVVNVDDDGVISLNFECD-----KMTPKSEFSWSKDYVST 1082
             P D   P+  + +  P + E+ V + +  V+            +  P     W+ D    
Sbjct: 11188 P-DTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEI 11246

Query: 1083  EDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHE 1142
             +      VE+    + +T K+    D G Y   V++  G         + +   L +   
Sbjct: 11247 KTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAG--------SKTVAVHLTVLDV 11298

Query: 1143  HKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1187
                PT P+     +++  +     W   +   G+  +NYI  +++
Sbjct: 11299 PGPPTGPIN---ILDVTPEHMTISWQPPKDDGGSPVINYIVEKQD 11340



 Score =  203 bits (517), Expect = 9e-52
 Identities = 188/683 (27%), Positives = 288/683 (42%), Gaps = 141/683 (20%)

Query: 510  PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
            P  P  +  ++  K ++ + W+ P  DGG PI  Y I+K E     W +   T      F
Sbjct: 7879 PGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNF 7938

Query: 570  PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
             VT +IEG    F+VRA N+ G+G PS  +E ++  DP                      
Sbjct: 7939 RVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSP------------------- 7979

Query: 630  EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNT 688
                    P PP DL VT+A R ++ ++WKPP + G   I+ Y VE C  GTE W RVN+
Sbjct: 7980 --------PSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNS 8031

Query: 689  ELPVKSPRFALFD-LAEGKSYCFRVRCSNSAGVGEPSEATE------------------- 728
              P+K  +F + + +   K Y  RVR  N+ GV EPSE +E                   
Sbjct: 8032 R-PIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHD 8090

Query: 729  -VTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCN 787
             + + G+KL IP  P + +P         VSW   KD KE     ++AS          +
Sbjct: 8091 IIVIEGEKLSIP-VPFRAVPVPT------VSWH--KDGKE-----VKAS----------D 8126

Query: 788  NNPVKGSRFTCH----GLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCD 843
               +K    + H      V   + I+ +   N  G +  S     I VK  I  P P  D
Sbjct: 8127 RLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATAS-----INVKV-IGLPGPCKD 8180

Query: 844  ITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEE---AY 900
            I   +  + S  L W+ P+  GG  I  Y +  RE         R   +  +S E   ++
Sbjct: 8181 IKASDITKSSCKLTWEPPEFDGGTPILHYVLERREA-------GRRTYIPVMSGENKLSW 8233

Query: 901  KISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAV-----PGPPHSLKCSEVR 955
             + +L  N  Y F+V A+N  G G      E  + +   IA      P PP  ++     
Sbjct: 8234 TVKDLIPNGEYFFRVKAVNKVGGG------EYIELKNPVIAQDPKQPPDPPVDVEVHNPT 8287

Query: 956  KDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSY 1015
             +++ + WKPP++ G + + GY ++ K AK  E++W+  NE  +  +    +GL+EG  Y
Sbjct: 8288 AEAMTITWKPPLYDGGSKIMGYIIE-KIAKG-EERWKRCNEHLVPILTYTAKGLEEGKEY 8345

Query: 1016 VFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVV----VNVDDDGVISLNFECDKMTPKS 1071
             FRVRA N AG+ +PS    P  A       +V+    + V     I+L+      +P  
Sbjct: 8346 QFRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDASISG-SPYP 8404

Query: 1072 EFSWSKD----------------------YVSTED------SPRLEVE-SKGNKTKMTFK 1102
              +W KD                       V  E+      + RL ++ SK  ++++  +
Sbjct: 8405 TITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVR 8464

Query: 1103 DLGMDDLGIYSCDVTDTDGIASS 1125
            D    D G+Y   V +  GIA +
Sbjct: 8465 DSLRPDHGLYMIKVENDHGIAKA 8487



 Score =  203 bits (516), Expect = 1e-51
 Identities = 196/779 (25%), Positives = 311/779 (39%), Gaps = 124/779 (15%)

Query: 277   PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
             P   +   ++++   E++K+   + G P P ++W K+  P+       +  +E       
Sbjct: 18007 PSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLK---QTTRVNVEETATSTV 18063

Query: 337   LEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTP 396
             L I   + +D  +Y  +A N  G  +   SV+V    G                     P
Sbjct: 18064 LHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPG--------------------PP 18103

Query: 397   YGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWV 456
              G     E+  D    V    E    + GC++      K       W+     ++     
Sbjct: 18104 VGPVRFDEVSAD---FVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVA----- 18155

Query: 457   QTLWSGERATLTFSHLNKEDEGLYTIRV----RMGEYYEQYSAYVFVRDADAEIEGAPAA 512
                    R T+  + L    E  Y  R+    R G+     S  V V+    E  G P  
Sbjct: 18156 -------RTTIKITKLKTGTE--YQFRIFAENRYGKSAPLDSKAVIVQYPFKE-PGPPGT 18205

Query: 513   PLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVT 572
             P        +KD +++ W +P  DGG+ I+GY +++ E  +  W + N TP++  +F  T
Sbjct: 18206 PF---VTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTT 18262

Query: 573   GLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEP 632
             GL EG  Y F+V A N +GIG PS+VSE   A DP +                       
Sbjct: 18263 GLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDP---------------------- 18300

Query: 633   SEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELP 691
                  PG P  + +   TR+ V L WK P   G   I  Y VEK +     W + +    
Sbjct: 18301 -----PGRPEAIVI---TRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASF-TN 18351

Query: 692   VKSPRFALFDLAEGKSYCFRVRCSNSAG-VGEPSEATEVTVVGDKLDIPKAPGKIIPSRN 750
             V    F +  L E + Y FRV   N+AG   EPS+++      D++D P A    +  + 
Sbjct: 18352 VLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNAS---LDPKY 18408

Query: 751   TDTSVVVSWEE-----------------SKDAKELVGYYIEASVAGSGKWEPCNNNPVKG 793
              D  VV + E                  SKD KEL        +           + ++ 
Sbjct: 18409 KDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEI----------KSTIQK 18458

Query: 794   SRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDS 853
             +       +      + ++  N  G          ++V     PP  P  +T + +  + 
Sbjct: 18459 TTLVVKDCIRTDGGQYILKLSNVGGTKSI---PITVKVLDRPGPPEGPLKVTGVTA--EK 18513

Query: 854   MVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQF 913
               L W  P + GGA I+ Y +  RE        W + + + V    YK++ L     Y F
Sbjct: 18514 CYLAWNPPLQDGGANISHYIIEKRET---SRLSWTQVSTE-VQALNYKVTKLLPGNEYIF 18569

Query: 914   QVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTP 973
             +V A+N  G+G P        C  +    PGPP + + S + KDS+V+ W  PV  G T 
Sbjct: 18570 RVMAVNKYGIGEPLESGPVTACNPY--KPPGPPSTPEVSAITKDSMVVTWARPVDDGGTE 18627

Query: 974   VTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSD 1032
             + GY ++ ++ +    +W   N+  + ++ L+V GL EG SY FRV A N AGVG+PS+
Sbjct: 18628 IEGYILEKRDKEGV--RWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSE 18684



 Score =  202 bits (514), Expect = 2e-51
 Identities = 165/622 (26%), Positives = 276/622 (44%), Gaps = 66/622 (10%)

Query: 429  VITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGE 488
            ++ P   + + E +W++   PLS +K + T  + E+ +       K D+G Y I ++   
Sbjct: 6714 MVVPYDAYPKAEAEWFKENEPLS-TKTIDT--TAEQTSFRILEAKKGDKGRYKIVLQ--N 6768

Query: 489  YYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDK 548
             + +   ++ ++  D      P    +++  E     + ++W++P  DGGS I+GY +++
Sbjct: 6769 KHGKAEGFINLKVIDV-----PGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVER 6823

Query: 549  CEVGTDSWSQCNDTPVKFARFPVTGLIEGR-SYIFRVRAVNKMGIGFPSRVSEPVAALDP 607
             ++   +W    D   +   F VTGL +G   Y+FRV A N++G G P     PV     
Sbjct: 6824 RDIKRKTWVLATDR-AESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPV----- 6877

Query: 608  AEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHE 667
                                  E  S+  VPGPP ++++T+  R  V L+W+PP   G  
Sbjct: 6878 ----------------------EARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGA 6915

Query: 668  GIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEA 726
             I  Y +E  +  +  W    T +  +     + D+ EG+ Y FRVR  N  GVG+PS A
Sbjct: 6916 EITNYVIELRDKTSIRWDTAMT-VRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAA 6974

Query: 727  TEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES-KDA-KELVGYYIEASVAGSGKWE 784
            T    V D ++ P  P  +  S  T +SV + WE   KD    ++GY IE    G   W 
Sbjct: 6975 TPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWI 7034

Query: 785  PCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDI 844
             CN   V    +   GL  G  Y++RV A N AG+S+ S+    +    A   P+     
Sbjct: 7035 RCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMD--- 7091

Query: 845  TCLESFRDSMVLGWKQPDKI-----GGAEITGYYVNYREVIDGVPGKWREANVKAVSEEA 899
              L +F+D + +    P  I     G    T  +    +V++    + +   + A +E  
Sbjct: 7092 --LSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLE-TGDRVKMKTLSAYAELV 7148

Query: 900  YKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSL 959
               S   +  +Y  ++        G         + +   IA P  P  LK  ++ KDS+
Sbjct: 7149 ISPSERSDKGIYTLKLENRVKTISG---------EIDVNVIARPSAPKELKFGDITKDSV 7199

Query: 960  VLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRV 1019
             L W+PP   G +P+TGY V+ +E   K   W  + +  + ++   V  L +G  Y+F+V
Sbjct: 7200 HLTWEPPDDDGGSPLTGYVVEKREVSRK--TWTKVMD-FVTDLEFTVPDLVQGKEYLFKV 7256

Query: 1020 RAINQAGVGKPSDLAGPVVAET 1041
             A N+ G G+P+ +  PV   T
Sbjct: 7257 CARNKCGPGEPAYVDEPVNMST 7278



 Score =  202 bits (513), Expect = 3e-51
 Identities = 175/684 (25%), Positives = 289/684 (42%), Gaps = 72/684 (10%)

Query: 519   LEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGR 578
             L   +  + + W +P   GG  I  Y ++K ++    W + N + +    F V+GL E  
Sbjct: 15061 LNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDA 15120

Query: 579   SYIFRVRAVNKMG-IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIV 637
             +Y FRV A N  G I  PS  S+ +   D  E  ++K       T  +   E    E  V
Sbjct: 15121 AYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADV 15180

Query: 638   PG--PPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSP 695
              G  PPT             + W   G+                 E   ++  ++   S 
Sbjct: 15181 SGRPPPT-------------MEWSKDGKE---------------LEGTAKLEIKIADFST 15212

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAP-GKIIPSRNTDTS 754
                  D     S  + +  +N  G  +     +V      LD P  P G +  +  T   
Sbjct: 15213 NLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKV------LDRPGPPEGPLAVTEVTSEK 15266

Query: 755   VVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVR 812
              V+SW    D    ++  Y ++        W    +  V+ ++     L+ G  YIFRV 
Sbjct: 15267 CVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASE-VQVTKLKVTKLLKGNEYIFRVM 15325

Query: 813   AVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGY 872
             AVN  G+ E   +SE +       PP PP +       +DSMV+ W  PD  GG+EI  Y
Sbjct: 15326 AVNKYGVGE-PLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINY 15384

Query: 873   YVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSEC 932
              V  R   D    +W + N K +++  YK+S L E   Y+F++ A N AG+ APS  S  
Sbjct: 15385 IVERR---DKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPF 15441

Query: 933   FKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWR 992
             +K  + T+  PGPP + +  +  + S+ + W  P++ G + +TGY V++  A  +ED+W+
Sbjct: 15442 YKACD-TVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEI--ALPEEDEWQ 15498

Query: 993   GLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVN 1051
              +   A +K     + GL E   Y  R+ A+N  G+G+P+ + G   AE R    E+ ++
Sbjct: 15499 IVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELD 15558

Query: 1052  VDDDGVISLNFECD-------KMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDL 1104
              D   V+++   C        K  P  E  W++D+  + D  +  +ES  + T +   ++
Sbjct: 15559 ADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLD--KASIESTSSYTLLIVGNV 15616

Query: 1105  GMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQV 1164
                D G Y   V ++ G  S+++             +     T     +L V+ + K  V
Sbjct: 15617 NRFDSGKYILTVENSSGSKSAFV-------------NVRVLDTPGPPQDLKVKEVTKTSV 15663

Query: 1165  RFWMQAEKLSGNAKV-NYIFNEKE 1187
                     L G +K+ NYI  ++E
Sbjct: 15664 TLTWDPPLLDGGSKIKNYIVEKRE 15687



 Score =  201 bits (510), Expect = 6e-51
 Identities = 176/628 (28%), Positives = 265/628 (42%), Gaps = 84/628 (13%)

Query: 508   GAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFA 567
             G P  P   +     K+   +SWK+P  DGGS I GY +++ E  +  W +   TPV   
Sbjct: 14265 GPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDL 14324

Query: 568   RFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIV 627
             R  VTGL EG +Y FRV A N+ GIG PS  S+ V   D A                   
Sbjct: 14325 RCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYP----------------- 14367

Query: 628   TEEEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRV 686
                       PGPP++  VT+ T+    L+W KP    G E   Y VE  + G E W + 
Sbjct: 14368 ----------PGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKD 14417

Query: 687   NTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKII 746
              T   ++  +F + DL   + Y FR+   N AGVGEP+   +V +V  ++    AP   +
Sbjct: 14418 TTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREM----APDFEL 14473

Query: 747   PSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSR------FT--- 797
              +    T VV +    +     +   I+   A    W   N N    +       FT   
Sbjct: 14474 DAELRRTLVVRAGLSIR-----IFVPIKGRPAPEVTWTKDNINLKNRANIENTESFTLLI 14528

Query: 798   ---CHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSM 854
                C+   TG+   F +   N AG     + S  + V+  +  P P  ++   +  +DS+
Sbjct: 14529 IPECNRYDTGK---FVMTIENPAG-----KKSGFVNVRV-LDTPGPVLNLRPTDITKDSV 14579

Query: 855   VLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQ 914
              L W  P   GG+ IT Y V  RE        +  A  K   +  YK++ L E   Y F+
Sbjct: 14580 TLHWDLPLIDGGSRITNYIVEKREA---TRKSYSTATTKC-HKCTYKVTGLSEGCEYFFR 14635

Query: 915   VAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPV 974
             V A N  G+G P+  +E  K  E     P PP SL   ++ K ++ L W  P H G + +
Sbjct: 14636 VMAENEYGIGEPTETTEPVKASE----APSPPDSLNIMDITKSTVSLAWPKPKHDGGSKI 14691

Query: 975   TGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLA 1034
             TGY ++ +  +   DQW  +    +K +   VR L EG  Y F+V A+N AG   P + +
Sbjct: 14692 TGYVIEAQ--RKGSDQWTHI--TTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRE-S 14746

Query: 1035  GPVVAETRPGTKE----------VVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTED 1084
              PV+ + +    E          V+    D+  + +        PK   +W K     + 
Sbjct: 14747 RPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPV---LGRPKPTVTWKKGDQILKQ 14803

Query: 1085  SPRLEVESKGNKTKMTFKDLGMDDLGIY 1112
             + R+  E+    T +   +    D G Y
Sbjct: 14804 TQRVNFETTATSTILNINECVRSDSGPY 14831



 Score =  200 bits (508), Expect = 1e-50
 Identities = 160/609 (26%), Positives = 255/609 (41%), Gaps = 68/609 (11%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P + W +    L    +V T  +  R +LT  + N+ D G YT+ ++        +  V 
Sbjct: 19911 PNVLWSKPDTDLRTRAYVDT--TDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVK 19968

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V D        P  P ++   +  K+  ++SW  P  DGG+P+  Y I+K E    +W  
Sbjct: 19969 VLDT-------PGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKREASKKAWVS 20021

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
               +   + + + VT L EG  Y FRV   N+ G+G P+   E V                
Sbjct: 20022 VTNNCNRLS-YKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVK--------------- 20065

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCE 677
                     +TE+       P PP  L VT  ++  V L+W KP    G   + Y VE  E
Sbjct: 20066 --------ITEK-------PSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALE 20110

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
              G +NW +       KS    +  L E   Y FRV   N AG+ +P E     ++ ++L+
Sbjct: 20111 KGQKNWVKCAV---AKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLE 20167

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFT 797
              P+   K  PS    T  V +    K    + G  +   V  S    P        +  T
Sbjct: 20168 PPEIDMKNFPSH---TVYVRAGSNLKVDIPISGKPL-PKVTLSRDGVPLKATMRFNTEIT 20223

Query: 798   CHGL-------VTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESF 850
                L       VT  +  + + A N++G ++       I +     P  P   +   +  
Sbjct: 20224 AENLTINLKESVTADAGRYEITAANSSGTTK-----AFINIVVLDRPGPPTGPVVISDIT 20278

Query: 851   RDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMV 910
              +S+ L W+ P   GG+++T Y +  RE    V   W E +   V+    K+  L     
Sbjct: 20279 EESVTLKWEPPKYDGGSQVTNYILLKRETSTAV---WTEVSA-TVARTMMKVMKLTTGEE 20334

Query: 911   YQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSG 970
             YQF++ A N  G+     +       +     PGPP +   + V ++S+ + W  PV +G
Sbjct: 20335 YQFRIKAENRFGIS--DHIDSACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNG 20392

Query: 971   RTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKP 1030
              + V GY +++K+  +    W+  N+  I+  + KV  +  G+ Y FRV A N AGVGKP
Sbjct: 20393 GSAVVGYHLEMKDRNS--ILWQKANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVGKP 20450

Query: 1031  SDLAGPVVA 1039
             S  + PV+A
Sbjct: 20451 SHPSEPVLA 20459



 Score =  199 bits (505), Expect = 2e-50
 Identities = 216/935 (23%), Positives = 382/935 (40%), Gaps = 106/935 (11%)

Query: 523   KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIF 582
             ++ I + W +P  DGGS I GY ++K ++    W + + T V   +F V+GL E + Y F
Sbjct: 17229 RNEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEF 17288

Query: 583   RVRAVNKMG-IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPP 641
             RV A N  G I  PS  + P+ A D  E  R+   P    T  +   E    E  V G P
Sbjct: 17289 RVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKP 17348

Query: 642   TDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFD 701
                           + W    +   E       +CE    +++ +   L VK        
Sbjct: 17349 LP-----------TIEWLRGDKEIEESA-----RCEIKNTDFKAL---LIVKDAI----- 17384

Query: 702   LAEGKSYCFRVRCSNSAGVGEPSEATEVTV-VGDKLDIPKAPGKIIPSRNTDTSVVVSWE 760
               +G  Y   +R SN AG    S++  V V V D+   P+ P ++    +   S+  S  
Sbjct: 17385 RIDGGQYI--LRASNVAG----SKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPP 17438

Query: 761   ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLS 820
                   ++  Y +E        W    +  V  S      L+ G  Y+FR+ AVN  G+ 
Sbjct: 17439 LQDGGSDISHYVVEKRETSRLAWTVVASEVVTNS-LKVTKLLEGNEYVFRIMAVNKYGVG 17497

Query: 821   EYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVI 880
             E   +S  + +K     P PP  +      +DSM + W +PD  GG+EI GY V  R+  
Sbjct: 17498 E-PLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDR- 17555

Query: 881   DGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTI 940
              G+  +W + N + +++   +++ L E+  Y+F+V+A N AG+G PS  +  +K  +  +
Sbjct: 17556 SGI--RWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACD-PV 17612

Query: 941   AVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN-EAAI 999
               PGPP +    +  K+S+ L W  P++ G + + GY V++   KA E++W+ +  +  +
Sbjct: 17613 FKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEI--CKADEEEWQIVTPQTGL 17670

Query: 1000  KNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKE----------VV 1049
             +    ++  L E   Y  RV A+N+ G+G+ + + G V  E +    E          +V
Sbjct: 17671 RVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIV 17730

Query: 1050  VNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDL 1109
             V       I + F   K  P  E +WS++    E + ++++E   N T+++  +   +D 
Sbjct: 17731 VRAGGSARIHIPF---KGRPTPEITWSRE--EGEFTDKVQIEKGVNYTQLSIDNCDRNDA 17785

Query: 1110  GIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQ 1169
             G Y   + ++ G  S+++  +                T      LAV+ + K       +
Sbjct: 17786 GKYILKLENSSGSKSAFVTVK-------------VLDTPGPPQNLAVKEVRKDSAFLVWE 17832

Query: 1170  AEKLSGNAKV-NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGK 1228
                + G AKV NY+ +++E     K   ++          +E L   +   Y F++    
Sbjct: 17833 PPIIDGGAKVKNYVIDKRE--STRKAYANVSSKCSKTSFKVENL--TEGAIYYFRVMAEN 17888

Query: 1229  ATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIK 1288
                    V   D  K  +               P     ++     + +  L  +     
Sbjct: 17889 EFGVGVPVETVDAVKAAEP--------------PSPPGKVTLTDVSQTSASLMWEKPEHD 17934

Query: 1289  KETHIVWYKDEREISVDEKHDF--KDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLK 1346
               + ++ Y  E +    EK     +  +C  ++T  S      + V   +++GK   R+ 
Sbjct: 17935 GGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVL 17994

Query: 1347  LVDEAFKELMMEVCKKIAL------SATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNG 1400
              V    K+L ++   K+        +  DLKI+    G    +          ++W  +G
Sbjct: 17995 GVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPN----------ISWVKDG 18044

Query: 1401  SAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVM 1435
               ++ + RV    T     L I E   +D GKY +
Sbjct: 18045 EPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTV 18079



 Score =  198 bits (503), Expect = 4e-50
 Identities = 166/618 (26%), Positives = 260/618 (42%), Gaps = 78/618 (12%)

Query: 526   IIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQC-NDTPVKFARFPVTGLIEGRSYIFRV 584
             I ++W +P  DGGS I  Y +++ E  +  W +  +  P+   RF VTGL EG  Y F V
Sbjct: 21863 ITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHV 21922

Query: 585   RAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDL 644
              A N  G+G  S +S  +   +P                              PGPPT +
Sbjct: 21923 MAENAAGVGPASGISRLIKCREPVNP---------------------------PGPPTVV 21955

Query: 645   SVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLA 703
              VT+ +++ V L W KP    G E I Y +E C+A   +W +VN E  VK+ R+ + DL 
Sbjct: 21956 KVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKT-RYTVTDLQ 22014

Query: 704   EGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESK 763
              G+ Y FRV   N AG G+  E T      D+L  P+     I +    T VV       
Sbjct: 22015 AGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELD---IDANFKQTHVV---RAGA 22068

Query: 764   DAKELVGYYIEASVAGSGKW-EPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEY 822
               +  + Y  +     +  W +P +N  ++    T     T       V   N     +Y
Sbjct: 22069 SIRLFIAY--QGRPTPTAVWSKPDSNLSLRADIHTTDSFST-----LTVENCNRNDAGKY 22121

Query: 823   SQDSEAIEVKAAIA-------PPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVN 875
             +   E      +I         P PP  IT  +  R S  L W  P   GGA I  Y V 
Sbjct: 22122 TLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVE 22181

Query: 876   YREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKC 935
              RE        W+  + K  + + +K+++L E + Y F+V+A+N  G+G P  + E    
Sbjct: 22182 KRE---ASRRSWQVISEKC-TRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVA 22237

Query: 936   EEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN 995
              E     P PP  L   +  K S VL W  P H G + +TGY +++++  +  D W  + 
Sbjct: 22238 TE----QPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGS--DFW--VE 22289

Query: 996   EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDD 1055
                 K +   V  L E   Y FRV+A N AG  +P +    V+ +      ++    D  
Sbjct: 22290 AGHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIK----EPQIEPTADLT 22345

Query: 1056  GVISLNFECDKMT-----------PKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDL 1104
             G+ +    C   +           P  + +W  + +  +++ R+ + +  ++T +T KD 
Sbjct: 22346 GITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDS 22405

Query: 1105  GMDDLGIYSCDVTDTDGI 1122
                D G Y   + +T G+
Sbjct: 22406 MRGDSGRYFLTLENTAGV 22423



 Score =  196 bits (499), Expect = 1e-49
 Identities = 180/631 (28%), Positives = 266/631 (42%), Gaps = 87/631 (13%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRV--RMGEYYEQYSAY 496
             P++ W + G+     K    L     A L   +  ++D G Y++ +    GE     + +
Sbjct: 12331 PKVTWRKVGIDNVVRKGQVDLVD-TMAFLVIPNSTRDDSGKYSLTLVNPAGEK----AVF 12385

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
             V VR  D      P    D+K  +  K    +SW  P  DGGS +  Y ++K E    +W
Sbjct: 12386 VNVRVLDT-----PGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTW 12440

Query: 557   SQCNDTP-VKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKS 615
             S    TP VK   F VT L+ G  Y FRV AVN+ G G P+ V +PV A DP  +     
Sbjct: 12441 STV--TPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPLSE----- 12493

Query: 616   RPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEK 675
                                   P PP  L VTE T++   L+W PP + G   I  ++  
Sbjct: 12494 ----------------------PDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITS 12531

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
                  +   R      VK     +  L EGK Y FRV   N+ GV  P EA  V    ++
Sbjct: 12532 YREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQ 12591

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAG----SGKWEPCNNNPV 791
             L  PK    ++P + T           K  K+L    IEA V G    + KW+   +  V
Sbjct: 12592 LLPPKI---LMPEQIT----------IKAGKKL---RIEAHVYGKPHPTCKWKKGEDEVV 12635

Query: 792   KGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSE----------AIEVKAAIAPPSPP 841
               S    H      S I  ++ V       YS  +E           + V  A  PP PP
Sbjct: 12636 TSSHLAVH--KADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPP 12693

Query: 842   CDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYK 901
              DI+ +++  D+  L W  P + GG+ IT Y V   E  D   G W  A + +V++ + +
Sbjct: 12694 FDISDIDA--DACSLSWHIPLEDGGSNITNYIV---EKCDVSRGDWVTA-LASVTKTSCR 12747

Query: 902   ISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVL 961
             +  L     Y F+V A N  G+  P  ++      ++   VP  P + + ++V KD + +
Sbjct: 12748 VGKLIPGQEYIFRVRAENRFGISEP--LTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFV 12805

Query: 962   QWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRA 1021
              W  P   G +P+ GY ++ KE  +    W   N+  +++      GL EG+ Y FR+ A
Sbjct: 12806 AWDRPDSDGGSPIIGYLIERKERNSL--LWVKANDTLVRSTEYPCAGLVEGLEYSFRIYA 12863

Query: 1022  INQAGVGKPSDLAGPVVAE---TRPGTKEVV 1049
             +N+AG   PS     V A      PG  EV+
Sbjct: 12864 LNKAGSSPPSKPTEYVTARMPVDPPGKPEVI 12894



 Score =  196 bits (499), Expect = 1e-49
 Identities = 171/629 (27%), Positives = 261/629 (41%), Gaps = 81/629 (12%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             PE+ W ++ + L     ++   S     L     N+ D G + + +       + S +V 
Sbjct: 14501 PEVTWTKDNINLKNRANIENTESF--TLLIIPECNRYDTGKFVMTIENPA--GKKSGFVN 14556

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             VR  D      P   L+++  +  KD + + W  P +DGGS I  Y ++K E    S+S 
Sbjct: 14557 VRVLDT-----PGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYST 14611

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
                T      + VTGL EG  Y FRV A N+ GIG P+  +EPV A +            
Sbjct: 14612 AT-TKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASE------------ 14658

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                                P PP  L++ + T+S V L+W  P   G   I  Y +E   
Sbjct: 14659 ------------------APSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQR 14700

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
              G++ W  + T   VK     + +L EG+ Y F+V   NSAG   P E+  V +V ++  
Sbjct: 14701 KGSDQWTHITT---VKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRPV-IVKEQTM 14756

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGK----WEPCNNNPVKG 793
             +P+     +  R     +V+       AK      +E  V G  K    W+  +    + 
Sbjct: 14757 LPE-----LDLRGIYQKLVI-------AKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQT 14804

Query: 794   SRFTCHGLVTGQSYIFRVRAVNAAGLSEY--------SQDSEAIEVKAAIAPPSPPCDIT 845
              R       T  S I  +     +    Y         +  + I ++    P  P   I 
Sbjct: 14805 QRVNFE--TTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIK 14862

Query: 846   CLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNL 905
               E   D +   W  P+  GG  I+ Y V  R+        W E     V    YK + L
Sbjct: 14863 FDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTT---WVEL-ATTVIRTTYKATRL 14918

Query: 906   KENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKP 965
                + YQF+V A N  G+G P   S C     +   VPGPP + + + V KDS+ + W  
Sbjct: 14919 TTGLEYQFRVKAQNRYGVG-PGITSACI-VANYPFKVPGPPGTPQVTAVTKDSMTISWHE 14976

Query: 966   PVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQA 1025
             P+  G +P+ GY V+ KE       W+ +++A +     K  GL +G++Y FRV A N A
Sbjct: 14977 PLSDGGSPILGYHVERKERNG--ILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMA 15034

Query: 1026  GVGKPSDLAGPVVA--ETRPGTKEVVVNV 1052
             G  KPS  + P++A     P  K V +N+
Sbjct: 15035 GKSKPSKPSEPMLALDPIDPPGKPVPLNI 15063



 Score =  195 bits (496), Expect = 3e-49
 Identities = 220/853 (25%), Positives = 345/853 (40%), Gaps = 123/853 (14%)

Query: 293   NVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRA 352
             + ++H    G P P +TW + +          K  IE       L I+ CD  D  +Y  
Sbjct: 17736 SARIHIPFKGRPTPEITWSREEGEFT-----DKVQIEKGVNYTQLSIDNCDRNDAGKYIL 17790

Query: 353   SAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFD 412
                N  G  SA+ +V V    G                     P   A + E+  D  F 
Sbjct: 17791 KLENSSGSKSAFVTVKVLDTPGP--------------------PQNLAVK-EVRKDSAF- 17828

Query: 413   VSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHL 472
                            +V  P I     +++ Y      S  K    + S + +  +F   
Sbjct: 17829 ---------------LVWEPPIIDGGAKVKNYVIDKRESTRKAYANV-SSKCSKTSFKVE 17872

Query: 473   NKEDEGLYTIRVRMGEYYEQYSAYVFVRDADA-EIEGAPAAPLDVKCLEANKDYIIISWK 531
             N  +  +Y  RV M E   ++   V V   DA +    P+ P  V   + ++    + W+
Sbjct: 17873 NLTEGAIYYFRV-MAE--NEFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASLMWE 17929

Query: 532   QPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMG 591
             +P  DGGS +LGY ++    GT+ WS   ++  K     VTGL  G+ Y FRV+A N+ G
Sbjct: 17930 KPEHDGGSRVLGYVVEMQPKGTEKWSIVAES--KVCNAVVTGLSSGQEYQFRVKAYNEKG 17987

Query: 592   IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATR 651
                P  +  PV A D   +  LK     P+           +  I  G    + +    R
Sbjct: 17988 KSDPRVLGVPVIAKDLTIQPSLK----LPFN----------TYSIQAGEDLKIEIPVIGR 18033

Query: 652   SYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCF- 710
                 +SW   G+                 +   RVN E    S    +  + EG    F 
Sbjct: 18034 PRPNISWVKDGEP---------------LKQTTRVNVEETATS---TVLHIKEGNKDDFG 18075

Query: 711   --RVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTS---VVVSWEESK-- 763
                V  +NSAG    +E   V V    L+ P  P  + P R  + S   VV+SWE     
Sbjct: 18076 KYTVTATNSAGTA--TENLSVIV----LEKPGPP--VGPVRFDEVSADFVVISWEPPAYT 18127

Query: 764   DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYS 823
                ++  Y +E     +  W   +   V  +      L TG  Y FR+ A N  G S   
Sbjct: 18128 GGCQISNYIVEKRDTTTTTWHMVSAT-VARTTIKITKLKTGTEYQFRIFAENRYGKSA-P 18185

Query: 824   QDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGV 883
              DS+A+ V+     P PP         +D M++ W +P   GG +I GY++  +E    +
Sbjct: 18186 LDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSIL 18245

Query: 884   PGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVP 943
                W + N   + +  +K + L E + Y+F+V+A N+ G+G PS VSECF   +     P
Sbjct: 18246 ---WVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARD-PCDPP 18301

Query: 944   GPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVY 1003
             G P ++    + ++++ L+WK P + G + +TGY V+ K+    + +W   +   +    
Sbjct: 18302 GRPEAI---VITRNNVTLKWKKPAYDGGSKITGYIVEKKD--LPDGRWMKASFTNVLETE 18356

Query: 1004  LKVRGLKEGVSYVFRVRAINQAG-VGKPSDLAGPVVAETR---------PGTKEV-VVNV 1052
               V GL E   Y FRV A N AG   +PSD +G + A            P  K+V VV+ 
Sbjct: 18357 FTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHA 18416

Query: 1053  DDDGVISLNFECDKMTPKSEFSWSKDYVSTED-SPRLEVESKGNKTKMTFKDLGMDDLGI 1111
              +  V+  +    +  P  +  WSKD    E+ + R+E++S   KT +  KD    D G 
Sbjct: 18417 GETFVLEADI---RGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQ 18473

Query: 1112  YSCDVTDTDGIAS 1124
             Y   +++  G  S
Sbjct: 18474 YILKLSNVGGTKS 18486



 Score =  194 bits (494), Expect = 4e-49
 Identities = 217/923 (23%), Positives = 361/923 (39%), Gaps = 143/923 (15%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTL-EINGCDFEDTAQY 350
             E +K++  IAG P P ++W K+ + I   A       ++    HTL  +  C   DT QY
Sbjct: 19500 EVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDN----HTLLTVKDCIRRDTGQY 19555

Query: 351   RASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF-GVTPYGYASRFEIHFDD 409
               +  NV G  S   +  V       D+    AG    PL   G+T             +
Sbjct: 19556 VLTLKNVAGTRSVAVNCKV------LDKPGPPAG----PLEINGLTA------------E 19593

Query: 410   KFDVSFGREGET--MSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGE--RA 465
             K  +S+GR  E     +   +V   E  H    + W              T+  GE    
Sbjct: 19594 KCSLSWGRPQEDGGADIDYYIVEKRETSH----LAW--------------TICEGELQMT 19635

Query: 466   TLTFSHLNKEDEGLYTI----RVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEA 521
             +   + L K +E ++ +    +  +GE  E     V ++  D      P+ P  ++    
Sbjct: 19636 SCKVTKLLKGNEYIFRVTGVNKYGVGEPLES----VAIKALDPFT--VPSPPTSLEITSV 19689

Query: 522   NKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYI 581
              K+ + + W +P  DGGS I GY I++ E  +  W + N  PV   R   TGL EG  Y 
Sbjct: 19690 TKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYE 19749

Query: 582   FRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPP 641
             +RV A N  G+  PS  S  + A DP                             +P PP
Sbjct: 19750 YRVYAENAAGLSLPSETSPLIRAEDPV---------------------------FLPSPP 19782

Query: 642   TDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALF 700
             +   + ++ ++ + ++W  P   G   I  Y VE  ++   +W+     L  +   + + 
Sbjct: 19783 SKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTSIQSL--RGTEYTIS 19840

Query: 701   DLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE 760
              L  G  Y FRV+  N  G  +PS++++  +  ++ + P      I S    T +V +  
Sbjct: 19841 GLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFD---IDSEMRKTLIVKA-- 19895

Query: 761   ESKDAKELVGYYIEASVAGSGKWEP--CNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAG 818
                      G     +V   G+  P    + P    R   +   T       +   N   
Sbjct: 19896 ---------GASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRTSLTIENANRND 19946

Query: 819   LSEYSQDSEAIEVKAAIA-------PPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITG 871
               +Y+   + +   A++         P PP +IT  +  ++S VL W  P+  GGA +  
Sbjct: 19947 SGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKN 20006

Query: 872   YYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSE 931
             Y++  RE        W        +  +YK++NL+E  +Y F+V+  N  G+G P+   E
Sbjct: 20007 YHIEKREASKKA---WVSVTNNC-NRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKE 20062

Query: 932   CFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQW 991
               K  E     P PP  L  + + KDS+ L W  P H G + +  Y V+  E   K   W
Sbjct: 20063 GVKITE----KPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKN--W 20116

Query: 992   RGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVN 1051
               +  A  K+ +  V GL+E   Y FRV A NQAG+  P +L  PV+ + +    E+ + 
Sbjct: 20117 --VKCAVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMK 20174

Query: 1052  VDDDGVISL----NFECD---KMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDL 1104
                   + +    N + D      P  + + S+D V  + + R   E       +  K+ 
Sbjct: 20175 NFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKES 20234

Query: 1105  GMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQV 1164
                D G Y     ++ G   +++        ++ L      P  P    +  +I E+   
Sbjct: 20235 VTADAGRYEITAANSSGTTKAFI-------NIVVLDR----PGPPTGPVVISDITEESVT 20283

Query: 1165  RFWMQAEKLSGNAKVNYIFNEKE 1187
               W   +   G+   NYI  ++E
Sbjct: 20284 LKWEPPKYDGGSQVTNYILLKRE 20306



 Score =  194 bits (492), Expect = 7e-49
 Identities = 176/650 (27%), Positives = 280/650 (43%), Gaps = 84/650 (12%)

Query: 432   PEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHL---NKEDEGLYTIRVR--M 486
             P I   +P I W ++G PL  +  V      E AT T  H+   NK+D G YT+      
Sbjct: 18029 PVIGRPRPNISWVKDGEPLKQTTRVNV---EETATSTVLHIKEGNKDDFGKYTVTATNSA 18085

Query: 487   GEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFI 546
             G   E  S  V       E  G P  P  V+  E + D+++ISW+ PA  GG  I  Y +
Sbjct: 18086 GTATENLSVIVL------EKPGPPVGP--VRFDEVSADFVVISWEPPAYTGGCQISNYIV 18137

Query: 547   DKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALD 606
             +K +  T +W   + T V      +T L  G  Y FR+ A N+ G               
Sbjct: 18138 EKRDTTTTTWHMVSAT-VARTTIKITKLKTGTEYQFRIFAENRYG--------------- 18181

Query: 607   PAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRG 665
                        SAP   + ++ +    E   PGPP    VT  ++  +++ W +P    G
Sbjct: 18182 ----------KSAPLDSKAVIVQYPFKE---PGPPGTPFVTSISKDQMLVQWHEPVNDGG 18228

Query: 666   HEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSE 725
              + I Y +E+ E  +  W ++N + P++  +F    L EG  Y F+V   N  G+G+PS+
Sbjct: 18229 TKIIGYHLEQKEKNSILWVKLN-KTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSK 18287

Query: 726   ATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKW 783
              +E  V  D  D P  P  I+ +RN   +V + W++       ++ GY +E      G+W
Sbjct: 18288 VSECFVARDPCDPPGRPEAIVITRN---NVTLKWKKPAYDGGSKITGYIVEKKDLPDGRW 18344

Query: 784   EPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIAPPSPPC 842
                +   V  + FT  GLV  Q Y FRV A NAAG  SE S  S AI  +  I  P+   
Sbjct: 18345 MKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASL 18404

Query: 843   DITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKI 902
             D      ++D +V+        G   +    +  + + D V  K  +   +  +    K 
Sbjct: 18405 D----PKYKDVIVV------HAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKS 18454

Query: 903   SNLKENMVYQFQVAA------MNMAGLGAPSAVSECFKCEEWTIAVPGPPHS-LKCSEVR 955
             +  K  +V +  +        + ++ +G   ++    K     +  PGPP   LK + V 
Sbjct: 18455 TIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVK----VLDRPGPPEGPLKVTGVT 18510

Query: 956   KDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSY 1015
              +   L W PP+  G   ++ Y ++ +E       W  ++   ++ +  KV  L  G  Y
Sbjct: 18511 AEKCYLAWNPPLQDGGANISHYIIEKRETSRL--SWTQVS-TEVQALNYKVTKLLPGNEY 18567

Query: 1016  VFRVRAINQAGVGKPSDLAGPVVA------ETRPGTKEVVVNVDDDGVIS 1059
             +FRV A+N+ G+G+P + +GPV A         P T EV     D  V++
Sbjct: 18568 IFRVMAVNKYGIGEPLE-SGPVTACNPYKPPGPPSTPEVSAITKDSMVVT 18616



 Score =  192 bits (488), Expect = 2e-48
 Identities = 219/892 (24%), Positives = 362/892 (40%), Gaps = 103/892 (11%)

Query: 367   VVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKF-DVSFGREGETMSLG 425
             V+ +   G F E    +GA        +T            D K+ DV     GET  L 
Sbjct: 18372 VIARNAAGNFSEPSDSSGA--------ITARDEIDAPNASLDPKYKDVIVVHAGETFVLE 18423

Query: 426   CRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSG-ERATLTFSHLNKEDEGLYTIRV 484
               +   P      P++ W ++G  L  +     + S  ++ TL      + D G Y +++
Sbjct: 18424 ADIRGKPI-----PDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKL 18478

Query: 485   RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGY 544
                   +     V V D      G P  PL V  + A K Y+  +W  P  DGG+ I  Y
Sbjct: 18479 SNVGGTKSIPITVKVLDRP----GPPEGPLKVTGVTAEKCYL--AWNPPLQDGGANISHY 18532

Query: 545   FIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAA 604
              I+K E    SW+Q + T V+   + VT L+ G  YIFRV AVNK GIG P   S PV A
Sbjct: 18533 IIEKRETSRLSWTQVS-TEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLE-SGPVTA 18590

Query: 605   LDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQ 663
              +P +                            PGPP+   V+  T+  +V++W +P   
Sbjct: 18591 CNPYKP---------------------------PGPPSTPEVSAITKDSMVVTWARPVDD 18623

Query: 664   RGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEP 723
              G E   Y +EK +     W + N +  +   R  +  L EG SY FRV   N+AGVGEP
Sbjct: 18624 GGTEIEGYILEKRDKEGVRWTKCNKK-TLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEP 18682

Query: 724   SEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSG 781
             SE +      D L  P  P     +  + +SV ++W +        + GY +E   A + 
Sbjct: 18683 SEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAAD 18742

Query: 782   KWEPCN-NNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSP 840
             +W  C     ++G +FT   L     Y FR+ A+N+ G+ E +    ++  +  I PP  
Sbjct: 18743 EWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEI 18802

Query: 841   PCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPG---KWREA----NVK 893
               D       R  +VL          A  T   +     I G P    KW +A      +
Sbjct: 18803 ELD----ADLRKVVVL---------RASAT---LRLFVTIKGRPEPEVKWEKAEGILTDR 18846

Query: 894   AVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSE 953
             A  E     + L  + V +F     N+  L   S     F      +  P  P +L   E
Sbjct: 18847 AQIEVTSSFTMLVIDNVTRFDSGRYNLT-LENNSGSKTAF-VNVRVLDSPSAPVNLTIRE 18904

Query: 954   VRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGV 1013
             V+KDS+ L W+PP+  G   +T Y V+ +E   K   +  +     K  + ++  L+EG 
Sbjct: 18905 VKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRK--AYATITNNCTKTTF-RIENLQEGC 18961

Query: 1014  SYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVD-DDGVISLNFECDKMTPKSE 1072
             SY FRV A N+ G+G P++   PV     P     V  VD      ++ +E  +    S+
Sbjct: 18962 SYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSK 19021

Query: 1073  FSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEE 1132
              +     + T+ S +    ++    + T   L   +  ++     +  G +    +    
Sbjct: 19022 ITGYVVEMQTKGSEKWSTCTQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPV 19081

Query: 1133  LKRLLALSHEHKFP----TVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEI 1188
             + R + +    + P     V  + +L +++  KG+ +           A VN+  + + +
Sbjct: 19082 IARDIEIKPSVELPFHTFNVKAREQLKIDVPFKGRPQ-----------ATVNWRKDGQTL 19130

Query: 1189  FEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQD--GKATNHSTVVLV 1238
              E    ++++  +  +  + +++   ED GTY   + +  G  T   T++++
Sbjct: 19131 KE--TTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVL 19180



 Score =  191 bits (486), Expect = 4e-48
 Identities = 192/782 (24%), Positives = 299/782 (38%), Gaps = 153/782 (19%)

Query: 290   EKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQ 349
             E  N +L   I G P P V+W K + P+   A   +  +ES     TL +  C   D  +
Sbjct: 13691 ENSNFRLKIPIKGKPAPSVSWKKGEDPL---ATDTRVSVESSAVNTTLIVYDCQKSDAGK 13747

Query: 350   YRASAMNVKGELSAYASVVVKRYKG------EFDETRFHA-------------------- 383
             Y  +  NV G      S+ V    G      +FDE    A                    
Sbjct: 13748 YTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYI 13807

Query: 384   --------------GASTMPLSFGVTPY--GYASRFEIHFDDKFDVSFGREGETMSLGCR 427
                            ++    +F VT    G    F +  ++K+ V  G + E +     
Sbjct: 13808 LEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHP 13867

Query: 428   VVITP--------EIKHFQPEIQWY----RNGVPLSPSKWVQTLWSGERATLTFSHLNKE 475
               +          +++H    + W       G P++       L   ER +L +   NK 
Sbjct: 13868 FDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYH----LEFKERNSLLWKRANKT 13923

Query: 476   DEGLYTIRV----RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDV-------KCLEANKD 524
                +   +V       EY  +  A          +   P   LD        + +   ++
Sbjct: 13924 PIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITRN 13983

Query: 525   YIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRV 584
              + + W +P  DGG  + GY ++K ++ + SW + N   V    F VT L+EG  Y FR+
Sbjct: 13984 SVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRI 14043

Query: 585   RAVNKMG-IGFPSRVSE----------PVAALDPAEKARL-----------------KSR 616
             RA N  G I  PS  +E          P   LDP  K  L                 K  
Sbjct: 14044 RAKNTAGAISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPL 14103

Query: 617   PSAPWT---------------------------------GQIIVTEEEPS----EGI--- 636
             P + W+                                 G+  +T   P     E +   
Sbjct: 14104 PKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVT 14163

Query: 637   ---VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPV 692
                VPGPP  + ++  +     L+W PP + G   I  Y +EK E     W  V+ +  +
Sbjct: 14164 VLDVPGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSED--I 14221

Query: 693   KSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTD 752
             +S R     L +G  Y FRV   N  G GEP ++  V +V D+   P  P K   S  T 
Sbjct: 14222 QSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQSEPVKMV-DRFGPPGPPEKPEVSNVTK 14280

Query: 753   TSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFR 810
              +  VSW+   D    E+ GY++E     S +W      PV   R    GL  G +Y FR
Sbjct: 14281 NTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFR 14340

Query: 811   VRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEIT 870
             V A N AG+   S+ S+++ +K A  PP PP +    ++ + S  L W +P   GG EIT
Sbjct: 14341 VSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEIT 14400

Query: 871   GYYVNYREVIDGVPGKW-REANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAV 929
             GY V +++V D     W ++    A+    + + +L+    Y F+++A+N AG+G P+ +
Sbjct: 14401 GYVVEHQKVGDEA---WIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVI 14457

Query: 930   SE 931
              +
Sbjct: 14458 PD 14459



 Score =  190 bits (482), Expect = 1e-47
 Identities = 163/618 (26%), Positives = 264/618 (42%), Gaps = 62/618 (10%)

Query: 526   IIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVR 585
             + + W +P  DGG+ I GY +++ E+    W +CN T ++   F VT L E + Y FRV 
Sbjct: 19396 VSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVF 19455

Query: 586   AVNKM-GIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDL 644
             A N    +  PS  + P+   D  E  R+       +   I+V           G    +
Sbjct: 19456 ARNAADSVSEPSESTGPIIVKDDVEPPRVMM--DVKFRDVIVVKA---------GEVLKI 19504

Query: 645   SVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAE 704
             +   A R   V+SW                  + G E  +R  TE+ + +    L  + +
Sbjct: 19505 NADIAGRPLPVISW-----------------AKDGIEIEERARTEI-ISTDNHTLLTVKD 19546

Query: 705   GKSYCFRVRCSNSAGVGEPSEATEVTVVGDK-LDIPKAP-GKIIPSRNTDTSVVVSW-EE 761
                 C R          +    T    V  K LD P  P G +  +  T     +SW   
Sbjct: 19547 ----CIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRP 19602

Query: 762   SKDAKELVGYYI-EASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLS 820
              +D    + YYI E        W  C    ++ +      L+ G  YIFRV  VN  G+ 
Sbjct: 19603 QEDGGADIDYYIVEKRETSHLAWTICEGE-LQMTSCKVTKLLKGNEYIFRVTGVNKYGVG 19661

Query: 821   EYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVI 880
             E   +S AI+       PSPP  +      ++SM L W +P+  GG+EI+GY +  RE  
Sbjct: 19662 E-PLESVAIKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSEISGYIIERREKN 19720

Query: 881   DGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTI 940
                  +W   N K V +   K + L+E   Y+++V A N AGL  PS  S   + E+  +
Sbjct: 19721 SL---RWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAED-PV 19776

Query: 941   AVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIK 1000
              +P PP   K  +  K ++ + W  P+  G  P+TGY V+ K  K+ +  W+  +  +++
Sbjct: 19777 FLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYK--KSDDTDWK-TSIQSLR 19833

Query: 1001  NVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPG----------TKEVVV 1050
                  + GL  G  YVFRV+++N+ G   PSD + P +A+ R             K ++V
Sbjct: 19834 GTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIV 19893

Query: 1051  NVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLG 1110
                    +++ F   +  P     WSK    T+   R  V++  ++T +T ++   +D G
Sbjct: 19894 KAGASFTMTVPF---RGRPVPNVLWSKP--DTDLRTRAYVDTTDSRTSLTIENANRNDSG 19948

Query: 1111  IYSCDVTDTDGIASSYLI 1128
              Y+  + +    AS  L+
Sbjct: 19949 KYTLTIQNVLSAASLTLV 19966



 Score =  189 bits (481), Expect = 1e-47
 Identities = 203/854 (23%), Positives = 338/854 (39%), Gaps = 114/854 (13%)

Query: 294   VKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRAS 353
             V+    I G P P   W  +   I    +   Y +E+      L I  C   DT +Y+ +
Sbjct: 11223 VRFPAIIRGVPVPTAKWTTDGSEIKTDEH---YTVETDNFSSVLTIKNCLRRDTGEYQIT 11279

Query: 354   AMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF-GVTPYGYASRFEIHFDDKFD 412
               N  G  +    + V    G            T P++   VTP                
Sbjct: 11280 VSNAAGSKTVAVHLTVLDVPGP----------PTGPINILDVTP---------------- 11313

Query: 413   VSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHL 472
                    E M++  +    P+     P I +           W        +  L   HL
Sbjct: 11314 -------EHMTISWQ---PPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHL 11363

Query: 473   NKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQ 532
              K  E  Y  RVR                        P+ P      +  ++   +SW  
Sbjct: 11364 QKGCE--YVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTL 11421

Query: 533   PAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGI 592
             P  DGGSPI GY++++ EV T  W + N TP+   +F VTGL EG +Y FRV A N  G+
Sbjct: 11422 PKSDGGSPITGYYMERREV-TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGL 11480

Query: 593   GFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRS 652
               PS  S+P+ A           RP  P                 PGPP +  + + +R 
Sbjct: 11481 SKPSPSSDPIKAC----------RPIKP-----------------PGPPINPKLKDKSRE 11513

Query: 653   YVVLSWKPPGQRGHEGIMYFVEKCEA-GTENWQRVNTELPVKSPRFALFDLAEGKSYCFR 711
                L W  P   G   I+ +V +C+  GT  W R+N +  ++   F +  L EG  Y FR
Sbjct: 11514 TADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFR 11573

Query: 712   VRCSNSAGVGEPSEATEVTVVGDKLDIPKAP-----GKIIPSRNTDTSVVVSWEESKDAK 766
             ++ +N  G GEP E  E  +  D L  P+         +I  R   T  +++  + +   
Sbjct: 11574 IKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEP 11633

Query: 767   ELVGYYIEASVAGSGKWEPCNNNP-----VKGSRFTCHGLVTGQSYIFRVRAVNAAGLSE 821
             ++        +    + +   + P     +K +    HG      YI     ++A   S 
Sbjct: 11634 DITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHG-----KYI-----ISAKNSSG 11683

Query: 822   YSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVID 881
             ++Q S  + V   +  P P  ++      +++  + W+ P   GG+EIT + V YR+   
Sbjct: 11684 HAQGSAIVNV---LDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRK--- 11737

Query: 882   GVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIA 941
               P +   + V +   +    +NL  N  Y F+V A N  G+G P+  ++        I 
Sbjct: 11738 --PNQKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVG-PTIETKTPILAINPID 11794

Query: 942   VPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKN 1001
              PG P +L  ++  K  + L+W+ P + G +P   Y V+ +  K  +D W  +++ +IK 
Sbjct: 11795 RPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVE-RRLKGSDD-WERVHKGSIKE 11852

Query: 1002  VYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVIS-- 1059
              +  V    E   Y FRV+  N+ G    SD         +   ++ V+++   GV++  
Sbjct: 11853 THYMVDRCVENQIYEFRVQTKNEGG---ESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVK 11909

Query: 1060  ----LNFECD-KMTPKSEFSWSKDYVSTE--DSPRLEVESKGNKTKMTFKDLGMDDLGIY 1112
                 +  E   +  P  E +W+KD  +T+   SPR++++++ + +K +       D G Y
Sbjct: 11910 AGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKY 11969

Query: 1113  SCDVTDTDGIASSY 1126
                 T+T G   +Y
Sbjct: 11970 VVTATNTAGSFVAY 11983



 Score =  189 bits (481), Expect = 1e-47
 Identities = 170/620 (27%), Positives = 261/620 (42%), Gaps = 78/620 (12%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVR--MGEYYEQYSAY 496
             P+  W + G  + PS   Q   +   + LT  +  ++D G YTI      G   E     
Sbjct: 14104 PKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVT 14163

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
             V       ++ G P  P+++  + A K    ++W  P  DGGSPI  Y ++K E     W
Sbjct: 14164 VL------DVPGPPG-PVEISNVSAEK--ATLTWTPPLEDGGSPIKSYILEKRETSRLLW 14214

Query: 557   SQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSR 616
             +  ++  ++  R   T LI+G  YIFRV AVN  G G P + SEPV  +D       +  
Sbjct: 14215 TVVSE-DIQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQ-SEPVKMVD-------RFG 14265

Query: 617   PSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEK 675
             P                    PGPP    V+  T++   +SWK P   G   I  Y VE+
Sbjct: 14266 P--------------------PGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVER 14305

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
              E  +  W R   + PV   R  +  L EG +Y FRV   N AG+G PSEA++  ++ D 
Sbjct: 14306 REKKSLRWVRA-IKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDA 14364

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKW-EPCNNNPVK 792
                P  P     +  T  S  ++W +       E+ GY +E    G   W +      ++
Sbjct: 14365 AYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALR 14424

Query: 793   GSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRD 852
              ++F    L T + Y FR+ A+N AG+ E +   +   V+  +AP     D       R 
Sbjct: 14425 ITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAP-----DFELDAELRR 14479

Query: 853   SMVLGWKQPDKIGGAEITGYYVNYREVIDGVPG---KWREANVKAVSE------EAYKIS 903
             ++V+              G  +     I G P     W + N+   +       E++ + 
Sbjct: 14480 TLVVR------------AGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESFTLL 14527

Query: 904   NLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQW 963
              + E   Y      M +     P+     F      +  PGP  +L+ +++ KDS+ L W
Sbjct: 14528 IIPECNRYDTGKFVMTIEN---PAGKKSGF-VNVRVLDTPGPVLNLRPTDITKDSVTLHW 14583

Query: 964   KPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAIN 1023
               P+  G + +T Y V+ +EA  K   +        K  Y KV GL EG  Y FRV A N
Sbjct: 14584 DLPLIDGGSRITNYIVEKREATRK--SYSTATTKCHKCTY-KVTGLSEGCEYFFRVMAEN 14640

Query: 1024  QAGVGKPSDLAGPVVAETRP 1043
             + G+G+P++   PV A   P
Sbjct: 14641 EYGIGEPTETTEPVKASEAP 14660



 Score =  189 bits (480), Expect = 2e-47
 Identities = 175/614 (28%), Positives = 265/614 (43%), Gaps = 107/614 (17%)

Query: 462  GERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEA 521
            G ++ L      ++D G Y I         +++A      A  E+   P   LD+K +  
Sbjct: 8851 GTKSELIIKDALRKDHGRYVITAT-NSCGSKFAA------ARVEVFDVPGPVLDLKPVVT 8903

Query: 522  NKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYI 581
            N+   +++W  P  DGGS I G+ I++ +    +W Q  +T  + ++  +TGL+EG+ Y 
Sbjct: 8904 NRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIET--ERSKCDITGLLEGQEYK 8961

Query: 582  FRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPP 641
            FRV A NK G G P  +  P+ A+DP                               GPP
Sbjct: 8962 FRVIAKNKFGCGPPVEIG-PILAVDPL------------------------------GPP 8990

Query: 642  TD---LSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRF 697
            T    L+ TE T+S + L WK P   G   I  Y +EK      +++RVN  L   +  F
Sbjct: 8991 TSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRL-CPTTSF 9049

Query: 698  ALFDLAEGKSYCFRVRCSNSAGVGEPSEATEV---------------TVVGDKLDIPKAP 742
             + +L E + Y FRV+  N  G  EPS    V               +V GD + +    
Sbjct: 9050 LVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGE 9109

Query: 743  GKIIPSRNTDTSV-VVSW-------EESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGS 794
               IP+  T   +  + W       E+  DA ++    +  S A +    P      KG+
Sbjct: 9110 PVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGT 9169

Query: 795  RFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSM 854
                          + V A N  G    +   E  +       PSPP ++   +   +S 
Sbjct: 9170 --------------YTVTASNRLGSVFRNVHVEVYD------RPSPPRNLAVTDIKAESC 9209

Query: 855  VLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQ 914
             L W  P   GG+EIT Y ++ R+       +W E    AV E+ Y I  L  N  Y+F+
Sbjct: 9210 YLTWDAPLDNGGSEITHYVIDKRDA-SRKKAEWEEVTNTAV-EKRYGIWKLIPNGQYEFR 9267

Query: 915  VAAMNMAGLGAPSAVSECFKCEEWTI----AVPGPPHSLKCSEVRKDSLVLQWKPPVHSG 970
            V A+N  G+       EC K ++  I     +PGPP   K     K S+++ W PP+ +G
Sbjct: 9268 VRAVNKYGIS-----DEC-KSDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNG 9321

Query: 971  RTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLK-----VRGLKEGVSYVFRVRAINQA 1025
             +P+TGY+++ +E  +    W  ++ A I  V LK     V  L EGV Y FR  AIN A
Sbjct: 9322 GSPITGYWLEKREEGS--PYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAA 9379

Query: 1026 GVGKPSDLAGPVVA 1039
            G+G PS+ + P VA
Sbjct: 9380 GIGPPSEPSDPEVA 9393



 Score =  189 bits (480), Expect = 2e-47
 Identities = 195/781 (24%), Positives = 325/781 (41%), Gaps = 123/781 (15%)

Query: 276   APEFIIKP------RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIE 329
             A + +I+P       S++V   +++K+   I+G P+P +TW K+ +P+       +  + 
Sbjct: 16918 AKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLK---QTTRINVT 16974

Query: 330   SRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRY----KG--EFDETRFHA 383
                 + TL I     +D  QY  +  NV G+ +A   +V        KG  +FD+     
Sbjct: 16975 DSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDV---- 17030

Query: 384   GASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQW 443
              A ++ LS+    Y    +   +   K D +                             
Sbjct: 17031 SAESITLSWNPPLYTGGCQITNYIVQKRDTT----------------------------- 17061

Query: 444   YRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV---FVR 500
                      + W     +  R TL  + L    E  Y  R+     Y Q  A      V 
Sbjct: 17062 --------TTVWDVVSATVARTTLKVTKLKTGTE--YQFRIFAENRYGQSFALESDPIVA 17111

Query: 501   DADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCN 560
                 +  G P  P        +KD ++I W +P  +GGSP++GY +++ E  +  W++ N
Sbjct: 17112 QYPYKEPGPPGTPF---ATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVN 17168

Query: 561   DTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAP 620
              T +   +F    L EG  Y FRV A N +G+G  S+ SE   A DP +           
Sbjct: 17169 KTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDP---------- 17218

Query: 621   WTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAG 679
                              PG P  + V    R+ + L W  P   G   I  Y VEK +  
Sbjct: 17219 -----------------PGTPEPIMVK---RNEITLQWTKPVYDGGSMITGYIVEKRDLP 17258

Query: 680   TENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAG-VGEPSEATEVTVVGDKLDI 738
                W + +    +++ +F +  L E + Y FRV   N+AG + +PS++T      D++++
Sbjct: 17259 DGRWMKASFTNVIET-QFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVEL 17317

Query: 739   PKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEAS--VAGSGKWEPCNNNPVKGSRF 796
             P+     +  +  DT VV + E  +   ++ G  +     + G  + E      +K + F
Sbjct: 17318 PRIS---MDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDF 17374

Query: 797   TCHGLVT------GQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESF 850
                 +V       G  YI  +RA N AG   +  +   ++V     PP  P  +T + S 
Sbjct: 17375 KALLIVKDAIRIDGGQYI--LRASNVAGSKSFPVN---VKVLDRPGPPEGPVQVTGVTSE 17429

Query: 851   RDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMV 910
             + S+   W  P + GG++I+ Y V  RE        W     + V+  + K++ L E   
Sbjct: 17430 KCSLT--WSPPLQDGGSDISHYVVEKRETSRLA---WTVVASEVVTN-SLKVTKLLEGNE 17483

Query: 911   YQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSG 970
             Y F++ A+N  G+G P   +       + +  PGPP SL+ + + KDS+ + W  P   G
Sbjct: 17484 YVFRIMAVNKYGVGEPLESAPVLMKNPFVL--PGPPKSLEVTNIAKDSMTVCWNRPDSDG 17541

Query: 971   RTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKP 1030
              + + GY V+ ++      +W   N+  I ++ L+V GL E   Y FRV A N AGVG+P
Sbjct: 17542 GSEIIGYIVEKRDRSG--IRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEP 17599

Query: 1031  S 1031
             S
Sbjct: 17600 S 17600



 Score =  188 bits (478), Expect = 3e-47
 Identities = 179/629 (28%), Positives = 266/629 (42%), Gaps = 86/629 (13%)

Query: 439   PEIQWYRN-GVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
             PE++W R+ G  L  +    T        L   ++N+ D G Y + V      +  SA+V
Sbjct: 15585 PEVKWARDHGESLDKASIEST---SSYTLLIVGNVNRFDSGKYILTVENSSGSK--SAFV 15639

Query: 498   FVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
              VR  D      P  P D+K  E  K  + ++W  P +DGGS I  Y ++K E    ++S
Sbjct: 15640 NVRVLDT-----PGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYS 15694

Query: 558   ----QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARL 613
                  C+ T  K     V  L EG SY FRV A N+ GIG P+  +E V A +       
Sbjct: 15695 TVATNCHKTSWK-----VDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASER------ 15743

Query: 614   KSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YF 672
                                     P PP  +++ + TR+ V LSW+ P   G   I+ Y 
Sbjct: 15744 ------------------------PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYI 15779

Query: 673   VEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVV 732
             VE    G++ W    T   VK     +  L +G+ Y FRV   N  G+ +P + + V V+
Sbjct: 15780 VEMQTKGSDKWATCAT---VKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLS-VPVI 15835

Query: 733   GDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVK 792
                L IP A   +      +T  V++ E+ K     +G    A       W   +N P+K
Sbjct: 15836 AKDLVIPPAFKLLF-----NTFTVLAGEDLKVDVPFIGRPTPAVT-----WHK-DNVPLK 15884

Query: 793   GSRFTCHGLVTGQSYIFRVRAVNAAGLSEY-----SQDSEAIEVKAAIA--PPSPPC-DI 844
              +    +   T  + +  ++      +  Y     +   EAIE    I    P PP   +
Sbjct: 15885 QTT-RVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPV 15943

Query: 845   TCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISN 904
                E   DS+ L W  P   GG+ I  Y V  R   D     W+  +   V+    K   
Sbjct: 15944 KMDEVTADSITLSWGPPKYDGGSSINNYIVEKR---DTSTTTWQIVSA-TVARTTIKACR 15999

Query: 905   LKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWK 964
             LK    YQF++AA N    G  + ++      ++   VPGPP +   +   +DS+ +QW 
Sbjct: 16000 LKTGCEYQFRIAAENR--YGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWN 16057

Query: 965   PPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQ 1024
              P+  G + V GY ++ KE  +    W  LN+  I     K  GL+EGV Y FRV A N 
Sbjct: 16058 EPISDGGSRVIGYHLERKERNS--ILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENI 16115

Query: 1025  AGVGKPSDLAGPVVAE---TRPGTKEVVV 1050
              G+GKPS ++   VA      PG  E ++
Sbjct: 16116 VGIGKPSKVSECYVARDPCDPPGRPEAII 16144



 Score =  186 bits (473), Expect = 1e-46
 Identities = 204/782 (26%), Positives = 323/782 (41%), Gaps = 112/782 (14%)

Query: 474  KEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQP 533
            + D GLY I+V       +    V V D        P  P++    +  K  ++  W+ P
Sbjct: 8468 RPDHGLYMIKVENDHGIAKAPCTVSVLDT-------PGPPINFVFEDIRKTSVLCKWEPP 8520

Query: 534  AVDGGSPILGYFIDKCE-VGTDS-WSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMG 591
              DGGS I+ Y ++K +    DS W     T ++  ++ VT LIEG+ Y+FRVRA N+ G
Sbjct: 8521 LDDGGSEIINYTLEKKDKTKPDSEWIVVTST-LRHCKYSVTKLIEGKEYLFRVRAENRFG 8579

Query: 592  IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATR 651
             G P  VS+P+ A DP                              P  P    V + T 
Sbjct: 8580 PG-PPCVSKPLVAKDPFGP---------------------------PDAPDKPIVEDVTS 8611

Query: 652  SYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFR 711
            + +++ W  P   G   + Y++EK E  + +W RVN  L + + +  +  L EG +Y FR
Sbjct: 8612 NSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSL-LNALKANVDGLLEGLTYVFR 8670

Query: 712  VRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTS---VVVSWEES--KDAK 766
            V   N+AG G+ S  ++     D +     PG  IP R TDTS   + + WE        
Sbjct: 8671 VCAENAAGPGKFSPPSDPKTAHDPI---SPPGPPIP-RVTDTSSTTIELEWEPPAFNGGG 8726

Query: 767  ELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDS 826
            E+VGY+++  + G+ +W  C    +K  ++T   +  G  Y  RV AVNAAG      ++
Sbjct: 8727 EIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGP-PGET 8785

Query: 827  EAIEVKAAIAPPSPPCDITCLESFR---------DSMVLGWKQPDKIGGAEITGYYVNYR 877
            + + V     PP+   D++     +          ++V G   P K+   E  G     R
Sbjct: 8786 QPVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKE-EGELDKDR 8844

Query: 878  EVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEE 937
             VID         NV   SE   K +  K++   ++ + A N  G    +A  E F    
Sbjct: 8845 VVID---------NVGTKSELIIKDALRKDH--GRYVITATNSCGSKFAAARVEVFD--- 8890

Query: 938  WTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEA 997
                VPGP   LK     +   +L W  P   G + +TG+ ++ K+AK     WR   E 
Sbjct: 8891 ----VPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKM--HTWRQPIET 8944

Query: 998  AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPG----TKEVVVNVD 1053
              +     + GL EG  Y FRV A N+ G G P ++ GP++A    G     + +     
Sbjct: 8945 --ERSKCDITGLLEGQEYKFRVIAKNKFGCGPPVEI-GPILAVDPLGPPTSPERLTYTER 9001

Query: 1054 DDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYS 1113
                I+L+++  +    S            D P  E  +K      +F    +D+  +Y 
Sbjct: 9002 TKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYE 9061

Query: 1114 CDVTDTDGIASS-------YLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRF 1166
              V   + I  S        +I ++E+   + L    +  T+ VK+   V I        
Sbjct: 9062 FRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHI-------- 9113

Query: 1167 WMQAEKLSG--NAKVNYIFNEKEIFEGPK-----YKMHIDRNTGIIEMFMEKLQDEDEGT 1219
                  ++G    K+ +  NE  + E P       K  + R+    E+ + K   ED+GT
Sbjct: 9114 ---PADVTGLPMPKIEWSKNE-TVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGT 9169

Query: 1220 YT 1221
            YT
Sbjct: 9170 YT 9171



 Score =  186 bits (473), Expect = 1e-46
 Identities = 159/643 (24%), Positives = 266/643 (41%), Gaps = 71/643 (11%)

Query: 411   FDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFS 470
             FD    + GE++ +   V   P      P + W+++GV +     ++        +L   
Sbjct: 21660 FDGLIIKSGESLRIKALVQGRPV-----PRVTWFKDGVEIEKRMNMEITDVLGSTSLFVR 21714

Query: 471   HLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISW 530
                ++  G+YT+  +      +    V V+D   ++ G       ++      + + + W
Sbjct: 21715 DATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGP------IRFTNITGEKMTLWW 21768

Query: 531   KQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKM 590
               P  DG +PI  Y I+K E    +W+   D   +   +    LI G  Y FRV AVNK 
Sbjct: 21769 DAPLNDGCAPITHYIIEKRETSRLAWALIEDK-CEAQSYTAIKLINGNEYQFRVSAVNKF 21827

Query: 591   GIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEAT 650
             G+G P   S+PV A                   QI  T        VP  P     +  T
Sbjct: 21828 GVGRPLD-SDPVVA-------------------QIQYT--------VPDAPGIPEPSNIT 21859

Query: 651   RSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYC 709
              + + L+W +P    G E   Y +E+ E  +  W +V ++ P+   RF +  L EG  Y 
Sbjct: 21860 GNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYE 21919

Query: 710   FRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKE 767
             F V   N+AGVG  S  + +    + ++ P  P  +  +  + T+V + W +       E
Sbjct: 21920 FHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGME 21979

Query: 768   LVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSE 827
             ++GY IE   A  G W   N      +R+T   L  G+ Y FRV A+N AG  +  + + 
Sbjct: 21980 IIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTG 22039

Query: 828   AIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKW 887
              I  KA     +P  DI    +F+ + V+         GA I  +               
Sbjct: 22040 TI--KAVDRLTAPELDIDA--NFKQTHVVR-------AGASIRLFIAYQGRPTPTAVWSK 22088

Query: 888   REANVKAVSE-------EAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTI 940
              ++N+   ++           + N   N   ++ +   N +G       S+        +
Sbjct: 22089 PDSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSG-------SKSITFTVKVL 22141

Query: 941   AVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIK 1000
               PGPP  +   +V + S  L W  P+  G   +  Y V+ +EA  +   W+ ++E   +
Sbjct: 22142 DTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRR--SWQVISEKCTR 22199

Query: 1001  NVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRP 1043
              ++ KV  L EGV Y FRV A+N+ GVG+P ++  P+VA  +P
Sbjct: 22200 QIF-KVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQP 22241



 Score =  186 bits (473), Expect = 1e-46
 Identities = 215/868 (24%), Positives = 351/868 (40%), Gaps = 112/868 (12%)

Query: 274   LHAPEFIIKP---RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIES 330
             L APE  I     ++H V    +++L  +  G P P   W K    +++ A+     I +
Sbjct: 22047 LTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRAD-----IHT 22101

Query: 331   RYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPL 390
                  TL +  C+  D  +Y  +  N  G  S   +V V    G              P+
Sbjct: 22102 TDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGP-----------PGPI 22150

Query: 391   SFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPL 450
             +F     G A+                +   +  G R      I H+  E +        
Sbjct: 22151 TFKDVTRGSATLMW-------------DAPLLDGGAR------IHHYVVEKR------EA 22185

Query: 451   SPSKWVQTLWSGERATLTFSHLNKEDEGL-YTIRVRMGEYYEQYSAYVFVRDADAEIEGA 509
             S   W Q +   E+ T     +N   EG+ Y  RV     Y     Y       A  + A
Sbjct: 22186 SRRSW-QVI--SEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPA 22242

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P   LDV  ++ +K   +++W +P  DGGS I GY ++  + G+D W +   T  K   F
Sbjct: 22243 PPRRLDV--VDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHT--KQLTF 22298

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTG---QII 626
              V  L+E   Y FRV+A N  G   P      V   +P      +  P+A  TG   Q+I
Sbjct: 22299 TVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEP------QIEPTADLTGITNQLI 22352

Query: 627   VTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRV 686
               +         G P  + V  + R    ++WK    R        +++ +  +    + 
Sbjct: 22353 TCK--------AGSPFTIDVPISGRPAPKVTWKLEEMR--------LKETDRVSITTTKD 22396

Query: 687   NTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKII 746
              T L VK       D   G S  + +   N+AGV   + +  V V+G    +    G I 
Sbjct: 22397 RTTLTVK-------DSMRGDSGRYFLTLENTAGV--KTFSVTVVVIGRPGPV---TGPIE 22444

Query: 747   PSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTG 804
              S  +  S V+SW E KD    E+  Y +E   +G+  W+  N++ VK ++     L   
Sbjct: 22445 VSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSS-VKRTQIKVTHLTKY 22503

Query: 805   QSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKI 864
               Y FRV + N  G+S+   +S  I  +    PPS P          ++M + W++P   
Sbjct: 22504 MEYSFRVSSENRFGVSK-PLESAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHD 22562

Query: 865   GGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLG 924
             GG++I GY+V  +E    +   W + N     E  YK++ L E + YQF+  A+N AG+ 
Sbjct: 22563 GGSKIIGYWVEKKERNTIL---WVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVS 22619

Query: 925   APSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE- 983
               S  S     +   +  PG P   + ++V + ++ L W  P + G + V GY ++ K  
Sbjct: 22620 KASEASRPIMAQN-PVDAPGRP---EVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPV 22675

Query: 984   AKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGV-GKPSDLAGPVVA--E 1040
             ++  + +W   N   + + +  V  L EG +Y FRV A N AGV  K S+  GPV    E
Sbjct: 22676 SEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDE 22735

Query: 1041  TRPGTKEVVVNVDDDGVISLNFECDKM-------TPKSEFSWSKDYVSTEDSPRLEVESK 1093
               P   E+   +  D ++++    D +        P+ +  W+K     +   ++ ++  
Sbjct: 22736 YAPPKAELDARLHGD-LVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYT 22794

Query: 1094  GNKTKMTFKDLGMDDLGIYSCDVTDTDG 1121
             G +     K     D G Y+  V +  G
Sbjct: 22795 GKRATAVIKFCDRSDSGKYTLTVKNASG 22822



 Score =  186 bits (472), Expect = 2e-46
 Identities = 178/662 (26%), Positives = 274/662 (41%), Gaps = 105/662 (15%)

Query: 418  EGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDE 477
            EGE +S+       P      P + W+++G  +  S  +        A L      + D 
Sbjct: 8095 EGEKLSIPVPFRAVPV-----PTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADA 8149

Query: 478  GLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAV 535
            G+YTI +  ++G               + ++ G P    D+K  +  K    ++W+ P  
Sbjct: 8150 GIYTITLENKLGSA---------TASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEF 8200

Query: 536  DGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFP 595
            DGG+PIL Y +++ E G  ++        K + + V  LI    Y FRV+AVNK+G G  
Sbjct: 8201 DGGTPILHYVLERREAGRRTYIPVMSGENKLS-WTVKDLIPNGEYFFRVKAVNKVGGGEY 8259

Query: 596  SRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVV 655
              +  PV A DP +                            P PP D+ V   T   + 
Sbjct: 8260 IELKNPVIAQDPKQP---------------------------PDPPVDVEVHNPTAEAMT 8292

Query: 656  LSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRC 714
            ++WKPP   G   IM Y +EK   G E W+R N  L V    +    L EGK Y FRVR 
Sbjct: 8293 ITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHL-VPILTYTAKGLEEGKEYQFRVRA 8351

Query: 715  SNSAGVGEPSEATEVTVVGDKLDIPKA--------------------PGKIIPSRN--TD 752
             N+AG+ EPS AT  T   D +D PK                      G   P+     D
Sbjct: 8352 ENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYPTITWIKD 8411

Query: 753  TSVVVSWEESKDAKELV----GYYIE-----------ASVAGSGKWEPCNNNPVKGSRFT 797
             +V+V  E  K A  LV    G   E            S+  S K E  +   V+ S   
Sbjct: 8412 ENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGE--SQLRVRDSLRP 8469

Query: 798  CHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLG 857
             HGL       + ++  N  G+      ++A    + +  P PP +    +  + S++  
Sbjct: 8470 DHGL-------YMIKVENDHGI------AKAPCTVSVLDTPGPPINFVFEDIRKTSVLCK 8516

Query: 858  WKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAA 917
            W+ P   GG+EI  Y +  ++     P          +    Y ++ L E   Y F+V A
Sbjct: 8517 WEPPLDDGGSEIINYTLEKKDKTK--PDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRA 8574

Query: 918  MNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGY 977
             N  G G P  VS+    ++     P  P      +V  +S++++W  P  +G +P+ GY
Sbjct: 8575 ENRFGPG-PPCVSKPLVAKD-PFGPPDAPDKPIVEDVTSNSMLVKWNEPKDNG-SPILGY 8631

Query: 978  FVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPV 1037
            +++ +E  +    W  +N++ +  +   V GL EG++YVFRV A N AG GK S  + P 
Sbjct: 8632 WLEKREVNS--THWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPK 8689

Query: 1038 VA 1039
             A
Sbjct: 8690 TA 8691



 Score =  186 bits (472), Expect = 2e-46
 Identities = 178/659 (27%), Positives = 264/659 (40%), Gaps = 81/659 (12%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P + W +   PL+    V    S    TL      K D G YTI ++     ++ +  + 
Sbjct: 13707 PSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISI- 13765

Query: 499   VRDADAEIEGAPAAPLD-VKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
                   ++ G P  P   +K  E   + + + W  P  DGGS I  Y ++K +   + W 
Sbjct: 13766 ------KVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWV 13819

Query: 558   QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRP 617
              C    V+   F VT L EG  Y FRV A NK G+G   + SEP+ A  P +        
Sbjct: 13820 TCASA-VQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLK-SEPIVARHPFD-------- 13869

Query: 618   SAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKC 676
                                VP  P   ++ +     V L+W  P + G   I  Y +E  
Sbjct: 13870 -------------------VPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFK 13910

Query: 677   EAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKL 736
             E  +  W+R N + P++   F +  L EG  Y FRV   N AGVG+PS  +E  V  D +
Sbjct: 13911 ERNSLLWKRAN-KTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPI 13969

Query: 737   DIPKAPGKIIPSRNTDTSVVVSWEESK--DAKELVGYYIEASVAGSGKWEPCNNNPVKGS 794
             D P  P  I  +RN   SV + W E K     +L GY +E     S  W   N+  V   
Sbjct: 13970 DPPGKPEVINITRN---SVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPEC 14026

Query: 795   RFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDS 853
              FT   LV G  Y FR+RA N AG +S  S+ +E I  K     P+   D T     +D 
Sbjct: 14027 AFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIVLDPT----IKDG 14082

Query: 854   MVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQF 913
             + +       +    I G  +            W +A       +  +I++   + +   
Sbjct: 14083 LTIKAGDTIVLNAISILGKPLP--------KSSWSKAGKDIRPSDITQITSTPTSSMLTI 14134

Query: 914   QVAAMNMAGLGAPSAVSEC-FKCEEWTIAV---PGPPHSLKCSEVRKDSLVLQWKPPVHS 969
             + A    AG    +A +    K E   + V   PGPP  ++ S V  +   L W PP+  
Sbjct: 14135 KYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLED 14194

Query: 970   GRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGK 1029
             G +P+  Y ++ +E       W  ++E  I++       L +G  Y+FRV A+N  G G+
Sbjct: 14195 GGSPIKSYILEKRETSRL--LWTVVSE-DIQSCRHVATKLIQGNEYIFRVSAVNHYGKGE 14251

Query: 1030  P--------SDLAGPVVAETRPGTKEVVVN---------VDDDGVISLNFECDKMTPKS 1071
             P         D  GP     +P    V  N         VDD G     +  ++   KS
Sbjct: 14252 PVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKS 14310



 Score =  186 bits (471), Expect = 2e-46
 Identities = 165/626 (26%), Positives = 258/626 (41%), Gaps = 74/626 (11%)

Query: 519   LEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTP--VKFARFPVTGLIE 576
             ++  K  + + W +P  DGGS I+GYF++ C++  D W +CN  P  +    +  TGL E
Sbjct: 12894 IDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEE 12953

Query: 577   GRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGI 636
                Y FR  A   + I  PS  S+PV  L  AE    +   S      + V         
Sbjct: 12954 KAQYQFRAIARTAVNISPPSEPSDPVTIL--AENVPPRIDLSVAMKSLLTVK-------- 13003

Query: 637   VPGPPTDLSVTEATRSYVVLSWKPPGQ--RGHEGIMYFVEKCEAGTENWQRVNTELPVKS 694
               G    L  T   +    +SWK  G   +  EGI   +++     E             
Sbjct: 13004 -AGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLE------------- 13049

Query: 695   PRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTS 754
                 LF +    S  + +   NS+G      +   T+    LD P  P  +  ++     
Sbjct: 13050 ----LFSVNRKDSGDYTITAENSSG------SKSATIKLKVLDKPGPPASVKINKMYSDR 13099

Query: 755   VVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVR 812
              ++SWE   +    E+  Y ++        W   +   V  +  +   L+ G  Y FR+ 
Sbjct: 13100 AMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVSAT-VPITSCSVEKLIEGHEYQFRIC 13158

Query: 813   AVNAAGLSEYSQDSEAIEVKAAIAPPSPP--CDITCLESF-RDSMVLGWKQPDKIGGAEI 869
             A N  G+     D    E   A  P  PP  CD   + +  +D M + WK P   GG+ I
Sbjct: 13159 AENKYGVG----DPVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPI 13214

Query: 870   TGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAV 929
             TGY +  RE        W + N K + E   K + L+E   Y+F+V A+N AG G PS  
Sbjct: 13215 TGYLLEKRET---QAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDA 13271

Query: 930   SECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKED 989
             S+     +     PGPP   K  +  + S+ L W  P + G +P+ GY V++K  +A  D
Sbjct: 13272 SKAAYARDPQYP-PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVK--RADSD 13328

Query: 990   QWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDL-------------AG 1035
              W   N    ++    +V GL E   Y FRV A+N+ G   PSD+              G
Sbjct: 13329 NWVRCNLPQNLQKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEG 13388

Query: 1036  PVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGN 1095
              + A+ R   K +++     GV    +   K  P  + +WSK  V+  D   L+++S   
Sbjct: 13389 ELDADLR---KTLILRA---GVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDF 13442

Query: 1096  KTKMTFKDLGMDDLGIYSCDVTDTDG 1121
              T +  +++   D G Y   + ++ G
Sbjct: 13443 DTFLRCENVNKYDAGKYILTLENSCG 13468



 Score =  184 bits (467), Expect = 6e-46
 Identities = 185/681 (27%), Positives = 281/681 (41%), Gaps = 137/681 (20%)

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
             VF R  DA     P  P + K  + ++  + ++W +P  DGG+P+ GY ++  E   D W
Sbjct: 18687 VFYRACDALYP--PGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEW 18744

Query: 557   SQCND-TPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPS----------RVSEPVAAL 605
             + C   T ++  +F VT L E   Y FR+ A+N  G+G P+          R+  P   L
Sbjct: 18745 TTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIEL 18804

Query: 606   DPAEKARLKSRPSAPWTGQIIVTEE---------EPSEGIV------------------- 637
             D   +  +  R SA  T ++ VT +         E +EGI+                   
Sbjct: 18805 DADLRKVVVLRASA--TLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTMLVIDN 18862

Query: 638   -------------------------------PGPPTDLSVTEATRSYVVLSWKPPGQRGH 666
                                            P  P +L++ E  +  V LSW+PP   G 
Sbjct: 18863 VTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGG 18922

Query: 667   EGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSE 725
               I  Y VEK E   + +  +       +  F + +L EG SY FRV  SN  G+G P+E
Sbjct: 18923 AKITNYIVEKRETTRKAYATITNNCTKTT--FRIENLQEGCSYYFRVLASNEYGIGLPAE 18980

Query: 726   ATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE--ESKDAKELVGYYIEASVAGSGKW 783
              TE   V +    P  PG++     T  +  + WE  ES    ++ GY +E    GS KW
Sbjct: 18981 TTEPVKVSEP---PLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKW 19037

Query: 784   EPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQ-----DSEAIEVKAAIAPP 838
               C    VK    T  GL  G+ Y+FRV AVN  G S+  Q      +  IE+K ++  P
Sbjct: 19038 STCTQ--VKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELP 19095

Query: 839   SPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEE 898
                 ++   E  +  +      P K G  + T   VN+R+  DG   K     V   S +
Sbjct: 19096 FHTFNVKAREQLKIDV------PFK-GRPQAT---VNWRK--DGQTLK-ETTRVNVSSSK 19142

Query: 899   AYKISNLKENM---VYQFQVAAMNMAG-LGAPSAVSECFKCEEWTIAVPGPPHSLKCSEV 954
                  ++KE     V  +++   N AG +  P  +          +  PGPP  ++  EV
Sbjct: 19143 TVTSLSIKEASKEDVGTYELCVSNSAGSITVPITII--------VLDRPGPPGPIRIDEV 19194

Query: 955   RKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVS 1014
               DS+ + W PP + G   ++ Y V+ KE  +    W  +++ A+    +K+  L  G  
Sbjct: 19195 SCDSITISWNPPEYDGGCQISNYIVEKKETTS--TTWHIVSQ-AVARTSIKIVRLTTGSE 19251

Query: 1015  YVFRVRAINQAGVGKPSDLAGPVVAE------TRPGTKEVV------------VNVDDDG 1056
             Y FRV A N+ G    S+ +  VVAE        PGT +VV            V V+D G
Sbjct: 19252 YQFRVCAENRYGKSSYSE-SSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGG 19310

Query: 1057  VISLNFECDKMTPKSEFSWSK 1077
                + +  +    +S   WSK
Sbjct: 19311 SRVIGYHLE-YKERSSILWSK 19330



 Score =  182 bits (462), Expect = 2e-45
 Identities = 161/687 (23%), Positives = 288/687 (41%), Gaps = 62/687 (9%)

Query: 451   SPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADA-EIEGA 509
             S   WV    +  R  L++   N ++  +Y  RV  GE   ++   +     +  +I   
Sbjct: 20015 SKKAWVSVTNNCNR--LSYKVTNLQEGAIYYFRVS-GE--NEFGVGIPAETKEGVKITEK 20069

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P+ P  +     +KD + ++W +P  DGGS I+ Y ++  E G  +W +C     K    
Sbjct: 20070 PSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKC--AVAKSTHH 20127

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              V+GL E   Y FRV A N+ G+  P  +  PV   +  E   +  +             
Sbjct: 20128 VVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMK------------- 20174

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTE 689
               PS  +     ++L V       + +S KP  +         + +     +   R NTE
Sbjct: 20175 NFPSHTVYVRAGSNLKVD------IPISGKPLPK-------VTLSRDGVPLKATMRFNTE 20221

Query: 690   LPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAP-GKIIPS 748
             +  ++    L +     +  + +  +NS+G       T+  +    LD P  P G ++ S
Sbjct: 20222 ITAENLTINLKESVTADAGRYEITAANSSGT------TKAFINIVVLDRPGPPTGPVVIS 20275

Query: 749   RNTDTSVVVSWEESK--DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQS 806
               T+ SV + WE  K     ++  Y +      +  W   +   V  +      L TG+ 
Sbjct: 20276 DITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSAT-VARTMMKVMKLTTGEE 20334

Query: 807   YIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGG 866
             Y FR++A N  G+S++  DS  + VK     P PP         R+S+ +GW +P   GG
Sbjct: 20335 YQFRIKAENRFGISDHI-DSACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGG 20393

Query: 867   AEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAP 926
             + + GY++   E+ D     W++AN   +    +K++ +   ++Y+F+V A N AG+G P
Sbjct: 20394 SAVVGYHL---EMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVGKP 20450

Query: 927   SAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKA 986
             S  SE        I    PP +++ +++ K+S+ L W+ P   G + +TGY V+ ++   
Sbjct: 20451 SHPSE----PVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLP- 20505

Query: 987   KEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG-VGKPSDLAGPVVAETRPGT 1045
              + +W   +   +      + GL +   Y FRV A N  G +  PS++ GP+      G 
Sbjct: 20506 -DGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGG 20564

Query: 1046  KEVVVNVDDDGVISLNFECDKMT-------PKSEFSWSKDYVSTEDSPRLEVESKGNKTK 1098
               + + ++   V+                 P     W KD    + +  + VE+  +   
Sbjct: 20565 PVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLAS 20624

Query: 1099  MTFKDLGMDDLGIYSCDVTDTDGIASS 1125
             +  KD    + G Y   + +  G AS+
Sbjct: 20625 ILIKDADRLNSGCYELKLRNAMGSASA 20651



 Score =  181 bits (460), Expect = 4e-45
 Identities = 158/602 (26%), Positives = 244/602 (40%), Gaps = 104/602 (17%)

Query: 509   APAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFAR 568
             AP  P   K  +  K    + W  P  DGGS + GY ++  E G + W +  D  V+  +
Sbjct: 10115 APPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTK 10174

Query: 569   FPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSE----------PVAALDPAEKARL----- 613
               VTGL EG  Y FRVRAVN  GIG P  V++          P   LD + + R+     
Sbjct: 10175 LVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAG 10234

Query: 614   -----------KSRPSAPW-------------------TGQIIVTEEEPSEGI------- 636
                        K  P+  W                   +  +I   +   +G+       
Sbjct: 10235 GVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGVYSLLAKN 10294

Query: 637   ---------------VPGPP-TDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAG 679
                            VPGP  T       T     L+W  P   G   I  Y +EK E+ 
Sbjct: 10295 EAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESD 10354

Query: 680   TENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIP 739
                W  V     V      +  L +GK+Y FR+   NS G+G   E +E  V+ + + +P
Sbjct: 10355 RRAWTPVT--YTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVP 10412

Query: 740   KAPGKIIPSRNTDTSVVVSWEESK--DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFT 797
             + P  +     T  +V ++W   K     E++ Y +E+ + G+ K+    N+ +   ++T
Sbjct: 10413 ERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYT 10472

Query: 798   CHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLG 857
               GL  G +Y +RV AVN  G  + S  ++ I  K  +APP+   D      FRD + + 
Sbjct: 10473 VKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLD------FRDKLTI- 10525

Query: 858   WKQPDKIGGA-EITGYYVNYREVIDGVPG---KWREANVKAVSEEAYKISNLKENMVYQF 913
                  ++G A  +TG Y        G P     W +     + ++   I      +  + 
Sbjct: 10526 -----RVGEAFALTGRY-------SGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEK 10573

Query: 914   QVAAMNMAG----LGAPSAVSECFKCEEWTIAVPGPP-HSLKCSEVRKDSLVLQWKPPVH 968
               A  + +G    +   S  S    C+   +  PGPP   +   EV KD +V+ WKPP+ 
Sbjct: 10574 IKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLD 10633

Query: 969   SGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVG 1028
              G + +T Y ++ KE    +D W  +  A+ K    KV  L EG  Y+FR+ A N  G+ 
Sbjct: 10634 DGGSKITNYIIEKKE--VGKDVWMPVTSASAKTT-CKVSKLLEGKDYIFRIHAENLYGIS 10690

Query: 1029  KP 1030
              P
Sbjct: 10691 DP 10692



 Score =  180 bits (457), Expect = 9e-45
 Identities = 195/764 (25%), Positives = 297/764 (38%), Gaps = 127/764 (16%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYR 351
             +N+K+   + G P+P VTW K      +     +   E+      L IN C   D+  Y 
Sbjct: 14776 DNIKVEIPVLGRPKPTVTWKKGD---QILKQTQRVNFETTATSTILNINECVRSDSGPYP 14832

Query: 352   ASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKF 411
              +A N+ GE+    ++ V    G            T P+ F      +            
Sbjct: 14833 LTARNIVGEVGDVITIQVHDIPGP----------PTGPIKFDEVSSDF------------ 14870

Query: 412   DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSH 471
              V+F  +      G        I ++  E++          + WV+   +  R T   + 
Sbjct: 14871 -VTFSWDPPENDGGV------PISNYVVEMR------QTDSTTWVELATTVIRTTYKATR 14917

Query: 472   LNKEDEGLYTIRVRMGEYY---EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIII 528
             L    E  Y  RV+    Y      ++   V +   ++ G P  P   +     KD + I
Sbjct: 14918 LTTGLE--YQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTP---QVTAVTKDSMTI 14972

Query: 529   SWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVN 588
             SW +P  DGGSPILGY +++ E     W   +   V    F  +GL +G +Y FRV A N
Sbjct: 14973 SWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAEN 15032

Query: 589   KMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTE 648
               G   PS+ SEP+ ALDP +                            PG P  L++T 
Sbjct: 15033 MAGKSKPSKPSEPMLALDPIDP---------------------------PGKPVPLNITR 15065

Query: 649   ATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKS 707
              T   V L W KP    G +   Y VEK +     W + N    +    F +  L E  +
Sbjct: 15066 HT---VTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFS-NILENEFTVSGLTEDAA 15121

Query: 708   YCFRVRCSNSAG-VGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEE----- 761
             Y FRV   N+AG +  PSE ++     D ++ PK     +  +  DT ++ + E      
Sbjct: 15122 YEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIK---VDVKFKDTVILKAGEAFRLEA 15178

Query: 762   ------------SKDAKELVG-YYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYI 808
                         SKD KEL G   +E  +A     +   N   K S     G  T     
Sbjct: 15179 DVSGRPPPTMEWSKDGKELEGTAKLEIKIA-----DFSTNLVNKDSTRRDSGAYT----- 15228

Query: 809   FRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAE 868
               + A N  G +++        VK    P  P   +   E   +  VL W  P   GGA+
Sbjct: 15229 --LTATNPGGFAKH-----IFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAK 15281

Query: 869   ITGYYVNYREVIDGVPGKWREANVKA-VSEEAYKISNLKENMVYQFQVAAMNMAGLGAPS 927
             I  Y V  RE       +    NV + V     K++ L +   Y F+V A+N  G+G P 
Sbjct: 15282 IDHYIVQKRET-----SRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPL 15336

Query: 928   AVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAK 987
                       +    P PP + + + + KDS+V+ W  P   G + +  Y V+ ++   +
Sbjct: 15337 ESEPVLAVNPY--GPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQ 15394

Query: 988   EDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPS 1031
               +W   N+  + ++  KV GL EG  Y FR+ A N AG+  PS
Sbjct: 15395 --RWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPS 15436



 Score =  180 bits (457), Expect = 9e-45
 Identities = 166/615 (26%), Positives = 262/615 (42%), Gaps = 61/615 (9%)

Query: 432   PEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVR--MGEY 489
             P +   +P + W +    L  ++ V    +     L  +   + D G Y +  R  +GE 
Sbjct: 14783 PVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEV 14842

Query: 490   YEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKC 549
              +  +  V       +I G P  P  +K  E + D++  SW  P  DGG PI  Y ++  
Sbjct: 14843 GDVITIQVH------DIPGPPTGP--IKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMR 14894

Query: 550   EVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAE 609
             +  + +W +   T ++   +  T L  G  Y FRV+A N+ G+G P   S  + A  P +
Sbjct: 14895 QTDSTTWVELATTVIR-TTYKATRLTTGLEYQFRVKAQNRYGVG-PGITSACIVANYPFK 14952

Query: 610   KARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGI 669
                                        VPGPP    VT  T+  + +SW  P   G   I
Sbjct: 14953 ---------------------------VPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPI 14985

Query: 670   M-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATE 728
             + Y VE+ E     WQ V+  L V    F    L +G +Y FRV   N AG  +PS+ +E
Sbjct: 14986 LGYHVERKERNGILWQTVSKAL-VPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSE 15044

Query: 729   VTVVGDKLDIPKAPGKIIPSRNTDTSVVVSW--EESKDAKELVGYYIEASVAGSGKWEPC 786
               +  D +D    PGK +P   T  +V + W   E     ++  Y +E     +G+W   
Sbjct: 15045 PMLALDPID---PPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKA 15101

Query: 787   NNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIAPPSPPCDIT 845
             N + +  + FT  GL    +Y FRV A NAAG +S  S+ S+AI  +  +  P    D+ 
Sbjct: 15102 NFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDV- 15160

Query: 846   CLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNL 905
                 F+D+++L   +  ++  A+++G      E      GK  E   K   + A   +NL
Sbjct: 15161 ---KFKDTVILKAGEAFRL-EADVSGRPPPTMEW--SKDGKELEGTAKLEIKIADFSTNL 15214

Query: 906   KENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHS-LKCSEVRKDSLVLQWK 964
                   +    A  +            F  +   +  PGPP   L  +EV  +  VL W 
Sbjct: 15215 VNKDSTRRDSGAYTLTATNPGGFAKHIFNVK--VLDRPGPPEGPLAVTEVTSEKCVLSWF 15272

Query: 965   PPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQ 1024
             PP+  G   +  Y V  +E       W  +  + ++   LKV  L +G  Y+FRV A+N+
Sbjct: 15273 PPLDDGGAKIDHYIVQKRETSRL--AWTNV-ASEVQVTKLKVTKLLKGNEYIFRVMAVNK 15329

Query: 1025  AGVGKPSDLAGPVVA 1039
              GVG+P + + PV+A
Sbjct: 15330 YGVGEPLE-SEPVLA 15343



 Score =  179 bits (455), Expect = 1e-44
 Identities = 207/860 (24%), Positives = 335/860 (38%), Gaps = 131/860 (15%)

Query: 280   IIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEI 339
             ++K R+ T     +VKL   I+G P P + WYK+   +  +A      +E+   + ++ I
Sbjct: 20576 VVKYRAGT-----SVKLRAGISGKPAPTIEWYKDDKELQTNA---LVCVENTTDLASILI 20627

Query: 340   NGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGY 399
                D  ++  Y     N  G  SA   V +    G                     P G 
Sbjct: 20628 KDADRLNSGCYELKLRNAMGSASATIRVQILDKPG---------------------PPGG 20666

Query: 400   ASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTL 459
                F+    +K  + +    +            +I H+  E +        S   W    
Sbjct: 20667 PIEFKTVTAEKITLLWRPPADDGGA--------KITHYIVEKR------ETSRVVWSMVS 20712

Query: 460   WSGERATLTFSHLNKEDEGLYTIRV----RMGEYYEQYSAYVFVRDADAEIEGAPAAPLD 515
                E   +T + + K +E ++ +R      +GE  E  S  V  ++A     G P  P  
Sbjct: 20713 EHLEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDS--VVAKNAFVT-PGPPGIP-- 20767

Query: 516   VKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLI 575
              +  +  K+ + + W +P  DGGS I GYF++K +  +  W +     ++  R  VTGL 
Sbjct: 20768 -EVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLT 20826

Query: 576   EGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEG 635
             E   Y +RV AVN  G G  S  SE   A DP +                          
Sbjct: 20827 ENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDP------------------------- 20861

Query: 636   IVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKS 694
               PGPP  + + ++T+S + L W  P   G   +  Y VE  +   E W  V+T+  V++
Sbjct: 20862 --PGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRT 20919

Query: 695   PRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTS 754
               + + +L  G +Y FRV   N AG GEP E  E     D L+ P+    +       TS
Sbjct: 20920 TEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVA----LRTS 20975

Query: 755   VVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAV 814
             V+   +  +D + L+ +  +     +  W     N    +R++     T  S +  +  V
Sbjct: 20976 VIA--KAGEDVQVLIPF--KGRPPPTVTWRKDEKNLGSDARYSIEN--TDSSSLLTIPQV 21029

Query: 815   NAAGLSEY---------SQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIG 865
                   +Y            S  + VK  +  P+    +      R ++ L W  P   G
Sbjct: 21030 TRNDTGKYILTIENGVGEPKSSTVSVK-VLDTPAACQKLQVKHVSRGTVTLLWDPPLIDG 21088

Query: 866   GAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGA 925
             G+ I  Y +  R   D     W   + K  S  ++K+ +L E   + F+V A N  G+G 
Sbjct: 21089 GSPIINYVIEKR---DATKRTWSVVSHKC-SSTSFKLIDLSEKTPFFFRVLAENEIGIGE 21144

Query: 926   PSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAK 985
             P   +E  K  E    VP P   L   +  K S++L W  P   G + +T Y V   E K
Sbjct: 21145 PCETTEPVKAAE----VPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVV---ERK 21197

Query: 986   AKEDQ-WRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETR-- 1042
              K +Q W   +    K   ++V  LKE     FRV A N+ G+  P  + GP+  +    
Sbjct: 21198 GKGEQTWS--HAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTI-GPITVKELII 21254

Query: 1043  ---------PGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESK 1093
                      PG  +V V +  +  + L +   K  PK   SW KD +  ++S  +     
Sbjct: 21255 TPEVDLSDIPGA-QVTVRIGHNVHLELPY---KGKPKPSISWLKDGLPLKESEFVRFSKT 21310

Query: 1094  GNKTKMTFKDLGMDDLGIYS 1113
              NK  ++ K+   +  G Y+
Sbjct: 21311 ENKITLSIKNAKKEHGGKYT 21330



 Score =  179 bits (454), Expect = 2e-44
 Identities = 174/639 (27%), Positives = 266/639 (41%), Gaps = 71/639 (11%)

Query: 500   RDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQC 559
             RDA  +    P   +D+K    +K    I WK+P  DGGS I+GY +D      + W + 
Sbjct: 13570 RDA-VKASQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFL-TEENKWQRV 13627

Query: 560   NDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDP--AEKARLKSRP 617
               +     ++    L EG+ Y FRV A N+ G G PS ++  V A D   A    LK  P
Sbjct: 13628 MKS--LSLQYSAKDLTEGKEYTFRVSAENENGEGTPSEIT--VVARDDVVAPDLDLKGLP 13683

Query: 618   SAPWTGQIIVTEEEPSEGIVP--GPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEK 675
                +    +  E       +P  G P              +SWK               K
Sbjct: 13684 DLCY----LAKENSNFRLKIPIKGKPAPS-----------VSWK---------------K 13713

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
              E       RV+ E    +    ++D  +  +  + +   N AG  E +    + VVG K
Sbjct: 13714 GEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGT--ISIKVVG-K 13770

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKG 793
               IP  P K      T  ++ + W   KD    E+  Y +E   + + KW  C +  V+ 
Sbjct: 13771 PGIPTGPIKF--DEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCAS-AVQK 13827

Query: 794   SRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDS 853
             + F    L  G  Y FRV A N  G+ E    SE I  +     P  P     ++   DS
Sbjct: 13828 TTFRVTRLHEGMEYTFRVSAENKYGVGE-GLKSEPIVARHPFDVPDAPPPPNIVDVRHDS 13886

Query: 854   MVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQF 913
             + L W  P K GG+ ITGY++ ++E    +   W+ AN   +    +K++ L E + Y+F
Sbjct: 13887 VSLTWTDPKKTGGSPITGYHLEFKERNSLL---WKRANKTPIRMRDFKVTGLTEGLEYEF 13943

Query: 914   QVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTP 973
             +V A+N+AG+G PS  SE     +  I  PG P  +    + ++S+ L W  P + G   
Sbjct: 13944 RVMAINLAGVGKPSLPSEPVVALD-PIDPPGKPEVIN---ITRNSVTLIWTEPKYDGGHK 13999

Query: 974   VTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG-VGKPSD 1032
             +TGY V+ ++  +K   W   N   +      V  L EG  Y FR+RA N AG +  PS+
Sbjct: 14000 LTGYIVEKRDLPSK--SWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSE 14057

Query: 1033  LAGPVVAETR---------PGTKE-VVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVST 1082
                 ++ +           P  K+ + +   D  V++      K  PKS  SWSK     
Sbjct: 14058 STETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKS--SWSKAGKDI 14115

Query: 1083  EDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1121
               S   ++ S    + +T K     D G Y+   T+  G
Sbjct: 14116 RPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFG 14154



 Score =  179 bits (453), Expect = 2e-44
 Identities = 161/559 (28%), Positives = 239/559 (42%), Gaps = 51/559 (9%)

Query: 508  GAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFA 567
            G P +P  +   E  K  I + WK+P  +GGSPI GY I+K       + + N       
Sbjct: 8988 GPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTT 9047

Query: 568  RFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALD---PAEKARLKSRPSAPWTGQ 624
             F V  L E + Y FRV+AVN++G   PS     V   D   P  K RL  R        
Sbjct: 9048 SFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDT----- 9102

Query: 625  IIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQ 684
            I V   EP    +P   T L + +       + W     +    I    +  +   E   
Sbjct: 9103 IKVKAGEPVH--IPADVTGLPMPK-------IEWS----KNETVIEKPTDALQITKEEVS 9149

Query: 685  RVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGK 744
            R   +  +  P+    D        + V  SN  G    +   EV       D P  P  
Sbjct: 9150 RSEAKTELSIPKAVREDKGT-----YTVTASNRLGSVFRNVHVEV------YDRPSPPRN 9198

Query: 745  IIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGK--WEPCNNNPVKGSRFTCHG 800
            +  +     S  ++W+   D    E+  Y I+   A   K  WE   N  V+  R+    
Sbjct: 9199 LAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVE-KRYGIWK 9257

Query: 801  LVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQ 860
            L+    Y FRVRAVN  G+S+  + S+ + ++     P PP     L   + SM++ W  
Sbjct: 9258 LIPNGQYEFRVRAVNKYGISDECK-SDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTP 9316

Query: 861  PDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYK-----ISNLKENMVYQFQV 915
            P   GG+ ITGY++  RE  +G P  W   +   +++   K     +  L E + YQF+ 
Sbjct: 9317 PLDNGGSPITGYWLEKRE--EGSP-YWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRA 9373

Query: 916  AAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVT 975
             A+N AG+G PS  S+     +  I  PGPP   +  +  K S+ L WKPP   G +P+ 
Sbjct: 9374 MAINAAGIGPPSEPSDPEVAGD-PIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIK 9432

Query: 976  GYFVDLKEAKAKEDQWRGLNEA--AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDL 1033
            GY V+++E    +  W+ +NE    I      V  LKE   Y FRV+A+N+AG  +PSD 
Sbjct: 9433 GYIVEMQEEGTTD--WKRVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDT 9490

Query: 1034 AGPVVAETRPGTKEVVVNV 1052
             G + A       EV +++
Sbjct: 9491 TGEIPATDIQEEPEVFIDI 9509



 Score =  178 bits (452), Expect = 3e-44
 Identities = 172/622 (27%), Positives = 261/622 (41%), Gaps = 83/622 (13%)

Query: 439  PEIQWYRNGVPLS-PSKWVQTLW-----SGERATLTFSHLNKEDEGLYTIRV--RMGEYY 490
            P+I+W +N   +  P+  +Q        S  +  L+     +ED+G YT+    R+G  +
Sbjct: 9123 PKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVF 9182

Query: 491  EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCE 550
                     R+   E+   P+ P ++   +   +   ++W  P  +GGS I  Y IDK +
Sbjct: 9183 ---------RNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRD 9233

Query: 551  VGTD--SWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPA 608
                   W +  +T V+  R+ +  LI    Y FRVRAVNK GI    + S+ V   DP 
Sbjct: 9234 ASRKKAEWEEVTNTAVE-KRYGIWKLIPNGQYEFRVRAVNKYGISDECK-SDKVVIQDPY 9291

Query: 609  EKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEG 668
                                        +PGPP    V   T+  +++SW PP   G   
Sbjct: 9292 R---------------------------LPGPPGKPKVLARTKGSMLVSWTPPLDNGGSP 9324

Query: 669  IM-YFVEKCEAGTENWQRVN----TELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEP 723
            I  Y++EK E G+  W RV+    T++ +K   F +  L EG  Y FR    N+AG+G P
Sbjct: 9325 ITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPP 9384

Query: 724  SEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE-ESKD-AKELVGYYIEASVAGSG 781
            SE ++  V GD +  P  P        T +S+ + W+  +KD    + GY +E    G+ 
Sbjct: 9385 SEPSDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTT 9444

Query: 782  KWEPCNNNPVKGSRFTCHGLVTG----QSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAP 837
             W+   N P K    TC  +V      + Y FRV+AVN AG SE S  +  I        
Sbjct: 9445 DWKRV-NEPDK-LITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEE 9502

Query: 838  PSPPCDI---TCLESFRDSMVLGWKQPDKIGGAEITGYYVNY-----REVIDGVPGKWRE 889
            P    DI    CL     S +   + P  I G         +     + + DGV     +
Sbjct: 9503 PEVFIDIGAQDCLVCKAGSQI---RIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPED 9559

Query: 890  ANVK-AVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHS 948
            A ++ A +     I   K +   ++ + A N AG        +   C    + VPGPP  
Sbjct: 9560 AQLETAENSSVIIIPECKRSHTGKYSITAKNKAG-------QKTANCRVKVMDVPGPPKD 9612

Query: 949  LKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRG 1008
            LK S++ + S  L WK P   G   + GY ++ +    K   W  +N       ++ V  
Sbjct: 9613 LKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGK--AWTKVNPDCGSTTFV-VPD 9669

Query: 1009 LKEGVSYVFRVRAINQAGVGKP 1030
            L     Y FRVRA N+ G+G P
Sbjct: 9670 LLSEQQYFFRVRAENRFGIGPP 9691



 Score =  178 bits (451), Expect = 4e-44
 Identities = 171/643 (26%), Positives = 272/643 (42%), Gaps = 79/643 (12%)

Query: 438   QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
             +P I W ++G+PL  +  +    S +  TL+    +K+D G Y I V       Q +A +
Sbjct: 16953 KPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITV--ANVVGQKTASI 17010

Query: 498   FVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
              +   D      P  P  VK  + + + I +SW  P   GG  I  Y + K +  T  W 
Sbjct: 17011 EIVTLDK--PDPPKGP--VKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWD 17066

Query: 558   QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRP 617
               + T V      VT L  G  Y FR+ A N+ G  F +  S+P+ A  P ++       
Sbjct: 17067 VVSAT-VARTTLKVTKLKTGTEYQFRIFAENRYGQSF-ALESDPIVAQYPYKE------- 17117

Query: 618   SAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKC 676
                                 PGPP     T  ++  +V+ W  P   G   ++ Y +E+ 
Sbjct: 17118 --------------------PGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERK 17157

Query: 677   EAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKL 736
             E  +  W +VN  + +   +F   +L EG  Y FRV   N  GVG+ S+ +E  V  D  
Sbjct: 17158 ERNSILWTKVNKTI-IHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPC 17216

Query: 737   DIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCNNNPVKGS 794
             D P  P  I+  RN    + + W +        + GY +E      G+W   +   V  +
Sbjct: 17217 DPPGTPEPIMVKRN---EITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIET 17273

Query: 795   RFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDS 853
             +FT  GL   Q Y FRV A NAAG +S+ S  +  I  K  +  P    D      FRD+
Sbjct: 17274 QFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMD----PKFRDT 17329

Query: 854   MVLGWKQPDKIGGAEITG-------YYVNYREVIDGVPGKWREANVKA--VSEEAYKISN 904
             +V+   +  ++  A++ G       +    +E+ +    + +  + KA  + ++A +I  
Sbjct: 17330 IVVNAGETFRL-EADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDG 17388

Query: 905   LKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHS-LKCSEVRKDSLVLQW 963
                    Q+ + A N+AG       S+ F      +  PGPP   ++ + V  +   L W
Sbjct: 17389 ------GQYILRASNVAG-------SKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTW 17435

Query: 964   KPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAIN 1023
              PP+  G + ++ Y V+ +E       W  +    + N  LKV  L EG  YVFR+ A+N
Sbjct: 17436 SPPLQDGGSDISHYVVEKRETSRL--AWTVVASEVVTN-SLKVTKLLEGNEYVFRIMAVN 17492

Query: 1024  QAGVGKPSDLA-----GPVVAETRPGTKEVVVNVDDDGVISLN 1061
             + GVG+P + A      P V    P + EV     D   +  N
Sbjct: 17493 KYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWN 17535



 Score =  177 bits (449), Expect = 7e-44
 Identities = 155/641 (24%), Positives = 273/641 (42%), Gaps = 58/641 (9%)

Query: 505   EIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPV 564
             ++   P  P  +   +  ++ + +SW +P  DGGS I+ Y ++     ++ WS+C    V
Sbjct: 16821 KVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSEC--ARV 16878

Query: 565   KFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQ 624
             K  +  +T L +G  Y+FRV AVN+ G   P  ++ P+ A D   +  +K   S      
Sbjct: 16879 KSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFS------ 16932

Query: 625   IIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQ 684
                     S  +  G    + V  + R    ++W   G                  +   
Sbjct: 16933 --------SYSVQVGQDLKIEVPISGRPKPTITWTKDG---------------LPLKQTT 16969

Query: 685   RVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGK 744
             R+N    +     ++ +  +     + +  +N   VG+ + + E+  + DK D PK P K
Sbjct: 16970 RINVTDSLDLTTLSIKETHKDDGGQYGITVANV--VGQKTASIEIVTL-DKPDPPKGPVK 17026

Query: 745   IIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLV 802
                   +  S+ +SW         ++  Y ++     +  W+  +   V  +      L 
Sbjct: 17027 F--DDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSAT-VARTTLKVTKLK 17083

Query: 803   TGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPD 862
             TG  Y FR+ A N  G S ++ +S+ I  +     P PP         +DSMV+ W +P 
Sbjct: 17084 TGTEYQFRIFAENRYGQS-FALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPV 17142

Query: 863   KIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAG 922
               GG+ + GY++  +E    +   W + N   + +  +K  NL+E + Y+F+V A N+ G
Sbjct: 17143 NNGGSPVIGYHLERKERNSIL---WTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVG 17199

Query: 923   LGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLK 982
             +G  S  SEC+   +     PG P  +    V+++ + LQW  PV+ G + +TGY V+ +
Sbjct: 17200 VGKASKNSECYVARD-PCDPPGTPEPIM---VKRNEITLQWTKPVYDGGSMITGYIVEKR 17255

Query: 983   EAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG-VGKPSDLAGPVVAET 1041
             +    + +W   +   +      V GL E   Y FRV A N AG + KPSD  GP+ A+ 
Sbjct: 17256 DLP--DGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKD 17313

Query: 1042  RPGTKEVVVNVDDDGVISLN------FECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKG 1094
                   + ++      I +N       E D    P     W +     E+S R E+++  
Sbjct: 17314 EVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTD 17373

Query: 1095  NKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKR 1135
              K  +  KD    D G Y    ++  G + S+ ++ + L R
Sbjct: 17374 FKALLIVKDAIRIDGGQYILRASNVAG-SKSFPVNVKVLDR 17413



 Score =  176 bits (445), Expect = 2e-43
 Identities = 165/624 (26%), Positives = 272/624 (43%), Gaps = 67/624 (10%)

Query: 519   LEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGR 578
             ++  ++ I + W  P  DGGS I+GY I+K + G + W +CN T V   ++ VTGL  G 
Sbjct: 21559 IDVTRETITLKWNPPLRDGGSKIVGYSIEKRQ-GNERWVRCNFTDVSECQYTVTGLSPGD 21617

Query: 579   SYIFRVRAVNKMG-IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIV 637
              Y FR+ A N +G I  PS+ S  +   D      ++  P             E  +G++
Sbjct: 21618 RYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGP-------------EYFDGLI 21664

Query: 638   PGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRF 697
                   +   E+ R   ++  +P  +     + +F +    G E  +R+N E+       
Sbjct: 21665 ------IKSGESLRIKALVQGRPVPR-----VTWFKD----GVEIEKRMNMEITDVLGST 21709

Query: 698   ALF--DLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKII-PSRNTDTS 754
             +LF  D        + V   N++G    S   E+     K+ +   PGK++ P R T+ +
Sbjct: 21710 SLFVRDATRDHRGVYTVEAKNASG----SAKAEI-----KVKVQDTPGKVVGPIRFTNIT 21760

Query: 755   ---VVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIF 809
                + + W+   +     +  Y IE        W    +   +   +T   L+ G  Y F
Sbjct: 21761 GEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDK-CEAQSYTAIKLINGNEYQF 21819

Query: 810   RVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEI 869
             RV AVN  G+     DS+ +  +     P  P          +S+ L W +P+  GG+EI
Sbjct: 21820 RVSAVNKFGVGR-PLDSDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEI 21878

Query: 870   TGYYVNYREVIDGVPGKW-REANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSA 928
               Y +  RE       +W +  + + +SE  +K++ L E   Y+F V A N AG+G  S 
Sbjct: 21879 QQYILERREKKST---RWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASG 21935

Query: 929   VSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKE 988
             +S   KC E  +  PGPP  +K ++  K ++ L+W  PV  G   + GY +++   KA  
Sbjct: 21936 ISRLIKCRE-PVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEM--CKADL 21992

Query: 989   DQWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKE 1047
               W  +N EA +K  Y  V  L+ G  Y FRV AIN AG G   ++ G + A  R    E
Sbjct: 21993 GDWHKVNAEACVKTRY-TVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPE 22051

Query: 1048  VVV-------NVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMT 1100
             + +       +V   G     F   +  P     WSK    +  S R ++ +  + + +T
Sbjct: 22052 LDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKP--DSNLSLRADIHTTDSFSTLT 22109

Query: 1101  FKDLGMDDLGIYSCDVTDTDGIAS 1124
              ++   +D G Y+  V +  G  S
Sbjct: 22110 VENCNRNDAGKYTLTVENNSGSKS 22133



 Score =  175 bits (443), Expect = 4e-43
 Identities = 164/643 (25%), Positives = 264/643 (41%), Gaps = 81/643 (12%)

Query: 412   DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSH 471
             DV   R G+T+ +  RV   PE     P+I W + G  L   K V  +    R  L    
Sbjct: 11611 DVITVRVGQTIRILARVKGRPE-----PDITWTKEGKVLVREKRVDLIQDLPRVELQIKE 11665

Query: 472   LNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWK 531
               + D G Y I  +    + Q SA V V D        P    ++K     K+   ISW+
Sbjct: 11666 AVRADHGKYIISAKNSSGHAQGSAIVNVLDR-------PGPCQNLKVTNVTKENCTISWE 11718

Query: 532   QPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMG 591
              P  +GGS I  + ++  +     WS       K  R     L+    Y FRV A NK+G
Sbjct: 11719 NPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTK--RLIKANLLANNEYYFRVCAENKVG 11776

Query: 592   IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATR 651
             +G       P+ A++P ++                           PG P +L + +  +
Sbjct: 11777 VGPTIETKTPILAINPIDR---------------------------PGEPENLHIADKGK 11809

Query: 652   SYVVLSWKPPG-QRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCF 710
             ++V L W+ P    G   + Y VE+   G+++W+RV+    +K   + +    E + Y F
Sbjct: 11810 TFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKG-SIKETHYMVDRCVENQIYEF 11868

Query: 711   RVRCSNSAGVGEPSEATEVTVVGDK----LDIPKAPGKIIPSRNT---DTSV------VV 757
             RV+  N  G  +  +  EV V  D     LD+  +    + + +T   +  V       V
Sbjct: 11869 RVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEV 11928

Query: 758   SWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAA 817
             +W + KDA +L        V    + +    +  K  R        G  Y+  V A N A
Sbjct: 11929 AWTKDKDATDLTR---SPRVKIDTRADSSKFSLTKAKRSD------GGKYV--VTATNTA 11977

Query: 818   GLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYR 877
             G         A      +  P P  ++  ++   D   + W  P+  GG EI  Y +   
Sbjct: 11978 G------SFVAYATVNVLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKC 12031

Query: 878   EVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEE 937
             E    V   W   +   ++     ++ L E   Y F+V A N  G G P+         +
Sbjct: 12032 ETKRMV---WSTYSATVLTPGT-TVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTK 12087

Query: 938   WTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEA 997
             +    PG P   + ++V K+ + + W PP + G   +TGYF++ KE  +   +W  +N++
Sbjct: 12088 YD--KPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHST--RWVPVNKS 12143

Query: 998   AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAE 1040
             AI    +KV+ L     Y FRV+A N+ G+G+PS  + PVVA+
Sbjct: 12144 AIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAK 12186



 Score =  174 bits (440), Expect = 8e-43
 Identities = 163/620 (26%), Positives = 263/620 (42%), Gaps = 82/620 (13%)

Query: 438   QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
             +P I W ++G+PL  S++V+   +  + TL+  +  KE  G YT+ +            V
Sbjct: 21287 KPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITV 21346

Query: 498   FVRDADAEIEGAPAAPL-DVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
                       G P+ P   ++  E   D +I+SW  P  +GG  I  Y I+K E    +W
Sbjct: 21347 ITL-------GPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNW 21399

Query: 557   SQ-CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKS 615
                C+   V    F V  L++   Y FRVRA N+ G+                       
Sbjct: 21400 KMVCSS--VARTTFKVPNLVKDAEYQFRVRAENRYGV----------------------- 21434

Query: 616   RPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYF-VE 674
               S P    IIV + +     +PGPP    +   T   + L+W  P   G   +  F VE
Sbjct: 21435 --SQPLVSSIIVAKHQFR---IPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVE 21489

Query: 675   KCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGD 734
             K E  +  WQ+VNT  P+    +    L EG  Y FRV   NSAG+  PS+ ++ T+   
Sbjct: 21490 KKERNSILWQKVNTS-PISGREYRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLAVS 21548

Query: 735   KLDIPKAPGKIIPSRNTDTSVVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVK 792
              +D P  P  I  +R T   + + W         ++VGY IE    G+ +W  CN   V 
Sbjct: 21549 PVDPPGTPDYIDVTRET---ITLKWNPPLRDGGSKIVGYSIEKR-QGNERWVRCNFTDVS 21604

Query: 793   GSRFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIAPPSPPCDITCLESFR 851
               ++T  GL  G  Y FR+ A NA G +S  SQ S  I  +    PP     +     + 
Sbjct: 21605 ECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPI----VEFGPEYF 21660

Query: 852   DSMVLGWKQPDKIGGAEITGYYVNYREVIDGVP---GKWREANVKAVSEEAYKISNLKEN 908
             D +++             +G  +  + ++ G P     W +  V+       +I+++  +
Sbjct: 21661 DGLIIK------------SGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGS 21708

Query: 909   MVYQFQVAAMNMAGL-------GAPSAVSEC-FKCEEWTIAVPGPPHSLKCSEVRKDSLV 960
                  + A  +  G+        + SA +E   K ++    V GP   ++ + +  + + 
Sbjct: 21709 TSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGP---IRFTNITGEKMT 21765

Query: 961   LQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVR 1020
             L W  P++ G  P+T Y ++ +E       W  + +      Y  ++ L  G  Y FRV 
Sbjct: 21766 LWWDAPLNDGCAPITHYIIEKRETSRL--AWALIEDKCEAQSYTAIK-LINGNEYQFRVS 21822

Query: 1021  AINQAGVGKPSDLAGPVVAE 1040
             A+N+ GVG+P D + PVVA+
Sbjct: 21823 AVNKFGVGRPLD-SDPVVAQ 21841



 Score =  172 bits (437), Expect = 2e-42
 Identities = 226/950 (23%), Positives = 372/950 (39%), Gaps = 134/950 (14%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P++ W    + L  +  V    + +R TLT     + D G Y + +      + +S  V 
Sbjct: 22372 PKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVV 22431

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V      + G    P++V  + A     ++SW +P   GG+ I  Y ++K E GT +W  
Sbjct: 22432 VIGRPGPVTG----PIEVSSVSAES--CVLSWGEPKDGGGTEITNYIVEKRESGTTAWQL 22485

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
              N + VK  +  VT L +   Y FRV + N+ G+  P   S P+ A  P           
Sbjct: 22486 VNSS-VKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE-SAPIIAEHPF---------- 22533

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                              + P  PT   V   + + + + W+ P   G   I+ Y+VEK E
Sbjct: 22534 -----------------VPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKE 22576

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
               T  W + N ++P     + +  L EG  Y FR    N+AGV + SEA+   +  + +D
Sbjct: 22577 RNTILWVKEN-KVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVD 22635

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIE---ASVAGSGKWEPCNNNPVKGS 794
              P  P     +R+T  S++ S        ++VGY IE    S  G G+W  CN   V  +
Sbjct: 22636 APGRPEVTDVTRST-VSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDN 22694

Query: 795   RFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIAPPSPPCDITC---LESF 850
              FT   L  G +Y FRV A NAAG +S+ S+ +  +  +   APP    D      L + 
Sbjct: 22695 FFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTI 22754

Query: 851   R-------DSMVLGWKQPDKI---GGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAY 900
             R       D+ V G  +P  I   G  E+        ++ + V  ++      AV +   
Sbjct: 22755 RAGSDLVLDAAVGGKPEPKIIWTKGDKEL--------DLCEKVSLQYTGKRATAVIKFCD 22806

Query: 901   KISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLV 960
             +  + K      + +   N +G  A S + +        +  PGP   L  S V ++   
Sbjct: 22807 RSDSGK------YTLTVKNASGTKAVSVMVK-------VLDSPGPCGKLTVSRVTQEKCT 22853

Query: 961   LQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVR 1020
             L W  P   G   +T Y V+ +E       W  +        Y+  R +K    Y+FRVR
Sbjct: 22854 LAWSLPQEDGGAEITHYIVERRETSRL--NWVIVEGECPTLSYVVTRLIKNN-EYIFRVR 22910

Query: 1021  AINQAGVGKPSDLAGPVVA--------------ETRPGTKEVVVN----VDDDGVISLNF 1062
             A+N+ G G P + + P+VA              E   G + +++       D G    N+
Sbjct: 22911 AVNKYGPGVPVE-SEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNY 22969

Query: 1063  ECDKMTPKSEFSW---SKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDT 1119
               DK   KS   W   +KDYV  +            + K+T    G D    Y   VT  
Sbjct: 22970 LVDKREKKS-LRWTRVNKDYVVYD-----------TRLKVTSLMEGCD----YQFRVTAV 23013

Query: 1120  DGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKV 1179
             +   +S   +  E    ++   E  +   P  +   V+  +      W +     G   V
Sbjct: 23014 NAAGNS---EPSEASNFIS-CREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIV 23069

Query: 1180  NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVG 1239
              Y+   +E      Y++H +      E  +  L+   +  Y+F++           V V 
Sbjct: 23070 GYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQK--YSFRV---------AAVNVK 23118

Query: 1240  DVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVA-NIKKETHIVWYKD 1298
              + +  +  AE +  E I        + L   VT      L+  V+ + +    I W K 
Sbjct: 23119 GMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQ 23178

Query: 1299  EREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLV 1348
               +++     D  +    L++ + ++ DAG Y +  ++  GK KS   LV
Sbjct: 23179 GIDLASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGK-KSATVLV 23227



 Score =  169 bits (427), Expect = 3e-41
 Identities = 167/626 (26%), Positives = 253/626 (40%), Gaps = 57/626 (9%)

Query: 509   APAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFAR 568
             AP+ P  +  ++  K  + ++W +P  DGGS I GY I+    G+D W+    T VK   
Sbjct: 14659 APSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHI--TTVKGLE 14716

Query: 569   FPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVT 628
               V  L EG  Y F+V AVN  G   P R S PV   +      L  R       ++++ 
Sbjct: 14717 CVVRNLTEGEEYTFQVMAVNSAGRSAP-RESRPVIVKEQTMLPELDLRGIYQ---KLVIA 14772

Query: 629   EEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNT 688
             +         G    + +    R    ++WK               K +   +  QRVN 
Sbjct: 14773 KA--------GDNIKVEIPVLGRPKPTVTWK---------------KGDQILKQTQRVNF 14809

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAP-GKIIP 747
             E    S    + +     S  + +   N   VGE  +   + V     DIP  P G I  
Sbjct: 14810 ETTATSTILNINECVRSDSGPYPLTARNI--VGEVGDVITIQVH----DIPGPPTGPIKF 14863

Query: 748   SRNTDTSVVVSWE--ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQ 805
                +   V  SW+  E+     +  Y +E     S  W       ++ + +    L TG 
Sbjct: 14864 DEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTVIR-TTYKATRLTTGL 14922

Query: 806   SYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIG 865
              Y FRV+A N  G+      S  I        P PP         +DSM + W +P   G
Sbjct: 14923 EYQFRVKAQNRYGVGP-GITSACIVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDG 14981

Query: 866   GAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGA 925
             G+ I GY+V  +E  +G+   W+  +   V    +K S L + + Y+F+V A NMAG   
Sbjct: 14982 GSPILGYHVERKER-NGI--LWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSK 15038

Query: 926   PSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAK 985
             PS  SE     +  I  PG P  L    + + ++ L+W  P ++G   +T Y V+ ++  
Sbjct: 15039 PSKPSEPMLALD-PIDPPGKPVPLN---ITRHTVTLKWAKPEYTGGFKITSYIVEKRDLP 15094

Query: 986   AKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG-VGKPSDLAGPVVAETRPG 1044
                 +W   N + I      V GL E  +Y FRV A N AG +  PS+ +  +       
Sbjct: 15095 --NGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVE 15152

Query: 1045  TKEVVVNVD-DDGVI-----SLNFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKGNKT 1097
               ++ V+V   D VI     +   E D    P     WSKD    E + +LE++     T
Sbjct: 15153 APKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFST 15212

Query: 1098  KMTFKDLGMDDLGIYSCDVTDTDGIA 1123
              +  KD    D G Y+   T+  G A
Sbjct: 15213 NLVNKDSTRRDSGAYTLTATNPGGFA 15238



 Score =  168 bits (425), Expect = 4e-41
 Identities = 215/837 (25%), Positives = 338/837 (40%), Gaps = 135/837 (16%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESR-YGM------HTLEINGCDF 344
             E  +L C I G P P + WY+           GK +I+SR Y M      HTL +   + 
Sbjct: 24243 EAAQLSCQIVGRPLPDIKWYRF----------GKELIQSRKYKMSSDGRTHTLTVMTEEQ 24292

Query: 345   EDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFE 404
             ED   Y   A N  GE+   + ++++         +FH G    PL              
Sbjct: 24293 EDEGVYTCIATNEVGEVETSSKLLLQA------TPQFHPG---YPLK------------- 24330

Query: 405   IHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGER 464
                 +K+   +G  G T+ L    +  P      P + W+     L  S+ + T+ + E 
Sbjct: 24331 ----EKY---YGAVGSTLRLHVMYIGRPV-----PAMTWFHGQKLLQNSENI-TIENTEH 24377

Query: 465   AT-LTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDA--DAEIEGAPAAPLDVKCLEA 521
              T L   ++ +        +   G+Y  Q S      DA  D EI+  P  P     +EA
Sbjct: 24378 YTHLVMKNVQR--------KTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEA 24429

Query: 522   N-KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSY 580
               K+  +ISWK PA DGGS I  Y ++KCE    +  Q   + +      +  L E   Y
Sbjct: 24430 LLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGY 24489

Query: 581   IFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGP 640
              FRV A N  GI  P  VS  V    P EK                           PG 
Sbjct: 24490 YFRVSAQNTFGISDPLEVSSVVIIKSPFEK---------------------------PGA 24522

Query: 641   PTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFAL 699
             P   ++T  T+   V++WKPP   G   I  Y++EK E     W  V TE  ++   F++
Sbjct: 24523 PGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTE-EIRETVFSV 24581

Query: 700   FDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIP-KAPGKIIPSRNTD----TS 754
              +L EG  Y FRV+C N  G  E SE +E   +  K D+P +AP      RN +    ++
Sbjct: 24582 KNLIEGLEYEFRVKCENLGGESEWSEISE--PITPKSDVPIQAPHFKEELRNLNVRYQSN 24639

Query: 755   VVVSWEESKDAKELVGYYIEAS--VAGSGKWEPCNNNPVKGS--RFTCHGLVTGQSYIFR 810
               +  + +   K +V +Y +    +A   K+        KG   +     +    + +++
Sbjct: 24640 ATLVCKVTGHPKPIVKWYRQGKEIIADGLKY---RIQEFKGGYHQLIIASVTDDDATVYQ 24696

Query: 811   VRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEIT 870
             VRA N  G S     S  +EV A I  P     +  + + R   V+  K P   G  +  
Sbjct: 24697 VRATNQGG-SVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGE-VVSIKIPFS-GKPDPV 24753

Query: 871   GYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVS 930
               +   +++ID   G ++    ++ +   +  + ++      + V A N  G+       
Sbjct: 24754 ITWQKGQDLIDN-NGHYQVIVTRSFTSLVFP-NGVERKDAGFYVVCAKNRFGIDQ----- 24806

Query: 931   ECFKCEEWTIA-VPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKED 989
                K  E  +A VP PP  +K S+V +DS+ L W  P   G + +T Y V+  +     +
Sbjct: 24807 ---KTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVE--KCATTAE 24861

Query: 990   QWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVV 1049
             +W  + +A  +     V  L    SY FRV A N+ G+ KPS+ + P + +     K   
Sbjct: 24862 RWLRVGQA--RETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKE---DKTRA 24916

Query: 1050  VNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLE-------VESKGNKTKM 1099
             +N D++   +      K +  S     + Y+  ED  R E       VE+   KT M
Sbjct: 24917 MNYDEEVDETREVSMTKASHSSTKELYEKYMIAEDLGRGEFGIVHRCVETSSKKTYM 24973



 Score =  167 bits (423), Expect = 7e-41
 Identities = 186/737 (25%), Positives = 305/737 (41%), Gaps = 84/737 (11%)

Query: 638   PGPPTD-LSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSP 695
             PGPP   +     +   + LSW PP   G   I  Y +EK EA  + W  V++E   K  
Sbjct: 9912  PGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSE--PKEC 9969

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSV 755
              + +  L EG  Y FR+   N  G+GEP ++ E     +   +P AP K   S  T  S+
Sbjct: 9970  TYTIPKLLEGHEYVFRIMAQNKYGIGEPLDS-EPETARNLFSVPGAPDKPTVSSVTRNSM 10028

Query: 756   VVSWEESK--DAKELVGYYIEASVAGSGKWEPCNNNPVK----GSRFTCHGLVTGQSYIF 809
              V+WEE +      + GY++E     S +W+  N +P+K    G  +   GL+ G  Y F
Sbjct: 10029 TVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQF 10088

Query: 810   RVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEI 869
             RV A+NAAG+   S  S+    +  IAPP PP      +  + S  L W  P K GG+++
Sbjct: 10089 RVYAINAAGVGPASLPSDPATARDPIAPPGPPFP-KVTDWTKSSADLEWSPPLKDGGSKV 10147

Query: 870   TGYYVNYREVIDGVPGK--WREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPS 927
             TGY V Y+E      GK  W +   K V      ++ LKE   Y+F+V A+N+AG+G P 
Sbjct: 10148 TGYIVEYKE-----EGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPG 10202

Query: 928   AVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVH-----SGRTPVTGYFVDLK 982
              V++  + ++  ++   P   L  S   +D +V+     +      SG+ P T   V   
Sbjct: 10203 EVTDVIEMKDRLVS---PDLQLDASV--RDRIVVHAGGVIRIIAYVSGKPPPT---VTWN 10254

Query: 983   EAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPS------DLAGP 1036
               +    Q   +   AI +  + ++  +     V+ + A N+AG  K +      D+ GP
Sbjct: 10255 MNERTLPQEATIETTAISSSMV-IKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGP 10313

Query: 1037  VVAETRPGTKEVVVNVDDDGVISLNF--ECDKMTPKSEFSWSKDYVSTEDSPRLEVESKG 1094
             V      GT  +  N+ ++      F  E D  +P + +   K     E   R       
Sbjct: 10314 V------GTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEK----RESDRRAWTPVTY 10363

Query: 1095  NKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSEL 1154
               T+      G+     Y   +   + I     ++  E    L +      P  P   +L
Sbjct: 10364 TVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEA---LVIREPITVPERP--EDL 10418

Query: 1155  AVEILEKGQVRFWMQAEKLSGNAKV-NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQ 1213
              V+ + K  V       K  G +++ NY+   + I      K H   N  ++        
Sbjct: 10419 EVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLI---GTEKFHKVTNDNLLSRKYTVKG 10475

Query: 1214  DEDEGTYTFQLQ------DGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEY 1267
              ++  TY +++        GK +  +  +   D         +F+ +  IR  G  F   
Sbjct: 10476 LKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIRV-GEAFA-- 10532

Query: 1268  LSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKK-- 1325
                 +TG  +   K KV+         W+KDE ++  D++   K    TL + +   K  
Sbjct: 10533 ----LTGRYSGKPKPKVS---------WFKDEADVLEDDRTHIKTTPATLALEKIKAKRS 10579

Query: 1326  DAGIYEVILKDDRGKDK 1342
             D+G Y V++++  G  K
Sbjct: 10580 DSGKYCVVVENSTGSRK 10596



 Score =  167 bits (423), Expect = 7e-41
 Identities = 226/924 (24%), Positives = 354/924 (38%), Gaps = 117/924 (12%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P  +W + G  +S    + T  S     L     ++ D G Y + +       + + Y+ 
Sbjct: 23861 PICKWTKEGQDISKRAMIAT--SETHTELVIKEADRGDSGTYDLVLE--NKCGKKAVYIK 23916

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             VR   +    +P  PL+   ++     + +SW+ PA DGG+ ILGY +++ EV   +W  
Sbjct: 23917 VRVIGSP--NSPEGPLEYDDIQVRS--VRVSWRPPADDGGADILGYILERREVPKAAWYT 23972

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
               D+ V+     V GL E   Y FRV A N+ GI  P +  EPV    P           
Sbjct: 23973 I-DSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTP----------- 24020

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                    +   E PS      PP    V + T+S V LSW  P   G   +  Y++E+ E
Sbjct: 24021 -------LNPPEPPS-----NPP---EVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKE 24065

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
               T+ W R N +  + +  + +  L     Y FR+   N  G+ E S A+E  V  D  D
Sbjct: 24066 TSTDKWVRHN-KTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFD 24124

Query: 738   IPKAPGKIIPSRNTDTSVVVSWE--ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSR 795
              P  PG++     +  SV + WE  E    KE++GY++E   +G   W+  N   +K  +
Sbjct: 24125 KPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQ 24184

Query: 796   FTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMV 855
             FT  GL+    Y FRV A N  GLS   +   A+ +K  +     P         R  M 
Sbjct: 24185 FTIGGLLEATEYEFRVFAENETGLSRPRR--TAMSIKTKLTSGEAP-------GIRKEMK 24235

Query: 856   LGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQV 915
                    K+G A      +  R + D    KW     + +    YK+S+           
Sbjct: 24236 ---DVTTKLGEAAQLSCQIVGRPLPD---IKWYRFGKELIQSRKYKMSSDGRTHTLTVMT 24289

Query: 916   AAMNMAGLGAPSAVSECFKCEEWTIAV--------PGPPHSLKCSEVRKDSLVLQWKPPV 967
                   G+    A +E  + E  +  +        PG P   K       +L L     +
Sbjct: 24290 EEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLH---VM 24346

Query: 968   HSGR-TPVTGYFVDLKEAKAKE----DQWRGLNEAAIKNVYLKVRG--LKEGVSYVF-RV 1019
             + GR  P   +F   K  +  E    +         +KNV  K      K  +S VF  V
Sbjct: 24347 YIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTV 24406

Query: 1020  RAINQAGV-GKPSDLAGPVVAETRPGTKEVV---VNVDDDGVISLNFECDKMTPKSEFSW 1075
              AI    +  KP    GP+V E       V+      DD G    N+  +K   K    W
Sbjct: 24407 DAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEW 24466

Query: 1076  SKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKR 1135
                           V S  + T     +L  +    +     +T GI+     D  E+  
Sbjct: 24467 QL------------VSSAISVTTCRIVNLTENAGYYFRVSAQNTFGIS-----DPLEVSS 24509

Query: 1136  LLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKV-NYIFNEKEIFEGPKY 1194
             ++ +    + P  P K  +   + +   V  W +     G AK+ NY   ++E     K 
Sbjct: 24510 VVIIKSPFEKPGAPGKPTITA-VTKDSCVVAW-KPPASDGGAKIRNYYLEKRE----KKQ 24563

Query: 1195  KMHIDRNTGIIEMFMEKLQDEDEG-TYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQR 1253
                I   T  I   +  +++  EG  Y F++   K  N        ++ + +  +++   
Sbjct: 24564 NKWISVTTEEIRETVFSVKNLIEGLEYEFRV---KCENLGGESEWSEISEPITPKSD--- 24617

Query: 1254  QEWIRKQGPHFVEYL-SWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVD----EKH 1308
                +  Q PHF E L +  V  + N  L CKV    K   + WY+  +EI  D       
Sbjct: 24618 ---VPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPI-VKWYRQGKEIIADGLKYRIQ 24673

Query: 1309  DFKDGICTLLITEFSKKDAGIYEV 1332
             +FK G   L+I   +  DA +Y+V
Sbjct: 24674 EFKGGYHQLIIASVTDDDATVYQV 24697



 Score =  160 bits (404), Expect = 1e-38
 Identities = 162/640 (25%), Positives = 260/640 (40%), Gaps = 84/640 (13%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             PA   D+   ++ K  +I+SW +P  DGGS I  Y +++   G  +WS    +  K    
Sbjct: 21158 PAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGIS--KTCEI 21215

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              V+ L E     FRV A N+ G+      S+PV                 P T + ++  
Sbjct: 21216 EVSQLKEQSVLEFRVFAKNEKGL------SDPVTI--------------GPITVKELIIT 21255

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTE 689
              E     +PG    + +       +    KP                   + +W  +   
Sbjct: 21256 PEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKP-----------------SISW--LKDG 21296

Query: 690   LPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSE---------ATEVTVVGDKLDIPK 740
             LP+K   F  F   E K     ++ +     G+ +          A  +TV+   L  P 
Sbjct: 21297 LPLKESEFVRFSKTENK-ITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVI--TLGPPS 21353

Query: 741   AP-GKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFT 797
              P G I        SV++SW+  +D    E+  Y IE        W+   ++ V  + F 
Sbjct: 21354 KPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCSS-VARTTFK 21412

Query: 798   CHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLG 857
                LV    Y FRVRA N  G+S+    S  I  K     P PP          D M L 
Sbjct: 21413 VPNLVKDAEYQFRVRAENRYGVSQ-PLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLT 21471

Query: 858   WKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAA 917
             W  P   GG+E+TG++V  +E    +   W++ N   +S   Y+ + L E + YQF+V A
Sbjct: 21472 WDAPVYDGGSEVTGFHVEKKERNSIL---WQKVNTSPISGREYRATGLVEGLDYQFRVYA 21528

Query: 918   MNMAGLGAPSAVSECFKCEEWTIAVP--GPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVT 975
              N AGL +PS  S      ++T+AV    PP +    +V ++++ L+W PP+  G + + 
Sbjct: 21529 ENSAGLSSPSDPS------KFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIV 21582

Query: 976   GYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG-VGKPSDLA 1034
             GY ++ ++     ++W   N   +      V GL  G  Y FR+ A N  G +  PS  +
Sbjct: 21583 GYSIEKRQG---NERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSS 21639

Query: 1035  GPVVAETRPGTKEVVVNVDD---DGVISLNFECDKM------TPKSEFSWSKDYVSTEDS 1085
             G ++  TR      +V       DG+I  + E  ++       P    +W KD V  E  
Sbjct: 21640 GIIM--TRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKR 21697

Query: 1086  PRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1125
               +E+      T +  +D   D  G+Y+ +  +  G A +
Sbjct: 21698 MNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKA 21737



 Score =  159 bits (401), Expect = 3e-38
 Identities = 182/772 (23%), Positives = 309/772 (40%), Gaps = 102/772 (13%)

Query: 274   LHAPEFIIKP-RSHTVWEK--ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIES 330
             L  PE  +K   SHTV+ +   N+K+   I+G P P+VT  ++ VP+       ++  E 
Sbjct: 20166 LEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATM---RFNTEI 20222

Query: 331   RYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPL 390
                  T+ +      D  +Y  +A N  G   A+ ++VV              G  T P+
Sbjct: 20223 TAENLTINLKESVTADAGRYEITAANSSGTTKAFINIVVLD----------RPGPPTGPV 20272

Query: 391   SFG-VTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVP 449
                 +T      ++E     K+D            G +V     +K              
Sbjct: 20273 VISDITEESVTLKWE---PPKYDG-----------GSQVTNYILLKR------------E 20306

Query: 450   LSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRV--RMGEYYEQYSAYVFVRDADAEIE 507
              S + W +   +  R  +    L   +E  + I+   R G      SA V V+       
Sbjct: 20307 TSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVK-LPYTTP 20365

Query: 508   GAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFA 567
             G P+ P         ++ I + W +P  +GGS ++GY ++  +  +  W + N   ++  
Sbjct: 20366 GPPSTPW---VTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTT 20422

Query: 568   RFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIV 627
              F VT +  G  Y FRV A N  G+G PS  SEPV A+D  E                  
Sbjct: 20423 HFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACE------------------ 20464

Query: 628   TEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRV 686
                         PP ++ +T+ +++ V LSW+ P   G   I  Y VE+ +     W + 
Sbjct: 20465 ------------PPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKA 20512

Query: 687   NTELPVKSPRFALFDLAEGKSYCFRVRCSNSAG-VGEPSEAT-EVTVV----GDKLDIPK 740
             +    V   +F +  L +   Y FRV   N+ G +  PSE    +T +    G  +D+P 
Sbjct: 20513 SF-TNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPL 20571

Query: 741   APGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHG 800
                +++  R   +  + +    K A  +  Y  +  +  +     C  N    +      
Sbjct: 20572 EYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNAL--VCVENTTDLASILIKD 20629

Query: 801   LVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQ 860
                  S  + ++  NA G +     S  I V+    P  P   I       + + L W+ 
Sbjct: 20630 ADRLNSGCYELKLRNAMGSA-----SATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRP 20684

Query: 861   PDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNM 920
             P   GGA+IT Y V  RE    V   W   + + + E     + + +   Y F+V A+N 
Sbjct: 20685 PADDGGAKITHYIVEKRETSRVV---WSMVS-EHLEECIITTTKIIKGNEYIFRVRAVNK 20740

Query: 921   AGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVD 980
              G+G P  +       +     PGPP   + +++ K+S+ + W  P+  G + ++GYF++
Sbjct: 20741 YGIGEP--LESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLE 20798

Query: 981   LKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSD 1032
              ++ K+    W  + +  I++   KV GL E   Y +RV A+N AG G  S+
Sbjct: 20799 KRDKKSL--GWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSE 20848



 Score =  157 bits (397), Expect = 8e-38
 Identities = 160/604 (26%), Positives = 253/604 (41%), Gaps = 69/604 (11%)

Query: 438   QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
             Q  + W ++G  L  +  V    S    +L+    +KED G Y + V            +
Sbjct: 19118 QATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITI 19177

Query: 498   FVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
              V D        P  P  ++  E + D I ISW  P  DGG  I  Y ++K E  + +W 
Sbjct: 19178 IVLDR-------PGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWH 19230

Query: 558   QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRP 617
               +   V      +  L  G  Y FRV A N+ G    S  S  VA             P
Sbjct: 19231 IVSQA-VARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVA-----------EYP 19278

Query: 618   SAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWK-PPGQRGHEGIMYFVEKC 676
              +P                 PGPP    V  AT+S ++++W+ P    G   I Y +E  
Sbjct: 19279 FSP-----------------PGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYK 19321

Query: 677   EAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKL 736
             E  +  W + N ++ +   +  +  L EG  Y +RV   N AG+G+ S++ E     D  
Sbjct: 19322 ERSSILWSKAN-KILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPC 19380

Query: 737   DIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCNNNPVKGS 794
             D    PG+   +  T  SV + W +       ++ GY +E      G+W  CN   ++ +
Sbjct: 19381 D---PPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQET 19437

Query: 795   RFTCHGLVTGQSYIFRVRAVNAA-GLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDS 853
              F    L   Q Y FRV A NAA  +SE S+ +  I VK  + PP    D+     FRD 
Sbjct: 19438 YFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDV----KFRDV 19493

Query: 854   MVLGWKQPDKIGGAEITGY---YVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENM- 909
             +V+   +  KI  A+I G     +++ +  DG+  + R A  + +S + + +  +K+ + 
Sbjct: 19494 IVVKAGEVLKI-NADIAGRPLPVISWAK--DGIEIEER-ARTEIISTDNHTLLTVKDCIR 19549

Query: 910   --VYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHS-LKCSEVRKDSLVLQWKPP 966
                 Q+ +   N+AG       S    C+   +  PGPP   L+ + +  +   L W  P
Sbjct: 19550 RDTGQYVLTLKNVAG-----TRSVAVNCK--VLDKPGPPAGPLEINGLTAEKCSLSWGRP 19602

Query: 967   VHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG 1026
                G   +  Y V+ +E       W  + E  ++    KV  L +G  Y+FRV  +N+ G
Sbjct: 19603 QEDGGADIDYYIVEKRE--TSHLAWT-ICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYG 19659

Query: 1027  VGKP 1030
             VG+P
Sbjct: 19660 VGEP 19663



 Score =  149 bits (375), Expect = 3e-35
 Identities = 167/712 (23%), Positives = 271/712 (38%), Gaps = 127/712 (17%)

Query: 294   VKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRAS 353
             ++L   + G P P+VTW K  +  NV       ++++   M  L I     +D+ +Y  +
Sbjct: 12319 IRLFAIVRGRPAPKVTWRKVGID-NVVRKGQVDLVDT---MAFLVIPNSTRDDSGKYSLT 12374

Query: 354   AMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDV 413
              +N  GE + + +V V    G   + +      T        P         H+     +
Sbjct: 12375 LVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHY-----I 12429

Query: 414   SFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLN 473
                RE +  +      +TPE+K                 S  V  L  G       + +N
Sbjct: 12430 VEKREADRKTWS---TVTPEVK---------------KTSFHVTNLVPGNEYYFRVTAVN 12471

Query: 474   KEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQP 533
             +   G+ T               V   D  +E    P  P  ++  E  K+   ++W  P
Sbjct: 12472 EYGPGVPT----------DVPKPVLASDPLSE----PDPPRKLEVTEMTKNSATLAWLPP 12517

Query: 534   AVDGGSPILGYFID--KCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMG 591
               DGG+ I GY     + E   D W++ +   VK     VTGL EG+ Y FRV A N +G
Sbjct: 12518 LRDGGAKIDGYITSYREEEQPADRWTEYS--VVKDLSLVVTGLKEGKKYKFRVAARNAVG 12575

Query: 592   IGF---------------PSRVSEPVA-ALDPAEKARL------KSRPSAPW-------- 621
             +                 P ++  P    +   +K R+      K  P+  W        
Sbjct: 12576 VSLPREAEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVV 12635

Query: 622   -----------TGQIIVTEE-------------EPSEGI-----------VPGPPTD-LS 645
                        +  I++ ++             E S G             PGPP     
Sbjct: 12636 TSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFD 12695

Query: 646   VTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAE 704
             +++       LSW  P + G   I  Y VEKC+    +W      +   S R     L  
Sbjct: 12696 ISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVG--KLIP 12753

Query: 705   GKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE--ES 762
             G+ Y FRVR  N  G+ EP  + ++ V      +P  P     ++     + V+W+  +S
Sbjct: 12754 GQEYIFRVRAENRFGISEPLTSPKM-VAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDS 12812

Query: 763   KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEY 822
                  ++GY IE     S  W   N+  V+ + + C GLV G  Y FR+ A+N AG S  
Sbjct: 12813 DGGSPIIGYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPP 12872

Query: 823   SQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDG 882
             S+ +E +  +  + PP  P     ++  + ++ L W +P   GG++I GY+V   +    
Sbjct: 12873 SKPTEYVTARMPVDPPGKP---EVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACK---- 12925

Query: 883   VPG-KWREANV--KAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSE 931
             +PG KW   N     + +E Y  + L+E   YQF+  A     +  PS  S+
Sbjct: 12926 LPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSD 12977



 Score =  144 bits (364), Expect = 5e-34
 Identities = 192/758 (25%), Positives = 305/758 (40%), Gaps = 92/758 (12%)

Query: 638  PGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFV-EKCEAGTEN--WQRVNTELPVKS 694
            P PP +L+VT+       L+W  P   G   I ++V +K +A  +   W+ V      K 
Sbjct: 9193 PSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEK- 9251

Query: 695  PRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTS 754
             R+ ++ L     Y FRVR  N  G+ +  ++ +V V+ D   +P  PGK      T  S
Sbjct: 9252 -RYGIWKLIPNGQYEFRVRAVNKYGISDECKSDKV-VIQDPYRLPGPPGKPKVLARTKGS 9309

Query: 755  VVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPV-----KGSRFTCHGLVTGQSY 807
            ++VSW    D     + GY++E    GS  W   +  P+     KG  F    L+ G  Y
Sbjct: 9310 MLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKY 9369

Query: 808  IFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGA 867
             FR  A+NAAG+   S+ S+       I PP PP      +  + S+ LGWK P K GG+
Sbjct: 9370 QFRAMAINAAGIGPPSEPSDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGS 9429

Query: 868  EITGYYVNYREVIDGVPGKWREANV--KAVSEEAYKISNLKENMVYQFQVAAMNMAGLGA 925
             I GY V  +E  +G    W+  N   K ++     + NLKE   Y+F+V A+N AG   
Sbjct: 9430 PIKGYIVEMQE--EGTTD-WKRVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESE 9486

Query: 926  PSAVSECFKC----EEWTIAVP-GPPHSLKCSEVRKDSLVLQWKPPVHSGR-TPVTGYFV 979
            PS  +         EE  + +  G    L C    +  +     P V  GR TP + +  
Sbjct: 9487 PSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRI-----PAVIKGRPTPKSSWEF 9541

Query: 980  DLKEAKAKEDQWRGLNE-----AAIKNVYLKVRGLKEGVSYVFRVRAINQAGVG------ 1028
            D K  KA +D    + E      A  +  + +   K   +  + + A N+AG        
Sbjct: 9542 DGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRV 9601

Query: 1029 KPSDLAGP-----VVAETRPGTKEVVVNVDDDGVISLN-FECDKMTPKSEFSWSKDYVST 1082
            K  D+ GP     V   TR   +      DDDG   +  +  +K T   + +W+K     
Sbjct: 9602 KVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGK-AWTK----- 9655

Query: 1083 EDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHE 1142
                   V      T     DL  +    +     +  GI        E ++R  A    
Sbjct: 9656 -------VNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPV----ETIQRTTARDPI 9704

Query: 1143 HKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFE--GPKYKMHIDR 1200
            +  P  P+K  L + ++ K  V    +  K  G + V +   E   ++  G K +     
Sbjct: 9705 YP-PDPPIK--LKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQC 9761

Query: 1201 NTGIIEMFMEKLQDEDEG-TYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRK 1259
            N   +E     ++D  EG  Y F++   KA N + V          +  A     +  R 
Sbjct: 9762 NKRDVEELQFTVEDLVEGGEYEFRV---KAVNAAGVS---------KPSATVGPCDCQRP 9809

Query: 1260 QGPHFVEYLSW-EVTGECNVLLKCKVANIKKETHIVWYK------DEREISVDEKHDFK- 1311
              P  ++   + EV    NV +  K+  +   T + W+K      D +E  + + H  K 
Sbjct: 9810 DMPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPT-LTWFKAPPKKPDNKEPVLYDTHVNKL 9868

Query: 1312 --DGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKL 1347
              D  CTL+I +  + D G+Y +   ++ G     ++L
Sbjct: 9869 VVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRL 9906



 Score =  142 bits (357), Expect = 3e-33
 Identities = 127/419 (30%), Positives = 181/419 (43%), Gaps = 48/419 (11%)

Query: 637  VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSP 695
            VPGPP DL V++ TR    LSWK P   G + I  Y +EK     + W +VN +    S 
Sbjct: 9606 VPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCG--ST 9663

Query: 696  RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSV 755
             F + DL   + Y FRVR  N  G+G P E  + T   D +  P  P K+     T  +V
Sbjct: 9664 TFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTV 9723

Query: 756  VVSWEESK-DAKELVGYYIEASVA----GSGK--WEPCNNNPVKGSRFTCHGLVTGQSYI 808
             +SW+  K D    V +YI   +A    G+ K  W  CN   V+  +FT   LV G  Y 
Sbjct: 9724 HLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYE 9783

Query: 809  FRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAE 868
            FRV+AVNAAG+S+ S      + +    PPS       L+ F +                
Sbjct: 9784 FRVKAVNAAGVSKPSATVGPCDCQRPDMPPS-----IDLKEFMEVE-------------- 9824

Query: 869  ITGYYVNYREVIDGVPG---KWREANVKAVSEEAYKISNLKENMVYQFQVAAM------- 918
              G  VN    I GVP     W +A  K    +   + +   N +       +       
Sbjct: 9825 -EGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRR 9883

Query: 919  NMAGLGAPSAVSECFKCEEW----TIAVPGPP-HSLKCSEVRKDSLVLQWKPPVHSGRTP 973
            +  GL   +AV+      +      +  PGPP   +K   V  D + L W PP   G + 
Sbjct: 9884 SDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSK 9943

Query: 974  VTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSD 1032
            +T Y ++ +EA  K   W  ++    +  Y  +  L EG  YVFR+ A N+ G+G+P D
Sbjct: 9944 ITNYVIEKREANRK--TWVHVSSEPKECTY-TIPKLLEGHEYVFRIMAQNKYGIGEPLD 9999



 Score =  139 bits (349), Expect = 3e-32
 Identities = 161/644 (25%), Positives = 249/644 (38%), Gaps = 133/644 (20%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDT-PVKFAR 568
             P  P  ++  ++ K  I + W +P  DGGS + GY ++  +   + W+  +    V+   
Sbjct: 20862 PGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTE 20921

Query: 569   FPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARL--------------- 613
             + V+ L  G +Y FRV AVN  G G P  ++EPV A D  E   +               
Sbjct: 20922 YVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAG 20981

Query: 614   -----------KSRPSAPW---------------------------------TGQIIVTE 629
                        +  P+  W                                 TG+ I+T 
Sbjct: 20982 EDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTI 21041

Query: 630   E----EPSEGIV-------PGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
             E    EP    V       P     L V   +R  V L W PP   G   I+ Y +EK +
Sbjct: 21042 ENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRD 21101

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
             A    W  V+ +    S  F L DL+E   + FRV   N  G+GEP E TE     +   
Sbjct: 21102 ATKRTWSVVSHKC--SSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAE--- 21156

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEESK--DAKELVGYYIEASVAGSGKWEPCNNNPVKGSR 795
             +P     +    +T TSV++SW +        +  Y +E    G   W         G  
Sbjct: 21157 VPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHA------GIS 21210

Query: 796   FTCHGLVTG---QSYI-FRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFR 851
              TC   V+    QS + FRV A N  GLS+       I VK  I   +P  D++      
Sbjct: 21211 KTCEIEVSQLKEQSVLEFRVFAKNEKGLSD-PVTIGPITVKELII--TPEVDLS------ 21261

Query: 852   DSMVLGWKQPDKIGGAEIT---GYYVNYREVIDGVPG---KWREANVKAVSEEAYKISNL 905
                         I GA++T   G+ V+      G P     W +  +     E  + S  
Sbjct: 21262 -----------DIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKT 21310

Query: 906   KENMVYQFQVAAMNMAG---LGAPSAVSECFKCEEWTIAVPGPPHS----LKCSEVRKDS 958
             +  +    + A     G   +   +AV  C      T+   GPP      ++  E++ DS
Sbjct: 21311 ENKITLSIKNAKKEHGGKYTVILDNAV--CRIAVPITVITLGPPSKPKGPIRFDEIKADS 21368

Query: 959   LVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFR 1018
             ++L W  P  +G   +T Y ++ +E    +  W+ +  +  +  + KV  L +   Y FR
Sbjct: 21369 VILSWDVPEDNGGGEITCYSIEKRE--TSQTNWKMVCSSVARTTF-KVPNLVKDAEYQFR 21425

Query: 1019  VRAINQAGVGKPSDLAGPVVAETR-----PGTKEVVVNVDDDGV 1057
             VRA N+ GV +P  ++  +VA+ +     P  K V+ NV  DG+
Sbjct: 21426 VRAENRYGVSQPL-VSSIIVAKHQFRIPGPPGKPVIYNVTSDGM 21468



 Score =  134 bits (338), Expect = 5e-31
 Identities = 127/462 (27%), Positives = 199/462 (43%), Gaps = 40/462 (8%)

Query: 638   PGPPTD-LSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSP 695
             PGPPT  + +++ T   V L W+PP   G   +  Y + K E  T  W  V+    V   
Sbjct: 20265 PGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSAT--VART 20322

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDI--PKAPGKIIPSRNTDT 753
                +  L  G+ Y FR++  N  G+ +  ++  VTV   KL    P  P     +  T  
Sbjct: 20323 MMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTV---KLPYTTPGPPSTPWVTNVTRE 20379

Query: 754   SVVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRV 811
             S+ V W E  S     +VGY++E     S  W+  N   ++ + F    +  G  Y FRV
Sbjct: 20380 SITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRV 20439

Query: 812   RAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITG 871
              A NAAG+ + S  SE +    AI    PP ++   +  ++S+ L W+QP   GG++ITG
Sbjct: 20440 YAENAAGVGKPSHPSEPV---LAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITG 20496

Query: 872   YYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAG-LGAPSAVS 930
             Y V  R++ D   G+W +A+   V+E  + IS L +N  Y+F+V A N  G +  PS V 
Sbjct: 20497 YIVERRDLPD---GRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVV 20553

Query: 931   ECFKCEEWTIAVPGPPHSLKCSEVRK--DSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKE 988
                 C + +   P     L+ +EV K      ++ +  +     P   ++ D KE +   
Sbjct: 20554 GPITCID-SYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNA 20612

Query: 989   ----DQWRGLNEAAIKNV--------YLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGP 1036
                 +    L    IK+          LK+R      S   RV+ ++     KP    GP
Sbjct: 20613 LVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILD-----KPGPPGGP 20667

Query: 1037  VVAETRPGTKEVVV--NVDDDGVISLNFECDKMTPKSEFSWS 1076
             +  +T    K  ++     DDG   +     +    S   WS
Sbjct: 20668 IEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWS 20709



 Score =  129 bits (323), Expect = 3e-29
 Identities = 123/466 (26%), Positives = 184/466 (39%), Gaps = 48/466 (10%)

Query: 502  ADAEIEG----APAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
            +D E+ G     P  P   +  +  K  I + WK PA DGGSPI GY ++  E GT  W 
Sbjct: 9388 SDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWK 9447

Query: 558  QCN--DTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKS 615
            + N  D  +      V  L E R Y FRV+AVN+ G   PS  +  + A D  E+  +  
Sbjct: 9448 RVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFI 9507

Query: 616  RPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGH---EGIMYF 672
               A          +     ++ G PT  S           SW+  G+      +G+   
Sbjct: 9508 DIGAQDCLVCKAGSQIRIPAVIKGRPTPKS-----------SWEFDGKAKKAMKDGVHDI 9556

Query: 673  VEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVV 732
             E  +  T             S    + +     +  + +   N AG    +   +V   
Sbjct: 9557 PEDAQLETAE----------NSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKV--- 9603

Query: 733  GDKLDIPKAPGKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNP 790
               +D+P  P  +  S  T  S  +SW+   D     + GY IE        W   N  P
Sbjct: 9604 ---MDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVN--P 9658

Query: 791  VKGSR-FTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLES 849
              GS  F    L++ Q Y FRVRA N  G+    +  +    +  I PP PP  +     
Sbjct: 9659 DCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLI 9718

Query: 850  FRDSMVLGWKQPDKIGGAEITGYYVNYR--EVIDGVPGKWREANVKAVSEEAYKISNLKE 907
             ++++ L WK P   GG+ +T Y V     +        WR+ N + V E  + + +L E
Sbjct: 9719 TKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVE 9778

Query: 908  NMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSE 953
               Y+F+V A+N AG+  PSA      C+      P  P S+   E
Sbjct: 9779 GGEYEFRVKAVNAAGVSKPSATVGPCDCQR-----PDMPPSIDLKE 9819



 Score =  109 bits (273), Expect = 2e-23
 Identities = 85/306 (27%), Positives = 139/306 (45%), Gaps = 18/306 (5%)

Query: 829   IEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWR 888
             ++V+    P  P   I      ++S V+ WK P   GG+ IT Y V   E  +G   +W+
Sbjct: 24410 LDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGA--EWQ 24467

Query: 889   EANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHS 948
               +  A+S    +I NL EN  Y F+V+A N  G+  P  VS     +      PG P  
Sbjct: 24468 LVS-SAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKS-PFEKPGAPGK 24525

Query: 949   LKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRG 1008
                + V KDS V+ WKPP   G   +  Y+++ +E K  +++W  +    I+     V+ 
Sbjct: 24526 PTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKK--QNKWISVTTEEIRETVFSVKN 24583

Query: 1009  LKEGVSYVFRVRAINQAGVGKPSDLAGPVVAET-----RPGTKEVVVNVDDDGVISLNFE 1063
             L EG+ Y FRV+  N  G  + S+++ P+  ++      P  KE + N++     +    
Sbjct: 24584 LIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLV 24643

Query: 1064  CDKMT--PKSEFSW---SKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTD 1118
             C K+T  PK    W    K+ ++     R++ E KG   ++    +  DD  +Y    T+
Sbjct: 24644 C-KVTGHPKPIVKWYRQGKEIIADGLKYRIQ-EFKGGYHQLIIASVTDDDATVYQVRATN 24701

Query: 1119  TDGIAS 1124
               G  S
Sbjct: 24702 QGGSVS 24707



 Score = 94.0 bits (232), Expect = 1e-18
 Identities = 83/340 (24%), Positives = 135/340 (39%), Gaps = 45/340 (13%)

Query: 274   LHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKY-IIESRY 332
             + AP F  + R+  V  + N  L C + G P+P V WY+      + A+  KY I E + 
Sbjct: 24620 IQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGK--EIIADGLKYRIQEFKG 24677

Query: 333   GMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF 392
             G H L I     +D   Y+  A N  G +S  AS+ V+         + H   +   +  
Sbjct: 24678 GYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVE------VPAKIHLPKTLEGMGA 24731

Query: 393   GVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSP 452
                  G     +I F  K D                          P I W +    +  
Sbjct: 24732 VHALRGEVVSIKIPFSGKPD--------------------------PVITWQKGQDLIDN 24765

Query: 453   SKWVQTLWSGERATLTFSH-LNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPA 511
             +   Q + +    +L F + + ++D G Y +  +     +Q       +  + ++   P 
Sbjct: 24766 NGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQ-------KTVELDVADVPD 24818

Query: 512   APLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPV 571
              P  VK  + ++D + ++W +PA DGGS I  Y ++KC    + W +      +  R+ V
Sbjct: 24819 PPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQ--ARETRYTV 24876

Query: 572   TGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKA 611
               L    SY FRV A NK G+  PS  SEP    +   +A
Sbjct: 24877 INLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRA 24916



 Score = 77.8 bits (190), Expect = 8e-14
 Identities = 58/224 (25%), Positives = 109/224 (48%), Gaps = 17/224 (7%)

Query: 157   ERIKEAAAYIAQRNLLASEEGITTSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTA 216
             E +K++AA   +++++  E  IT + Q++   +T A  ++ +++ S    Q    + + A
Sbjct: 26701 EEVKKSAATSLEKSIVHEE--ITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIA 26758

Query: 217   SRQSVV----SKQATSALQQEETSEKKSRKVVIREKAER-----LSLRKTLEETET--YH 265
                 V       + T++ +         + + I++ + R       + KT E      Y 
Sbjct: 26759 GATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYD 26818

Query: 266   AKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGK 325
               L+++ L  AP FI +PRS  + E +NV   C I+G P P + W+KN +PI++ +N   
Sbjct: 26819 LTLSKE-LSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVS- 26876

Query: 326   YIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVV 369
               I     +++LEI      D+ +Y   A N +G+ SA AS++V
Sbjct: 26877 --ISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV 26918



 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 104/533 (19%), Positives = 203/533 (38%), Gaps = 97/533 (18%)

Query: 1062 FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1121
            F C+  T  ++  W ++  +  DS +  +  K     +  +D  +DD   Y+  +T+  G
Sbjct: 6354 FNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRG 6413

Query: 1122 ----IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNA 1177
                 A++ +++EE+L+ +            P+K    +E +EK  V FW +  +L  N 
Sbjct: 6414 ENVKSAANLIVEEEDLRIV-----------EPLKD---IETMEKKSVTFWCKVNRL--NV 6457

Query: 1178 KVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVL 1237
             + +  N +E+    +    +D+   ++ +  +     DEG Y       K+     ++ 
Sbjct: 6458 TLKWTKNGEEVPFDNRVSYRVDKYKHMLTI--KDCGFPDEGEYIVTAGQDKSVAELLII- 6514

Query: 1238 VGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECN-VLLKCKVANIKKETHIVWY 1296
                                 +    FVE+L  +   E +  +  C+++  +++ ++ WY
Sbjct: 6515 ---------------------EAPTEFVEHLEDQTVTEFDDAVFSCQLS--REKANVKWY 6551

Query: 1297 KDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKE-- 1354
            ++ REI   +K+ F+             KD  I+ +I+KD R  D+       E  K   
Sbjct: 6552 RNGREIKEGKKYKFE-------------KDGSIHRLIIKDCRLDDECEYACGVEDRKSRA 6598

Query: 1355 --LMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTG 1412
               + E+  +I     D+     A G  +        + ++V W  N   +   D+ +  
Sbjct: 6599 RLFVEEIPVEIIRPPQDIL---EAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMM 6655

Query: 1413 VTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAE 1472
              G+   LQI +  P D+G+Y     D                 EA A+ +      I  
Sbjct: 6656 SEGKIHRLQICDIKPRDQGEYRFIAKD----------------KEARAKLELAAAPKIKT 6699

Query: 1473 KNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRT 1532
             ++  V         +  GK L +       P  E  W K  + L++     +   A +T
Sbjct: 6700 ADQDLV---------VDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTK---TIDTTAEQT 6747

Query: 1533 AYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVF-IPEEEARMAALESLKG 1584
            + F I      D G+Y +V++NK+G       + V  +P     +   E+  G
Sbjct: 6748 S-FRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDG 6799



 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 67/296 (22%), Positives = 117/296 (39%), Gaps = 27/296 (9%)

Query: 1282  CKVANIKKETHIVWYKDEREISVDEKHD--FKDGICTLLITEFSKKDAGIYEVILKDDRG 1339
             CK+ N  + T + WY   R++   EK++  ++DG+  L + + +K D G Y   + +D G
Sbjct: 25284 CKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYG 25343

Query: 1340  KDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHN 1399
             +D S  +L  +  +E+    C++     T  KI+   + ++L      +   L    ++ 
Sbjct: 25344 EDSSYAELFVKGVREVYDYYCRR-----TMKKIKRRTDTMRLLERPPEFTLPLYNKTAYV 25398

Query: 1400  GSAIRYSDRVKTGVTGEQIWLQINE---PTPNDKGKYVMELFDGKTGHQKTVDLSGQAYD 1456
             G  +R+   +         W +  +   P  NDK KY  E    K  +Q T++      D
Sbjct: 25399 GENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDK-KYTFE--SDKGLYQLTINSVTTDDD 25455

Query: 1457  EAYAEFQRLKQAAIAEKNRARVLGGLPDV--------------VTIQEGKALNLTCNVWG 1502
               Y    R K    + K +  V    P                   QEG+++     V G
Sbjct: 25456 AEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSG 25515

Query: 1503  DPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGS 1558
              PPP + W K+ + L+   +  +  E        I      D+G Y +   N  GS
Sbjct: 25516 IPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGS 25571



 Score = 69.7 bits (169), Expect = 2e-11
 Identities = 102/489 (20%), Positives = 180/489 (36%), Gaps = 79/489 (16%)

Query: 1069 PKSEFSWSKDYVSTEDSPRLE-VESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1127
            P  E  W K+ V  E S R+     + N  ++  +D+  +D         +  G  SS+ 
Sbjct: 2059 PDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHA 2118

Query: 1128 IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1187
                + K+L+  + E +      K  +A             + E      KV +  +  E
Sbjct: 2119 FLLVQAKQLITFTQELQDVVAKEKDTMAT-----------FECETSEPFVKVKWYKDGME 2167

Query: 1188 IFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQK 1247
            + EG KY+MH DR    + +      D ++ +    ++D      + +++ G V + +++
Sbjct: 2168 VHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVL-VEDENVKTTAKLIVEGAVVEFVKE 2226

Query: 1248 EAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVA--NIKKETHIVWYKDEREISVD 1305
              + +  E                 +GE    L+C V+  NI+ +    WY ++ E+  +
Sbjct: 2227 LQDIEVPE---------------SYSGE----LECIVSPENIEGK----WYHNDVELKSN 2263

Query: 1306 EKHDF--KDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKI 1363
             K+    + G   L + + +K+D G Y  ++  D  K   +LK+       L        
Sbjct: 2264 GKYTITSRRGRQNLTVKDVTKEDQGEYSFVI--DGKKTTCKLKMKPRPIAILQ------- 2314

Query: 1364 ALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQIN 1423
                  L  Q   EG  +   V   +E ++  W  +G  ++ SDRV   +  +   L I 
Sbjct: 2315 -----GLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIE 2369

Query: 1424 EPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLP 1483
            + T  D G Y   +          + LS       Y+                 V+  L 
Sbjct: 2370 DMTKEDAGNYSFTI--------PALGLSTSGRVSVYS---------------VDVITPLK 2406

Query: 1484 DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
            DV  I+  KA+ L C V       V W  N++ +  DD        G      IN    +
Sbjct: 2407 DVNVIEGTKAV-LECKVSVPDVTSVKWYLNDEQIKPDDRVQ-AIVKGTKQRLVINRTHAS 2464

Query: 1544 DSGKYGLVV 1552
            D G Y L+V
Sbjct: 2465 DEGPYKLIV 2473



 Score = 69.7 bits (169), Expect = 2e-11
 Identities = 121/559 (21%), Positives = 206/559 (36%), Gaps = 117/559 (20%)

Query: 1072  EFSWSKDYVSTEDSPRLEVESKGNKT-KMTFKDLGMDDLGIYSCDVTDTDGIASSYL--- 1127
             E +W KD    +++   +     + T ++   +L   D G Y C+++   G + + L   
Sbjct: 26443 EVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFM 26502

Query: 1128  -------------------IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWM 1168
                                 D++  +  +    E K P       + V  L+   V    
Sbjct: 26503 GQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDS 26562

Query: 1169  QAE---KLSGNAKVNYIFNE--KEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQ 1223
              A+   K +G  +   I+ +  K I +G KYK+  D+    +E+   K    D G YT  
Sbjct: 26563 VAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEI--HKTDTSDSGLYTCT 26620

Query: 1224  LQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCK 1283
             +++   +  S+  L      K  K+ E Q+              +S + T E   +   K
Sbjct: 26621 VKNSAGSVSSSCKLT----IKAIKDTEAQK--------------VSTQKTSE---ITPQK 26659

Query: 1284  VANIKKETHIVWYKDER----EISVDEKHDFKDGICTLLITEFSKKDAG-------IYEV 1332
              A +++E      + E     E    EK   K+    +LI+E  KK A        ++E 
Sbjct: 26660 KAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEE 26719

Query: 1333  ILKDDRGKDKSRLKLVDEAFKELMME------VCKKIALSATDLKIQSTAEGIQLYSFVT 1386
             I K  +  ++ R     +AF   M        V K     ATD+K               
Sbjct: 26720 ITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGATDVK--------------- 26764

Query: 1387  YYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKG--KYVMELFDGKTGH 1444
                      W  NG  +  S+  + GV+G    L I + +  D+G    + +  +G    
Sbjct: 26765 ---------WVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKC 26815

Query: 1445  QKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDP 1504
             Q  + LS +  D           A I++          P    I EG+ +  TC + G+P
Sbjct: 26816 QYDLTLSKELSDAP---------AFISQ----------PRSQNINEGQNVLFTCEISGEP 26856

Query: 1505  PPEVSWLKNEKALASDDHCNLKFEAGRTAY-FTINGVSTADSGKYGLVVKNKYGSETSDF 1563
              PE+ W KN   ++     N+     R  Y   I   S +DSGKY +  KN  G  ++  
Sbjct: 26857 SPEIEWFKNNLPISISS--NVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATA 26914

Query: 1564  TVSVF-IPEEEARMAALES 1581
             ++ V  + EE +R   L +
Sbjct: 26915 SLMVLPLVEEPSREVVLRT 26933



 Score = 68.2 bits (165), Expect = 6e-11
 Identities = 91/360 (25%), Positives = 148/360 (41%), Gaps = 39/360 (10%)

Query: 175  EEGITTSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEE 234
            E  I  S  +T  K+ +A+  S+A K + + K  T     T  R               +
Sbjct: 785  EASIAGSAIATLQKELSAT--SSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPD 842

Query: 235  TSEKKSRKVVIREKAERLSLRKTLEET-ETYH---AKLNEDHLLHAP-EFIIKP------ 283
            T + ++   V +E    ++     EE  E  H   AK+ E   + AP E  + P      
Sbjct: 843  TYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSG 902

Query: 284  -RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGC 342
             ++ TV E E+V L C I+G+P P VTWY+    I    +   + I  + G+  L I   
Sbjct: 903  LKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSID---FQITFQSGIARLMIREA 959

Query: 343  DFEDTAQYRASAMNVKGEL--SAYASVVVKR----------YKGEFDETRFHAGASTMPL 390
              ED+ ++  SA+N  G +  S Y +V V             K   +E RF      +  
Sbjct: 960  FAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMT 1019

Query: 391  SFGVT--PYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGV 448
               +T    G       +F  K  V    EG ++  GC+V   P     +P + W ++GV
Sbjct: 1020 DTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNP-----KPHVYWKKSGV 1074

Query: 449  PLSPSKWVQTLWSGE--RATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEI 506
            PL+     +  ++ +     L  S    +D G YTI VR  ++ E  ++   + +AD E+
Sbjct: 1075 PLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVR-NKHGETSASASLLEEADYEL 1133



 Score = 67.4 bits (163), Expect = 1e-10
 Identities = 62/233 (26%), Positives = 93/233 (39%), Gaps = 35/233 (15%)

Query: 251   RLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTW 310
             R +++K    T+T         L   PEF +   + T +  ENV+   +I   PEP VTW
Sbjct: 25365 RRTMKKIKRRTDTMRL------LERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTW 25418

Query: 311   YKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
             YK+   I    N  KY  ES  G++ L IN    +D A+Y   A N  GE S  A + V 
Sbjct: 25419 YKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVT 25478

Query: 371   RYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVI 430
              +    D T         P+                F      +  +EG+++    RV  
Sbjct: 25479 LHPPPTDST-------LRPM----------------FKRLLANAECQEGQSVCFEIRVSG 25515

Query: 431   TPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSG-ERATLTFSHLNKEDEGLYTI 482
              P      P ++W ++G PLS    ++ +  G +   L       ED G Y +
Sbjct: 25516 IP-----PPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRV 25563



 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 110/549 (20%), Positives = 203/549 (36%), Gaps = 91/549 (16%)

Query: 1036 PVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGN 1095
            P V  T+P   + V    ++G  ++  EC+     ++  W K+      S + E+ + G 
Sbjct: 5978 PPVEFTKPLEDQTV----EEGATAV-LECEVSRENAKVKWFKNGTEILKSKKYEIVADGR 6032

Query: 1096 KTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELA 1155
              K+   D   +D+  Y+CD  D     +  ++                 P V     L 
Sbjct: 6033 VRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVP----------------PHVEFLRPLT 6076

Query: 1156 -VEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQD 1214
             +++ EK   RF  + E    NAKV +  +  EI +G KY   I     +  + + K   
Sbjct: 6077 DLQVREKEMARF--ECELSRENAKVKWFKDGAEIKKGKKY--DIISKGAVRILVINKCLL 6132

Query: 1215 EDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTG 1274
            +DE  Y+ +++  + +   TV         L++EA F +               + EV+ 
Sbjct: 6133 DDEAEYSCEVRTARTSGMLTV---------LEEEAVFTK------------NLANIEVSE 6171

Query: 1275 ECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVIL 1334
               + L C+V+  K    ++WYK + EI    +++        ++TE  K+   I    L
Sbjct: 6172 TDTIKLVCEVS--KPGAEVIWYKGDEEIIETGRYE--------ILTEGRKRILVIQNAHL 6221

Query: 1335 KDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKV 1394
             +D G    RL       K  + E+  +      +L+I    EG +     +   E   V
Sbjct: 6222 -EDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEI---LEGEKAEFVCSISKESFPV 6277

Query: 1395 NWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQA 1454
             W  +   +   D+      G++  L + + T  D G YV+ +   +     TV      
Sbjct: 6278 QWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTV------ 6331

Query: 1455 YDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNE 1514
                                + R++  L D   ++E + +   C V      +  W +NE
Sbjct: 6332 ------------------IEKLRIVVPLKD-TRVKEQQEVVFNCEV-NTEGAKAKWFRNE 6371

Query: 1515 KALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEA 1574
            +A+  D    +  +        I      D   Y + + N  G E      ++ + EE+ 
Sbjct: 6372 EAI-FDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRG-ENVKSAANLIVEEEDL 6429

Query: 1575 RMAALESLK 1583
            R+  +E LK
Sbjct: 6430 RI--VEPLK 6436



 Score = 65.5 bits (158), Expect = 4e-10
 Identities = 62/235 (26%), Positives = 100/235 (42%), Gaps = 13/235 (5%)

Query: 142   SGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITTSKQSTASKQTTASKQSTASKQ 201
             S RQ+ V+ IT+ EEE   E + + AQR   +S   +   ++S +       +  +   +
Sbjct: 25930 SRRQREVTEITEIEEEY--EISKH-AQRESSSSASRLLRRRRSLSPTYIELMRPVSELIR 25986

Query: 202   STAS-----KQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKVVIREKAERLSLRK 256
             S        +  T  R  T  R    S    S+ +     E+ +R  +        +  K
Sbjct: 25987 SRPQPAEEYEDDTERRSPTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALK 26046

Query: 257   TLEETETYHAKLNEDH--LLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQ 314
             T + +E  +  L++    L HAP   ++ RSH V   +N +   ++   P   V WY N 
Sbjct: 26047 TQKTSERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNG 26106

Query: 315   VPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVV 369
             V +       K    +  G+ TLEI  C  +D+  YRA   N KGE S YA++ V
Sbjct: 26107 VELQ---ESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDV 26158



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 105/531 (19%), Positives = 200/531 (37%), Gaps = 98/531 (18%)

Query: 1051 NVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLG 1110
            N++     + +FEC+         W K+ V  E S + ++  +G   ++   +   +D  
Sbjct: 2844 NIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSA 2903

Query: 1111 IYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQA 1170
             Y+  V   D ++++  +    +  +L   +  +  T+  +    V +  +G    W++ 
Sbjct: 2904 EYTF-VCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFE----VTVNYEGISYKWLK- 2957

Query: 1171 EKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKAT 1230
                         N  EI    K +M   + T  + +    +   D   YTF    GKAT
Sbjct: 2958 -------------NGVEIKSTDKCQMRTKKLTHSLNI--RNVHFGDAADYTFVA--GKAT 3000

Query: 1231 NHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKE 1290
            + +T+ +         +  EF++         H  +    +V  +   + +C+V+  + +
Sbjct: 3001 STATLYVEA-------RHIEFRK---------HIKDI---KVLEKKRAMFECEVS--EPD 3039

Query: 1291 THIVWYKDEREISVDEKHDFKDG--ICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLV 1348
              + W KD++E+ + ++   +    +  LLI      DAG Y V+     G + S  KL 
Sbjct: 3040 ITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVA----GGNVSTAKLF 3095

Query: 1349 DEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVE------DLKVNWSHNGSA 1402
             E                  D++I+S  + +Q+       VE      D+  +W  +G  
Sbjct: 3096 VEG----------------RDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIE 3139

Query: 1403 IRYS--DRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYA 1460
            I +   +R K  V      + I+E   +D G+Y      G+     T+ ++     +   
Sbjct: 3140 INFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA--GRNRSSVTLYVNAPEPPQVLQ 3197

Query: 1461 EFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASD 1520
            E Q                      VT+Q GK       + G P P++SW K E+ L++ 
Sbjct: 3198 ELQP---------------------VTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTG 3236

Query: 1521 DHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPE 1571
              C    +        I      D+  Y    KN YG  T+  ++SV +PE
Sbjct: 3237 FKCKFLHDGQEYTLLLIEAF-PEDAAVYTCEAKNDYGVATTSASLSVEVPE 3286



 Score = 62.4 bits (150), Expect = 3e-09
 Identities = 101/468 (21%), Positives = 186/468 (39%), Gaps = 77/468 (16%)

Query: 977  YFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGP 1036
            +F D  E K K  ++  +++ A++ + +    L +   Y   VR    +G+         
Sbjct: 6101 WFKDGAEIK-KGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLT------- 6152

Query: 1037 VVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNK 1096
            V+ E    TK +  N++     ++   C+   P +E  W K      ++ R E+ ++G K
Sbjct: 6153 VLEEEAVFTKNLA-NIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRK 6211

Query: 1097 TKMTFKDLGMDDLGIYSCDVTD--TDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSEL 1154
              +  ++  ++D G Y+C +    TDG    + +  E + +   L               
Sbjct: 6212 RILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNL--------------- 6256

Query: 1155 AVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQD 1214
              EILE  +  F     K S    V +  ++K +  G KY +  D    ++ +    LQD
Sbjct: 6257 --EILEGEKAEFVCSISKES--FPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQD 6312

Query: 1215 EDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTG 1274
               GTY   +   +A  H TV+    +   L+     ++QE                   
Sbjct: 6313 M--GTYVVMVGAARAAAHLTVIEKLRIVVPLKDTRVKEQQE------------------- 6351

Query: 1275 ECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDF--KDGICTLLITEFSKKDAGIYEV 1332
               V+  C+V    +     W+++E  I    K+    KD + TL I +    D   Y V
Sbjct: 6352 ---VVFNCEVNT--EGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNV 6406

Query: 1333 ILKDDRGKD-KSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVED 1391
             L + RG++ KS   L+ E     ++E  K I             E ++  S VT++ + 
Sbjct: 6407 SLTNHRGENVKSAANLIVEEEDLRIVEPLKDI-------------ETMEKKS-VTFWCKV 6452

Query: 1392 LKVN----WSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVM 1435
             ++N    W+ NG  + + +RV   V   +  L I +    D+G+Y++
Sbjct: 6453 NRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIV 6500



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 92/403 (22%), Positives = 156/403 (38%), Gaps = 48/403 (11%)

Query: 1062 FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1121
            FEC+   P     W KD    + + R++++ +    ++      M D G Y+  V     
Sbjct: 3031 FECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYT--VVAGGN 3088

Query: 1122 IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQ--VRFWMQAEKLSGNAKV 1179
            ++++ L  E    R+ ++  E             V+++EK +  V F +  + +  +   
Sbjct: 3089 VSTAKLFVEGRDVRIRSIKKE-------------VQVIEKQRAVVEFEVNEDDVDAHWYK 3135

Query: 1180 NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVG 1239
            + I    ++ E  KY   ++R   I  MF+ + +  D G YTF        N S+V L  
Sbjct: 3136 DGIEINFQVQERHKYV--VERR--IHRMFISETRQSDAGEYTFVA----GRNRSSVTLYV 3187

Query: 1240 DVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDE 1299
            +  +  Q   E Q       +   F                 C V + + +  I WYK+E
Sbjct: 3188 NAPEPPQVLQELQPVTVQSGKPARF-----------------CAVISGRPQPKISWYKEE 3230

Query: 1300 REISVDEKHDF-KDGI-CTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMM 1357
            + +S   K  F  DG   TLL+ E   +DA +Y    K+D G   +   L  E  + +  
Sbjct: 3231 QLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSP 3290

Query: 1358 EVCKKIALSA--TDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTG 1415
            +    +   A  T L+   T+EG            DLKV+W      I+ S   +     
Sbjct: 3291 DQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFE 3350

Query: 1416 EQIWLQINEPTPNDKGKYVMELFD--GKTGHQKTVDLSGQAYD 1456
            +   L+I E  P D+G Y     +  G+      + L  QA D
Sbjct: 3351 DTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEVQALD 3393



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 63/288 (21%), Positives = 114/288 (39%), Gaps = 96/288 (33%)

Query: 1393  KVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKY--VMELFDGKTGHQKTVDL 1450
             +V W HNG  ++ S ++    T   + L+I +   +D G Y  V   + G+     T+D+
Sbjct: 26099 EVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDV 26158

Query: 1451  SGQAYD----------------------EAYA--EFQR---------------------- 1464
             +G  Y                       EAYA   F++                      
Sbjct: 26159 TGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRE 26218

Query: 1465  ------------LKQAAIAEKN--------------RARVLGGLPDVVTIQEGKALNLTC 1498
                         +K AA+ EK+               AR+L   P  +T+ EG++   +C
Sbjct: 26219 SLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTK-PRSMTVYEGESARFSC 26277

Query: 1499  NVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAY---FTINGVSTADSGKYGLVVKNK 1555
             +  G+P P V+WL+  + L++    + + +   T Y   F I+ V  +D G Y +VV+N 
Sbjct: 26278 DTDGEPVPTVTWLRKGQVLST----SARHQVTTTKYKSTFEISSVQASDEGNYSVVVENS 26333

Query: 1556  YGSETSDFTVSV--------------FIPEEEARMAALESLKGGKKAK 1589
              G + ++FT+++               +   E R+ + E++K  K+ K
Sbjct: 26334 EGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVK 26381



 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 43/130 (33%), Positives = 67/130 (51%), Gaps = 10/130 (7%)

Query: 940  IAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAI 999
            I VPGP  +L+ +E     + L W+ P+  G + + GY V+ ++ K K   W    + A 
Sbjct: 6782 IDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKT--WVLATDRA- 6838

Query: 1000 KNVYLKVRGL-KEGVSYVFRVRAINQAGVGKPSDLAGPVVAETR-----PGTKEVVVNVD 1053
            ++    V GL K GV Y+FRV A N+ G G+P +   PV A ++     P     + +V+
Sbjct: 6839 ESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVN 6898

Query: 1054 DDGVISLNFE 1063
              GV SL +E
Sbjct: 6899 RFGV-SLTWE 6907



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 57/235 (24%), Positives = 100/235 (42%), Gaps = 27/235 (11%)

Query: 1370  LKIQSTAEGIQLYSFVTYYVEDLK-VNWSHNGSAIRYSDRVKTGVTGEQIW-LQINEPTP 1427
             LK +++ E  +L   V   V   K V W  +G  ++ +   +   + +  + L+IN  T 
Sbjct: 26419 LKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTE 26478

Query: 1428  NDKGKYVMELFDGKTGHQKT-VDLSGQAY----------DEAYAEFQRLKQAAIAEKNRA 1476
             +D+G+YV E+  G+ G  KT +   GQA+           E     Q+  ++ +  K   
Sbjct: 26479 SDQGEYVCEI-SGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEP 26537

Query: 1477  R----------VLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLK 1526
             +          ++ GL D  T+             G+P P   W K+ KA+       L 
Sbjct: 26538 KAPEPISSKPVIVTGLQD-TTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLS 26596

Query: 1527  FEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV-FIPEEEARMAALE 1580
              + G   +  I+   T+DSG Y   VKN  GS +S   +++  I + EA+  + +
Sbjct: 26597 EDKG-GFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQ 26650



 Score = 54.7 bits (130), Expect = 7e-07
 Identities = 100/495 (20%), Positives = 186/495 (37%), Gaps = 92/495 (18%)

Query: 1062 FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1121
            FEC+     ++  W KD    +   + ++ SKG    +      +DD   YSC+V     
Sbjct: 6088 FECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTART 6147

Query: 1122 IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNY 1181
                 +++EE                V  K+   +E+ E   ++   +  K    A+V +
Sbjct: 6148 SGMLTVLEEE---------------AVFTKNLANIEVSETDTIKLVCEVSK--PGAEVIW 6190

Query: 1182 IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQL----QDGKATNHSTVVL 1237
               ++EI E  +Y++  +    I  + ++    ED G Y  +L     DGK   H     
Sbjct: 6191 YKGDEEIIETGRYEILTEGRKRI--LVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAA- 6247

Query: 1238 VGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYK 1297
                             E+I K  P  +E L  E          C ++  K+   + W +
Sbjct: 6248 -----------------EFISK--PQNLEILEGE-----KAEFVCSIS--KESFPVQWKR 6281

Query: 1298 DEREISVDEKHD-FKDG-ICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKEL 1355
            D++ +   +K+D   DG    L++ + + +D G Y V++   R    + L ++++     
Sbjct: 6282 DDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARA--AAHLTVIEKL---- 6335

Query: 1356 MMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTG 1415
                  +I +   D +++   E +      T   E  K  W  N  AI  S +       
Sbjct: 6336 ------RIVVPLKDTRVKEQQEVVFNCEVNT---EGAKAKWFRNEEAIFDSSKYIILQKD 6386

Query: 1416 EQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAA--IAEK 1473
                L+I +   +D+  Y + L    T H+                 + +K AA  I E+
Sbjct: 6387 LVYTLRIRDAHLDDQANYNVSL----TNHRG----------------ENVKSAANLIVEE 6426

Query: 1474 NRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTA 1533
               R++  L D+ T+ E K++   C V       + W KN + +  D+  + + +  +  
Sbjct: 6427 EDLRIVEPLKDIETM-EKKSVTFWCKV-NRLNVTLKWTKNGEEVPFDNRVSYRVDKYK-H 6483

Query: 1534 YFTINGVSTADSGKY 1548
              TI      D G+Y
Sbjct: 6484 MLTIKDCGFPDEGEY 6498



 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 1482  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1541
             +P+ +TI+ GK L +  +V+G P P   W K E  + +  H  +  +A  ++   I  V+
Sbjct: 12599 MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAV-HKADSSSILIIKDVT 12657

Query: 1542  TADSGKYGLVVKNKYGSETSDFTVSV 1567
               DSG Y L  +N  G++T    V V
Sbjct: 12658 RKDSGYYSLTAENSSGTDTQKIKVVV 12683



 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 44/192 (22%), Positives = 83/192 (43%), Gaps = 30/192 (15%)

Query: 180   TSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKK 239
             T   + +S + T+  ++++S +   S Q T +R+S +S +   S +  SA  +E++ E  
Sbjct: 26186 TEAYAVSSFKKTSEMEASSSVREVKS-QMTETRESLSSYEHSASAEMKSAALEEKSLE-- 26242

Query: 240   SRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCS 299
                    EK+    ++ TL                 A   + KPRS TV+E E+ +  C 
Sbjct: 26243 -------EKSTTRKIKTTL-----------------AARILTKPRSMTVYEGESARFSCD 26278

Query: 300   IAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKG 359
               G P P VTW +    ++  A   ++ + +     T EI+     D   Y     N +G
Sbjct: 26279 TDGEPVPTVTWLRKGQVLSTSA---RHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEG 26335

Query: 360   ELSAYASVVVKR 371
             +  A  ++ +++
Sbjct: 26336 KQEAEFTLTIQK 26347



 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 1/84 (1%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
             D +TI+ G+A  LT    G P P+VSW K+E  +  DD  ++K      A   I     +
Sbjct: 10521 DKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIK-AKRS 10579

Query: 1544  DSGKYGLVVKNKYGSETSDFTVSV 1567
             DSGKY +VV+N  GS      V+V
Sbjct: 10580 DSGKYCVVVENSTGSRKGFCQVNV 10603



 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 47/166 (28%), Positives = 72/166 (43%), Gaps = 9/166 (5%)

Query: 1407  DRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQ--- 1463
             +R      G+  WL+ N    +D    V  L +G T   + +  +        +E     
Sbjct: 22671 ERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPV 22730

Query: 1464  --RLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDD 1521
               R + A    +  AR+ G   D+VTI+ G  L L   V G P P++ W K +K L   +
Sbjct: 22731 TCRDEYAPPKAELDARLHG---DLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCE 22787

Query: 1522  HCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1567
               +L++  G+ A   I     +DSGKY L VKN  G++     V V
Sbjct: 22788 KVSLQY-TGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKV 22832



 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 78/375 (20%), Positives = 132/375 (35%), Gaps = 84/375 (22%)

Query: 184  STASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKV 243
            +T +K+    K++         ++S   R     R      +A +A++ +   + +S + 
Sbjct: 1924 TTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEE 1983

Query: 244  VIREKAERLSLRKTLEETETYHAKLNEDHLL----------------HAPEFIIKPRSHT 287
            ++R+  + L L  T E TE     L E+  +                 AP+   + +S T
Sbjct: 1984 LLRKTKDEL-LHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQT 2042

Query: 288  VWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDT 347
            V +  +      + G P+P   WYKN V I        Y  E    +  L I     ED+
Sbjct: 2043 VGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPED--NVCELVIRDVTAEDS 2100

Query: 348  AQYRASAMNVKGELSAYASVVVKRYK-------------GEFDETRFHAGASTMPLSFGV 394
            A     A+N+ GE S++A ++V+  +              E D        ++ P    V
Sbjct: 2101 ASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPF---V 2157

Query: 395  TPYGYASRFEIHFDDKFDVSFGR-----------------------EGETMSLGCRVVIT 431
                Y    E+H  DK+ +   R                       E E +    ++++ 
Sbjct: 2158 KVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVE 2217

Query: 432  PEIKHFQPEIQ------------------------WYRNGVPL-SPSKWVQTLWSGERAT 466
              +  F  E+Q                        WY N V L S  K+  T   G R  
Sbjct: 2218 GAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRG-RQN 2276

Query: 467  LTFSHLNKEDEGLYT 481
            LT   + KED+G Y+
Sbjct: 2277 LTVKDVTKEDQGEYS 2291



 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 59/299 (19%), Positives = 114/299 (38%), Gaps = 36/299 (12%)

Query: 1277  NVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDG--ICTLLITEFSKKDAGIYEVIL 1334
             NVL  C+++  +    I W+K+   IS+           + +L I   S  D+G Y +  
Sbjct: 26845 NVLFTCEISG-EPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKA 26903

Query: 1335  KDDRGKDKSR-----LKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYV 1389
             K+ RG+  +      L LV+E  +E+++          T L+   +++ +Q+ +      
Sbjct: 26904 KNFRGQCSATASLMVLPLVEEPSREVVLRTS-----GDTSLQGSFSSQSVQMSAS----- 26953

Query: 1390  EDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVD 1449
                        S   +S    + +T  +      +   + +  +V        G      
Sbjct: 26954 -------KQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQ 27006

Query: 1450  LSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVS 1509
             L             ++ +A I  +     +  LP  ++I EGK L + C   G+P PEV+
Sbjct: 27007 LESST--------SKMLKAGI--RGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVT 27056

Query: 1510  WLKNEKALASDDHCNLKFE-AGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1567
             W    + + S +      E         I  V   D G Y L + N++GS+++   + +
Sbjct: 27057 WSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 27115



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 42/157 (26%), Positives = 69/157 (43%), Gaps = 20/157 (12%)

Query: 217  SRQS-VVSKQATSALQQEETSEK---KSRKVVIREKAERLSLRKTLEETETYHAKLNEDH 272
            SR S +++ +AT+    + TS     K  K ++ E+++    RK L+  E      +E  
Sbjct: 1723 SRDSGIITCRATNKYGTDHTSATLIVKDEKSLV-EESQLPEGRKGLQRIEELERMAHEGA 1781

Query: 273  LL---------HAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANP 323
            L            P+ ++ P    V E E  +  C + G+P+P+V WY N   I      
Sbjct: 1782 LTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKR- 1840

Query: 324  GKYIIESRY-GMHTLEINGCDFEDTAQYRASAMNVKG 359
                   RY G+H L+I  C   DT + + +A N +G
Sbjct: 1841 ----FRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEG 1873



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 93/463 (20%), Positives = 166/463 (35%), Gaps = 72/463 (15%)

Query: 1018 RVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSK 1077
            RV A+  +   K + L G        G  +    V+ D VI    +C+     +   W K
Sbjct: 5694 RVEAMGMSSEAKLTVLEGDPYFT---GKLQDYTGVEKDEVI---LQCEISKADAPVKWFK 5747

Query: 1078 DYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLL 1137
            D    + S    +++ G K  +  K     D+G Y+CD   TD  +    I++ E+K + 
Sbjct: 5748 DGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCD-CGTDKTSGKLDIEDREIKLVR 5806

Query: 1138 ALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMH 1197
             L               +VE++E    RF  + E    +   N+    + + + P     
Sbjct: 5807 PLH--------------SVEVMETETARF--ETEISEDDIHANWKLKGEALLQTP--DCE 5848

Query: 1198 IDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTV-VLVGDVFKKLQKEAEFQRQEW 1256
            I     I  + +   + +  G   FQ  + K++ H  V   V  + + L+          
Sbjct: 5849 IKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVT------- 5901

Query: 1257 IRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICT 1316
                           VT        C+++   ++  + WY   +++   +K         
Sbjct: 5902 ---------------VTAGETATFDCELS--YEDIPVEWYLKGKKLEPSDK--------- 5935

Query: 1317 LLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSAT-DLKIQST 1375
                   + +  ++ + L+D + +D   ++L  + FK       K+  +  T  L+ Q+ 
Sbjct: 5936 ----VVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKPLEDQTV 5991

Query: 1376 AEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVM 1435
             EG           E+ KV W  NG+ I  S + +    G    L I++ TP D   Y  
Sbjct: 5992 EEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTC 6051

Query: 1436 ELFDGKTGHQKTVDLSGQAYDEAYAEFQR-LKQAAIAEKNRAR 1477
            +  D KT     V          + EF R L    + EK  AR
Sbjct: 6052 DAKDFKTSCNLNV-------VPPHVEFLRPLTDLQVREKEMAR 6087



 Score = 49.3 bits (116), Expect = 3e-05
 Identities = 96/436 (22%), Positives = 168/436 (38%), Gaps = 62/436 (14%)

Query: 1004 LKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFE 1063
            L +R +    S    V+AIN AG             +    T+E+   V  +      FE
Sbjct: 2090 LVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFE 2149

Query: 1064 CDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIA 1123
            C+   P  +  W KD +   +  +  + S      ++   +   D   YSC + + + + 
Sbjct: 2150 CETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVK 2209

Query: 1124 SSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILE--KGQVRFWMQAEKLSGNAKVNY 1181
            ++         +L+      +F    VK    +E+ E   G++   +  E + G     +
Sbjct: 2210 TT--------AKLIVEGAVVEF----VKELQDIEVPESYSGELECIVSPENIEG----KW 2253

Query: 1182 IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDV 1241
              N+ E+    KY   I    G   + ++ +  ED+G Y+F + DGK T           
Sbjct: 2254 YHNDVELKSNGKYT--ITSRRGRQNLTVKDVTKEDQGEYSFVI-DGKKTT---------- 2300

Query: 1242 FKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVL-LKCKVANIKKETHIVWYKDER 1300
              KL+          ++ +    ++ LS +   E +++ L+ KV+   +    VW KD +
Sbjct: 2301 -CKLK----------MKPRPIAILQGLSDQKVCEGDIVQLEVKVS--LESVEGVWMKDGQ 2347

Query: 1301 EIS-VDEKHDFKDGIC-TLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMME 1358
            E+   D  H   D     LLI + +K+DAG Y   +         R+ +         ++
Sbjct: 2348 EVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYS-------VD 2400

Query: 1359 VCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDL-KVNWSHNGSAIRYSDRVKTGVTGEQ 1417
            V        T LK  +  EG +        V D+  V W  N   I+  DRV+  V G +
Sbjct: 2401 V-------ITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTK 2453

Query: 1418 IWLQINEPTPNDKGKY 1433
              L IN    +D+G Y
Sbjct: 2454 QRLVINRTHASDEGPY 2469



 Score = 48.9 bits (115), Expect = 4e-05
 Identities = 115/564 (20%), Positives = 203/564 (35%), Gaps = 88/564 (15%)

Query: 994  LNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVD 1053
            L E   + + ++   L++  +Y  R+ +    G  K  +LA   ++  +P   E++    
Sbjct: 6206 LTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFIS--KPQNLEILEGEK 6263

Query: 1054 DDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYS 1113
             + V S++ E   +       W +D  + E   + +V + G K  +  KD  + D+G Y 
Sbjct: 6264 AEFVCSISKESFPV------QWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYV 6317

Query: 1114 CDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKL 1173
              V      A   +I++  +              VP+K      + E+ +V F    E  
Sbjct: 6318 VMVGAARAAAHLTVIEKLRI-------------VVPLKD---TRVKEQQEVVF--NCEVN 6359

Query: 1174 SGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHS 1233
            +  AK  +  NE+ IF+  KY   I +   +  + +     +D+  Y   L + +  N  
Sbjct: 6360 TEGAKAKWFRNEEAIFDSSKYI--ILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVK 6417

Query: 1234 TVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHI 1293
            +   +    + L+     +  E + K+   F     W      NV LK            
Sbjct: 6418 SAANLIVEEEDLRIVEPLKDIETMEKKSVTF-----WCKVNRLNVTLK------------ 6460

Query: 1294 VWYKDEREISVDEKHDFKDGICTLLIT--EFSKKDAGIYEVILKDDRGKDKSRLKLVDEA 1351
             W K+  E+  D +  ++      ++T  +    D G Y V      G+DKS  +L    
Sbjct: 6461 -WTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTA----GQDKSVAEL---- 6511

Query: 1352 FKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKT 1411
               L++E   +      D   Q+  E            E   V W  NG  I+   + K 
Sbjct: 6512 ---LIIEAPTEFVEHLED---QTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKF 6565

Query: 1412 GVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIA 1471
               G    L I +   +D+ +Y   + D K+  +  V       +E   E  R  Q  + 
Sbjct: 6566 EKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFV-------EEIPVEIIRPPQDILE 6618

Query: 1472 EKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGR 1531
                        DVV + E   LN           EV WL+N   +   D   +  E G+
Sbjct: 6619 APG--------ADVVFLAE---LN-------KDKVEVQWLRNNMVVVQGDKHQMMSE-GK 6659

Query: 1532 TAYFTINGVSTADSGKYGLVVKNK 1555
                 I  +   D G+Y  + K+K
Sbjct: 6660 IHRLQICDIKPRDQGEYRFIAKDK 6683



 Score = 48.9 bits (115), Expect = 4e-05
 Identities = 44/200 (22%), Positives = 83/200 (41%), Gaps = 11/200 (5%)

Query: 1388  YVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKT 1447
             Y +  +V W      +  S++ +         L + + T  D G Y  ++ +        
Sbjct: 25289 YDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSY 25348

Query: 1448  VDLSGQAYDEAYAEFQRLKQAAIAEK-NRARVLGGLPDVV------TIQEGKALNLTCNV 1500
              +L  +   E Y  + R     I  + +  R+L   P+        T   G+ +     +
Sbjct: 25349 AELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTI 25408

Query: 1501  WGDPPPEVSWLKN-EKALASDDHCNLKFEAGRTAY-FTINGVSTADSGKYGLVVKNKYGS 1558
                P P V+W K+ +K    D+     FE+ +  Y  TIN V+T D  +Y +V +NKYG 
Sbjct: 25409 TVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGE 25468

Query: 1559  ET--SDFTVSVFIPEEEARM 1576
             ++  +  TV++  P  ++ +
Sbjct: 25469 DSCKAKLTVTLHPPPTDSTL 25488



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 49/207 (23%), Positives = 79/207 (38%), Gaps = 35/207 (16%)

Query: 276 APEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMH 335
           AP F    +S  V E         I+G+P P V+W+++   I+    PG  I  S  G  
Sbjct: 5   APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD-GRA 63

Query: 336 TLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVT 395
            L I      ++ +Y   A N  G+ ++ A ++VK              A T P      
Sbjct: 64  KLTIPAVTKANSGRYSLKATNGSGQATSTAELLVK--------------AETAP------ 103

Query: 396 PYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKW 455
                     +F  +      R+G  + L  RV   P      P +++YR+G  +  S  
Sbjct: 104 ---------PNFVQRLQSMTVRQGSQVRLQVRVTGIP-----TPVVKFYRDGAEIQSSLD 149

Query: 456 VQTLWSGERATLTFSHLNKEDEGLYTI 482
            Q    G+  +L  +    ED G Y++
Sbjct: 150 FQISQEGDLYSLLIAEAYPEDSGTYSV 176



 Score = 48.1 bits (113), Expect = 7e-05
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query: 1479  LGGLPDVVTI-QEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTI 1537
             L GLPD+  + +E     L   + G P P VSW K E  LA+D   +++  A  T    +
Sbjct: 13679 LKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTT-LIV 13737

Query: 1538  NGVSTADSGKYGLVVKNKYGSETSDFTVSV 1567
                  +D+GKY + +KN  G++    ++ V
Sbjct: 13738 YDCQKSDAGKYTITLKNVAGTKEGTISIKV 13767



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 112/499 (22%), Positives = 178/499 (35%), Gaps = 92/499 (18%)

Query: 1062 FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1121
            FEC+       F W K         R E+   G K  M  K    +D   Y  +  D   
Sbjct: 5554 FECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKH- 5612

Query: 1122 IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNY 1181
             +   +I+   LK L            P+K    V   EK    F    E    N +V +
Sbjct: 5613 TSGKLIIEGIRLKFL-----------TPLKD---VTAKEKESAVF--TVELSHDNIRVKW 5656

Query: 1182 IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDV 1241
              N++ +       M  +  T  I    + L  +D      +   G ++     VL GD 
Sbjct: 5657 FKNDQRLHTTRSVSMQDEGKTHSIT--FKDLSIDDTSQIRVEAM-GMSSEAKLTVLEGDP 5713

Query: 1242 F--KKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDE 1299
            +   KLQ     ++ E                      V+L+C+++  K +  + W+KD 
Sbjct: 5714 YFTGKLQDYTGVEKDE----------------------VILQCEIS--KADAPVKWFKDG 5749

Query: 1300 REISVDEKHDFK-DGICTLLITEFS-KKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMM 1357
            +EI   +    K DG   +LI + + K D G Y      D G DK+  KL D   +E+  
Sbjct: 5750 KEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC----DCGTDKTSGKL-DIEDREI-- 5802

Query: 1358 EVCKKIALSATDLKIQSTAEGIQLYSFVTYYVE-DLKVNWSHNGSAIRYSDRVKTGVTGE 1416
                K+      +++  T    +   F T   E D+  NW   G A+             
Sbjct: 5803 ----KLVRPLHSVEVMET----ETARFETEISEDDIHANWKLKGEAL------------- 5841

Query: 1417 QIWLQINEPTPNDKGK-YVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNR 1475
               LQ  +    ++GK + + L + +      VD   QA +   +   R+K   I     
Sbjct: 5842 ---LQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDF--QAANVKSSAHLRVKPRVIG---- 5892

Query: 1476 ARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYF 1535
              +L  L D VT+  G+     C +  +  P V W    K L   D    + E G+    
Sbjct: 5893 --LLRPLKD-VTVTAGETATFDCELSYEDIP-VEWYLKGKKLEPSDKVVPRSE-GKVHTL 5947

Query: 1536 TINGVSTADSGKYGLVVKN 1554
            T+  V   D+G+  L  K+
Sbjct: 5948 TLRDVKLEDAGEVQLTAKD 5966



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 2/95 (2%)

Query: 1486  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADS 1545
             V  + G+ + +     G PPP V+W K+EK L SD   +++     ++  TI  V+  D+
Sbjct: 20976 VIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIE-NTDSSSLLTIPQVTRNDT 21034

Query: 1546  GKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALE 1580
             GKY L ++N  G E    TVSV + +  A    L+
Sbjct: 21035 GKYILTIENGVG-EPKSSTVSVKVLDTPAACQKLQ 21068



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 7/122 (5%)

Query: 1448  VDLSGQA-YDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPP 1506
             V++ G + Y E+ AE + +++  I +   A     L   VTI+ G +L L  +V G PPP
Sbjct: 23115 VNVKGMSEYSESIAEIEPVERIEIPDLELA---DDLKKTVTIRAGASLRLMVSVSGRPPP 23171

Query: 1507  EVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVS 1566
              ++W K    LAS    +        +   ++ V+  D+GKY +  +N+ G +++   V 
Sbjct: 23172 VITWSKQGIDLASRAIID---TTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVK 23228

Query: 1567  VF 1568
             V+
Sbjct: 23229 VY 23230



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 152/790 (19%), Positives = 286/790 (36%), Gaps = 153/790 (19%)

Query: 901  KISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLV 960
            KIS  K    Y+  +A   +A L     +S     ++ T +V  P  ++K SE R     
Sbjct: 774  KISVPKTEHGYEASIAGSAIATL--QKELSATSSAQKITKSVKAP--TVKPSETR----- 824

Query: 961  LQWKPPVHSGRTPVTGY-FVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRV 1019
                  V +  TP+  + F D  +    E       E  +      VR  +  V +    
Sbjct: 825  ------VRAEPTPLPQFPFADTPDTYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREA 878

Query: 1020 RAINQAGVGKPSDLAGPVVAETR-PGTKEVVVNVDDDGVISLNFECD-KMTPKSEFSWSK 1077
            +    A V  P ++  PV   T   G K V V   +    S+  EC     P    +W +
Sbjct: 879  KVTETARVPAPVEI--PVTPPTLVSGLKNVTVIEGE----SVTLECHISGYPSPTVTWYR 932

Query: 1078 DYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS--YL---IDEE- 1131
            +    E S   ++  +    ++  ++   +D G ++C   +  G  S+  YL   + EE 
Sbjct: 933  EDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEF 992

Query: 1132 -------------ELKRLL----------ALSHEHKFPTVP-----VKSELAVEILEKGQ 1163
                         E KR +          +L+ E   P  P     +   +  +++E G 
Sbjct: 993  EKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGS 1052

Query: 1164 VRFWMQAEKLSGNAKVNYIFNEKEI--FEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYT 1221
            V F  Q   + GN K +  + +  +    G +YK+  ++ TG  ++ +     +D G YT
Sbjct: 1053 VVFGCQ---VGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYT 1109

Query: 1222 FQLQDGKATNHSTVVLVGD----VFKKLQKEAEFQRQEWIRKQGPHFVE------YLSWE 1271
              +++      ++  L+ +    +  K Q+E  +Q Q     Q P   E      Y  +E
Sbjct: 1110 IVVRNKHGETSASASLLEEADYELLMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYE 1169

Query: 1272 VTGECN-VLLKCKVANIKKETHIV-WYKDEREISVDEKHDFKDGICTLLITEFSKKDAGI 1329
               E    L++ K+A   K+T +V  Y +++E  +     F++ +   +     K     
Sbjct: 1170 KEYEKEQALIRKKMA---KDTVVVRTYVEDQEFHISS---FEERLIKEIEYRIIKTTL-- 1221

Query: 1330 YEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQS----TAEGIQLYSFV 1385
             E +L++D G++K  + + +    E           S  D +I++       G+  +  +
Sbjct: 1222 -EELLEED-GEEKMAVDISESEAVE-----------SGFDSRIKNYRILEGMGVTFHCKM 1268

Query: 1386 TYYVEDLKVNWSHNGSAIRYSDRVKTGVTGE-QIWLQINEPTPNDKGKYVM--------E 1436
            + Y    K+ W  +G  I++ +R +     + +  L+I    P D+G Y           
Sbjct: 1269 SGYPLP-KIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNA 1327

Query: 1437 LFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNR--------------------- 1475
            +  GK   +    L    Y        R++  +    +R                     
Sbjct: 1328 ICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMS 1387

Query: 1476 -ARVLGGL---------------------PDVVTIQEGKALNLTCNVWGDPPPEVSWLKN 1513
             AR+  G                      P      EG+       V G P PE  W  +
Sbjct: 1388 PARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHD 1447

Query: 1514 EKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEE 1573
             + + +D    +  +   T    I   + +DSG++ +V +N+ G  +    ++V   E +
Sbjct: 1448 GQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQ 1507

Query: 1574 ARMAALESLK 1583
             +   +E LK
Sbjct: 1508 VKPMFVEKLK 1517



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 41/205 (20%), Positives = 77/205 (37%), Gaps = 33/205 (16%)

Query: 1262  PHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFK---DGICTLL 1318
             P   ++L  E + E   L     +++ +   + WYKD +++  +    F    DG   L 
Sbjct: 26413 PKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELK 26472

Query: 1319  ITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTA-- 1376
             I   ++ D G Y   +  + G  K+ L+ + +AFK +  +V K      +D K   +   
Sbjct: 26473 INNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVT 26532

Query: 1377  --------EGIQLYSFVTYYVEDLKVN--------------------WSHNGSAIRYSDR 1408
                     E I     +   ++D  V+                    W+ +G AI    +
Sbjct: 26533 RKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGK 26592

Query: 1409  VKTGVTGEQIWLQINEPTPNDKGKY 1433
              K        +L+I++   +D G Y
Sbjct: 26593 YKLSEDKGGFFLEIHKTDTSDSGLY 26617



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 64/306 (20%), Positives = 122/306 (39%), Gaps = 34/306 (11%)

Query: 184   STASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKV 243
             S++ K T  + + T +++ +  K S  + Q  A  Q  +S++A  + + + +  K   K+
Sbjct: 26629 SSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKL 26688

Query: 244   VIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGW 303
              ++E+A ++ +    EE +   A   E  ++H  E I K    T    E V+ H  I   
Sbjct: 26689 ALKEEASKVLIS---EEVKKSAATSLEKSIVH--EEITK----TSQASEEVRTHAEIKA- 26738

Query: 304   PEPRVTWYKNQVPINVHANPGKYIIESRYGMHT---LEINGCDFEDTAQYRASAMNVKGE 360
                    +  Q+ IN      + ++++     T     +NG +  ++ +YR         
Sbjct: 26739 -------FSTQMSIN---EGQRLVLKANIAGATDVKWVLNGVELTNSEEYRYG------- 26781

Query: 361   LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGE 420
             +S     +  +     DE      + T     G+    Y         D          +
Sbjct: 26782 VSGSDQTLTIKQASHRDEGILTCISKTKE---GIVKCQYDLTLSKELSDAPAFISQPRSQ 26838

Query: 421   TMSLGCRVVITPEIK-HFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGL 479
              ++ G  V+ T EI     PEI+W++N +P+S S  V    S    +L   + +  D G 
Sbjct: 26839 NINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGK 26898

Query: 480   YTIRVR 485
             YTI+ +
Sbjct: 26899 YTIKAK 26904



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 46/190 (24%), Positives = 78/190 (41%), Gaps = 28/190 (14%)

Query: 1396 WSHNGSAI--RYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQ 1453
            W H+G  I   Y+ +V     G Q  L I   TP+D G++ +   +       +V L+ +
Sbjct: 1444 WFHDGQQIVNDYTHKVVIKEDGTQS-LIIVPATPSDSGEWTVVAQNRAGRSSISVILTVE 1502

Query: 1454 AYDEAYAEF--QRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWL 1511
            A +        ++LK                   V I+EG  L +     G+P P++ WL
Sbjct: 1503 AVEHQVKPMFVEKLKN------------------VNIKEGSRLEMKVRATGNPNPDIVWL 1544

Query: 1512 KNEKALASDDHCNLKFEAGR-TAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFI- 1569
            KN   +    +  ++ E  +  A   I+   + DS  Y     NK G +T+   V+V + 
Sbjct: 1545 KNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVE 1604

Query: 1570 ---PEEEARM 1576
               PE E ++
Sbjct: 1605 FAEPEPERKL 1614



 Score = 44.7 bits (104), Expect = 7e-04
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 5/91 (5%)

Query: 1486 VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASD--DHCNLKFEAGRTAYFTINGVSTA 1543
            V + EG       ++ G P PEVSW ++ + +++       + F  GR A  TI  V+ A
Sbjct: 15   VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR-AKLTIPAVTKA 73

Query: 1544 DSGKYGLVVKNKYGSETSDFTVSVFIPEEEA 1574
            +SG+Y L   N  G  TS  T  + +  E A
Sbjct: 74   NSGRYSLKATNGSGQATS--TAELLVKAETA 102



 Score = 44.7 bits (104), Expect = 7e-04
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
             DV+T++ G+ + +   V G P P+++W K  K L  +   +L  +  R     I     A
Sbjct: 11611 DVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVE-LQIKEAVRA 11669

Query: 1544  DSGKYGLVVKNKYGSETSDFTVSV 1567
             D GKY +  KN  G       V+V
Sbjct: 11670 DHGKYIISAKNSSGHAQGSAIVNV 11693



 Score = 44.7 bits (104), Expect = 7e-04
 Identities = 29/86 (33%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 1482  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1541
             L  VV ++    L L   + G P PEV W K E  L   D   ++  +  T    I+ V+
Sbjct: 18808 LRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT--DRAQIEVTSSFTM-LVIDNVT 18864

Query: 1542  TADSGKYGLVVKNKYGSETSDFTVSV 1567
               DSG+Y L ++N  GS+T+   V V
Sbjct: 18865 RFDSGRYNLTLENNSGSKTAFVNVRV 18890



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 56/255 (21%), Positives = 97/255 (38%), Gaps = 41/255 (16%)

Query: 238  KKSRKVVIREKAERLSLRKTLEETE---TYHAKLNEDHLL------HAPEFIIKPRSHTV 288
            ++  K V+  +  R+ + +T +      T+ A  N   +         P+ + + +  TV
Sbjct: 3145 QERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTV 3204

Query: 289  WEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTA 348
               +  +    I+G P+P+++WYK +  ++      K++ + +   +TL +     ED A
Sbjct: 3205 QSGKPARFCAVISGRPQPKISWYKEEQLLST-GFKCKFLHDGQ--EYTLLLIEAFPEDAA 3261

Query: 349  QYRASAMNVKG--ELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIH 406
             Y   A N  G    SA  SV V        E   +  A   PL   VT  G  +RF+  
Sbjct: 3262 VYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQ-- 3319

Query: 407  FDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERAT 466
                               CRV  T        ++ WY     + PS++ +     +   
Sbjct: 3320 -------------------CRVSGT------DLKVSWYSKDKKIKPSRFFRMTQFEDTYQ 3354

Query: 467  LTFSHLNKEDEGLYT 481
            L  +    EDEG YT
Sbjct: 3355 LEIAEAYPEDEGTYT 3369



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 83/367 (22%), Positives = 145/367 (39%), Gaps = 60/367 (16%)

Query: 1085 SPRLEVESKGNKTKMTFKDLGMDDLG--IYSCDVTDTDGIASSYLIDEEELKRLLALSHE 1142
            SP  E++++G K  +T   + +D  G  +Y      T  I +   + E EL         
Sbjct: 5134 SPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILT---VKEIELDF------- 5183

Query: 1143 HKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNT 1202
                 VP+K    V + E+ Q RF      L+  A V +      I    K+ +  D   
Sbjct: 5184 ----AVPLKD---VTVPERRQARFECV---LTREANVIWSKGPDIIKSSDKFDIIADGKK 5233

Query: 1203 GIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGP 1262
             I+   +   Q +DEG YT +++ GK T  S  + V  +  K     E Q  +       
Sbjct: 5234 HIL--VINDSQFDDEGVYTAEVE-GKKT--SARLFVTGIRLKFMSPLEDQTVK------- 5281

Query: 1263 HFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEF 1322
                       GE    + C++++ K   H+VW+K++ ++             T+LI+  
Sbjct: 5282 ----------EGETATFV-CELSHEKM--HVVWFKNDAKLHTSR---------TVLISSE 5319

Query: 1323 SKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLY 1382
             K      + +  DD  + K+++K +    +  ++E      +   D K     + I L 
Sbjct: 5320 GKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHD-KTAVEKDEITLK 5378

Query: 1383 SFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKT 1442
              V+   +D+ V W  +G  I  S +      G +  L+I +    DKG+YV +    KT
Sbjct: 5379 CEVS---KDVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKT 5435

Query: 1443 GHQKTVD 1449
                TV+
Sbjct: 5436 KANVTVE 5442



 Score = 43.5 bits (101), Expect = 0.002
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 1482  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEA-GRTAYFTINGV 1540
             L  V+T++ G  + L   V G P PEV+W K++ A        +K +    ++ F++   
Sbjct: 11902 LSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKA 11961

Query: 1541  STADSGKYGLVVKNKYGSETSDFTVSV 1567
               +D GKY +   N  GS  +  TV+V
Sbjct: 11962 KRSDGGKYVVTATNTAGSFVAYATVNV 11988



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 30/116 (25%), Positives = 51/116 (43%), Gaps = 5/116 (4%)

Query: 1456  DEAYAEFQRLKQAAIAEKNR----ARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWL 1511
             D  Y+E +    + I ++ +    A + G    ++T + G    +   + G P P+V+W 
Sbjct: 22318 DAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWK 22377

Query: 1512  KNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1567
               E  L   D  ++     RT   T+      DSG+Y L ++N  G +T   TV V
Sbjct: 22378 LEEMRLKETDRVSITTTKDRTT-LTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVV 22432



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 22/84 (26%), Positives = 35/84 (41%), Gaps = 1/84 (1%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
             D + +  G+   L  +V G P P + WL+ +K +     C +K      A   +      
Sbjct: 17328 DTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIK-NTDFKALLIVKDAIRI 17386

Query: 1544  DSGKYGLVVKNKYGSETSDFTVSV 1567
             D G+Y L   N  GS++    V V
Sbjct: 17387 DGGQYILRASNVAGSKSFPVNVKV 17410



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 1/94 (1%)

Query: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
            P F+ K ++  + E   +++     G P P + W KN   I  H  P K  IE   G   
Sbjct: 1510 PMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYP-KIRIEGTKGEAA 1568

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
            L+I+    +D+A Y A+A+N  G  +    V V+
Sbjct: 1569 LKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVE 1602



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 66/302 (21%), Positives = 111/302 (36%), Gaps = 30/302 (9%)

Query: 224  KQATSALQQEETSEKKSRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKP 283
            K+ +S+    E     S ++ + +  E L L   L E+  Y  K + +     P FI + 
Sbjct: 3599 KEFSSSFLSAEEEGLHSAELQLSKINETLEL---LSESPVYPTKFDSEKEGTGPIFIKEV 3655

Query: 284  RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCD 343
             +  +   +   L  ++ G P+P++ W+ N V +   A+  K++ +     H+L I    
Sbjct: 3656 SNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSAD-YKFVFDG--DDHSLIILFTK 3712

Query: 344  FEDTAQYRASAMNVKGE--LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYAS 401
             ED  +Y   A N  G+   SAY  +  K    +  ET      S   L     P     
Sbjct: 3713 LEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPP----- 3767

Query: 402  RFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWS 461
                HF  +       +G        VV  P      P + W++    L  S +   + +
Sbjct: 3768 ----HFLKELKPIRCAQGLPAIFEYTVVGEP-----APTVTWFKENKQLCTSVYYTIIHN 3818

Query: 462  -GERATLTFSHLNKEDEGLYTIRVR--MGEYYEQYSAYVFVRDAD-----AEIEGAPAAP 513
                 T   +   +ED GLY  +    +GE        V + D D      + +  P AP
Sbjct: 3819 PNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLLEDTDMTDTPCKAKSTPEAP 3878

Query: 514  LD 515
             D
Sbjct: 3879 ED 3880



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 43/211 (20%), Positives = 77/211 (36%), Gaps = 25/211 (11%)

Query: 1372 IQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPND-K 1430
            + + +E   +    T      +VNW      +   ++ K         L I++    D +
Sbjct: 4442 VDTVSEEGDIVHLTTSITNAKEVNWYFENKLVPSDEKFKCLQDQNTYTLVIDKVNTEDHQ 4501

Query: 1431 GKYVMELFD--GKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTI 1488
            G+YV E  +  GKT                 A+   +K+AA   K +   L        +
Sbjct: 4502 GEYVCEALNDSGKTATS--------------AKLTVVKRAAPVIKRKIEPL-------EV 4540

Query: 1489 QEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKY 1548
              G     TC +   P     W K  + +   D C+++  +   +   I      D G+Y
Sbjct: 4541 ALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIR-SSKYISSLEILRTQVVDCGEY 4599

Query: 1549 GLVVKNKYGSETSDFTVSVFIPEEEARMAAL 1579
                 N+YGS +   T++V +P  E ++  L
Sbjct: 4600 TCKASNEYGSVSCTATLTVTVPGGEKKVRKL 4630



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 72/365 (19%), Positives = 133/365 (36%), Gaps = 62/365 (16%)

Query: 124  LSGEEKENLPSDYMVPIFSGRQKHVSGITDTEEERIKE----AAAYIAQRNLLASEEGIT 179
            L G++ E  PSD +VP   G+  H   + D + E   E    A  +    NL   E  + 
Sbjct: 5925 LKGKKLE--PSDKVVPRSEGKV-HTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVE 5981

Query: 180  TSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKK 239
             +K           +  T  + +TA  +   SR++   +      +   + + E  ++ +
Sbjct: 5982 FTKPL---------EDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGR 6032

Query: 240  SRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCS 299
             RK+VI +      ++    + + +    N + +    EF+       V EKE  +  C 
Sbjct: 6033 VRKLVIHDCTPE-DIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFECE 6091

Query: 300  IAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKG 359
            ++     +V W+K+   I       KY I S+  +  L IN C  +D A+Y       + 
Sbjct: 6092 LSR-ENAKVKWFKDGAEIK---KGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTAR- 6146

Query: 360  ELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREG 419
              S   +V+        +E  F    + + +S                          E 
Sbjct: 6147 -TSGMLTVLE-------EEAVFTKNLANIEVS--------------------------ET 6172

Query: 420  ETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGL 479
            +T+ L C      E+     E+ WY+    +  +   + L  G +  L   + + ED G 
Sbjct: 6173 DTIKLVC------EVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGN 6226

Query: 480  YTIRV 484
            Y  R+
Sbjct: 6227 YNCRL 6231



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 26/84 (30%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 1484 DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
            D++ I EG+ L++       P P VSW K+ K + + D   +K +   +A+  +     A
Sbjct: 8090 DIIVI-EGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKND-HISAHLEVPKSVRA 8147

Query: 1544 DSGKYGLVVKNKYGSETSDFTVSV 1567
            D+G Y + ++NK GS T+   V V
Sbjct: 8148 DAGIYTITLENKLGSATASINVKV 8171



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 50/209 (23%), Positives = 82/209 (39%), Gaps = 25/209 (11%)

Query: 286   HTVWEKE-NVKLHCSIAGWPEP-RVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCD 343
             H V E+  +VK  C I  + +  +VTWY     +    N  KY I    G+  L +    
Sbjct: 25271 HAVGEEGGHVKYVCKIENYDQSTQVTWYFG---VRQLENSEKYEITYEDGVAILYVKDIT 25327

Query: 344   FEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASR- 402
               D   YR   +N  GE S+YA + VK  +  +D   ++   +   +           R 
Sbjct: 25328 KLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYD---YYCRRTMKKIKRRTDTMRLLERP 25384

Query: 403   --FEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSP----SKWV 456
               F +   +K        GE +  G  + + PE     P + WY++G  + P     K+ 
Sbjct: 25385 PEFTLPLYNK----TAYVGENVRFGVTITVHPE-----PHVTWYKSGQKIKPGDNDKKYT 25435

Query: 457   QTLWSGERATLTFSHLNKEDEGLYTIRVR 485
                  G    LT + +  +D+  YT+  R
Sbjct: 25436 FESDKG-LYQLTINSVTTDDDAEYTVVAR 25463



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
             D + +  G++  +  +++G P P + W+K ++ L++     +K     T+  ++      
Sbjct: 16246 DTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATS-LSVKDAVRV 16304

Query: 1544  DSGKYGLVVKNKYGSETSDFTVSV 1567
             DSG Y L  KN  G  +    V V
Sbjct: 16305 DSGNYILKAKNVAGERSVTVNVKV 16328



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 29/96 (30%), Positives = 42/96 (43%), Gaps = 5/96 (5%)

Query: 290   EKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQ 349
             E ++V     ++G P P + W K+  P+++   P   II      + L I     EDT  
Sbjct: 25503 EGQSVCFEIRVSGIPPPTLKWEKDGQPLSL--GPNIEIIHEGLDYYALHIRDTLPEDTGY 25560

Query: 350   YRASAMNVKGELSAYASVVVKRY---KGEFDETRFH 382
             YR +A N  G  S  A + V+R    K EF     H
Sbjct: 25561 YRVTATNTAGSTSCQAHLQVERLRYKKQEFKSKEEH 25596



 Score = 41.2 bits (95), Expect = 0.008
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 1/81 (1%)

Query: 1487  TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSG 1546
             +IQ G+ L +   V G P P +SW+K+ + L      N++  A  T      G +  D G
Sbjct: 18017 SIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEG-NKDDFG 18075

Query: 1547  KYGLVVKNKYGSETSDFTVSV 1567
             KY +   N  G+ T + +V V
Sbjct: 18076 KYTVTATNSAGTATENLSVIV 18096



 Score = 40.8 bits (94), Expect = 0.011
 Identities = 40/166 (24%), Positives = 64/166 (38%), Gaps = 21/166 (12%)

Query: 1396 WSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAY 1455
            W  +GS IR S + +    G+   L I +   +D G+Y   L  G      T  L     
Sbjct: 4846 WMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKL----- 4900

Query: 1456 DEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEK 1515
                          + E+   R +  L + VT+ +G+ L L+C +  +   +V W K+ K
Sbjct: 4901 --------------VVEELPVRFVKTLEEEVTVVKGQPLYLSCEL--NKERDVVWRKDGK 4944

Query: 1516 ALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETS 1561
             +       +    G     TIN     D+G Y + V+N    E S
Sbjct: 4945 IVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECS 4990



 Score = 40.8 bits (94), Expect = 0.011
 Identities = 61/309 (19%), Positives = 119/309 (38%), Gaps = 50/309 (16%)

Query: 1047 EVVVNVDDDGVISLN---FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKD 1103
            E V +++D  V   +   F C     K+   W ++    ++  + + E  G+  ++  KD
Sbjct: 6519 EFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKD 6578

Query: 1104 LGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVK-SELAVEILEKG 1162
              +DD   Y+C V D    A  ++ +                  +PV+      +ILE  
Sbjct: 6579 CRLDDECEYACGVEDRKSRARLFVEE------------------IPVEIIRPPQDILEAP 6620

Query: 1163 QVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTF 1222
                   AE      +V ++ N   + +G K++M  +    I  + +  ++  D+G Y F
Sbjct: 6621 GADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGK--IHRLQICDIKPRDQGEYRF 6678

Query: 1223 QLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKC 1282
              +D +A     +     +     K A+   Q+ +   G      + ++           
Sbjct: 6679 IAKDKEARAKLELAAAPKI-----KTAD---QDLVVDVGKPLTMVVPYD----------- 6719

Query: 1283 KVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDK 1342
              A  K E    W+K+   +S  +  D      +  I E  K D G Y+++L++  GK +
Sbjct: 6720 --AYPKAEAE--WFKENEPLST-KTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAE 6774

Query: 1343 S--RLKLVD 1349
                LK++D
Sbjct: 6775 GFINLKVID 6783



 Score = 40.4 bits (93), Expect = 0.014
 Identities = 29/85 (34%), Positives = 37/85 (43%), Gaps = 3/85 (3%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVST- 1542
             D V ++ G+A  L  +V G PPP + W K+ K L       +K     T    +N  ST 
Sbjct: 15164 DTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTN--LVNKDSTR 15221

Query: 1543  ADSGKYGLVVKNKYGSETSDFTVSV 1567
              DSG Y L   N  G     F V V
Sbjct: 15222 RDSGAYTLTATNPGGFAKHIFNVKV 15246



 Score = 40.4 bits (93), Expect = 0.014
 Identities = 36/155 (23%), Positives = 63/155 (40%), Gaps = 16/155 (10%)

Query: 1414  TGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEK 1473
             +G+  W + N+    DK   +  L +         +   + + E      R ++ A++ K
Sbjct: 24167 SGDSAWKKSNKERIKDKQFTIGGLLEA-------TEYEFRVFAENETGLSRPRRTAMSIK 24219

Query: 1474  NRARVLGGLPDV------VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKF 1527
              +    G  P +      VT + G+A  L+C + G P P++ W +  K L       +  
Sbjct: 24220 TKL-TSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSS 24278

Query: 1528  EAGRTAYFTINGVSTADSGKYGLVVKNKYGS-ETS 1561
             + GRT   T+      D G Y  +  N+ G  ETS
Sbjct: 24279 D-GRTHTLTVMTEEQEDEGVYTCIATNEVGEVETS 24312



 Score = 40.0 bits (92), Expect = 0.018
 Identities = 112/546 (20%), Positives = 188/546 (34%), Gaps = 108/546 (19%)

Query: 1014 SYVFRVRAINQAGVGKPSDLAGPVVAETRP-----GTKEVVVNVDDDGVISLNFECDKMT 1068
            +Y F + A+  +  G+ S  +  V+   +      GTK V+             EC    
Sbjct: 2378 NYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVL-------------ECKVSV 2424

Query: 1069 PK-SEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1127
            P  +   W  +    +   R++   KG K ++        D G Y   V     + ++  
Sbjct: 2425 PDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIV---GRVETNCN 2481

Query: 1128 IDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1187
            +  E++K +  L       T  V  E  VE+   G    W               F +KE
Sbjct: 2482 LSVEKIKIIRGLRDLTCTETQNVVFE--VELSHSGIDVLWN--------------FKDKE 2525

Query: 1188 IFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQK 1247
            I    KYK  I+ +  I ++ +  +  +DEG YTF   +   +   TV   G + K L  
Sbjct: 2526 IKPSSKYK--IEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVA-GGAISKPLTD 2582

Query: 1248 EAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEK 1307
            +   + QE                       + +C+VAN   ++   W +D + + +   
Sbjct: 2583 QTVAESQE----------------------AVFECEVAN--PDSKGEWLRDGKHLPLTNN 2618

Query: 1308 -HDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALS 1366
                 DG    LI   +K D  I E   K    K  ++LK+  EA          KI  +
Sbjct: 2619 IRSESDGHKRRLIIAATKLD-DIGEYTYKVATSKTSAKLKV--EAV---------KIKKT 2666

Query: 1367 ATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPT 1426
              +L +  T + +         V+   V W  NG  +  +++    V G    L+I    
Sbjct: 2667 LKNLTVTETQDAVFTVELTHPNVKG--VQWIKNGVVLESNEKYAISVKGTIYSLRIKNCA 2724

Query: 1427 PNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVV 1486
              D+  Y   L  G+ G    +                ++   I +K         P  V
Sbjct: 2725 IVDESVYGFRL--GRLGASARL---------------HVETVKIIKK---------PKDV 2758

Query: 1487 TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSG 1546
            T  E   +    +V  D  P V W      +   D   L  E  +     +  +S +D+G
Sbjct: 2759 TALENATVAFEVSVSHDTVP-VKWFHKSVEIKPSDKHRLVSER-KVHKLMLQNISPSDAG 2816

Query: 1547 KYGLVV 1552
            +Y  VV
Sbjct: 2817 EYTAVV 2822



 Score = 40.0 bits (92), Expect = 0.018
 Identities = 29/86 (33%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 1482  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1541
             L  VVTI+    L L   + G P PEV W ++     S D  +++  +  T    +  V+
Sbjct: 15561 LRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGE--SLDKASIESTSSYTLLI-VGNVN 15617

Query: 1542  TADSGKYGLVVKNKYGSETSDFTVSV 1567
               DSGKY L V+N  GS+++   V V
Sbjct: 15618 RFDSGKYILTVENSSGSKSAFVNVRV 15643



 Score = 40.0 bits (92), Expect = 0.018
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 1482  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1541
             L  ++ I+ G +L L   + G P PEV W K +  +   D   +   +  T+   ++ V+
Sbjct: 16643 LRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIR--DAAIIDVTSSFTS-LVLDNVN 16699

Query: 1542  TADSGKYGLVVKNKYGSETSDFTVSV 1567
               DSGKY L ++N  G++++  TV V
Sbjct: 16700 RYDSGKYTLTLENSSGTKSAFVTVRV 16725



 Score = 40.0 bits (92), Expect = 0.018
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 7/82 (8%)

Query: 1488  IQEGKALNLTCNVWGDPPPEVSWLKNEK--ALASDDHCNLKFEAGRTAYFTINGVSTADS 1545
             ++ G ++ L     G P P   W K +   +L +D H    F        T+   +  D+
Sbjct: 22064 VRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTTDSFST-----LTVENCNRNDA 22118

Query: 1546  GKYGLVVKNKYGSETSDFTVSV 1567
             GKY L V+N  GS++  FTV V
Sbjct: 22119 GKYTLTVENNSGSKSITFTVKV 22140



 Score = 39.7 bits (91), Expect = 0.023
 Identities = 34/135 (25%), Positives = 52/135 (38%), Gaps = 9/135 (6%)

Query: 245   IREKAERLSL-----RKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENV-KLHC 298
             I EK  ++S      +KT E T T   +      + +   I+     T    ++V K   
Sbjct: 26509 IHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAV 26568

Query: 299   SIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVK 358
                G P P   W K+   I      GKY +    G   LEI+  D  D+  Y  +  N  
Sbjct: 26569 KATGEPRPTAIWTKDGKAIT---QGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSA 26625

Query: 359   GELSAYASVVVKRYK 373
             G +S+   + +K  K
Sbjct: 26626 GSVSSSCKLTIKAIK 26640



 Score = 39.3 bits (90), Expect = 0.031
 Identities = 36/157 (22%), Positives = 63/157 (40%), Gaps = 10/157 (6%)

Query: 1415 GEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKN 1474
            G   W+   EP    K + V  L +GK    +   L+ Q   +     + ++     E  
Sbjct: 7325 GSDKWVACGEPVAETKME-VTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAP 7383

Query: 1475 R----ARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAG 1530
                  ++L GL    T++ G  + L   V G P P+++W K +  L  D    ++    
Sbjct: 7384 EIFLDVKLLAGL----TVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIE-NVP 7438

Query: 1531 RTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1567
            + +  TI     +D+G Y +   N  G  T+   V+V
Sbjct: 7439 KKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 7475



 Score = 39.3 bits (90), Expect = 0.031
 Identities = 46/191 (24%), Positives = 78/191 (40%), Gaps = 11/191 (5%)

Query: 180   TSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKK 239
             TS Q + S Q   S Q +ASKQ  +    ++S  S+ +     S  A S    +E+  + 
Sbjct: 26937 TSLQGSFSSQ---SVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEM 26993

Query: 240   SRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCS 299
             S    +      +S    LE + +   K     +   P+    P   ++ E + + + C+
Sbjct: 26994 SSSSFMG-----ISNMTQLESSTSKMLKAGIRGI--PPKIEALPSDISIDEGKVLTVACA 27046

Query: 300   IAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKG 359
               G P P VTW      I+     G++ IE+   + TL I     +D   Y  S  N  G
Sbjct: 27047 FTGEPTPEVTWSCGGRKIH-SQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFG 27105

Query: 360   ELSAYASVVVK 370
               SA  ++ ++
Sbjct: 27106 SDSATVNIHIR 27116



 Score = 38.9 bits (89), Expect = 0.040
 Identities = 54/228 (23%), Positives = 97/228 (42%), Gaps = 27/228 (11%)

Query: 144  RQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITTSKQSTASKQT-----TASKQSTA 198
            R KH  G T      ++EA   +    L+ S++ +    Q TA  Q      TA     +
Sbjct: 1113 RNKH--GETSASASLLEEADYEL----LMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYS 1166

Query: 199  SKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKVVIREKAERLSLRKTL 258
              +    K+    R+  A    VV     + ++ +E       + +I+E   R+ ++ TL
Sbjct: 1167 EYEKEYEKEQALIRKKMAKDTVVVR----TYVEDQEFHISSFEERLIKEIEYRI-IKTTL 1221

Query: 259  EET------ETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYK 312
            EE       E     ++E   + +  F  + +++ + E   V  HC ++G+P P++ WYK
Sbjct: 1222 EELLEEDGEEKMAVDISESEAVESG-FDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYK 1280

Query: 313  NQVPINVHANPGKYIIE-SRYGMHTLEINGCDFEDTAQYRASAMNVKG 359
            +   I    +  +Y ++  + G  +L I     ED   Y A A N+KG
Sbjct: 1281 DGKRIK---HGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKG 1325



 Score = 38.9 bits (89), Expect = 0.040
 Identities = 63/315 (20%), Positives = 110/315 (34%), Gaps = 43/315 (13%)

Query: 171  LLASEEGITTSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSA- 229
            +L  +EGI T+  S        S +      +     +        SR   +S ++ S  
Sbjct: 1308 VLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRS 1367

Query: 230  -LQQEETSEKKSRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTV 288
             ++        +R    R    R+S  + LEET+      ++   L+ P F++KP S   
Sbjct: 1368 PIRMSPARMSPARMSPARMSPARMSPGRRLEETDE-----SQLERLYKPVFVLKPVSFKC 1422

Query: 289  WEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTA 348
             E +  +    + G P P   W+ +   I V+    K +I+   G  +L I      D+ 
Sbjct: 1423 LEGQTARFDLKVVGRPMPETFWFHDGQQI-VNDYTHKVVIKED-GTQSLIIVPATPSDSG 1480

Query: 349  QYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFD 408
            ++   A N  G  S    + V+  + +                  V P          F 
Sbjct: 1481 EWTVVAQNRAGRSSISVILTVEAVEHQ------------------VKPM---------FV 1513

Query: 409  DKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGER--AT 466
            +K      +EG  + +  R    P      P+I W +N   + P K+ +    G +  A 
Sbjct: 1514 EKLKNVNIKEGSRLEMKVRATGNP-----NPDIVWLKNSDIIVPHKYPKIRIEGTKGEAA 1568

Query: 467  LTFSHLNKEDEGLYT 481
            L       +D   YT
Sbjct: 1569 LKIDSTVSQDSAWYT 1583



 Score = 38.5 bits (88), Expect = 0.052
 Identities = 76/371 (20%), Positives = 137/371 (36%), Gaps = 83/371 (22%)

Query: 231  QQEETSEKKSRKVVIREKAERLSLRK--TLEETETYHAKLNEDH------LLHAPEFIIK 282
            + ++T E   +  VI +  +R+ + K  TL++  TY   +          ++     ++ 
Sbjct: 6281 RDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIVVP 6340

Query: 283  PRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGC 342
             +   V E++ V  +C +      +  W++N+  I    +  KYII  +  ++TL I   
Sbjct: 6341 LKDTRVKEQQEVVFNCEV-NTEGAKAKWFRNEEAI---FDSSKYIILQKDLVYTLRIRDA 6396

Query: 343  DFEDTAQYRASAMNVKGE-LSAYASVVVKR------------YKGEFDETRFHAGASTMP 389
              +D A Y  S  N +GE + + A+++V+                E     F    + + 
Sbjct: 6397 HLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLN 6456

Query: 390  LSFGVTPYGYASRFEIHFD-------DKF-------DVSFGREGETM-------SLGCRV 428
            ++   T  G     E+ FD       DK+       D  F  EGE +       S+   +
Sbjct: 6457 VTLKWTKNGE----EVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELL 6512

Query: 429  VI---TPEIKHFQPE--------------------IQWYRNGVPLSPSKWVQTLWSGERA 465
            +I   T  ++H + +                    ++WYRNG  +   K  +    G   
Sbjct: 6513 IIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIH 6572

Query: 466  TLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLD------VKCL 519
             L       +DE  Y      G    +  A +FV +   EI   P   L+      V   
Sbjct: 6573 RLIIKDCRLDDECEYA----CGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLA 6628

Query: 520  EANKDYIIISW 530
            E NKD + + W
Sbjct: 6629 ELNKDKVEVQW 6639



 Score = 38.5 bits (88), Expect = 0.052
 Identities = 27/105 (25%), Positives = 47/105 (44%), Gaps = 5/105 (4%)

Query: 1484 DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKAL--ASDDHCNLKFEAGRTAYFTINGVS 1541
            D + ++ G+ +++  +V G P P++ W KNE  +   +D     K E  R+   T   + 
Sbjct: 9101 DTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIP 9160

Query: 1542 TA---DSGKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALESLK 1583
             A   D G Y +   N+ GS   +  V V+      R  A+  +K
Sbjct: 9161 KAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIK 9205



 Score = 38.1 bits (87), Expect = 0.068
 Identities = 27/122 (22%), Positives = 55/122 (45%), Gaps = 7/122 (5%)

Query: 1436 ELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALN 1495
            +L +G+ G Q+  +L   A++ A       ++    EK +  ++   P+ V + EG+   
Sbjct: 1759 QLPEGRKGLQRIEELERMAHEGALTGVTTDQK----EKQKPDIVL-YPEPVRVLEGETAR 1813

Query: 1496 LTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNK 1555
              C V G P P+V+W  N + +       ++++     Y  I    + D+G+  +  +N 
Sbjct: 1814 FRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG--IHYLDIVDCKSYDTGEVKVTAENP 1871

Query: 1556 YG 1557
             G
Sbjct: 1872 EG 1873



 Score = 38.1 bits (87), Expect = 0.068
 Identities = 36/174 (20%), Positives = 69/174 (39%), Gaps = 20/174 (11%)

Query: 1062 FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1121
            F C+    K    W K+      S  + + S+G   K+  K++ +DD+      V +   
Sbjct: 5288 FVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSS 5347

Query: 1122 IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNY 1181
             A   +++ +             + TV +  + AV   EK ++    +  K   +  V +
Sbjct: 5348 TAQLKVLEAD------------PYFTVKLHDKTAV---EKDEITLKCEVSK---DVPVKW 5389

Query: 1182 IFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTV 1235
              + +EI   PKY +  D    I++  ++K   +D+G Y       K   + TV
Sbjct: 5390 FKDGEEIVPSPKYSIKADGLRRILK--IKKADLKDKGEYVCDCGTDKTKANVTV 5441



 Score = 37.7 bits (86), Expect = 0.089
 Identities = 44/193 (22%), Positives = 74/193 (38%), Gaps = 20/193 (10%)

Query: 1393 KVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFD--GKT--GHQKTV 1448
            K+ W  NG  +  S   K    G+   L I      D+G+Y     +  GKT       +
Sbjct: 3679 KIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKI 3738

Query: 1449 DLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGG------LPDVVTIQ--EGKALNLTCNV 1500
            +  G+ + +   E      +A+A+      LGG      L ++  I+  +G        V
Sbjct: 3739 NSKGEGHKDTETE------SAVAKS--LEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTV 3790

Query: 1501 WGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSET 1560
             G+P P V+W K  K L +  +  +      +  F +N     DSG Y    +N  G  T
Sbjct: 3791 VGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGEST 3850

Query: 1561 SDFTVSVFIPEEE 1573
                + V + + +
Sbjct: 3851 CAAELLVLLEDTD 3863



 Score = 37.7 bits (86), Expect = 0.089
 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 1/83 (1%)

Query: 1485  VVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTAD 1544
             +V  + G  + +   V G P P V+W K ++ L      N +  A  T    IN    +D
Sbjct: 14769 LVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATST-ILNINECVRSD 14827

Query: 1545  SGKYGLVVKNKYGSETSDFTVSV 1567
             SG Y L  +N  G      T+ V
Sbjct: 14828 SGPYPLTARNIVGEVGDVITIQV 14850



 Score = 37.7 bits (86), Expect = 0.089
 Identities = 18/77 (23%), Positives = 36/77 (46%)

Query: 1491  GKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGL 1550
             G+ +++     G P P ++W K +  + ++ H  +      T+    NGV   D+G Y +
Sbjct: 24737 GEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVV 24796

Query: 1551  VVKNKYGSETSDFTVSV 1567
               KN++G +     + V
Sbjct: 24797 CAKNRFGIDQKTVELDV 24813



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 21/84 (25%), Positives = 33/84 (39%), Gaps = 3/84 (3%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
             D + +  G  + +   V G PPP V+W  NE+ L  +           ++   I     +
Sbjct: 10227 DRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIE---TTAISSSMVIKNCQRS 10283

Query: 1544  DSGKYGLVVKNKYGSETSDFTVSV 1567
               G Y L+ KN+ G       V V
Sbjct: 10284 HQGVYSLLAKNEAGERKKTIIVDV 10307



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 1482  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1541
             +  ++T++ G  + L   V+G P P VSW K+   L   +   +  +        +  V+
Sbjct: 12996 MKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQR-NLCTLELFSVN 13054

Query: 1542  TADSGKYGLVVKNKYGSETSDFTVSV 1567
               DSG Y +  +N  GS+++   + V
Sbjct: 13055 RKDSGDYTITAENSSGSKSATIKLKV 13080



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 20/79 (25%), Positives = 35/79 (44%), Gaps = 1/79 (1%)

Query: 1487  TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSG 1546
             ++Q G+ L +   + G P P ++W K+   L      N+      T   +I      D G
Sbjct: 16935 SVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTT-LSIKETHKDDGG 16993

Query: 1547  KYGLVVKNKYGSETSDFTV 1565
             +YG+ V N  G +T+   +
Sbjct: 16994 QYGITVANVVGQKTASIEI 17012



 Score = 37.4 bits (85), Expect = 0.12
 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 3/84 (3%)

Query: 1486  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADS 1545
             + +  G+ + L   + G PPP  SW      L   +   ++    + A  TI   +  D+
Sbjct: 23443 IHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHT-KVAKLTIRETTIRDT 23501

Query: 1546  GKYGLVVKNKYGSETSDFTVSVFI 1569
             G+Y L +KN  G  T+  T+ V I
Sbjct: 23502 GEYTLELKNVTG--TTSETIKVII 23523



 Score = 37.0 bits (84), Expect = 0.15
 Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 8/93 (8%)

Query: 1482 LPDVVTIQEGKALNLTCNVWGDPPPEVSWLK-------NEKALASDDHCNLKFEAGRTAY 1534
            L + + ++EG  +N+   + G P P ++W K       N++ +  D H N K     T  
Sbjct: 9817 LKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVN-KLVVDDTCT 9875

Query: 1535 FTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1567
              I     +D+G Y +   N  G+ + +  ++V
Sbjct: 9876 LVIPQSRRSDTGLYTITAVNNLGTASKEMRLNV 9908



 Score = 37.0 bits (84), Expect = 0.15
 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 19/86 (22%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKN-----EKA----LASDDHCNLKFEAGRTAY 1534
             DV+ ++ G+ L +  ++ G P P +SW K+     E+A    +++D+H  L         
Sbjct: 19492 DVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLL--------- 19542

Query: 1535  FTINGVSTADSGKYGLVVKNKYGSET 1560
              T+      D+G+Y L +KN  G+ +
Sbjct: 19543 -TVKDCIRRDTGQYVLTLKNVAGTRS 19567



 Score = 36.6 bits (83), Expect = 0.20
 Identities = 99/530 (18%), Positives = 188/530 (35%), Gaps = 110/530 (20%)

Query: 1046 KEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLG 1105
            K++++   +    S  FEC      +  +W KD  +  +SP+    + G   K+   D+ 
Sbjct: 4817 KDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQ 4876

Query: 1106 MDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVP-VKSELAVEILEKGQV 1164
            + D G Y+C                     +L L ++ K  T   V  EL V  ++  + 
Sbjct: 4877 LSDAGEYTC---------------------VLRLGNKEKTSTAKLVVEELPVRFVKTLEE 4915

Query: 1165 RFW-MQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGII--------EMFMEKLQDE 1215
                ++ + L  + ++N    E+++      K+ +++   I+         + +    D 
Sbjct: 4916 EVTVVKGQPLYLSCELN---KERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDT 4972

Query: 1216 DEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGE 1275
            D GTYT  +++      S+ V V +V +           +W+ K            V  +
Sbjct: 4973 DAGTYTVTVENANNLECSSCVKVVEVIR-----------DWLVK------PIRDQHVKPK 5015

Query: 1276 CNVLLKCKVANIKKETHIVWYKDEREISV---DEKHDFKDG-ICTLLITEFSKKDAGIYE 1331
               +  C +A  K   +I W+K   EI     D+    +DG    L I     +D   Y 
Sbjct: 5016 GTAIFACDIA--KDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYA 5073

Query: 1332 VILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLY-----SFVT 1386
            V ++  R                       K+ L   ++++    E + +Y     SF  
Sbjct: 5074 VEIEGKR--------------------YPAKLTLGEREVELLKPIEDVTIYEKESASFDA 5113

Query: 1387 YYVE-DLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQ 1445
               E D+   W   G  +R S   +    G + +L +++   +  G+ + +  +  T   
Sbjct: 5114 EISEADIPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAIT--- 5170

Query: 1446 KTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPP 1505
             T  L+ +  +  +A    LK   + E+ +AR      + V  +E               
Sbjct: 5171 -TAILTVKEIELDFA--VPLKDVTVPERRQARF-----ECVLTREA-------------- 5208

Query: 1506 PEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNK 1555
              V W K    + S D  ++    G+     IN     D G Y   V+ K
Sbjct: 5209 -NVIWSKGPDIIKSSDKFDI-IADGKKHILVINDSQFDDEGVYTAEVEGK 5256



 Score = 36.2 bits (82), Expect = 0.26
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 293   NVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRA 352
             ++++   I G P P VTW K+ + +   AN     IE+      L I  C+  DT ++  
Sbjct: 14488 SIRIFVPIKGRPAPEVTWTKDNINLKNRAN-----IENTESFTLLIIPECNRYDTGKFVM 14542

Query: 353   SAMNVKGELSAYASVVV 369
             +  N  G+ S + +V V
Sbjct: 14543 TIENPAGKKSGFVNVRV 14559



 Score = 36.2 bits (82), Expect = 0.26
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 2/85 (2%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKAL-ASDDHCNLKFEAGRTAYFTINGVST 1542
             DV+ +  G+   L  ++ G P P+V W K+ K L  +     +K    +T     + + T
Sbjct: 18410 DVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRT 18469

Query: 1543  ADSGKYGLVVKNKYGSETSDFTVSV 1567
              D G+Y L + N  G+++   TV V
Sbjct: 18470 -DGGQYILKLSNVGGTKSIPITVKV 18493



 Score = 35.8 bits (81), Expect = 0.34
 Identities = 24/94 (25%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 277 PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
           P F+ + +S TV +   V+L   + G P P V +Y++   I    +   + I     +++
Sbjct: 104 PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLD---FQISQEGDLYS 160

Query: 337 LEINGCDFEDTAQYRASAMNVKGELSAYASVVVK 370
           L I     ED+  Y  +A N  G  ++ A ++V+
Sbjct: 161 LLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 35.8 bits (81), Expect = 0.34
 Identities = 38/153 (24%), Positives = 61/153 (39%), Gaps = 11/153 (7%)

Query: 221  VVSKQATSALQQEETSEKKSRKVVIREKA-ERLSLRKTLEETETYHAKLNEDHLLHAPEF 279
            V   +  +  + E T  ++ +    R KA  R    K    TE   A   ++    APE 
Sbjct: 7330 VACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQE----APEI 7385

Query: 280  IIKPR---SHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
             +  +     TV     ++L  ++ G PEP++TW K  +   +     +  IE+     T
Sbjct: 7386 FLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADM---ILKQDKRITIENVPKKST 7442

Query: 337  LEINGCDFEDTAQYRASAMNVKGELSAYASVVV 369
            + I      DT  Y   A+NV G  +A   V V
Sbjct: 7443 VTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 7475



 Score = 35.8 bits (81), Expect = 0.34
 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
             +VV  + G ++ L   + G P P + W K++K L ++    ++      A   I      
Sbjct: 20575 EVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVE-NTTDLASILIKDADRL 20633

Query: 1544  DSGKYGLVVKNKYGSETSDFTVSV 1567
             +SG Y L ++N  GS ++   V +
Sbjct: 20634 NSGCYELKLRNAMGSASATIRVQI 20657



 Score = 35.4 bits (80), Expect = 0.44
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query: 1484  DVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTA 1543
             D + I+ G++L +   V G P P V+W K+   +    +  +    G T+ F +   +  
Sbjct: 21661 DGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLF-VRDATRD 21719

Query: 1544  DSGKYGLVVKNKYGSETSDFTVSV 1567
               G Y +  KN  GS  ++  V V
Sbjct: 21720 HRGVYTVEAKNASGSAKAEIKVKV 21743



 Score = 35.0 bits (79), Expect = 0.58
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 439 PEIQWYRNGVPLSPS--KWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAY 496
           PE+ W+R+G  +S S    VQ  +S  RA LT   + K + G Y+++   G      +A 
Sbjct: 35  PEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAE 94

Query: 497 VFVR 500
           + V+
Sbjct: 95  LLVK 98



 Score = 35.0 bits (79), Expect = 0.58
 Identities = 17/75 (22%), Positives = 35/75 (46%), Gaps = 1/75 (1%)

Query: 1486  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADS 1545
             + ++ G  +     + G P P   W  +   + +D+H  ++ +   ++  TI      D+
Sbjct: 11215 LVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETD-NFSSVLTIKNCLRRDT 11273

Query: 1546  GKYGLVVKNKYGSET 1560
             G+Y + V N  GS+T
Sbjct: 11274 GEYQITVSNAAGSKT 11288



 Score = 35.0 bits (79), Expect = 0.58
 Identities = 23/84 (27%), Positives = 35/84 (41%), Gaps = 3/84 (3%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYR 351
             E++++   + G P PRVTW+K+ V I    N     I    G  +L +     +    Y 
Sbjct: 21669 ESLRIKALVQGRPVPRVTWFKDGVEIEKRMN---MEITDVLGSTSLFVRDATRDHRGVYT 21725

Query: 352   ASAMNVKGELSAYASVVVKRYKGE 375
               A N  G   A   V V+   G+
Sbjct: 21726 VEAKNASGSAKAEIKVKVQDTPGK 21749



 Score = 34.7 bits (78), Expect = 0.76
 Identities = 83/448 (18%), Positives = 160/448 (35%), Gaps = 90/448 (20%)

Query: 1072 EFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG---------- 1121
            + +W+ +    E+S RL+    GN   +T  ++ + D G+YSC V +  G          
Sbjct: 3519 DVTWTHEGAKIEESERLKQSQNGNIQFLTICNVQLVDQGLYSCIVHNDCGERTTSAVLSV 3578

Query: 1122 ----------------------IASSYLIDEEE-----------LKRLLALSHEHKFPTV 1148
                                   +SS+L  EEE           +   L L  E   P  
Sbjct: 3579 EGAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSES--PVY 3636

Query: 1149 PVKSELAVEILEKGQVRFWMQAEKLSGNA-------------KVNYIFNEKEIFEGPKYK 1195
            P K +   E      ++    A+   G+              K+ + FN   +     YK
Sbjct: 3637 PTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYK 3696

Query: 1196 MHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGK--ATNHSTVVLVGDVFKKLQKEAEFQR 1253
               D +   + +   KL+DE E T       GK   + +  +   G+  K  + E+   +
Sbjct: 3697 FVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAK 3756

Query: 1254 QEWIRKQG----PHFVEYLS-WEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKH 1308
               + K G    PHF++ L           + +  V      T + W+K+ +++     +
Sbjct: 3757 S--LEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPT-VTWFKENKQLCTSVYY 3813

Query: 1309 DF---KDGICTLLITEFSKKDAGIY-----------------EVILKD-DRGKDKSRLKL 1347
                  +G  T ++ +  ++D+G+Y                  V+L+D D      + K 
Sbjct: 3814 TIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLLEDTDMTDTPCKAKS 3873

Query: 1348 VDEAFKELMMEVCKKIALSATDLKIQ-STAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYS 1406
              EA ++      K  A+ A D + + +T     +        E+ ++++ H   A   S
Sbjct: 3874 TPEAPEDFPQTPLKGPAVEALDSEQEIATFVKDTILKAALITEENQQLSYEHIAKANELS 3933

Query: 1407 DRVKTGVTGEQIWLQINEPTPNDKGKYV 1434
             ++  G    Q  L+ ++ TP    +++
Sbjct: 3934 SQLPLGAQELQSILEQDKLTPESTREFL 3961



 Score = 34.7 bits (78), Expect = 0.76
 Identities = 22/86 (25%), Positives = 37/86 (43%), Gaps = 1/86 (1%)

Query: 1482  LPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVS 1541
             L   + ++ G  + L   V G PPP+++W K    L      ++K       +     V+
Sbjct: 13394 LRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIK-STDFDTFLRCENVN 13452

Query: 1542  TADSGKYGLVVKNKYGSETSDFTVSV 1567
               D+GKY L ++N  G +     V V
Sbjct: 13453 KYDAGKYILTLENSCGKKEYTIVVKV 13478



 Score = 34.3 bits (77), Expect = 0.99
 Identities = 41/195 (21%), Positives = 77/195 (39%), Gaps = 19/195 (9%)

Query: 1293 IVWYKDEREISVDE----KHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLV 1348
            + W++D + IS       +  F DG   L I   +K ++G Y +   +  G+  S  +L+
Sbjct: 37   VSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELL 96

Query: 1349 ---DEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRY 1405
               + A    +  +        + +++Q    GI     V +Y          +G+ I+ 
Sbjct: 97   VKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPT-PVVKFY---------RDGAEIQS 146

Query: 1406 SDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQR- 1464
            S   +    G+   L I E  P D G Y +   +       T +L  Q  +E  A+  + 
Sbjct: 147  SLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKT 206

Query: 1465 -LKQAAIAEKNRARV 1478
             +  A I+E  + R+
Sbjct: 207  IVSTAQISESRQTRI 221



 Score = 34.3 bits (77), Expect = 0.99
 Identities = 25/94 (26%), Positives = 43/94 (45%), Gaps = 7/94 (7%)

Query: 1481 GLPDVVTIQEGKALNLTCNVWGDPPPEVSWL---KNEKALASDDHC---NLKFE-AGRTA 1533
            G  D +  + G  + +   + G P P+ SW    K +KA+    H    + + E A  ++
Sbjct: 9510 GAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSS 9569

Query: 1534 YFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1567
               I     + +GKY +  KNK G +T++  V V
Sbjct: 9570 VIIIPECKRSHTGKYSITAKNKAGQKTANCRVKV 9603



 Score = 34.3 bits (77), Expect = 0.99
 Identities = 21/83 (25%), Positives = 39/83 (46%), Gaps = 5/83 (6%)

Query: 1486  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAG-RTAYFTINGVSTAD 1544
             + ++ G +  +     G P PE++W + E          ++ E G      +I+     D
Sbjct: 17729 IVVRAGGSARIHIPFKGRPTPEITWSREEGEFTD----KVQIEKGVNYTQLSIDNCDRND 17784

Query: 1545  SGKYGLVVKNKYGSETSDFTVSV 1567
             +GKY L ++N  GS+++  TV V
Sbjct: 17785 AGKYILKLENSSGSKSAFVTVKV 17807



 Score = 33.9 bits (76), Expect = 1.3
 Identities = 26/87 (29%), Positives = 33/87 (37%), Gaps = 10/87 (11%)

Query: 1486 VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASD----DHCNLKFEAGRTAYFTINGVS 1541
            + I  GK L +   V G P P   W K E  L  D    D+   K E        I    
Sbjct: 8809 IQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSE------LIIKDAL 8862

Query: 1542 TADSGKYGLVVKNKYGSETSDFTVSVF 1568
              D G+Y +   N  GS+ +   V VF
Sbjct: 8863 RKDHGRYVITATNSCGSKFAAARVEVF 8889



 Score = 33.5 bits (75), Expect = 1.7
 Identities = 31/109 (28%), Positives = 54/109 (49%), Gaps = 4/109 (3%)

Query: 1262 PHFVEYL-SWEVTGECNVLLKCKVANIKKETHIVWYKDEREI--SVDEKHDFKDGICTLL 1318
            P+FV+ L S  V     V L+ +V  I     + +Y+D  EI  S+D +   +  + +LL
Sbjct: 104  PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPV-VKFYRDGAEIQSSLDFQISQEGDLYSLL 162

Query: 1319 ITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSA 1367
            I E   +D+G Y V   +  G+  S  +L+ +  +E+  +  K I  +A
Sbjct: 163  IAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIVSTA 211



 Score = 33.5 bits (75), Expect = 1.7
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 5/67 (7%)

Query: 418  EGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDE 477
            EG    L C+V + P++      ++WY N   + P   VQ +  G +  L  +  +  DE
Sbjct: 2412 EGTKAVLECKVSV-PDVT----SVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDE 2466

Query: 478  GLYTIRV 484
            G Y + V
Sbjct: 2467 GPYKLIV 2473



 Score = 33.1 bits (74), Expect = 2.2
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 3/80 (3%)

Query: 1488  IQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGK 1547
             I+ G  L L+  + G P P+V+W K ++   +    ++     +     I   +  D G 
Sbjct: 10925 IKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGSK---LEIRNAAHEDGGI 10981

Query: 1548  YGLVVKNKYGSETSDFTVSV 1567
             Y L V+N  GS+T    V V
Sbjct: 10982 YSLTVENPAGSKTVSVKVLV 11001



 Score = 33.1 bits (74), Expect = 2.2
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 13/87 (14%)

Query: 1486  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAG--RTAYFT---INGV 1540
             + ++ G ++ +   + G P PEV+W K        D+ NLK  A    T  FT   I   
Sbjct: 14481 LVVRAGLSIRIFVPIKGRPAPEVTWTK--------DNINLKNRANIENTESFTLLIIPEC 14532

Query: 1541  STADSGKYGLVVKNKYGSETSDFTVSV 1567
             +  D+GK+ + ++N  G ++    V V
Sbjct: 14533 NRYDTGKFVMTIENPAGKKSGFVNVRV 14559



 Score = 32.7 bits (73), Expect = 2.9
 Identities = 38/176 (21%), Positives = 75/176 (42%), Gaps = 16/176 (9%)

Query: 1069 PKSEFSWSKD--YVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSY 1126
            P  E SW +D   +ST   P +++     + K+T   +   + G YS   T+  G A+S 
Sbjct: 33   PVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATS- 91

Query: 1127 LIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEK 1186
                 EL     L      P   V+   ++ + +  QVR  ++   +     V +  +  
Sbjct: 92   ---TAEL-----LVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIP-TPVVKFYRDGA 142

Query: 1187 EIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQD--GKATNHSTVVLVGD 1240
            EI     ++  I +   +  + + +   ED GTY+    +  G+AT+ + +++ G+
Sbjct: 143  EIQSSLDFQ--ISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGE 196



 Score = 32.7 bits (73), Expect = 2.9
 Identities = 43/204 (21%), Positives = 67/204 (32%), Gaps = 47/204 (23%)

Query: 278  EFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTL 337
            + I KP+  T  E   V    S++    P V W+   V I       K+ + S   +H L
Sbjct: 2750 KIIKKPKDVTALENATVAFEVSVSHDTVP-VKWFHKSVEIKPS---DKHRLVSERKVHKL 2805

Query: 338  EINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPY 397
             +      D  +Y A    V G+L   A + V+                           
Sbjct: 2806 MLQNISPSDAGEYTA----VVGQLECKAKLFVET-------------------------- 2835

Query: 398  GYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQ 457
                   +H           E +T S  C      E+ HF     W +NGV +  S+  +
Sbjct: 2836 -------LHITKTMKNIEVPETKTASFEC------EVSHFNVPSMWLKNGVEIEMSEKFK 2882

Query: 458  TLWSGERATLTFSHLNKEDEGLYT 481
             +  G+   L   + + ED   YT
Sbjct: 2883 IVVQGKLHQLIIMNTSTEDSAEYT 2906



 Score = 32.3 bits (72), Expect = 3.7
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 3/80 (3%)

Query: 1488  IQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGK 1547
             ++ G +  +T    G P P V W K +  L +  + +      RT+  TI   +  DSGK
Sbjct: 19893 VKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDT--TDSRTS-LTIENANRNDSGK 19949

Query: 1548  YGLVVKNKYGSETSDFTVSV 1567
             Y L ++N   + +    V V
Sbjct: 19950 YTLTIQNVLSAASLTLVVKV 19969



 Score = 32.0 bits (71), Expect = 4.9
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 5/45 (11%)

Query: 418  EGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSG 462
            EGET    CRV   P     QP++ WY NG  +  SK  +  + G
Sbjct: 1808 EGETARFRCRVTGYP-----QPKVNWYLNGQLIRKSKRFRVRYDG 1847



 Score = 32.0 bits (71), Expect = 4.9
 Identities = 23/89 (25%), Positives = 36/89 (40%), Gaps = 17/89 (19%)

Query: 1486  VTIQEGKALNLTCNVWGDPPPEVSWLKNEKALA-------SDDHCNLKFEAGRTAYFTIN 1538
             + +++G  + LT  + G P P   W K  + ++       S+ H  L           I 
Sbjct: 23841 IFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTEL----------VIK 23890

Query: 1539  GVSTADSGKYGLVVKNKYGSETSDFTVSV 1567
                  DSG Y LV++NK G +     V V
Sbjct: 23891 EADRGDSGTYDLVLENKCGKKAVYIKVRV 23919



 Score = 31.6 bits (70), Expect = 6.4
 Identities = 44/203 (21%), Positives = 71/203 (34%), Gaps = 46/203 (22%)

Query: 278  EFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTL 337
            +F+      TV E E     C ++   +  V W+KN   ++        +I S    H L
Sbjct: 5270 KFMSPLEDQTVKEGETATFVCELSH-EKMHVVWFKNDAKLHTSRT---VLISSEGKTHKL 5325

Query: 338  EINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPY 397
            E+     +D +Q +A       ELS+ A + V                          PY
Sbjct: 5326 EMKEVTLDDISQIKAQVK----ELSSTAQLKVLE----------------------ADPY 5359

Query: 398  GYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQ 457
                 F +   DK  V    E + ++L C V     +K       W+++G  + PS    
Sbjct: 5360 -----FTVKLHDKTAV----EKDEITLKCEVSKDVPVK-------WFKDGEEIVPSPKYS 5403

Query: 458  TLWSGERATLTFSHLNKEDEGLY 480
                G R  L     + +D+G Y
Sbjct: 5404 IKADGLRRILKIKKADLKDKGEY 5426



 Score = 31.2 bits (69), Expect = 8.3
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 8/88 (9%)

Query: 1502 GDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTIN-GVS-TADSGKYGLVVKNKYGSE 1559
            GDP   V WL + K L + +   +  E G   Y +++ GV+ + DSG       NKYG  
Sbjct: 1684 GDPTMVVEWLHDGKPLEAANRLRMINEFG---YCSLDYGVAYSRDSGIITCRATNKYG-- 1738

Query: 1560 TSDFTVSVFIPEEEARMAALESLKGGKK 1587
             +D T +  I ++E  +     L  G+K
Sbjct: 1739 -TDHTSATLIVKDEKSLVEESQLPEGRK 1765



 Score = 31.2 bits (69), Expect = 8.3
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 6/60 (10%)

Query: 419  GETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEG 478
            GET +  C      E+ +    ++WY  G  L PS  V     G+  TLT   +  ED G
Sbjct: 5905 GETATFDC------ELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAG 5958



 Score = 31.2 bits (69), Expect = 8.3
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 6/88 (6%)

Query: 1502 GDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETS 1561
            G P P  +W   +K L + D   +K      A   I+    +D G Y L ++N+  + + 
Sbjct: 7115 GYPRPTATWCFGDKVLETGDRVKMK-TLSAYAELVISPSERSDKGIYTLKLENRVKTISG 7173

Query: 1562 DFTVSVFIPEEEARMAALESLKGGKKAK 1589
            +  V+V      AR +A + LK G   K
Sbjct: 7174 EIDVNVI-----ARPSAPKELKFGDITK 7196



 Score = 31.2 bits (69), Expect = 8.3
 Identities = 24/91 (26%), Positives = 38/91 (41%), Gaps = 7/91 (7%)

Query: 1496  LTCNVWGDPPPEVSWLKNEKALASDDHCNLKFE----AGRTAYFTINGVSTADSGKYGLV 1551
             L C V G P P V W +  K + +D    LK+      G      I  V+  D+  Y + 
Sbjct: 24642 LVCKVTGHPKPIVKWYRQGKEIIAD---GLKYRIQEFKGGYHQLIIASVTDDDATVYQVR 24698

Query: 1552  VKNKYGSETSDFTVSVFIPEEEARMAALESL 1582
               N+ GS +   ++ V +P +      LE +
Sbjct: 24699 ATNQGGSVSGTASLEVEVPAKIHLPKTLEGM 24729


>gi|110349713 titin isoform novex-1 [Homo sapiens]
          Length = 27051

 Score =  266 bits (679), Expect = 2e-70
 Identities = 184/627 (29%), Positives = 295/627 (47%), Gaps = 50/627 (7%)

Query: 510  PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
            P  P  ++  +  KD + ++W +P  DGGSPI GY++++ +  TD W +CN  PVK   +
Sbjct: 7511 PGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTY 7570

Query: 570  PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
             V GL   + Y FRV A N  G G PS+ +EP+   DP +          PW        
Sbjct: 7571 RVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPID---------PPWP------- 7614

Query: 630  EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGI-MYFVEKCEAGTENWQRVNT 688
                    PG PT   V +  ++ V L+W  P   G   I  Y +E  + GT+ W RV  
Sbjct: 7615 --------PGKPT---VKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAE 7663

Query: 689  ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPS 748
             +P  + +  L  L EG+ Y FRVR  N AG  EPSE ++  +  +KL  P  P  +   
Sbjct: 7664 GVP--TTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVI 7721

Query: 749  RNTDTSVVVSW--EESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQS 806
              T  +  + W   E      +  Y +E        W+  +   VK ++ T   L  G  
Sbjct: 7722 NITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTT-VKDTKCTVTPLTEGSL 7780

Query: 807  YIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGG 866
            Y+FRV A NA G S+Y++  +++  K     P PP  +  ++  +  + L W+ P   GG
Sbjct: 7781 YVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGG 7840

Query: 867  AEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAP 926
              I  Y +  +E +     +W +A   A  +  ++++++ E    QFQV A N AG+G P
Sbjct: 7841 RPIQRYVIEKKERLG---TRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHP 7897

Query: 927  SAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKA 986
            S  +E    E+ T + P PP  L  ++  +  + + WKPP  +G +P+ GY V++     
Sbjct: 7898 SEPTEILSIEDPT-SPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEM--CPV 7954

Query: 987  KEDQWRGLNEAAIKNVYLKV-RGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA---ETR 1042
              ++W  +N   IK++  KV  G+     YV RVRA+N  GV +PS+++  VVA   + +
Sbjct: 7955 GTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCK 8014

Query: 1043 P----GTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTK 1098
            P     T +++V   +   I + F   +  P    SW KD    + S RL +++      
Sbjct: 8015 PTIDLETHDIIVIEGEKLSIPVPF---RAVPVPTVSWHKDGKEVKASDRLTMKNDHISAH 8071

Query: 1099 MTFKDLGMDDLGIYSCDVTDTDGIASS 1125
            +        D GIY+  + +  G A++
Sbjct: 8072 LEVPKSVRADAGIYTITLENKLGSATA 8098



 Score =  251 bits (642), Expect = 3e-66
 Identities = 187/627 (29%), Positives = 290/627 (46%), Gaps = 56/627 (8%)

Query: 438  QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
            +P+I W +  + L   K +      +++T+T     + D G Y I         + +A V
Sbjct: 7347 EPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAV--NVCGRATAVV 7404

Query: 498  FVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
             V   D      P  P      +   +  +++W  P  DGGS I  Y +++    ++ W 
Sbjct: 7405 EVNVLDK-----PGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWH 7459

Query: 558  QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAA---LDPAEKARLK 614
            + + T VK   F  T LI  + YIFRV A N  G+G P + S P+ A    DP       
Sbjct: 7460 KLSST-VKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQAS-PITAKYQFDP------- 7510

Query: 615  SRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFV 673
                                   PGPPT L  ++ T+  V L+W  P   G   I  Y+V
Sbjct: 7511 -----------------------PGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWV 7547

Query: 674  EKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVG 733
            E+ +  T+ W R N ++PVK   + +  L   K Y FRV   N AG G+PS++TE  ++ 
Sbjct: 7548 ERLDPDTDKWVRCN-KMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIK 7606

Query: 734  DKLDIPKAPGKIIPSRNTDTSVVVSW--EESKDAKELVGYYIEASVAGSGKWEPCNNNPV 791
            D +D P  PGK        TSV ++W   E     ++  Y IE    G+ +W       V
Sbjct: 7607 DPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEG-V 7665

Query: 792  KGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFR 851
              ++    GL+ GQ Y FRVRAVN AG SE S+ S+ +  +  + PPSPP  +  +   +
Sbjct: 7666 PTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITK 7725

Query: 852  DSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVY 911
            ++  L W  P+K GG+ IT Y V  R+V       W+  +   V +    ++ L E  +Y
Sbjct: 7726 NTADLKWTVPEKDGGSPITNYIVEKRDV---RRKGWQTVDT-TVKDTKCTVTPLTEGSLY 7781

Query: 912  QFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGR 971
             F+VAA N  G    + + +    ++ T   PGPP++L   +V K  + L+W+PP + G 
Sbjct: 7782 VFRVAAENAIGQSDYTEIEDSVLAKD-TFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGG 7840

Query: 972  TPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPS 1031
             P+  Y ++ KE      +W    + A  +   +V  + EG    F+VRA N+AGVG PS
Sbjct: 7841 RPIQRYVIEKKERLG--TRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPS 7898

Query: 1032 DLAGPVVAE--TRPGTKEVVVNVDDDG 1056
            +    +  E  T P +  + ++V D G
Sbjct: 7899 EPTEILSIEDPTSPPSPPLDLHVTDAG 7925



 Score =  226 bits (577), Expect = 1e-58
 Identities = 198/661 (29%), Positives = 274/661 (41%), Gaps = 96/661 (14%)

Query: 417   REGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKED 476
             R G TM L   V   P      P+I W +  V L     +    +     L   ++NK D
Sbjct: 13334 RAGVTMRLYVPVKGRPP-----PKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYD 13388

Query: 477   EGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVD 536
              G Y + +      ++Y+  V V D        P  P++V   E +KD   ++W+ P +D
Sbjct: 13389 AGKYILTLENSCGKKEYTIVVKVLDT-------PGPPVNVTVKEISKDSAYVTWEPPIID 13441

Query: 537   GGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPS 596
             GGSPI+ Y + K +    SWS    T      F V  L EG+SY FRV A N+ GIG P 
Sbjct: 13442 GGSPIINYVVQKRDAERKSWSTVT-TECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPG 13500

Query: 597   RVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVL 656
                + V A                                 PGP  DL V   ++S   +
Sbjct: 13501 ETRDAVKASQ------------------------------TPGPVVDLKVRSVSKSSCSI 13530

Query: 657   SWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSN 716
              WK P   G   I+ +V         WQRV   L   S +++  DL EGK Y FRV   N
Sbjct: 13531 GWKKPHSDGGSRIIGYVVDFLTEENKWQRVMKSL---SLQYSAKDLTEGKEYTFRVSAEN 13587

Query: 717   SAGVGEPSEATEVT---VVGDKLDIPKAPGKIIPSRNTDT-----------SVVVSWEES 762
               G G PSE T V    VV   LD+   P     ++               +  VSW++ 
Sbjct: 13588 ENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKG 13647

Query: 763   KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEY 822
             +D        +      S +    N   +    + C     G+   + +   N AG  E 
Sbjct: 13648 EDP-------LATDTRVSVESSAVNTTLIV---YDCQKSDAGK---YTITLKNVAGTKEG 13694

Query: 823   SQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDG 882
             +     I +K    P  P   I   E   ++M L W  P   GG+EIT Y +  R   D 
Sbjct: 13695 T-----ISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKR---DS 13746

Query: 883   VPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCE----EW 938
             V  KW      AV +  ++++ L E M Y F+V+A N  G+G      E  K E      
Sbjct: 13747 VNNKWVTC-ASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVG------EGLKSEPIVARH 13799

Query: 939   TIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAA 998
                VP  P      +VR DS+ L W  P  +G +P+TGY ++ KE  +    W+  N+  
Sbjct: 13800 PFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSL--LWKRANKTP 13857

Query: 999   IKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA--ETRPGTKEVVVNVDDDG 1056
             I+    KV GL EG+ Y FRV AIN AGVGKPS  + PVVA     P  K  V+N+  + 
Sbjct: 13858 IRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITRNS 13917

Query: 1057  V 1057
             V
Sbjct: 13918 V 13918



 Score =  224 bits (571), Expect = 5e-58
 Identities = 170/614 (27%), Positives = 266/614 (43%), Gaps = 55/614 (8%)

Query: 429  VITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGE 488
            ++ P   + +P   W      L     V+       A L  S   + D+G+YT+++    
Sbjct: 7042 ILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKL---- 7097

Query: 489  YYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDK 548
               +        + D  +   P+AP ++K  +  KD + ++W+ P  DGGSP+ GY ++K
Sbjct: 7098 ---ENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEK 7154

Query: 549  CEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPA 608
             EV   +W++  D  V    F V  L++G+ Y+F+V A NK G G P+ V EPV    PA
Sbjct: 7155 REVSRKTWTKVMDF-VTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPA 7213

Query: 609  EKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEG 668
                                        VP PP ++   + T + + L+W PP   G   
Sbjct: 7214 ---------------------------TVPDPPENVKWRDRTANSIFLTWDPPKNDGGSR 7246

Query: 669  IM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEAT 727
            I  Y VE+C  G++ W  V    PV   +  +  L EGK Y +RV+  N  G  +PS  T
Sbjct: 7247 IKGYIVERCPRGSDKW--VACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPT 7304

Query: 728  EVTVVGDKLDIPK--APGKIIPSRNTDTSVVVSWEESKDAK-ELVGYYIEASVAGSGKWE 784
            E     D  + P+     K++          +    +   K E    + +A +       
Sbjct: 7305 EEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKR 7364

Query: 785  PCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDI 844
                N  K S  T        +  + + AVN  G     + +  +EV   +  P PP   
Sbjct: 7365 ITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCG-----RATAVVEVN-VLDKPGPPAAF 7418

Query: 845  TCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISN 904
               +   +S +L W  P   GG++IT Y V  R     V   W + +   V +  +K + 
Sbjct: 7419 DITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEV---WHKLS-STVKDTNFKATK 7474

Query: 905  LKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWK 964
            L  N  Y F+VAA NM G+G P   S      ++    PGPP  L+ S++ KD++ L W 
Sbjct: 7475 LIPNKEYIFRVAAENMYGVGEPVQASPI--TAKYQFDPPGPPTRLEPSDITKDAVTLTWC 7532

Query: 965  PPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQ 1024
             P   G +P+TGY+V+  +     D+W   N+  +K+   +V+GL     Y FRV A N 
Sbjct: 7533 EPDDDGGSPITGYWVERLDPDT--DKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENL 7590

Query: 1025 AGVGKPSDLAGPVV 1038
            AG GKPS    P++
Sbjct: 7591 AGPGKPSKSTEPIL 7604



 Score =  221 bits (564), Expect = 3e-57
 Identities = 186/596 (31%), Positives = 260/596 (43%), Gaps = 91/596 (15%)

Query: 478  GLYTIRVRMGEYY----EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQP 533
            G Y  RVR    Y    E  S  V ++D    + G P  P   K L   K  +++SW  P
Sbjct: 9195 GQYEFRVRAVNKYGISDECKSDKVVIQDP-YRLPGPPGKP---KVLARTKGSMLVSWTPP 9250

Query: 534  AVDGGSPILGYFIDKCEVGTDSWSQCNDTPV-----KFARFPVTGLIEGRSYIFRVRAVN 588
              +GGSPI GY+++K E G+  WS+ +  P+     K   F V  L+EG  Y FR  A+N
Sbjct: 9251 LDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAIN 9310

Query: 589  KMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTE 648
              GIG PS  S+P  A DP                              PGPP+   V +
Sbjct: 9311 AAGIGPPSEPSDPEVAGDPI---------------------------FPPGPPSCPEVKD 9343

Query: 649  ATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNT-ELPVKSPRFALFDLAEGK 706
             T+S + L WKPP + G   I  Y VE  E GT +W+RVN  +  + +    + +L E +
Sbjct: 9344 KTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCECVVPNLKELR 9403

Query: 707  SYCFRVRCSNSAGVGEPSEATE-----------------------VTVVGDKLDIPKAPG 743
             Y FRV+  N AG  EPS+ T                        V   G ++ IP    
Sbjct: 9404 KYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPA--- 9460

Query: 744  KIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVT 803
             +I  R T  S   SWE    AK+ +   +   +    + E   N+ V      C    T
Sbjct: 9461 -VIKGRPTPKS---SWEFDGKAKKAMKDGVH-DIPEDAQLETAENSSVIIIP-ECKRSHT 9514

Query: 804  GQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDK 863
            G+   + + A N AG    +   + ++V      P PP D+   +  R S  L WK PD 
Sbjct: 9515 GK---YSITAKNKAGQKTANCRVKVMDV------PGPPKDLKVSDITRGSCRLSWKMPDD 9565

Query: 864  IGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 923
             GG  I GY +  R  IDG    W + N    S   + + +L     Y F+V A N  G+
Sbjct: 9566 DGGDRIKGYVIEKR-TIDGKA--WTKVNPDCGST-TFVVPDLLSEQQYFFRVRAENRFGI 9621

Query: 924  GAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDL-- 981
            G P    +     +  I  P PP  LK   + K+++ L WKPP + G +PVT Y V+   
Sbjct: 9622 GPPVETIQRTTARD-PIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLA 9680

Query: 982  -KEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGP 1036
                  K++ WR  N+  ++ +   V  L EG  Y FRV+A+N AGV KPS   GP
Sbjct: 9681 WDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGP 9736



 Score =  221 bits (563), Expect = 4e-57
 Identities = 182/641 (28%), Positives = 273/641 (42%), Gaps = 85/641 (13%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P  P  ++     KD + + W +P  DGGS I+GY ++K +     W +CN   +   R 
Sbjct: 17447 PGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRL 17506

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              VTGL E   Y FRV A N  G+G PS  +    A DP  K                   
Sbjct: 17507 RVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFK------------------- 17547

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNT 688
                     PGPPT+  + + T++ + L+W KP    G E + Y VE C+A  E WQ V  
Sbjct: 17548 --------PGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVTP 17599

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIP--------- 739
             +  ++  RF +  L E + Y  RV   N  G+GE +         DKL+ P         
Sbjct: 17600 QTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELR 17659

Query: 740   -----KAPGKI---IPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPV 791
                  +A G     IP +   T  +    E  +  + V   IE  V           N  
Sbjct: 17660 KGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTDKV--QIEKGV-----------NYT 17706

Query: 792   KGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFR 851
             + S   C     G+ YI ++   N++G       S  + VK  +  P PP ++   E  +
Sbjct: 17707 QLSIDNCDRNDAGK-YILKLE--NSSG-----SKSAFVTVKV-LDTPGPPQNLAVKEVRK 17757

Query: 852   DSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKA-VSEEAYKISNLKENMV 910
             DS  L W+ P   GGA++  Y ++ RE       +   ANV +  S+ ++K+ NL E  +
Sbjct: 17758 DSAFLVWEPPIIDGGAKVKNYVIDKREST-----RKAYANVSSKCSKTSFKVENLTEGAI 17812

Query: 911   YQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSG 970
             Y F+V A N  G+G P    +  K  E     P PP  +  ++V + S  L W+ P H G
Sbjct: 17813 YYFRVMAENEFGVGVPVETVDAVKAAE----PPSPPGKVTLTDVSQTSASLMWEKPEHDG 17868

Query: 971   RTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKP 1030
              + V GY V+++      ++W  + E+ + N    V GL  G  Y FRV+A N+ G   P
Sbjct: 17869 GSRVLGYVVEMQPKGT--EKWSIVAESKVCNAV--VTGLSSGQEYQFRVKAYNEKGKSDP 17924

Query: 1031  SDLAGPVVAET---RPGTKEVVVNVDDDGVISLNFECDKM-TPKSEFSWSKDYVSTEDSP 1086
               L  PV+A+    +P  K             L  E   +  P+   SW KD    + + 
Sbjct: 17925 RVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTT 17984

Query: 1087  RLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYL 1127
             R+ VE     T +  K+   DD G Y+   T++ G A+  L
Sbjct: 17985 RVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENL 18025



 Score =  219 bits (557), Expect = 2e-56
 Identities = 209/852 (24%), Positives = 345/852 (40%), Gaps = 99/852 (11%)

Query: 287   TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
             T+    +++L  S++G P P +TW K  + +   A     II++      L ++  +  D
Sbjct: 23085 TIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRA-----IIDTTESYSLLIVDKVNRYD 23139

Query: 347   TAQYRASAMNVKGELSAYASVVVKRYKGEFDETRF-HAGASTMPLSFGVTPYGYASRFEI 405
               +Y   A N  G+ SA   V V    G     +       ++ +++ +      +    
Sbjct: 23140 AGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNN 23199

Query: 406   HFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERA 465
             +  +K + +  R  +T++  C   +             YR          +  L  G   
Sbjct: 23200 YIVEKREAAM-RAFKTVTTKCSKTL-------------YR----------ISGLVEG--- 23232

Query: 466   TLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDY 525
               T  +     E +Y I    GE  E   A +        +   P  P  ++ ++  K  
Sbjct: 23233 --TMYYFRVLPENIYGI----GEPCETSDAVL--------VSEVPLVPAKLEVVDVTKST 23278

Query: 526   IIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVR 585
             + ++W++P  DGGS + GY ++ C+ GT+ W +            VT L EG  Y+FR+R
Sbjct: 23279 VTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIR 23338

Query: 586   AVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLS 645
             A N+ G+  P      V   D      L+  P+       + T  + +  +  G P +L 
Sbjct: 23339 AQNEKGVSEPRETVTAVTVQD------LRVLPTID-----LSTMPQKTIHVPAGRPVELV 23387

Query: 646   VTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEG 705
             +  A R     SW   G +  E                +RV  E   K  +  + +    
Sbjct: 23388 IPIAGRPPPAASWFFAGSKLRES---------------ERVTVETHTKVAKLTIRETTIR 23432

Query: 706   KSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE--ESK 763
              +  + +   N  G    SE  +V ++ DK   P  P KI       TS+ +SWE  E  
Sbjct: 23433 DTGEYTLELKNVTGT--TSETIKVIIL-DKPGPPTGPIKI--DEIDATSITISWEPPELD 23487

Query: 764   DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYS 823
                 L GY +E   A    W P + + V  S F    L  G  Y+FRV A N  G+  Y 
Sbjct: 23488 GGAPLSGYVVEQRDAHRPGWLPVSES-VTRSTFKFTRLTEGNEYVFRVAATNRFGIGSYL 23546

Query: 824   QDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGV 883
             Q SE IE +++I  P PP  +   +  RD M L W  P+  GG+++TGY V  +EV    
Sbjct: 23547 Q-SEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEV---R 23602

Query: 884   PGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVP 943
               +W   N   V+   Y+ + L E + Y+ +V A+N  G G PS  S+     +  IA P
Sbjct: 23603 ADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMD-PIAPP 23661

Query: 944   GPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVY 1003
             G P + + ++  + S+ L W  P   G + VTGY ++++  K  + +W   N    K   
Sbjct: 23662 GKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQ--KVDQHEWTKCNTTPTKIRE 23719

Query: 1004  LKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVN--------VDDD 1055
               +  L +G  Y FRV A N  G G+P+++ G V         +  ++        V   
Sbjct: 23720 YTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQG 23779

Query: 1056  GVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCD 1115
             GVI L     K  P     W+K+    + S R  + +    T++  K+    D G Y   
Sbjct: 23780 GVIRLTIPI-KGKPFPICKWTKE--GQDISKRAMIATSETHTELVIKEADRGDSGTYDLV 23836

Query: 1116  VTDTDGIASSYL 1127
             + +  G  + Y+
Sbjct: 23837 LENKCGKKAVYI 23848



 Score =  218 bits (554), Expect = 5e-56
 Identities = 175/618 (28%), Positives = 260/618 (42%), Gaps = 69/618 (11%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P + W ++G  L P++ ++        TL    +N++D G YTI        +  +  + 
Sbjct: 12953 PTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLK 13012

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V D        P  P  VK  +   D  ++SW+ P  DGGS I  Y +DK E    +W+Q
Sbjct: 13013 VLDK-------PGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQ 13065

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
              + T V      V  LIEG  Y FR+ A NK G+G P   +EP  A +P +         
Sbjct: 13066 VSAT-VPITSCSVEKLIEGHEYQFRICAENKYGVGDPV-FTEPAIAKNPYDP-------- 13115

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                                PG      ++  T+ ++ +SWKPP   G   I  Y +EK E
Sbjct: 13116 -------------------PGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRE 13156

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
                 NW +VN + P+         L EG  Y FRV   N AG G+PS+A++     D   
Sbjct: 13157 TQAVNWTKVNRK-PIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQY 13215

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCN-NNPVKGS 794
              P  P        T +SV +SW +        ++GY +E   A S  W  CN    ++ +
Sbjct: 13216 PPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKT 13275

Query: 795   RFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSM 854
             RF   GL+    Y FRV AVN  G S+ S   +    K  + PP    D       R ++
Sbjct: 13276 RFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELD----ADLRKTL 13331

Query: 855   VLGWKQPDKIGGAEITGYYVNYREVIDGVPG---KWREANVKAVSEEAYKISNLKENMVY 911
             +L              G  +     + G P     W + NV         I +   +   
Sbjct: 13332 ILR------------AGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFL 13379

Query: 912   QFQVAAMNMAGLGAPSAVSECFKCEEWTIAV-----PGPPHSLKCSEVRKDSLVLQWKPP 966
             + +      AG    +  + C K +E+TI V     PGPP ++   E+ KDS  + W+PP
Sbjct: 13380 RCENVNKYDAGKYILTLENSCGK-KEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPP 13438

Query: 967   VHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG 1026
             +  G +P+  Y V  ++A+ K   W  +     K  + +V  L+EG SY FRV A N+ G
Sbjct: 13439 IIDGGSPIINYVVQKRDAERK--SWSTVTTECSKTSF-RVANLEEGKSYFFRVFAENEYG 13495

Query: 1027  VGKPSDLAGPVVAETRPG 1044
             +G P +    V A   PG
Sbjct: 13496 IGDPGETRDAVKASQTPG 13513



 Score =  216 bits (550), Expect = 1e-55
 Identities = 195/731 (26%), Positives = 300/731 (41%), Gaps = 100/731 (13%)

Query: 339   INGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYG 398
             + G    DT +YR SA+N+ G+            K E      H                
Sbjct: 10406 VKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLH---------------- 10449

Query: 399   YASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQT 458
                   + F DK  +   R GE  +L  R    P+     P++ W+++   +        
Sbjct: 10450 ------LDFRDKLTI---RVGEAFALTGRYSGKPK-----PKVSWFKDEADVLEDDRTHI 10495

Query: 459   LWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKC 518
               +     L      + D G Y + V       +    V V D      G P  P+    
Sbjct: 10496 KTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRP----GPPVGPVSFD- 10550

Query: 519   LEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGR 578
              E  KDY++ISWK P  DGGS I  Y I+K EVG D W        K     V+ L+EG+
Sbjct: 10551 -EVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAK-TTCKVSKLLEGK 10608

Query: 579   SYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVP 638
              YIFR+ A N  GI      S+P+ +     K R +                      VP
Sbjct: 10609 DYIFRIHAENLYGI------SDPLVSDSMKAKDRFR----------------------VP 10640

Query: 639   GPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFA 698
               P    VTE T+   +++W  P   G     Y +EK E  ++ W RV  +      +F 
Sbjct: 10641 DAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKRETMSKRWARVTKDPIHPYTKFR 10700

Query: 699   LFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVS 758
             + DL EG  Y FRV   N  G+G+PS  ++     D +  P  P        T  SV ++
Sbjct: 10701 VPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLT 10760

Query: 759   WEESK--DAKELVGYYIEASVAGSGKWEPCNNNP--VKGSRFTCHGLVTGQSYIFRVRAV 814
             W+  +     +++GY +E    G  +W   N+ P     +++   GL  GQ+Y FRV AV
Sbjct: 10761 WQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVLAV 10820

Query: 815   NAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYV 874
             NAAG S+ +   E + VK  + PP    D            +  +Q  K+G        +
Sbjct: 10821 NAAGESDPAHVPEPVLVKDRLEPPELILDAN----------MAREQHIKVGDT------L 10864

Query: 875   NYREVIDGVP---GKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPS---- 927
                 +I GVP     W++ +  A ++    ++ +   +  + + AA    G+ + +    
Sbjct: 10865 RLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGSKL--EIRNAAHEDGGIYSLTVENP 10922

Query: 928   AVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAK 987
             A S+    +   +  PGPP  L+ SE+RKDS  L WK P+  G + +T Y V+ ++  + 
Sbjct: 10923 AGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASA 10982

Query: 988   EDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAET---RPG 1044
               QW  L+  + K  +   + L EG  Y+FRV A NQ G G   +   P+ A      PG
Sbjct: 10983 --QWSPLSATSKKKSHF-AKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPG 11039

Query: 1045  TKEVVVNVDDD 1055
               + + +VD D
Sbjct: 11040 PPKDLHHVDVD 11050



 Score =  216 bits (550), Expect = 1e-55
 Identities = 178/625 (28%), Positives = 265/625 (42%), Gaps = 65/625 (10%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P AP   +     KD +I+ W++PA DGGS ILGY ++K +     W++C+   +   R 
Sbjct: 16365 PDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRL 16424

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              VTGLIE   Y FRV A N  G+  PS  S    A DP  K                   
Sbjct: 16425 RVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACDPIYK------------------- 16465

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNT 688
                     PGPP +  V + TRS V LSW KP    G E   Y VEKC+     W     
Sbjct: 16466 --------PGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTP 16517

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAP-----G 743
                +      +  L E   Y FR+   N AGVGE ++     +V +KL+ P         
Sbjct: 16518 PTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELR 16577

Query: 744   KIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVT 803
             KII  R   +  +    + +   E+    ++  +  +   +         S FT   L  
Sbjct: 16578 KIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVT-------SSFTSLVLDN 16630

Query: 804   GQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDK 863
                Y      +    L   S    A      +  PSPP ++   E  +DS+ + W+ P  
Sbjct: 16631 VNRYDSGKYTLT---LENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLL 16687

Query: 864   IGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 923
              GG++I  Y V  RE       K   A V    + ++KI  L+E   Y F+V A N  G+
Sbjct: 16688 DGGSKIKNYIVEKREATR----KSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGI 16743

Query: 924   GAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE 983
             G P+  ++  K  E    VP PP  +   +V ++S+ L W  P H G + +  Y V++ +
Sbjct: 16744 GLPAQTADPIKVAE----VPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEM-Q 16798

Query: 984   AKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA---- 1039
             AK  E +W     A +K++   +  L +G  Y+FRV A+N+ G   P  LA P+VA    
Sbjct: 16799 AKHSE-KWSEC--ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLV 16855

Query: 1040  ---ETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNK 1096
                + +P      V V  D  I +        PK   +W+KD +  + + R+ V    + 
Sbjct: 16856 IEPDVKPAFSSYSVQVGQDLKIEVPI---SGRPKPTITWTKDGLPLKQTTRINVTDSLDL 16912

Query: 1097  TKMTFKDLGMDDLGIYSCDVTDTDG 1121
             T ++ K+   DD G Y   V +  G
Sbjct: 16913 TTLSIKETHKDDGGQYGITVANVVG 16937



 Score =  213 bits (541), Expect = 2e-54
 Identities = 192/700 (27%), Positives = 285/700 (40%), Gaps = 118/700 (16%)

Query: 523   KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIF 582
             KD++ +SWK PA DGGSPI GY ++K E    +W++ N  P+       TGL EG  Y F
Sbjct: 13129 KDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEF 13188

Query: 583   RVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPT 642
             RV A+NK G G PS  S+   A DP                              PGPP 
Sbjct: 13189 RVTAINKAGPGKPSDASKAAYARDPQYP---------------------------PGPPA 13221

Query: 643   DLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFD 701
                V + TRS V LSW  P   G   I+ Y VE   A ++NW R N    ++  RF +  
Sbjct: 13222 FPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTG 13281

Query: 702   LAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEE 761
             L E   Y FRV   N  G  +PS+                    +P ++    +++  E 
Sbjct: 13282 LMEDTQYQFRVYAVNKIGYSDPSD--------------------VPDKHYPKDILIPPEG 13321

Query: 762   SKDA---KELV---GYYIEASVAGSGK------WEPCNNN-------PVKGSRFT----C 798
               DA   K L+   G  +   V   G+      W   N N        +K + F     C
Sbjct: 13322 ELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRC 13381

Query: 799   HGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGW 858
               +    +  + +   N+ G  EY+     I VK  +  P PP ++T  E  +DS  + W
Sbjct: 13382 ENVNKYDAGKYILTLENSCGKKEYT-----IVVKV-LDTPGPPVNVTVKEISKDSAYVTW 13435

Query: 859   KQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAM 918
             + P   GG+ I  Y V  R   D     W     +  S+ +++++NL+E   Y F+V A 
Sbjct: 13436 EPPIIDGGSPIINYVVQKR---DAERKSWSTVTTEC-SKTSFRVANLEEGKSYFFRVFAE 13491

Query: 919   NMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYF 978
             N  G+G P    +  K  +     PGP   LK   V K S  + WK P   G + + GY 
Sbjct: 13492 NEYGIGDPGETRDAVKASQ----TPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYV 13547

Query: 979   VDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVV 1038
             VD      +E++W+ + ++   ++    + L EG  Y FRV A N+ G G PS++   VV
Sbjct: 13548 VDFL---TEENKWQRVMKSL--SLQYSAKDLTEGKEYTFRVSAENENGEGTPSEIT--VV 13600

Query: 1039  AETRPGTKEVVVNVDDDGVISL--------NFECD---KMTPKSEFSWSKDYVSTEDSPR 1087
             A        V  ++D  G+  L        NF      K  P    SW K         R
Sbjct: 13601 ARD----DVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTR 13656

Query: 1088  LEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPT 1147
             + VES    T +   D    D G Y+  + +  G     +         + +  +   PT
Sbjct: 13657 VSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTI--------SIKVVGKPGIPT 13708

Query: 1148  VPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1187
              P+K +   E+  +     W   +   G+   NYI  +++
Sbjct: 13709 GPIKFD---EVTAEAMTLKWAPPKDDGGSEITNYILEKRD 13745



 Score =  213 bits (541), Expect = 2e-54
 Identities = 293/1258 (23%), Positives = 492/1258 (39%), Gaps = 198/1258 (15%)

Query: 273   LLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRY 332
             L+  P F +   + TV   E++K+     G P P VTW+K+ VP+       +   ES  
Sbjct: 15772 LVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLK---QTTRVNAESTE 15828

Query: 333   GMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKG------EFDETRFHAGAS 386
                 L I     ED   Y     N  GE     +V+V    G      + DE      A 
Sbjct: 15829 NNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVT----AD 15884

Query: 387   TMPLSFGVTPYGYASRFEIHFDDKFDVSF-------GREGETMSLGCRVVITPEIK---- 435
             ++ LS+G   Y   S    +  +K D S             T    CR+    E +    
Sbjct: 15885 SITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFRIA 15944

Query: 436   -----------HFQPEIQWYRNGVPLSPSKWVQTLWSG---------------------- 462
                        + +P +  Y   VP  P   V TL S                       
Sbjct: 15945 AENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYH 16004

Query: 463   ----ERATLTFSHLNKE------------DEGL-YTIRVR------MGEYYEQYSAYVFV 499
                 ER ++ +  LNK             +EG+ Y  RV       +G+  +    YV  
Sbjct: 16005 LERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYV-A 16063

Query: 500   RDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQC 559
             RD   +  G P A +        ++ + + WK+P  DGGS I GY ++K E+    W + 
Sbjct: 16064 RDP-CDPPGRPEAII------VTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKA 16116

Query: 560   NDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGI-GFPSRVSEPVAALDPAEKARLKSRPS 618
             + T +    F VTGL+E   Y FRV A N  G+   PS  +  + A D  +  R+   P 
Sbjct: 16117 SFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPK 16176

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEA 678
                T  +   E    +  + G P              + W    Q               
Sbjct: 16177 YKDTIVVHAGESFKVDADIYGKPIP-----------TIQWIKGDQE-------------- 16211

Query: 679   GTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDI 738
                N  R+  +    +   ++ D     S  + ++  N AG         VTV    LD 
Sbjct: 16212 -LSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAG------ERSVTVNVKVLDR 16264

Query: 739   PKAP-GKIIPSRNTDTSVVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSR 795
             P  P G ++ S  T     ++W+        +++ Y +E        W   + N V+   
Sbjct: 16265 PGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDAN-VQTLS 16323

Query: 796   FTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPC-DITCLESFRDSM 854
                  L+ G  Y FR+ AVN  G+ E  +    +     + P +P   ++T +   +DSM
Sbjct: 16324 CKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVT--KDSM 16381

Query: 855   VLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQ 914
             ++ W++P   GG+EI GY +  R+  +G+  +W   + + + E   +++ L EN  Y+F+
Sbjct: 16382 IVVWERPASDGGSEILGYVLEKRDK-EGI--RWTRCHKRLIGELRLRVTGLIENHDYEFR 16438

Query: 915   VAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPV 974
             V+A N AGL  PS  S   K  +  I  PGPP++ K  ++ + S+ L W  P++ G   +
Sbjct: 16439 VSAENAAGLSEPSPPSAYQKACD-PIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEI 16497

Query: 975   TGYFVDLKEAKAKEDQWRGLNE-AAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDL 1033
              GY V+  +    E  W        I    ++V  L E   Y FR+ AIN+AGVG+ +D+
Sbjct: 16498 QGYIVEKCDVSVGE--WTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADV 16555

Query: 1034  AGPVVAETRPGTKEV--------VVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDS 1085
              GP++ E +    ++        ++N+   G + L F   K  P  E  W K      D+
Sbjct: 16556 PGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRL-FVPIKGRPTPEVKWGKVDGEIRDA 16614

Query: 1086  PRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKF 1145
               ++V S  + T +   ++   D G Y+  + ++ G  S+++       R+L        
Sbjct: 16615 AIIDVTS--SFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFV-----TVRVL------DT 16661

Query: 1146  PTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKV-NYIFNEKEIFEGPKYKMHIDRNTGI 1204
             P+ PV   L V  + K  V    +   L G +K+ NYI  ++E     K    +  N   
Sbjct: 16662 PSPPV--NLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATR--KSYAAVVTNCHK 16717

Query: 1205  IEMFMEKLQDEDEG-TYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPH 1263
                 +++LQ   EG +Y F++    A N   + L       + K AE           P 
Sbjct: 16718 NSWKIDQLQ---EGCSYYFRV---TAENEYGIGLPAQTADPI-KVAEV----------PQ 16760

Query: 1264  FVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTL--LITE 1321
                 ++ +     +V L          + I+ Y  E +    EK      + +L  +IT 
Sbjct: 16761 PPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVITN 16820

Query: 1322  FSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSA------TDLKIQST 1375
              ++ +  ++ V+  +++G+   R   V    K+L++E   K A S+       DLKI+  
Sbjct: 16821 LTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVP 16880

Query: 1376  AEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKY 1433
               G    +          + W+ +G  ++ + R+    + +   L I E   +D G+Y
Sbjct: 16881 ISGRPKPT----------ITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQY 16928



 Score =  213 bits (541), Expect = 2e-54
 Identities = 172/632 (27%), Positives = 276/632 (43%), Gaps = 62/632 (9%)

Query: 505   EIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPV 564
             ++   P  P  V  ++  ++   I W++P  DGGS I GY ++    G++ WS C  T V
Sbjct: 18919 KVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTC--TQV 18976

Query: 565   KFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQ 624
             K     ++GL  G  Y+FRV AVN+ G   P ++  PV A D      +K     P+   
Sbjct: 18977 KTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARD----IEIKPSVELPFHTF 19032

Query: 625   IIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQ 684
              +   E+            + V    R    ++W+  GQ                 +   
Sbjct: 19033 NVKAREQ----------LKIDVPFKGRPQATVNWRKDGQT---------------LKETT 19067

Query: 685   RVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGK 744
             RVN          ++ + ++     + +  SNSAG    S    +T++   LD P  PG 
Sbjct: 19068 RVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAG----SITVPITII--VLDRPGPPGP 19121

Query: 745   IIPSRNTDTSVVVSWE--ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLV 802
             I     +  S+ +SW   E     ++  Y +E     S  W    +  V  +      L 
Sbjct: 19122 IRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWH-IVSQAVARTSIKIVRLT 19180

Query: 803   TGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPD 862
             TG  Y FRV A N  G S YS +S A+  +   +PP PP     + + + +M++ W+ P 
Sbjct: 19181 TGSEYQFRVCAENRYGKSSYS-ESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPV 19239

Query: 863   KIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAG 922
               GG+ + GY++ Y+E    +   W +AN   +++   K+S L E ++Y+++V A N+AG
Sbjct: 19240 NDGGSRVIGYHLEYKERSSIL---WSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAG 19296

Query: 923   LGAPSAVSECFK-CEEWTIAVP-GPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVD 980
             +G      +C K CE      P  PP   + + + + S+ L+W  P + G   +TGY V+
Sbjct: 19297 IG------KCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVE 19350

Query: 981   LKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQA-GVGKPSDLAGPVVA 1039
              +E    + +W   N   I+  Y +V  L E   Y FRV A N A  V +PS+  GP++ 
Sbjct: 19351 RRE--LPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIV 19408

Query: 1040  ETRPGTKEVVVNVDDDGVI------SLNFECD-KMTPKSEFSWSKDYVSTEDSPRLEVES 1092
             +       V+++V    VI       L    D    P    SW+KD +  E+  R E+ S
Sbjct: 19409 KDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIIS 19468

Query: 1093  KGNKTKMTFKDLGMDDLGIYSCDVTDTDGIAS 1124
               N T +T KD    D G Y   + +  G  S
Sbjct: 19469 TDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRS 19500



 Score =  211 bits (538), Expect = 3e-54
 Identities = 175/691 (25%), Positives = 307/691 (44%), Gaps = 71/691 (10%)

Query: 513   PLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVT 572
             P +V+  + +K+ + +SW+QPA DGGS I GY +++ ++    W++ + T V   +F ++
Sbjct: 20399 PRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIIS 20458

Query: 573   GLIEGRSYIFRVRAVNKMG-IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEE 631
             GL +   Y FRV A N +G I  PS V  P+  +D              + G +I    E
Sbjct: 20459 GLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDS-------------YGGPVIDLPLE 20505

Query: 632   PSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELP 691
              +E +     T + +         +S KP        I ++ +  E  T     V     
Sbjct: 20506 YTEVVKYRAGTSVKLRAG------ISGKPAPT-----IEWYKDDKELQTNALVCVENTTD 20554

Query: 692   VKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRN- 750
             + S    + D     S C+ ++  N+ G      +   T+    LD P  PG  I  +  
Sbjct: 20555 LAS--ILIKDADRLNSGCYELKLRNAMG------SASATIRVQILDKPGPPGGPIEFKTV 20606

Query: 751   TDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYI 808
             T   + + W    D    ++  Y +E        W   + + ++    T   ++ G  YI
Sbjct: 20607 TAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEH-LEECIITTTKIIKGNEYI 20665

Query: 809   FRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAE 868
             FRVRAVN  G+ E   +S+++  K A   P PP      +  ++SM + W +P   GG++
Sbjct: 20666 FRVRAVNKYGIGE-PLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSD 20724

Query: 869   ITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSA 928
             I+GY++  R   D     W +   + + +   K++ L EN  YQ++V A+N AG G  S 
Sbjct: 20725 ISGYFLEKR---DKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSE 20781

Query: 929   VSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKE 988
              SE +K  +  I  PGPP  ++ ++  K S+ L W  PV+ G + VTGY V++++ +  E
Sbjct: 20782 PSEFYKAAD-PIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGE--E 20838

Query: 989   DQWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKE 1047
             ++W  ++ +  ++     V  LK GV+Y FRV A+N AG G+P ++  PV A+      E
Sbjct: 20839 EEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPE 20898

Query: 1048  ----------VVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKT 1097
                       V+    +D  + + F   K  P    +W KD  +     R  +E+  + +
Sbjct: 20899 IDLDVALRTSVIAKAGEDVQVLIPF---KGRPPPTVTWRKDEKNLGSDARYSIENTDSSS 20955

Query: 1098  KMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVE 1157
              +T   +  +D G Y   + +  G   S  +  + L             T     +L V+
Sbjct: 20956 LLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVL------------DTPAACQKLQVK 21003

Query: 1158  ILEKGQVRFWMQAEKLSGNAK-VNYIFNEKE 1187
              + +G V        + G +  +NY+  +++
Sbjct: 21004 HVSRGTVTLLWDPPLIDGGSPIINYVIEKRD 21034



 Score =  208 bits (529), Expect = 4e-53
 Identities = 198/729 (27%), Positives = 309/729 (42%), Gaps = 80/729 (10%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P  P  +  ++  ++ + +SW++P  DGGS ILGY ++    G+D W+ C    VK    
Sbjct: 15677 PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATC--ATVKVTEA 15734

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALD----PAEKARLKSRPSAPWTGQI 625
              +TGLI+G  Y FRV A N+ GI  P ++S PV A D    PA K           T  +
Sbjct: 15735 TITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFN-------TFTV 15787

Query: 626   IVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQR 685
             +  E+   +    G PT             ++W                K     +   R
Sbjct: 15788 LAGEDLKVDVPFIGRPTP-----------AVTW---------------HKDNVPLKQTTR 15821

Query: 686   VNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKI 745
             VN E    +    + D        + V+ +NSAG  E  E   V V+ DK   P  P K+
Sbjct: 15822 VNAESTENNSLLTIKDACREDVGHYVVKLTNSAG--EAIETLNVIVL-DKPGPPTGPVKM 15878

Query: 746   IPSRNTDTSVVVSWEESK--DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVT 803
                  T  S+ +SW   K      +  Y +E     +  W+  +    + +   C  L T
Sbjct: 15879 --DEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACR-LKT 15935

Query: 804   GQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDK 863
             G  Y FR+ A N  G S Y  +SE    +     P PP       S RDSM + W +P  
Sbjct: 15936 GCEYQFRIAAENRYGKSTYL-NSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPIS 15994

Query: 864   IGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 923
              GG+ + GY++  +E    +   W + N   + +  +K + L+E + Y+F+V+A N+ G+
Sbjct: 15995 DGGSRVIGYHLERKERNSIL---WVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGI 16051

Query: 924   GAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE 983
             G PS VSEC+   +     PG P ++    V ++S+ LQWK P + G + +TGY V+ KE
Sbjct: 16052 GKPSKVSECYVARD-PCDPPGRPEAII---VTRNSVTLQWKKPTYDGGSKITGYIVEKKE 16107

Query: 984   AKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGV-GKPSDLAGPVVA--E 1040
                 E +W   +   I + + +V GL E   Y FRV A N AGV  +PS+  G + A  E
Sbjct: 16108 LP--EGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDE 16165

Query: 1041  TRPGTKEVVVNVDDDGVISL--NFECDKMT---PKSEFSWSKDYVSTEDSPRLEVESKGN 1095
               P    +     D  V+    +F+ D      P     W K      ++ RLE++S   
Sbjct: 16166 VDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDF 16225

Query: 1096  KTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELA 1155
              T ++ KD    D G Y     +  G   S  ++ + L R          P  P    + 
Sbjct: 16226 ATSLSVKDAVRVDSGNYILKAKNVAG-ERSVTVNVKVLDR----------PGPPEGPVVI 16274

Query: 1156  VEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDE 1215
               +  +     W    +  G+  +NYI   +E          +D N   +   + KL + 
Sbjct: 16275 SGVTAEKCTLAWKPPLQDGGSDIINYIVERRE--TSRLVWTVVDANVQTLSCKVTKLLEG 16332

Query: 1216  DEGTYTFQL 1224
             +E  YTF++
Sbjct: 16333 NE--YTFRI 16339



 Score =  207 bits (527), Expect = 7e-53
 Identities = 166/636 (26%), Positives = 271/636 (42%), Gaps = 72/636 (11%)

Query: 510  PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
            P  PL+V   + N+  + ++W+ P  DGG+ I  Y I+  +  +  W        +    
Sbjct: 6819 PGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSA 6878

Query: 570  PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
             VT ++EG+ Y FRVRA N++G+G PS  +  V   DP E+                   
Sbjct: 6879 TVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIER------------------- 6919

Query: 630  EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNT 688
                    P PP +L+ ++ T+S V L W+PP + G   I+ Y +E+CE G +NW R N 
Sbjct: 6920 --------PSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNM 6971

Query: 689  ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPS 748
            +L V    + +  L +G  Y +RV   N AGV +PSE        D    P         
Sbjct: 6972 KL-VPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEP--------- 7021

Query: 749  RNTDTSVVVSWEESKDAKE-LVGYYIEASVAGSGKWEP----CNNNPV--KGSRFTCHGL 801
                    +     KD  E +V   I   V  +G   P    C  + V   G R     L
Sbjct: 7022 -------TMDLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTL 7074

Query: 802  VTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKA-----AIAPPSPPCDITCLESFRDSMVL 856
                  +      +  G+     ++    +        IA PS P ++   +  +DS+ L
Sbjct: 7075 SAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHL 7134

Query: 857  GWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVA 916
             W+ PD  GG+ +TGY V  REV       W +  +  V++  + + +L +   Y F+V 
Sbjct: 7135 TWEPPDDDGGSPLTGYVVEKREVSRKT---WTKV-MDFVTDLEFTVPDLVQGKEYLFKVC 7190

Query: 917  AMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTG 976
            A N  G G P+ V E          VP PP ++K  +   +S+ L W PP + G + + G
Sbjct: 7191 ARNKCGPGEPAYVDEPVNMST-PATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKG 7249

Query: 977  YFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGP 1036
            Y V+        D+W    E  +    ++V GL+EG  Y +RV+A+N+ G  KPS     
Sbjct: 7250 YIVE--RCPRGSDKWVACGEP-VAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEE 7306

Query: 1037 VVAETRPGTKEVVVNVDDDGVISLN----FECDKMT---PKSEFSWSKDYVSTEDSPRLE 1089
            + A       E+ ++V     +++      E        P+ + +W+K  +  +   R+ 
Sbjct: 7307 IQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRIT 7366

Query: 1090 VESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1125
            +E+   K+ +T  D    D G Y  +  +  G A++
Sbjct: 7367 IENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATA 7402



 Score =  207 bits (527), Expect = 7e-53
 Identities = 186/678 (27%), Positives = 300/678 (44%), Gaps = 67/678 (9%)

Query: 523   KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIF 582
             ++ + + WK+PA DGGS I GY ++K ++    W + + T V    F V+GL+E + Y F
Sbjct: 18244 RNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEF 18303

Query: 583   RVRAVNKMG-IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPP 641
             RV A N  G    PS  S  + A D  +       P       +   E    E  + G P
Sbjct: 18304 RVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKP 18363

Query: 642   TDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFD 701
                 V           W   G+         +E+  A      R+  +  ++     + D
Sbjct: 18364 IPDVV-----------WSKDGKE--------LEETAA------RMEIKSTIQKTTLVVKD 18398

Query: 702   LAEGKSYCFRVRCSNSAGVGEPSEATEVTV-VGDKLDIPKAPGKIIPSRNTDTSVVVSWE 760
                     + ++ SN  G    +++  +TV V D+   P+ P K+  +  T     ++W 
Sbjct: 18399 CIRTDGGQYILKLSNVGG----TKSIPITVKVLDRPGPPEGPLKV--TGVTAEKCYLAWN 18452

Query: 761   ES-KDAKELVGYYI-EASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAG 818
                +D    + +YI E        W   +   V+   +    L+ G  YIFRV AVN  G
Sbjct: 18453 PPLQDGGANISHYIIEKRETSRLSWTQVSTE-VQALNYKVTKLLPGNEYIFRVMAVNKYG 18511

Query: 819   LSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYRE 878
             + E   +S  +       PP PP         +DSMV+ W +P   GG EI GY +  R+
Sbjct: 18512 IGE-PLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRD 18570

Query: 879   VIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEW 938
               +GV  +W + N K +++   +++ L E   Y+F+VAA N AG+G PS  S  ++  + 
Sbjct: 18571 K-EGV--RWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACD- 18626

Query: 939   TIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN-EA 997
              +  PGPP + K ++  + S+ L W  P++ G  PV GY V++KEA A  D+W       
Sbjct: 18627 ALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAA--DEWTTCTPPT 18684

Query: 998   AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGV 1057
              ++     V  LKE   Y FR+ AIN  GVG+P+ L G VVA+ R    E+ ++ D   V
Sbjct: 18685 GLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKV 18744

Query: 1058  ISLN-------FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLG 1110
             + L        F   K  P+ E  W K      D  ++EV S  + T +   ++   D G
Sbjct: 18745 VVLRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTS--SFTMLVIDNVTRFDSG 18802

Query: 1111  IYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQA 1170
              Y+  + +  G  ++++       R+L        P+ PV   L +  ++K  V    + 
Sbjct: 18803 RYNLTLENNSGSKTAFV-----NVRVL------DSPSAPV--NLTIREVKKDSVTLSWEP 18849

Query: 1171  EKLSGNAKV-NYIFNEKE 1187
               + G AK+ NYI  ++E
Sbjct: 18850 PLIDGGAKITNYIVEKRE 18867



 Score =  207 bits (526), Expect = 8e-53
 Identities = 224/876 (25%), Positives = 354/876 (40%), Gaps = 114/876 (13%)

Query: 274   LHAPEFIIKP---RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIES 330
             L  PE I+     R   +   + ++L   I G P P+VTW K          P K  I+ 
Sbjct: 10841 LEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKED-----RDAPTKARIDV 10895

Query: 331   RYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPL 390
                   LEI     ED   Y  +  N  G  +    V+V    G              P 
Sbjct: 10896 TPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGP-------------PR 10942

Query: 391   SFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPL 450
                V+            + + D  +    E +  G  V+    ++              +
Sbjct: 10943 DLEVS------------EIRKDSCYLTWKEPLDDGGSVITNYVVERRD-----------V 10979

Query: 451   SPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGA- 509
             + ++W     + ++ +    HLN+ ++ L+ +         QY    FV +    I+   
Sbjct: 10980 ASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAE-----NQYGRGPFV-ETPKPIKALD 11033

Query: 510   ----PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVK 565
                 P  P D+  ++ +K  + + W +P  DGGSPI GY ++  E GT  W +     V 
Sbjct: 11034 PLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKT--VT 11091

Query: 566   FARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQI 625
                  VTGL +G++Y FRV+A N +G+G P           P E       PS     ++
Sbjct: 11092 NLECVVTGLQQGKTYRFRVKAENIVGLGLPDTTI-------PIECQEKLVPPSVELDVKL 11144

Query: 626   IVTEEEPSEGIVPGPPTDLSVTEATRSYVV--LSWKPPGQRGHEGIMYFVEKCEAGTENW 683
             I       EG+V    T +      R   V    W   G        Y VE     T+N+
Sbjct: 11145 I-------EGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVE-----TDNF 11192

Query: 684   QRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAP- 742
               V   L +K+      D  E     +++  SN+AG    + A  +TV    LD+P  P 
Sbjct: 11193 SSV---LTIKN--CLRRDTGE-----YQITVSNAAG--SKTVAVHLTV----LDVPGPPT 11236

Query: 743   GKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHG 800
             G I     T   + +SW+  KD     ++ Y +E        W   ++   K      H 
Sbjct: 11237 GPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPH- 11295

Query: 801   LVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQ 860
             L  G  Y+FRVRA N  G+     DS     K   +PPSPP      +   ++  + W  
Sbjct: 11296 LQKGCEYVFRVRAENKIGVGP-PLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTL 11354

Query: 861   PDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNM 920
             P   GG+ ITGYY+  REV     GKW   N   +++  ++++ L E   Y+F+V A N+
Sbjct: 11355 PKSDGGSPITGYYMERREVT----GKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENL 11410

Query: 921   AGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVD 980
             AGL  PS  S+  K     I  PGPP + K  +  +++  L W  P+  G +P+ GY V+
Sbjct: 11411 AGLSKPSPSSDPIKACR-PIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVE 11469

Query: 981   LKEAKAKEDQWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVA 1039
              +  K    QW  +N +  I+    +V GL EG  Y FR++A N  G G+P +LA  V+A
Sbjct: 11470 CQ--KPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIA 11527

Query: 1040  ETRPGTKEVVVNVDDDGVISLN-------FECDKMTPKSEFSWSKDYVSTEDSPRLEVES 1092
             +      EV ++V    VI++            K  P+ + +W+K+        R+++  
Sbjct: 11528 KDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQ 11587

Query: 1093  KGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLI 1128
                + ++  K+    D G Y     ++ G A    I
Sbjct: 11588 DLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAI 11623



 Score =  205 bits (522), Expect = 2e-52
 Identities = 185/707 (26%), Positives = 292/707 (41%), Gaps = 122/707 (17%)

Query: 494  SAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGT 553
            +A  FV+ AD  IE  P+ P+++   +  +  + + W+ P  DGGSPILGY I++CE G 
Sbjct: 6906 AATPFVKVADP-IE-RPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGK 6963

Query: 554  DSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARL 613
            D+W +CN   V    + VTGL +G  Y++RV A NK G+  PS +  P+ A D   +  +
Sbjct: 6964 DNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTM 7023

Query: 614  K-------------------------SRPSAPW--------TGQ-------------IIV 627
                                       RP+A W        TG              +I 
Sbjct: 7024 DLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVIS 7083

Query: 628  TEEEPSEGIV----------------------PGPPTDLSVTEATRSYVVLSWKPPGQRG 665
              E   +GI                       P  P +L   + T+  V L+W+PP   G
Sbjct: 7084 PSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDG 7143

Query: 666  HEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPS 724
               +  Y VEK E   + W +V     V    F + DL +GK Y F+V   N  G GEP+
Sbjct: 7144 GSPLTGYVVEKREVSRKTWTKVMDF--VTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPA 7201

Query: 725  EATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGK 782
               E   +     +P  P  +     T  S+ ++W+  K+     + GY +E    GS K
Sbjct: 7202 YVDEPVNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDK 7261

Query: 783  WEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPC 842
            W  C   PV  ++    GL  G+ Y +RV+A+N  G S+ S+ +E  E++A     +P  
Sbjct: 7262 WVAC-GEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTE--EIQAVDTQEAP-- 7316

Query: 843  DITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPG---KWREANVKAVSEEA 899
                 E F D  +L        G     G  +     + G P     W +A++    ++ 
Sbjct: 7317 -----EIFLDVKLLA-------GLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKR 7364

Query: 900  YKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKC----EEWTIAVPGPPHSLKCSEVR 955
              I N+ +        +  +  G     AV+ C +     E   +  PGPP +   ++V 
Sbjct: 7365 ITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVT 7424

Query: 956  KDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSY 1015
             +S +L W PP   G + +T Y V+ +   +  + W  L+ + +K+   K   L     Y
Sbjct: 7425 NESCLLTWNPPRDDGGSKITNYVVERRATDS--EVWHKLS-STVKDTNFKATKLIPNKEY 7481

Query: 1016 VFRVRAINQAGVGKPSDLAGPVVAETR---PG----------TKEVVV----NVDDDGVI 1058
            +FRV A N  GVG+P   A P+ A+ +   PG          TK+ V       DDDG  
Sbjct: 7482 IFRVAAENMYGVGEPVQ-ASPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGS 7540

Query: 1059 SL-NFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDL 1104
             +  +  +++ P ++  W +            V+   NK K  F+ L
Sbjct: 7541 PITGYWVERLDPDTD-KWVRCNKMPVKDTTYRVKGLTNKKKYRFRVL 7586



 Score =  205 bits (522), Expect = 2e-52
 Identities = 228/940 (24%), Positives = 353/940 (37%), Gaps = 152/940 (16%)

Query: 288   VWEKENVKLHCSIAGWPEPRVTWYK-------NQVPINVHANPGKYIIESRYGMHTLEIN 340
             V E  NV +   I G P P +TW+K       N+ P+    +  K +++      TL I 
Sbjct: 9756  VEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTC---TLVIP 9812

Query: 341   GCDFEDTAQYRASAMNVKGELSAYASV-VVKRYKGEFDETRFHA-GASTMPLSFGVTPYG 398
                  DT  Y  +A+N  G  S    + V+ R        +F +  A  M LS+      
Sbjct: 9813  QSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDD 9872

Query: 399   YASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQT 458
               S+   +  +K      RE    +                               WV  
Sbjct: 9873  GGSKITNYVIEK------REANRKT-------------------------------WVHV 9895

Query: 459   LWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGA------PAA 512
                 +  T T   L +  E ++ I  +        + Y      D+E E A      P A
Sbjct: 9896  SSEPKECTYTIPKLLEGHEYVFRIMAQ--------NKYGIGEPLDSEPETARNLFSVPGA 9947

Query: 513   PLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKF----AR 568
             P         ++ + ++W++P  DGGSP+ GY+++  +  +  W + N  P+K       
Sbjct: 9948  PDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVS 10007

Query: 569   FPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVT 628
             + VTGLIEG  Y FRV A+N  G+G  S  S+P  A DP           AP        
Sbjct: 10008 YKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPI----------AP-------- 10049

Query: 629   EEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVN 687
                      PGPP    VT+ T+S   L W PP + G   +  Y VE  E G E W++  
Sbjct: 10050 ---------PGPPFP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEK-G 10098

Query: 688   TELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIP 747
              +  V+  +  +  L EG  Y FRVR  N AG+GEP E T+V  + D+L        + P
Sbjct: 10099 KDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRL--------VSP 10150

Query: 748   SRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKW---------EPCNNNPVKGSRFTC 798
                 D SV             +  Y+      +  W         E         S    
Sbjct: 10151 DLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVI 10210

Query: 799   HGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGW 858
                      ++ + A N AG  + +   + ++V   +  P    ++T      +S  L W
Sbjct: 10211 KNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLT-----NESCKLTW 10265

Query: 859   KQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAM 918
               P+  GG+ IT Y +  RE        W         + A  +  L +   Y F++AA 
Sbjct: 10266 FSPEDDGGSPITNYVIEKRE---SDRRAWTPVTYTVTRQNA-TVQGLIQGKAYFFRIAAE 10321

Query: 919   NMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYF 978
             N  G+G     SE     E  I VP  P  L+  EV K+++ L W PP + G + +  Y 
Sbjct: 10322 NSIGMGPFVETSEALVIRE-PITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYV 10380

Query: 979   VDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVV 1038
             ++ +     E   +  N+  +   Y  V+GLKEG +Y +RV A+N  G GKPS    P+ 
Sbjct: 10381 LESRLI-GTEKFHKVTNDNLLSRKYT-VKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPIT 10438

Query: 1039  AETRPGTKEVVVNVDDDGVISLNFECDKMT------PKSEFSWSKDYVSTEDSPRLEVES 1092
              +       + ++  D   I +  E   +T      PK + SW KD     +  R  +++
Sbjct: 10439 CKDELAPPTLHLDFRDKLTIRVG-EAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKT 10497

Query: 1093  KGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSY----LIDEEELKRLLALSHEHKFPTV 1148
                   +        D G Y   V ++ G    +    ++D                P  
Sbjct: 10498 TPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDR---------------PGP 10542

Query: 1149  PVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEI 1188
             PV      E+ +   V  W       G+   NYI  +KE+
Sbjct: 10543 PVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEV 10582



 Score =  205 bits (521), Expect = 3e-52
 Identities = 203/858 (23%), Positives = 332/858 (38%), Gaps = 114/858 (13%)

Query: 287   TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
             TV   + ++L   + G P P V W K++   ++  +P +  I++R       +      D
Sbjct: 11840 TVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSP-RVKIDTRADSSKFSLTKAKRSD 11898

Query: 347   TAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIH 406
               +Y  +A N  G   AYA+V V    G     +                          
Sbjct: 11899 GGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKI------------------------- 11933

Query: 407   FDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERAT 466
                  DVS  R        C V   P       EIQ Y     L   +  + +WS   AT
Sbjct: 11934 ----VDVSSDR--------CTVCWDPPEDDGGCEIQNYI----LEKCETKRMVWSTYSAT 11977

Query: 467   L-----TFSHLNKEDEGLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCL 519
             +     T + L + +E ++ +R   ++G      S  V  +    +    P  P   +  
Sbjct: 11978 VLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYDK----PGRPDPPEVT 12033

Query: 520   EANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRS 579
             + +K+ + + W  P  DGG  I GYF++K E  +  W   N + +   R  V  L+    
Sbjct: 12034 KVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHE 12093

Query: 580   YIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPG 639
             Y FRV+A N++GIG PS  S PV A DP E                            PG
Sbjct: 12094 YQFRVKAENEIGIGEPSLPSRPVVAKDPIEP---------------------------PG 12126

Query: 640   PPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCE------AGTENWQRVNTELPVK 693
             PPT+  V + T+  + L W  P   G   I+ +V +        +  E W+R N    + 
Sbjct: 12127 PPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLV 12186

Query: 694   SPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGD-----KLDIPKAPGKIIPS 748
                F +  L E + Y FRV   N  G+G P+E  E     +     ++D+  +  K++  
Sbjct: 12187 RKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVIV 12246

Query: 749   RNTDTSVVVSWEESKDAKELVGYYIEA-SVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSY 807
             R      + +    + A ++    +   +V   G+ +  +                  S 
Sbjct: 12247 RAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAF----LVIPNSTRDDSG 12302

Query: 808   IFRVRAVNAAGLSEYSQDSEAIEVKAAIAP-PSPPCDITCLESFRDSMVLGWKQPDKIGG 866
              + +  VN AG        +A+ V   +   P P  D+   +  + S  + W  P+  GG
Sbjct: 12303 KYSLTLVNPAG-------EKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGG 12355

Query: 867   AEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAP 926
             +++T Y V  RE       K        V + ++ ++NL     Y F+V A+N  G G P
Sbjct: 12356 SQVTHYIVEKREA----DRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVP 12411

Query: 927   SAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKA 986
             + V +     +  ++ P PP  L+ +E+ K+S  L W PP+  G   + GY    +E + 
Sbjct: 12412 TDVPKPVLASD-PLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQ 12470

Query: 987   KEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTK 1046
               D+W     + +K++ L V GLKEG  Y FRV A N  GV  P +  G   A+ +    
Sbjct: 12471 PADRWT--EYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPP 12528

Query: 1047  EVVV--NVDDDGVISLNFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKD 1103
             ++++   +       L  E      P     W K       S  L V    + + +  KD
Sbjct: 12529 KILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKD 12588

Query: 1104  LGMDDLGIYSCDVTDTDG 1121
             +   D G YS    ++ G
Sbjct: 12589 VTRKDSGYYSLTAENSSG 12606



 Score =  205 bits (521), Expect = 3e-52
 Identities = 227/934 (24%), Positives = 381/934 (40%), Gaps = 151/934 (16%)

Query: 287   TVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFED 346
             T+    ++ L  ++ G PEP++ W K    +++     K  ++      T  I  CD  D
Sbjct: 22686 TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCE---KVSLQYTGKRATAVIKFCDRSD 22742

Query: 347   TAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIH 406
             + +Y  +  N  G  +    V V    G                     P G  +   + 
Sbjct: 22743 SGKYTLTVKNASGTKAVSVMVKVLDSPG---------------------PCGKLTVSRVT 22781

Query: 407   FDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERAT 466
               +K  +++    E            EI H+  E +        S   WV  +  GE  T
Sbjct: 22782 -QEKCTLAWSLPQEDGGA--------EITHYIVERR------ETSRLNWV--IVEGECPT 22824

Query: 467   LTF--SHLNKEDEGLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEAN 522
             L++  + L K +E ++ +R   + G      S  +  R++   I   P  P +V      
Sbjct: 22825 LSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFT-IPSPPGIPEEVG---TG 22880

Query: 523   KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCN-DTPVKFARFPVTGLIEGRSYI 581
             K++III W +P  DGG+ I  Y +DK E  +  W++ N D  V   R  VT L+EG  Y 
Sbjct: 22881 KEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQ 22940

Query: 582   FRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPP 641
             FRV AVN  G   PS  S  ++  +P+                             PGPP
Sbjct: 22941 FRVTAVNAAGNSEPSEASNFISCREPS---------------------------YTPGPP 22973

Query: 642   TDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALF 700
             +   V + T+  + L+W KP    G + + Y +E  E  T+ W RV+T   +++  F + 
Sbjct: 22974 SAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVP 23033

Query: 701   DLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE 760
             DL  G+ Y FRV   N  G+ E SE+       ++++IP                    E
Sbjct: 23034 DLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIP------------------DLE 23075

Query: 761   ESKDAKELV----GYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLV-TGQSY-IFRVRAV 814
              + D K+ V    G  +   V+ SG+  P      +G       ++ T +SY +  V  V
Sbjct: 23076 LADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSLLIVDKV 23135

Query: 815   NAAGLSEYSQDSE-------AIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGA 867
             N     +Y+ ++E       A  +      P P   +   E  RDS+ + W+ P   GGA
Sbjct: 23136 NRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGA 23195

Query: 868   EITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPS 927
              +  Y V  RE        ++    K  S+  Y+IS L E  +Y F+V   N+ G+G P 
Sbjct: 23196 PVNNYIVEKRE---AAMRAFKTVTTKC-SKTLYRISGLVEGTMYYFRVLPENIYGIGEPC 23251

Query: 928   AVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAK 987
               S+     E    VP  P  L+  +V K ++ L W+ P++ G + +TGY   L+  KA 
Sbjct: 23252 ETSDAVLVSE----VPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYV--LEACKAG 23305

Query: 988   EDQWRGLNEAAIKNVYLK--VRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAE----- 1040
              ++W  +    +K   L+  V  L EG  Y+FR+RA N+ GV +P +    V  +     
Sbjct: 23306 TERW--MKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLRVL 23363

Query: 1041  ------TRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKG 1094
                   T P   +  ++V     + L        P +  SW        +S R+ VE+  
Sbjct: 23364 PTIDLSTMP---QKTIHVPAGRPVELVIPIAGRPPPAA-SWFFAGSKLRESERVTVETHT 23419

Query: 1095  NKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSEL 1154
                K+T ++  + D G Y+ ++ +  G  S       E  +++ L      PT P+K   
Sbjct: 23420 KVAKLTIRETTIRDTGEYTLELKNVTGTTS-------ETIKVIILDKPGP-PTGPIK--- 23468

Query: 1155  AVEILEKGQVRFWMQAEKLSGNAKVN-YIFNEKE 1187
              ++ ++   +    +  +L G A ++ Y+  +++
Sbjct: 23469 -IDEIDATSITISWEPPELDGGAPLSGYVVEQRD 23501



 Score =  204 bits (519), Expect = 6e-52
 Identities = 185/698 (26%), Positives = 293/698 (41%), Gaps = 86/698 (12%)

Query: 508   GAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFA 567
             G P  P + +     KD +++ W  P  DGGS I+ Y +++ +     W +CN   +   
Sbjct: 15281 GPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDL 15340

Query: 568   RFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIV 627
             R+ V+GL EG  Y FR+ A N  GI  PS  S    A D   K                 
Sbjct: 15341 RYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFK----------------- 15383

Query: 628   TEEEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRV 686
                       PGPP +  V + +RS + ++W KP    G E   Y VE      + WQ V
Sbjct: 15384 ----------PGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIV 15433

Query: 687   NTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKII 746
                  +K+  + +  L E + Y  R+   NS G+GEP+      V G     PKA  +++
Sbjct: 15434 TPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPA-----LVPGT----PKAEDRML 15484

Query: 747   PSR---NTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVT 803
             P     + D   VV+       +  V   I+   A   KW   +   +  +        T
Sbjct: 15485 PPEIELDADLRKVVTIRACCTLRLFVP--IKGRPAPEVKWARDHGESLDKASIES----T 15538

Query: 804   GQSYIFRVRAVNAAGLSEY------SQDSEAIEVKAAIAP-PSPPCDITCLESFRDSMVL 856
                 +  V  VN     +Y      S  S++  V   +   P PP D+   E  + S+ L
Sbjct: 15539 SSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTL 15598

Query: 857   GWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVA 916
              W  P   GG++I  Y V  RE       K          + ++K+  L+E   Y F+V 
Sbjct: 15599 TWDPPLLDGGSKIKNYIVEKRESTR----KAYSTVATNCHKTSWKVDQLQEGCSYYFRVL 15654

Query: 917   AMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTG 976
             A N  G+G P+  +E  K  E     P PP  +   +V ++S+ L W+ P H G + + G
Sbjct: 15655 AENEYGIGLPAETAESVKASER----PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILG 15710

Query: 977   YFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGP 1036
             Y V+++   +  D+W     A +K     + GL +G  Y FRV A N+ G+  P  L+ P
Sbjct: 15711 YIVEMQTKGS--DKWATC--ATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVP 15766

Query: 1037  VVAETR--PGTKEVVVNV-----DDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLE 1089
             V+A+    P   +++ N       +D  + + F   + TP    +W KD V  + + R+ 
Sbjct: 15767 VIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPF-IGRPTPA--VTWHKDNVPLKQTTRVN 15823

Query: 1090  VESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVP 1149
              ES  N + +T KD   +D+G Y   +T++ G A        E   ++ L      PT P
Sbjct: 15824 AESTENNSLLTIKDACREDVGHYVVKLTNSAGEAI-------ETLNVIVLDKPGP-PTGP 15875

Query: 1150  VKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1187
             VK +   E+        W   +   G++  NYI  +++
Sbjct: 15876 VKMD---EVTADSITLSWGPPKYDGGSSINNYIVEKRD 15910



 Score =  204 bits (519), Expect = 6e-52
 Identities = 178/675 (26%), Positives = 276/675 (40%), Gaps = 94/675 (13%)

Query: 405   IHFDDKF-DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGE 463
             +  D KF DV   + GE + +   +   P      P I W ++G+ +      + + +  
Sbjct: 19417 VMMDVKFRDVIVVKAGEVLKINADIAGRP-----LPVISWAKDGIEIEERARTEIISTDN 19471

Query: 464   RATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANK 523
                LT     + D G Y + ++        +    V D      G PA PL++  L A K
Sbjct: 19472 HTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKP----GPPAGPLEINGLTAEK 19527

Query: 524   DYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFR 583
                 +SW +P  DGG+ I  Y ++K E    +W+ C +  ++     VT L++G  YIFR
Sbjct: 19528 --CSLSWGRPQEDGGADIDYYIVEKRETSHLAWTIC-EGELQMTSCKVTKLLKGNEYIFR 19584

Query: 584   VRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTD 643
             V  VNK G+G P   S  + ALDP                             VP PPT 
Sbjct: 19585 VTGVNKYGVGEPLE-SVAIKALDPFT---------------------------VPSPPTS 19616

Query: 644   LSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDL 702
             L +T  T+  + L W +P    G E   Y +E+ E  +  W RVN + PV   R     L
Sbjct: 19617 LEITSVTKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKK-PVYDLRVKSTGL 19675

Query: 703   AEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES 762
              EG  Y +RV   N+AG+  PSE + +    D + +P  P K     +  T++ ++W + 
Sbjct: 19676 REGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKP 19735

Query: 763   --KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLS 820
                    + GY +E   +    W+  +   ++G+ +T  GL TG  Y+FRV++VN  G S
Sbjct: 19736 LFDGGAPITGYTVEYKKSDDTDWK-TSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGAS 19794

Query: 821   EYSQDSEAIEVKAAIAPPSPPCD--------------ITCLESFRDSMV--LGWKQPDKI 864
             + S  S+    K     P    D               T    FR   V  + W +PD  
Sbjct: 19795 DPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDT- 19853

Query: 865   GGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLG 924
                      +  R  +D              S  +  I N   N   ++ +   N+    
Sbjct: 19854 --------DLRTRAYVDTTD-----------SRTSLTIENANRNDSGKYTLTIQNVLSAA 19894

Query: 925   APSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEA 984
             + + V +        +  PGPP ++   +V K+S VL W  P + G  PV  Y ++ +EA
Sbjct: 19895 SLTLVVK-------VLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKREA 19947

Query: 985   KAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPG 1044
               K   W  +     +  Y KV  L+EG  Y FRV   N+ GVG P++    V    +P 
Sbjct: 19948 SKK--AWVSVTNNCNRLSY-KVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVKITEKPS 20004

Query: 1045  TKEV--VVNVDDDGV 1057
               E   V ++  D V
Sbjct: 20005 PPEKLGVTSISKDSV 20019



 Score =  204 bits (519), Expect = 6e-52
 Identities = 179/742 (24%), Positives = 308/742 (41%), Gaps = 84/742 (11%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P  P + +  +  +  + ++W  P  +GGS + GY I+  +V    W++CN TP K   +
Sbjct: 23661 PGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREY 23720

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              +T L +G  Y FRV A N  G G P+ V   V   +  E    +              +
Sbjct: 23721 TLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYE-------------LD 23767

Query: 630   EEPSEGIV--PGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVN 687
             E   EGI    G    L++    + + +  W   GQ   +  M    +           +
Sbjct: 23768 ERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSE----------TH 23817

Query: 688   TELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAP-GKII 746
             TEL +K       +   G S  + +   N  G  + +   +V V+G     P +P G + 
Sbjct: 23818 TELVIK-------EADRGDSGTYDLVLENKCG--KKAVYIKVRVIGS----PNSPEGPLE 23864

Query: 747   PSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTG 804
                    SV VSW    D    +++GY +E        W   ++  V+G+     GL   
Sbjct: 23865 YDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSR-VRGTSLVVKGLKEN 23923

Query: 805   QSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDIT-CLESFRDSMVLGWKQPDK 863
               Y FRV A N  G+S+  +  E +  K  + PP PP +    L+  + S+ L W +P  
Sbjct: 23924 VEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKD 23983

Query: 864   IGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGL 923
              GG+ +TGYY+  +E       KW   N   ++   Y ++ L  +  YQF++ A N  GL
Sbjct: 23984 DGGSRVTGYYIERKETSTD---KWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGL 24040

Query: 924   GAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE 983
                S  SE   C++     P  P  L+   + KDS+ LQW+ P   G   + GY+V+ ++
Sbjct: 24041 SETSPASEPVVCKD-PFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQ 24099

Query: 984   AKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPV----VA 1039
               + +  W+  N+  IK+    + GL E   Y FRV A N+ G+ +P   A  +     +
Sbjct: 24100 --SGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTS 24157

Query: 1040  ETRPGTKEVVVNVDDDGVISLNFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKGNKTK 1098
                PG ++ + +V      +    C  +  P  +  W +       S + ++ S G    
Sbjct: 24158 GEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHT 24217

Query: 1099  MTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVK------- 1151
             +T      +D G+Y+C       IA++ + + E   +LL  +     P  P+K       
Sbjct: 24218 LTVMTEEQEDEGVYTC-------IATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAV 24270

Query: 1152  -SELAVEILEKGQ---VRFWMQAEKLSGNAKVNYIFNEKEI-----------FEGPKYKM 1196
              S L + ++  G+      W   +KL  N++   I N +                 KYK+
Sbjct: 24271 GSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKV 24330

Query: 1197  HIDRNTGIIEMFME-KLQDEDE 1217
              +    G ++  ++ ++QD+ +
Sbjct: 24331 QLSNVFGTVDAILDVEIQDKPD 24352



 Score =  204 bits (518), Expect = 7e-52
 Identities = 183/705 (25%), Positives = 300/705 (42%), Gaps = 98/705 (13%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVK-FAR 568
             P AP      E  KD  +++W +P  DGG PI  Y ++K E  +  W++    P+  + +
Sbjct: 10640 PDAPDQPIVTEVTKDSALVTWNKPH-DGGKPITNYILEKRETMSKRWARVTKDPIHPYTK 10698

Query: 569   FPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVT 628
             F V  L+EG  Y FRV A N++GIG PS  S+PV A DP  K                  
Sbjct: 10699 FRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAK------------------ 10740

Query: 629   EEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVN 687
                      P PP +    + T + V L+W+PP   G   I+ Y VE  + G E W+R N
Sbjct: 10741 ---------PSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRAN 10791

Query: 688   TELPVKSP--RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKI 745
                P   P  ++ +  L +G++Y FRV   N+AG  +P+   E  +V D+L+ P+     
Sbjct: 10792 -HTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPE----- 10845

Query: 746   IPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSG------KWEPCNNN-PVK------ 792
                      +++    +++    VG  +  S    G       W+  + + P K      
Sbjct: 10846 ---------LILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVT 10896

Query: 793   --GSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAP-PSPPCDITCLES 849
               GS+            I+ +   N AG       S+ + VK  +   P PP D+   E 
Sbjct: 10897 PVGSKLEIRNAAHEDGGIYSLTVENPAG-------SKTVSVKVLVLDKPGPPRDLEVSEI 10949

Query: 850   FRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENM 909
              +DS  L WK+P   GG+ IT Y V  R+V      +W   +  +  ++++   +L E  
Sbjct: 10950 RKDSCYLTWKEPLDDGGSVITNYVVERRDVASA---QWSPLSATS-KKKSHFAKHLNEGN 11005

Query: 910   VYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHS 969
              Y F+VAA N  G G      +  K  +  +  PGPP  L   +V K  + L W  P   
Sbjct: 11006 QYLFRVAAENQYGRGPFVETPKPIKALD-PLHPPGPPKDLHHVDVDKTEVSLVWNKPDRD 11064

Query: 970   GRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGK 1029
             G +P+TGY V+ +E   ++  W  +    + N+   V GL++G +Y FRV+A N  G+G 
Sbjct: 11065 GGSPITGYLVEYQEEGTQD--W--IKFKTVTNLECVVTGLQQGKTYRFRVKAENIVGLGL 11120

Query: 1030  PSDLAGPVVAETR--PGTKEVVVNVDDDGVISLNFECD-----KMTPKSEFSWSKDYVST 1082
             P D   P+  + +  P + E+ V + +  V+            +  P     W+ D    
Sbjct: 11121 P-DTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEI 11179

Query: 1083  EDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHE 1142
             +      VE+    + +T K+    D G Y   V++  G         + +   L +   
Sbjct: 11180 KTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAG--------SKTVAVHLTVLDV 11231

Query: 1143  HKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKE 1187
                PT P+     +++  +     W   +   G+  +NYI  +++
Sbjct: 11232 PGPPTGPIN---ILDVTPEHMTISWQPPKDDGGSPVINYIVEKQD 11273



 Score =  203 bits (517), Expect = 9e-52
 Identities = 188/683 (27%), Positives = 288/683 (42%), Gaps = 141/683 (20%)

Query: 510  PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
            P  P  +  ++  K ++ + W+ P  DGG PI  Y I+K E     W +   T      F
Sbjct: 7812 PGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNF 7871

Query: 570  PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
             VT +IEG    F+VRA N+ G+G PS  +E ++  DP                      
Sbjct: 7872 RVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSP------------------- 7912

Query: 630  EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNT 688
                    P PP DL VT+A R ++ ++WKPP + G   I+ Y VE C  GTE W RVN+
Sbjct: 7913 --------PSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNS 7964

Query: 689  ELPVKSPRFALFD-LAEGKSYCFRVRCSNSAGVGEPSEATE------------------- 728
              P+K  +F + + +   K Y  RVR  N+ GV EPSE +E                   
Sbjct: 7965 R-PIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHD 8023

Query: 729  -VTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCN 787
             + + G+KL IP  P + +P         VSW   KD KE     ++AS          +
Sbjct: 8024 IIVIEGEKLSIP-VPFRAVPVPT------VSWH--KDGKE-----VKAS----------D 8059

Query: 788  NNPVKGSRFTCH----GLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCD 843
               +K    + H      V   + I+ +   N  G +  S     I VK  I  P P  D
Sbjct: 8060 RLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATAS-----INVKV-IGLPGPCKD 8113

Query: 844  ITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEE---AY 900
            I   +  + S  L W+ P+  GG  I  Y +  RE         R   +  +S E   ++
Sbjct: 8114 IKASDITKSSCKLTWEPPEFDGGTPILHYVLERREA-------GRRTYIPVMSGENKLSW 8166

Query: 901  KISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAV-----PGPPHSLKCSEVR 955
             + +L  N  Y F+V A+N  G G      E  + +   IA      P PP  ++     
Sbjct: 8167 TVKDLIPNGEYFFRVKAVNKVGGG------EYIELKNPVIAQDPKQPPDPPVDVEVHNPT 8220

Query: 956  KDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSY 1015
             +++ + WKPP++ G + + GY ++ K AK  E++W+  NE  +  +    +GL+EG  Y
Sbjct: 8221 AEAMTITWKPPLYDGGSKIMGYIIE-KIAKG-EERWKRCNEHLVPILTYTAKGLEEGKEY 8278

Query: 1016 VFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVV----VNVDDDGVISLNFECDKMTPKS 1071
             FRVRA N AG+ +PS    P  A       +V+    + V     I+L+      +P  
Sbjct: 8279 QFRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDASISG-SPYP 8337

Query: 1072 EFSWSKD----------------------YVSTED------SPRLEVE-SKGNKTKMTFK 1102
              +W KD                       V  E+      + RL ++ SK  ++++  +
Sbjct: 8338 TITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVR 8397

Query: 1103 DLGMDDLGIYSCDVTDTDGIASS 1125
            D    D G+Y   V +  GIA +
Sbjct: 8398 DSLRPDHGLYMIKVENDHGIAKA 8420



 Score =  203 bits (516), Expect = 1e-51
 Identities = 196/779 (25%), Positives = 311/779 (39%), Gaps = 124/779 (15%)

Query: 277   PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHT 336
             P   +   ++++   E++K+   + G P P ++W K+  P+       +  +E       
Sbjct: 17940 PSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLK---QTTRVNVEETATSTV 17996

Query: 337   LEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTP 396
             L I   + +D  +Y  +A N  G  +   SV+V    G                     P
Sbjct: 17997 LHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPG--------------------PP 18036

Query: 397   YGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWV 456
              G     E+  D    V    E    + GC++      K       W+     ++     
Sbjct: 18037 VGPVRFDEVSAD---FVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVA----- 18088

Query: 457   QTLWSGERATLTFSHLNKEDEGLYTIRV----RMGEYYEQYSAYVFVRDADAEIEGAPAA 512
                    R T+  + L    E  Y  R+    R G+     S  V V+    E  G P  
Sbjct: 18089 -------RTTIKITKLKTGTE--YQFRIFAENRYGKSAPLDSKAVIVQYPFKE-PGPPGT 18138

Query: 513   PLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVT 572
             P        +KD +++ W +P  DGG+ I+GY +++ E  +  W + N TP++  +F  T
Sbjct: 18139 PF---VTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTT 18195

Query: 573   GLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEP 632
             GL EG  Y F+V A N +GIG PS+VSE   A DP +                       
Sbjct: 18196 GLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDP---------------------- 18233

Query: 633   SEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELP 691
                  PG P  + +   TR+ V L WK P   G   I  Y VEK +     W + +    
Sbjct: 18234 -----PGRPEAIVI---TRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASF-TN 18284

Query: 692   VKSPRFALFDLAEGKSYCFRVRCSNSAG-VGEPSEATEVTVVGDKLDIPKAPGKIIPSRN 750
             V    F +  L E + Y FRV   N+AG   EPS+++      D++D P A    +  + 
Sbjct: 18285 VLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNAS---LDPKY 18341

Query: 751   TDTSVVVSWEE-----------------SKDAKELVGYYIEASVAGSGKWEPCNNNPVKG 793
              D  VV + E                  SKD KEL        +           + ++ 
Sbjct: 18342 KDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEI----------KSTIQK 18391

Query: 794   SRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDS 853
             +       +      + ++  N  G          ++V     PP  P  +T + +  + 
Sbjct: 18392 TTLVVKDCIRTDGGQYILKLSNVGGTKSI---PITVKVLDRPGPPEGPLKVTGVTA--EK 18446

Query: 854   MVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQF 913
               L W  P + GGA I+ Y +  RE        W + + + V    YK++ L     Y F
Sbjct: 18447 CYLAWNPPLQDGGANISHYIIEKRET---SRLSWTQVSTE-VQALNYKVTKLLPGNEYIF 18502

Query: 914   QVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTP 973
             +V A+N  G+G P        C  +    PGPP + + S + KDS+V+ W  PV  G T 
Sbjct: 18503 RVMAVNKYGIGEPLESGPVTACNPY--KPPGPPSTPEVSAITKDSMVVTWARPVDDGGTE 18560

Query: 974   VTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSD 1032
             + GY ++ ++ +    +W   N+  + ++ L+V GL EG SY FRV A N AGVG+PS+
Sbjct: 18561 IEGYILEKRDKEGV--RWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSE 18617



 Score =  202 bits (514), Expect = 2e-51
 Identities = 165/622 (26%), Positives = 276/622 (44%), Gaps = 66/622 (10%)

Query: 429  VITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGE 488
            ++ P   + + E +W++   PLS +K + T  + E+ +       K D+G Y I ++   
Sbjct: 6647 MVVPYDAYPKAEAEWFKENEPLS-TKTIDT--TAEQTSFRILEAKKGDKGRYKIVLQ--N 6701

Query: 489  YYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDK 548
             + +   ++ ++  D      P    +++  E     + ++W++P  DGGS I+GY +++
Sbjct: 6702 KHGKAEGFINLKVIDV-----PGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVER 6756

Query: 549  CEVGTDSWSQCNDTPVKFARFPVTGLIEGR-SYIFRVRAVNKMGIGFPSRVSEPVAALDP 607
             ++   +W    D   +   F VTGL +G   Y+FRV A N++G G P     PV     
Sbjct: 6757 RDIKRKTWVLATDR-AESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPV----- 6810

Query: 608  AEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHE 667
                                  E  S+  VPGPP ++++T+  R  V L+W+PP   G  
Sbjct: 6811 ----------------------EARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGA 6848

Query: 668  GIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEA 726
             I  Y +E  +  +  W    T +  +     + D+ EG+ Y FRVR  N  GVG+PS A
Sbjct: 6849 EITNYVIELRDKTSIRWDTAMT-VRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAA 6907

Query: 727  TEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES-KDA-KELVGYYIEASVAGSGKWE 784
            T    V D ++ P  P  +  S  T +SV + WE   KD    ++GY IE    G   W 
Sbjct: 6908 TPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWI 6967

Query: 785  PCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDI 844
             CN   V    +   GL  G  Y++RV A N AG+S+ S+    +    A   P+     
Sbjct: 6968 RCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMD--- 7024

Query: 845  TCLESFRDSMVLGWKQPDKI-----GGAEITGYYVNYREVIDGVPGKWREANVKAVSEEA 899
              L +F+D + +    P  I     G    T  +    +V++    + +   + A +E  
Sbjct: 7025 --LSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLE-TGDRVKMKTLSAYAELV 7081

Query: 900  YKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSL 959
               S   +  +Y  ++        G         + +   IA P  P  LK  ++ KDS+
Sbjct: 7082 ISPSERSDKGIYTLKLENRVKTISG---------EIDVNVIARPSAPKELKFGDITKDSV 7132

Query: 960  VLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRV 1019
             L W+PP   G +P+TGY V+ +E   K   W  + +  + ++   V  L +G  Y+F+V
Sbjct: 7133 HLTWEPPDDDGGSPLTGYVVEKREVSRK--TWTKVMD-FVTDLEFTVPDLVQGKEYLFKV 7189

Query: 1020 RAINQAGVGKPSDLAGPVVAET 1041
             A N+ G G+P+ +  PV   T
Sbjct: 7190 CARNKCGPGEPAYVDEPVNMST 7211



 Score =  202 bits (513), Expect = 3e-51
 Identities = 175/684 (25%), Positives = 289/684 (42%), Gaps = 72/684 (10%)

Query: 519   LEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGR 578
             L   +  + + W +P   GG  I  Y ++K ++    W + N + +    F V+GL E  
Sbjct: 14994 LNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDA 15053

Query: 579   SYIFRVRAVNKMG-IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIV 637
             +Y FRV A N  G I  PS  S+ +   D  E  ++K       T  +   E    E  V
Sbjct: 15054 AYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADV 15113

Query: 638   PG--PPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSP 695
              G  PPT             + W   G+                 E   ++  ++   S 
Sbjct: 15114 SGRPPPT-------------MEWSKDGKE---------------LEGTAKLEIKIADFST 15145

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAP-GKIIPSRNTDTS 754
                  D     S  + +  +N  G  +     +V      LD P  P G +  +  T   
Sbjct: 15146 NLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKV------LDRPGPPEGPLAVTEVTSEK 15199

Query: 755   VVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVR 812
              V+SW    D    ++  Y ++        W    +  V+ ++     L+ G  YIFRV 
Sbjct: 15200 CVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASE-VQVTKLKVTKLLKGNEYIFRVM 15258

Query: 813   AVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGY 872
             AVN  G+ E   +SE +       PP PP +       +DSMV+ W  PD  GG+EI  Y
Sbjct: 15259 AVNKYGVGE-PLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINY 15317

Query: 873   YVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSEC 932
              V  R   D    +W + N K +++  YK+S L E   Y+F++ A N AG+ APS  S  
Sbjct: 15318 IVERR---DKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPF 15374

Query: 933   FKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWR 992
             +K  + T+  PGPP + +  +  + S+ + W  P++ G + +TGY V++  A  +ED+W+
Sbjct: 15375 YKACD-TVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEI--ALPEEDEWQ 15431

Query: 993   GLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVN 1051
              +   A +K     + GL E   Y  R+ A+N  G+G+P+ + G   AE R    E+ ++
Sbjct: 15432 IVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELD 15491

Query: 1052  VDDDGVISLNFECD-------KMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDL 1104
              D   V+++   C        K  P  E  W++D+  + D  +  +ES  + T +   ++
Sbjct: 15492 ADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLD--KASIESTSSYTLLIVGNV 15549

Query: 1105  GMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQV 1164
                D G Y   V ++ G  S+++             +     T     +L V+ + K  V
Sbjct: 15550 NRFDSGKYILTVENSSGSKSAFV-------------NVRVLDTPGPPQDLKVKEVTKTSV 15596

Query: 1165  RFWMQAEKLSGNAKV-NYIFNEKE 1187
                     L G +K+ NYI  ++E
Sbjct: 15597 TLTWDPPLLDGGSKIKNYIVEKRE 15620



 Score =  201 bits (510), Expect = 6e-51
 Identities = 176/628 (28%), Positives = 265/628 (42%), Gaps = 84/628 (13%)

Query: 508   GAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFA 567
             G P  P   +     K+   +SWK+P  DGGS I GY +++ E  +  W +   TPV   
Sbjct: 14198 GPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDL 14257

Query: 568   RFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIV 627
             R  VTGL EG +Y FRV A N+ GIG PS  S+ V   D A                   
Sbjct: 14258 RCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYP----------------- 14300

Query: 628   TEEEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRV 686
                       PGPP++  VT+ T+    L+W KP    G E   Y VE  + G E W + 
Sbjct: 14301 ----------PGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKD 14350

Query: 687   NTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKII 746
              T   ++  +F + DL   + Y FR+   N AGVGEP+   +V +V  ++    AP   +
Sbjct: 14351 TTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREM----APDFEL 14406

Query: 747   PSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSR------FT--- 797
              +    T VV +    +     +   I+   A    W   N N    +       FT   
Sbjct: 14407 DAELRRTLVVRAGLSIR-----IFVPIKGRPAPEVTWTKDNINLKNRANIENTESFTLLI 14461

Query: 798   ---CHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSM 854
                C+   TG+   F +   N AG     + S  + V+  +  P P  ++   +  +DS+
Sbjct: 14462 IPECNRYDTGK---FVMTIENPAG-----KKSGFVNVRV-LDTPGPVLNLRPTDITKDSV 14512

Query: 855   VLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQ 914
              L W  P   GG+ IT Y V  RE        +  A  K   +  YK++ L E   Y F+
Sbjct: 14513 TLHWDLPLIDGGSRITNYIVEKREA---TRKSYSTATTKC-HKCTYKVTGLSEGCEYFFR 14568

Query: 915   VAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPV 974
             V A N  G+G P+  +E  K  E     P PP SL   ++ K ++ L W  P H G + +
Sbjct: 14569 VMAENEYGIGEPTETTEPVKASE----APSPPDSLNIMDITKSTVSLAWPKPKHDGGSKI 14624

Query: 975   TGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLA 1034
             TGY ++ +  +   DQW  +    +K +   VR L EG  Y F+V A+N AG   P + +
Sbjct: 14625 TGYVIEAQ--RKGSDQWTHI--TTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRE-S 14679

Query: 1035  GPVVAETRPGTKE----------VVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTED 1084
              PV+ + +    E          V+    D+  + +        PK   +W K     + 
Sbjct: 14680 RPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPV---LGRPKPTVTWKKGDQILKQ 14736

Query: 1085  SPRLEVESKGNKTKMTFKDLGMDDLGIY 1112
             + R+  E+    T +   +    D G Y
Sbjct: 14737 TQRVNFETTATSTILNINECVRSDSGPY 14764



 Score =  200 bits (508), Expect = 1e-50
 Identities = 160/609 (26%), Positives = 255/609 (41%), Gaps = 68/609 (11%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P + W +    L    +V T  +  R +LT  + N+ D G YT+ ++        +  V 
Sbjct: 19844 PNVLWSKPDTDLRTRAYVDT--TDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVK 19901

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V D        P  P ++   +  K+  ++SW  P  DGG+P+  Y I+K E    +W  
Sbjct: 19902 VLDT-------PGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKREASKKAWVS 19954

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
               +   + + + VT L EG  Y FRV   N+ G+G P+   E V                
Sbjct: 19955 VTNNCNRLS-YKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVK--------------- 19998

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCE 677
                     +TE+       P PP  L VT  ++  V L+W KP    G   + Y VE  E
Sbjct: 19999 --------ITEK-------PSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALE 20043

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
              G +NW +       KS    +  L E   Y FRV   N AG+ +P E     ++ ++L+
Sbjct: 20044 KGQKNWVKCAV---AKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLE 20100

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFT 797
              P+   K  PS    T  V +    K    + G  +   V  S    P        +  T
Sbjct: 20101 PPEIDMKNFPSH---TVYVRAGSNLKVDIPISGKPL-PKVTLSRDGVPLKATMRFNTEIT 20156

Query: 798   CHGL-------VTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESF 850
                L       VT  +  + + A N++G ++       I +     P  P   +   +  
Sbjct: 20157 AENLTINLKESVTADAGRYEITAANSSGTTK-----AFINIVVLDRPGPPTGPVVISDIT 20211

Query: 851   RDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMV 910
              +S+ L W+ P   GG+++T Y +  RE    V   W E +   V+    K+  L     
Sbjct: 20212 EESVTLKWEPPKYDGGSQVTNYILLKRETSTAV---WTEVSA-TVARTMMKVMKLTTGEE 20267

Query: 911   YQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSG 970
             YQF++ A N  G+     +       +     PGPP +   + V ++S+ + W  PV +G
Sbjct: 20268 YQFRIKAENRFGIS--DHIDSACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNG 20325

Query: 971   RTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKP 1030
              + V GY +++K+  +    W+  N+  I+  + KV  +  G+ Y FRV A N AGVGKP
Sbjct: 20326 GSAVVGYHLEMKDRNS--ILWQKANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVGKP 20383

Query: 1031  SDLAGPVVA 1039
             S  + PV+A
Sbjct: 20384 SHPSEPVLA 20392



 Score =  199 bits (505), Expect = 2e-50
 Identities = 216/935 (23%), Positives = 382/935 (40%), Gaps = 106/935 (11%)

Query: 523   KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIF 582
             ++ I + W +P  DGGS I GY ++K ++    W + + T V   +F V+GL E + Y F
Sbjct: 17162 RNEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEF 17221

Query: 583   RVRAVNKMG-IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPP 641
             RV A N  G I  PS  + P+ A D  E  R+   P    T  +   E    E  V G P
Sbjct: 17222 RVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKP 17281

Query: 642   TDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFD 701
                           + W    +   E       +CE    +++ +   L VK        
Sbjct: 17282 LP-----------TIEWLRGDKEIEESA-----RCEIKNTDFKAL---LIVKDAI----- 17317

Query: 702   LAEGKSYCFRVRCSNSAGVGEPSEATEVTV-VGDKLDIPKAPGKIIPSRNTDTSVVVSWE 760
               +G  Y   +R SN AG    S++  V V V D+   P+ P ++    +   S+  S  
Sbjct: 17318 RIDGGQYI--LRASNVAG----SKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPP 17371

Query: 761   ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLS 820
                   ++  Y +E        W    +  V  S      L+ G  Y+FR+ AVN  G+ 
Sbjct: 17372 LQDGGSDISHYVVEKRETSRLAWTVVASEVVTNS-LKVTKLLEGNEYVFRIMAVNKYGVG 17430

Query: 821   EYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVI 880
             E   +S  + +K     P PP  +      +DSM + W +PD  GG+EI GY V  R+  
Sbjct: 17431 E-PLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDR- 17488

Query: 881   DGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTI 940
              G+  +W + N + +++   +++ L E+  Y+F+V+A N AG+G PS  +  +K  +  +
Sbjct: 17489 SGI--RWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACD-PV 17545

Query: 941   AVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN-EAAI 999
               PGPP +    +  K+S+ L W  P++ G + + GY V++   KA E++W+ +  +  +
Sbjct: 17546 FKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEI--CKADEEEWQIVTPQTGL 17603

Query: 1000  KNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKE----------VV 1049
             +    ++  L E   Y  RV A+N+ G+G+ + + G V  E +    E          +V
Sbjct: 17604 RVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIV 17663

Query: 1050  VNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDL 1109
             V       I + F   K  P  E +WS++    E + ++++E   N T+++  +   +D 
Sbjct: 17664 VRAGGSARIHIPF---KGRPTPEITWSRE--EGEFTDKVQIEKGVNYTQLSIDNCDRNDA 17718

Query: 1110  GIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQ 1169
             G Y   + ++ G  S+++  +                T      LAV+ + K       +
Sbjct: 17719 GKYILKLENSSGSKSAFVTVK-------------VLDTPGPPQNLAVKEVRKDSAFLVWE 17765

Query: 1170  AEKLSGNAKV-NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGK 1228
                + G AKV NY+ +++E     K   ++          +E L   +   Y F++    
Sbjct: 17766 PPIIDGGAKVKNYVIDKRE--STRKAYANVSSKCSKTSFKVENL--TEGAIYYFRVMAEN 17821

Query: 1229  ATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIK 1288
                    V   D  K  +               P     ++     + +  L  +     
Sbjct: 17822 EFGVGVPVETVDAVKAAEP--------------PSPPGKVTLTDVSQTSASLMWEKPEHD 17867

Query: 1289  KETHIVWYKDEREISVDEKHDF--KDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLK 1346
               + ++ Y  E +    EK     +  +C  ++T  S      + V   +++GK   R+ 
Sbjct: 17868 GGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVL 17927

Query: 1347  LVDEAFKELMMEVCKKIAL------SATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNG 1400
              V    K+L ++   K+        +  DLKI+    G    +          ++W  +G
Sbjct: 17928 GVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPN----------ISWVKDG 17977

Query: 1401  SAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVM 1435
               ++ + RV    T     L I E   +D GKY +
Sbjct: 17978 EPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTV 18012



 Score =  198 bits (503), Expect = 4e-50
 Identities = 166/618 (26%), Positives = 260/618 (42%), Gaps = 78/618 (12%)

Query: 526   IIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQC-NDTPVKFARFPVTGLIEGRSYIFRV 584
             I ++W +P  DGGS I  Y +++ E  +  W +  +  P+   RF VTGL EG  Y F V
Sbjct: 21796 ITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHV 21855

Query: 585   RAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDL 644
              A N  G+G  S +S  +   +P                              PGPPT +
Sbjct: 21856 MAENAAGVGPASGISRLIKCREPVNP---------------------------PGPPTVV 21888

Query: 645   SVTEATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLA 703
              VT+ +++ V L W KP    G E I Y +E C+A   +W +VN E  VK+ R+ + DL 
Sbjct: 21889 KVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKT-RYTVTDLQ 21947

Query: 704   EGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESK 763
              G+ Y FRV   N AG G+  E T      D+L  P+     I +    T VV       
Sbjct: 21948 AGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELD---IDANFKQTHVV---RAGA 22001

Query: 764   DAKELVGYYIEASVAGSGKW-EPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEY 822
               +  + Y  +     +  W +P +N  ++    T     T       V   N     +Y
Sbjct: 22002 SIRLFIAY--QGRPTPTAVWSKPDSNLSLRADIHTTDSFST-----LTVENCNRNDAGKY 22054

Query: 823   SQDSEAIEVKAAIA-------PPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVN 875
             +   E      +I         P PP  IT  +  R S  L W  P   GGA I  Y V 
Sbjct: 22055 TLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVE 22114

Query: 876   YREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKC 935
              RE        W+  + K  + + +K+++L E + Y F+V+A+N  G+G P  + E    
Sbjct: 22115 KRE---ASRRSWQVISEKC-TRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVA 22170

Query: 936   EEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLN 995
              E     P PP  L   +  K S VL W  P H G + +TGY +++++  +  D W  + 
Sbjct: 22171 TE----QPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGS--DFW--VE 22222

Query: 996   EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDD 1055
                 K +   V  L E   Y FRV+A N AG  +P +    V+ +      ++    D  
Sbjct: 22223 AGHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIK----EPQIEPTADLT 22278

Query: 1056  GVISLNFECDKMT-----------PKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDL 1104
             G+ +    C   +           P  + +W  + +  +++ R+ + +  ++T +T KD 
Sbjct: 22279 GITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDS 22338

Query: 1105  GMDDLGIYSCDVTDTDGI 1122
                D G Y   + +T G+
Sbjct: 22339 MRGDSGRYFLTLENTAGV 22356



 Score =  196 bits (499), Expect = 1e-49
 Identities = 180/631 (28%), Positives = 266/631 (42%), Gaps = 87/631 (13%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRV--RMGEYYEQYSAY 496
             P++ W + G+     K    L     A L   +  ++D G Y++ +    GE     + +
Sbjct: 12264 PKVTWRKVGIDNVVRKGQVDLVD-TMAFLVIPNSTRDDSGKYSLTLVNPAGEK----AVF 12318

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
             V VR  D      P    D+K  +  K    +SW  P  DGGS +  Y ++K E    +W
Sbjct: 12319 VNVRVLDT-----PGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTW 12373

Query: 557   SQCNDTP-VKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKS 615
             S    TP VK   F VT L+ G  Y FRV AVN+ G G P+ V +PV A DP  +     
Sbjct: 12374 STV--TPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPLSE----- 12426

Query: 616   RPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEK 675
                                   P PP  L VTE T++   L+W PP + G   I  ++  
Sbjct: 12427 ----------------------PDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITS 12464

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
                  +   R      VK     +  L EGK Y FRV   N+ GV  P EA  V    ++
Sbjct: 12465 YREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQ 12524

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAG----SGKWEPCNNNPV 791
             L  PK    ++P + T           K  K+L    IEA V G    + KW+   +  V
Sbjct: 12525 LLPPKI---LMPEQIT----------IKAGKKL---RIEAHVYGKPHPTCKWKKGEDEVV 12568

Query: 792   KGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSE----------AIEVKAAIAPPSPP 841
               S    H      S I  ++ V       YS  +E           + V  A  PP PP
Sbjct: 12569 TSSHLAVH--KADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPP 12626

Query: 842   CDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYK 901
              DI+ +++  D+  L W  P + GG+ IT Y V   E  D   G W  A + +V++ + +
Sbjct: 12627 FDISDIDA--DACSLSWHIPLEDGGSNITNYIV---EKCDVSRGDWVTA-LASVTKTSCR 12680

Query: 902   ISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVL 961
             +  L     Y F+V A N  G+  P  ++      ++   VP  P + + ++V KD + +
Sbjct: 12681 VGKLIPGQEYIFRVRAENRFGISEP--LTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFV 12738

Query: 962   QWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRA 1021
              W  P   G +P+ GY ++ KE  +    W   N+  +++      GL EG+ Y FR+ A
Sbjct: 12739 AWDRPDSDGGSPIIGYLIERKERNSL--LWVKANDTLVRSTEYPCAGLVEGLEYSFRIYA 12796

Query: 1022  INQAGVGKPSDLAGPVVAE---TRPGTKEVV 1049
             +N+AG   PS     V A      PG  EV+
Sbjct: 12797 LNKAGSSPPSKPTEYVTARMPVDPPGKPEVI 12827



 Score =  196 bits (499), Expect = 1e-49
 Identities = 171/629 (27%), Positives = 261/629 (41%), Gaps = 81/629 (12%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             PE+ W ++ + L     ++   S     L     N+ D G + + +       + S +V 
Sbjct: 14434 PEVTWTKDNINLKNRANIENTESF--TLLIIPECNRYDTGKFVMTIENPA--GKKSGFVN 14489

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             VR  D      P   L+++  +  KD + + W  P +DGGS I  Y ++K E    S+S 
Sbjct: 14490 VRVLDT-----PGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYST 14544

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
                T      + VTGL EG  Y FRV A N+ GIG P+  +EPV A +            
Sbjct: 14545 AT-TKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASE------------ 14591

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                                P PP  L++ + T+S V L+W  P   G   I  Y +E   
Sbjct: 14592 ------------------APSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQR 14633

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
              G++ W  + T   VK     + +L EG+ Y F+V   NSAG   P E+  V +V ++  
Sbjct: 14634 KGSDQWTHITT---VKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRPV-IVKEQTM 14689

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGK----WEPCNNNPVKG 793
             +P+     +  R     +V+       AK      +E  V G  K    W+  +    + 
Sbjct: 14690 LPE-----LDLRGIYQKLVI-------AKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQT 14737

Query: 794   SRFTCHGLVTGQSYIFRVRAVNAAGLSEY--------SQDSEAIEVKAAIAPPSPPCDIT 845
              R       T  S I  +     +    Y         +  + I ++    P  P   I 
Sbjct: 14738 QRVNFE--TTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIK 14795

Query: 846   CLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNL 905
               E   D +   W  P+  GG  I+ Y V  R+        W E     V    YK + L
Sbjct: 14796 FDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTT---WVEL-ATTVIRTTYKATRL 14851

Query: 906   KENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKP 965
                + YQF+V A N  G+G P   S C     +   VPGPP + + + V KDS+ + W  
Sbjct: 14852 TTGLEYQFRVKAQNRYGVG-PGITSACI-VANYPFKVPGPPGTPQVTAVTKDSMTISWHE 14909

Query: 966   PVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQA 1025
             P+  G +P+ GY V+ KE       W+ +++A +     K  GL +G++Y FRV A N A
Sbjct: 14910 PLSDGGSPILGYHVERKERNG--ILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMA 14967

Query: 1026  GVGKPSDLAGPVVA--ETRPGTKEVVVNV 1052
             G  KPS  + P++A     P  K V +N+
Sbjct: 14968 GKSKPSKPSEPMLALDPIDPPGKPVPLNI 14996



 Score =  195 bits (496), Expect = 3e-49
 Identities = 220/853 (25%), Positives = 345/853 (40%), Gaps = 123/853 (14%)

Query: 293   NVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRA 352
             + ++H    G P P +TW + +          K  IE       L I+ CD  D  +Y  
Sbjct: 17669 SARIHIPFKGRPTPEITWSREEGEFT-----DKVQIEKGVNYTQLSIDNCDRNDAGKYIL 17723

Query: 353   SAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFD 412
                N  G  SA+ +V V    G                     P   A + E+  D  F 
Sbjct: 17724 KLENSSGSKSAFVTVKVLDTPGP--------------------PQNLAVK-EVRKDSAF- 17761

Query: 413   VSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHL 472
                            +V  P I     +++ Y      S  K    + S + +  +F   
Sbjct: 17762 ---------------LVWEPPIIDGGAKVKNYVIDKRESTRKAYANV-SSKCSKTSFKVE 17805

Query: 473   NKEDEGLYTIRVRMGEYYEQYSAYVFVRDADA-EIEGAPAAPLDVKCLEANKDYIIISWK 531
             N  +  +Y  RV M E   ++   V V   DA +    P+ P  V   + ++    + W+
Sbjct: 17806 NLTEGAIYYFRV-MAE--NEFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASLMWE 17862

Query: 532   QPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMG 591
             +P  DGGS +LGY ++    GT+ WS   ++  K     VTGL  G+ Y FRV+A N+ G
Sbjct: 17863 KPEHDGGSRVLGYVVEMQPKGTEKWSIVAES--KVCNAVVTGLSSGQEYQFRVKAYNEKG 17920

Query: 592   IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATR 651
                P  +  PV A D   +  LK     P+           +  I  G    + +    R
Sbjct: 17921 KSDPRVLGVPVIAKDLTIQPSLK----LPFN----------TYSIQAGEDLKIEIPVIGR 17966

Query: 652   SYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCF- 710
                 +SW   G+                 +   RVN E    S    +  + EG    F 
Sbjct: 17967 PRPNISWVKDGEP---------------LKQTTRVNVEETATS---TVLHIKEGNKDDFG 18008

Query: 711   --RVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTS---VVVSWEESK-- 763
                V  +NSAG    +E   V V    L+ P  P  + P R  + S   VV+SWE     
Sbjct: 18009 KYTVTATNSAGTA--TENLSVIV----LEKPGPP--VGPVRFDEVSADFVVISWEPPAYT 18060

Query: 764   DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYS 823
                ++  Y +E     +  W   +   V  +      L TG  Y FR+ A N  G S   
Sbjct: 18061 GGCQISNYIVEKRDTTTTTWHMVSAT-VARTTIKITKLKTGTEYQFRIFAENRYGKSA-P 18118

Query: 824   QDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGV 883
              DS+A+ V+     P PP         +D M++ W +P   GG +I GY++  +E    +
Sbjct: 18119 LDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSIL 18178

Query: 884   PGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVP 943
                W + N   + +  +K + L E + Y+F+V+A N+ G+G PS VSECF   +     P
Sbjct: 18179 ---WVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARD-PCDPP 18234

Query: 944   GPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVY 1003
             G P ++    + ++++ L+WK P + G + +TGY V+ K+    + +W   +   +    
Sbjct: 18235 GRPEAI---VITRNNVTLKWKKPAYDGGSKITGYIVEKKD--LPDGRWMKASFTNVLETE 18289

Query: 1004  LKVRGLKEGVSYVFRVRAINQAG-VGKPSDLAGPVVAETR---------PGTKEV-VVNV 1052
               V GL E   Y FRV A N AG   +PSD +G + A            P  K+V VV+ 
Sbjct: 18290 FTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHA 18349

Query: 1053  DDDGVISLNFECDKMTPKSEFSWSKDYVSTED-SPRLEVESKGNKTKMTFKDLGMDDLGI 1111
              +  V+  +    +  P  +  WSKD    E+ + R+E++S   KT +  KD    D G 
Sbjct: 18350 GETFVLEADI---RGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQ 18406

Query: 1112  YSCDVTDTDGIAS 1124
             Y   +++  G  S
Sbjct: 18407 YILKLSNVGGTKS 18419



 Score =  194 bits (494), Expect = 4e-49
 Identities = 217/923 (23%), Positives = 361/923 (39%), Gaps = 143/923 (15%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTL-EINGCDFEDTAQY 350
             E +K++  IAG P P ++W K+ + I   A       ++    HTL  +  C   DT QY
Sbjct: 19433 EVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDN----HTLLTVKDCIRRDTGQY 19488

Query: 351   RASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF-GVTPYGYASRFEIHFDD 409
               +  NV G  S   +  V       D+    AG    PL   G+T             +
Sbjct: 19489 VLTLKNVAGTRSVAVNCKV------LDKPGPPAG----PLEINGLTA------------E 19526

Query: 410   KFDVSFGREGET--MSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGE--RA 465
             K  +S+GR  E     +   +V   E  H    + W              T+  GE    
Sbjct: 19527 KCSLSWGRPQEDGGADIDYYIVEKRETSH----LAW--------------TICEGELQMT 19568

Query: 466   TLTFSHLNKEDEGLYTI----RVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEA 521
             +   + L K +E ++ +    +  +GE  E     V ++  D      P+ P  ++    
Sbjct: 19569 SCKVTKLLKGNEYIFRVTGVNKYGVGEPLES----VAIKALDPFT--VPSPPTSLEITSV 19622

Query: 522   NKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYI 581
              K+ + + W +P  DGGS I GY I++ E  +  W + N  PV   R   TGL EG  Y 
Sbjct: 19623 TKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYE 19682

Query: 582   FRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPP 641
             +RV A N  G+  PS  S  + A DP                             +P PP
Sbjct: 19683 YRVYAENAAGLSLPSETSPLIRAEDPV---------------------------FLPSPP 19715

Query: 642   TDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALF 700
             +   + ++ ++ + ++W  P   G   I  Y VE  ++   +W+     L  +   + + 
Sbjct: 19716 SKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTSIQSL--RGTEYTIS 19773

Query: 701   DLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE 760
              L  G  Y FRV+  N  G  +PS++++  +  ++ + P      I S    T +V +  
Sbjct: 19774 GLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFD---IDSEMRKTLIVKA-- 19828

Query: 761   ESKDAKELVGYYIEASVAGSGKWEP--CNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAG 818
                      G     +V   G+  P    + P    R   +   T       +   N   
Sbjct: 19829 ---------GASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRTSLTIENANRND 19879

Query: 819   LSEYSQDSEAIEVKAAIA-------PPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITG 871
               +Y+   + +   A++         P PP +IT  +  ++S VL W  P+  GGA +  
Sbjct: 19880 SGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKN 19939

Query: 872   YYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSE 931
             Y++  RE        W        +  +YK++NL+E  +Y F+V+  N  G+G P+   E
Sbjct: 19940 YHIEKREASKKA---WVSVTNNC-NRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKE 19995

Query: 932   CFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQW 991
               K  E     P PP  L  + + KDS+ L W  P H G + +  Y V+  E   K   W
Sbjct: 19996 GVKITE----KPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKN--W 20049

Query: 992   RGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVN 1051
               +  A  K+ +  V GL+E   Y FRV A NQAG+  P +L  PV+ + +    E+ + 
Sbjct: 20050 --VKCAVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMK 20107

Query: 1052  VDDDGVISL----NFECD---KMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDL 1104
                   + +    N + D      P  + + S+D V  + + R   E       +  K+ 
Sbjct: 20108 NFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKES 20167

Query: 1105  GMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQV 1164
                D G Y     ++ G   +++        ++ L      P  P    +  +I E+   
Sbjct: 20168 VTADAGRYEITAANSSGTTKAFI-------NIVVLDR----PGPPTGPVVISDITEESVT 20216

Query: 1165  RFWMQAEKLSGNAKVNYIFNEKE 1187
               W   +   G+   NYI  ++E
Sbjct: 20217 LKWEPPKYDGGSQVTNYILLKRE 20239



 Score =  194 bits (492), Expect = 7e-49
 Identities = 176/650 (27%), Positives = 280/650 (43%), Gaps = 84/650 (12%)

Query: 432   PEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHL---NKEDEGLYTIRVR--M 486
             P I   +P I W ++G PL  +  V      E AT T  H+   NK+D G YT+      
Sbjct: 17962 PVIGRPRPNISWVKDGEPLKQTTRVNV---EETATSTVLHIKEGNKDDFGKYTVTATNSA 18018

Query: 487   GEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFI 546
             G   E  S  V       E  G P  P  V+  E + D+++ISW+ PA  GG  I  Y +
Sbjct: 18019 GTATENLSVIVL------EKPGPPVGP--VRFDEVSADFVVISWEPPAYTGGCQISNYIV 18070

Query: 547   DKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALD 606
             +K +  T +W   + T V      +T L  G  Y FR+ A N+ G               
Sbjct: 18071 EKRDTTTTTWHMVSAT-VARTTIKITKLKTGTEYQFRIFAENRYG--------------- 18114

Query: 607   PAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQRG 665
                        SAP   + ++ +    E   PGPP    VT  ++  +++ W +P    G
Sbjct: 18115 ----------KSAPLDSKAVIVQYPFKE---PGPPGTPFVTSISKDQMLVQWHEPVNDGG 18161

Query: 666   HEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSE 725
              + I Y +E+ E  +  W ++N + P++  +F    L EG  Y F+V   N  G+G+PS+
Sbjct: 18162 TKIIGYHLEQKEKNSILWVKLN-KTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSK 18220

Query: 726   ATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKW 783
              +E  V  D  D P  P  I+ +RN   +V + W++       ++ GY +E      G+W
Sbjct: 18221 VSECFVARDPCDPPGRPEAIVITRN---NVTLKWKKPAYDGGSKITGYIVEKKDLPDGRW 18277

Query: 784   EPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIAPPSPPC 842
                +   V  + FT  GLV  Q Y FRV A NAAG  SE S  S AI  +  I  P+   
Sbjct: 18278 MKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASL 18337

Query: 843   DITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKI 902
             D      ++D +V+        G   +    +  + + D V  K  +   +  +    K 
Sbjct: 18338 D----PKYKDVIVV------HAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKS 18387

Query: 903   SNLKENMVYQFQVAA------MNMAGLGAPSAVSECFKCEEWTIAVPGPPHS-LKCSEVR 955
             +  K  +V +  +        + ++ +G   ++    K     +  PGPP   LK + V 
Sbjct: 18388 TIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVK----VLDRPGPPEGPLKVTGVT 18443

Query: 956   KDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSY 1015
              +   L W PP+  G   ++ Y ++ +E       W  ++   ++ +  KV  L  G  Y
Sbjct: 18444 AEKCYLAWNPPLQDGGANISHYIIEKRETSRL--SWTQVS-TEVQALNYKVTKLLPGNEY 18500

Query: 1016  VFRVRAINQAGVGKPSDLAGPVVA------ETRPGTKEVVVNVDDDGVIS 1059
             +FRV A+N+ G+G+P + +GPV A         P T EV     D  V++
Sbjct: 18501 IFRVMAVNKYGIGEPLE-SGPVTACNPYKPPGPPSTPEVSAITKDSMVVT 18549



 Score =  192 bits (488), Expect = 2e-48
 Identities = 219/892 (24%), Positives = 362/892 (40%), Gaps = 103/892 (11%)

Query: 367   VVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKF-DVSFGREGETMSLG 425
             V+ +   G F E    +GA        +T            D K+ DV     GET  L 
Sbjct: 18305 VIARNAAGNFSEPSDSSGA--------ITARDEIDAPNASLDPKYKDVIVVHAGETFVLE 18356

Query: 426   CRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSG-ERATLTFSHLNKEDEGLYTIRV 484
               +   P      P++ W ++G  L  +     + S  ++ TL      + D G Y +++
Sbjct: 18357 ADIRGKPI-----PDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKL 18411

Query: 485   RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGY 544
                   +     V V D      G P  PL V  + A K Y+  +W  P  DGG+ I  Y
Sbjct: 18412 SNVGGTKSIPITVKVLDRP----GPPEGPLKVTGVTAEKCYL--AWNPPLQDGGANISHY 18465

Query: 545   FIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAA 604
              I+K E    SW+Q + T V+   + VT L+ G  YIFRV AVNK GIG P   S PV A
Sbjct: 18466 IIEKRETSRLSWTQVS-TEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLE-SGPVTA 18523

Query: 605   LDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSW-KPPGQ 663
              +P +                            PGPP+   V+  T+  +V++W +P   
Sbjct: 18524 CNPYKP---------------------------PGPPSTPEVSAITKDSMVVTWARPVDD 18556

Query: 664   RGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEP 723
              G E   Y +EK +     W + N +  +   R  +  L EG SY FRV   N+AGVGEP
Sbjct: 18557 GGTEIEGYILEKRDKEGVRWTKCNKK-TLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEP 18615

Query: 724   SEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSG 781
             SE +      D L  P  P     +  + +SV ++W +        + GY +E   A + 
Sbjct: 18616 SEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAAD 18675

Query: 782   KWEPCN-NNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSP 840
             +W  C     ++G +FT   L     Y FR+ A+N+ G+ E +    ++  +  I PP  
Sbjct: 18676 EWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEI 18735

Query: 841   PCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPG---KWREA----NVK 893
               D       R  +VL          A  T   +     I G P    KW +A      +
Sbjct: 18736 ELD----ADLRKVVVL---------RASAT---LRLFVTIKGRPEPEVKWEKAEGILTDR 18779

Query: 894   AVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSE 953
             A  E     + L  + V +F     N+  L   S     F      +  P  P +L   E
Sbjct: 18780 AQIEVTSSFTMLVIDNVTRFDSGRYNLT-LENNSGSKTAF-VNVRVLDSPSAPVNLTIRE 18837

Query: 954   VRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGV 1013
             V+KDS+ L W+PP+  G   +T Y V+ +E   K   +  +     K  + ++  L+EG 
Sbjct: 18838 VKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRK--AYATITNNCTKTTF-RIENLQEGC 18894

Query: 1014  SYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVD-DDGVISLNFECDKMTPKSE 1072
             SY FRV A N+ G+G P++   PV     P     V  VD      ++ +E  +    S+
Sbjct: 18895 SYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSK 18954

Query: 1073  FSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEE 1132
              +     + T+ S +    ++    + T   L   +  ++     +  G +    +    
Sbjct: 18955 ITGYVVEMQTKGSEKWSTCTQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPV 19014

Query: 1133  LKRLLALSHEHKFP----TVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEI 1188
             + R + +    + P     V  + +L +++  KG+ +           A VN+  + + +
Sbjct: 19015 IARDIEIKPSVELPFHTFNVKAREQLKIDVPFKGRPQ-----------ATVNWRKDGQTL 19063

Query: 1189  FEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQD--GKATNHSTVVLV 1238
              E    ++++  +  +  + +++   ED GTY   + +  G  T   T++++
Sbjct: 19064 KE--TTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVL 19113



 Score =  191 bits (486), Expect = 4e-48
 Identities = 192/782 (24%), Positives = 299/782 (38%), Gaps = 153/782 (19%)

Query: 290   EKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQ 349
             E  N +L   I G P P V+W K + P+   A   +  +ES     TL +  C   D  +
Sbjct: 13624 ENSNFRLKIPIKGKPAPSVSWKKGEDPL---ATDTRVSVESSAVNTTLIVYDCQKSDAGK 13680

Query: 350   YRASAMNVKGELSAYASVVVKRYKG------EFDETRFHA-------------------- 383
             Y  +  NV G      S+ V    G      +FDE    A                    
Sbjct: 13681 YTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYI 13740

Query: 384   --------------GASTMPLSFGVTPY--GYASRFEIHFDDKFDVSFGREGETMSLGCR 427
                            ++    +F VT    G    F +  ++K+ V  G + E +     
Sbjct: 13741 LEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHP 13800

Query: 428   VVITP--------EIKHFQPEIQWY----RNGVPLSPSKWVQTLWSGERATLTFSHLNKE 475
               +          +++H    + W       G P++       L   ER +L +   NK 
Sbjct: 13801 FDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYH----LEFKERNSLLWKRANKT 13856

Query: 476   DEGLYTIRV----RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDV-------KCLEANKD 524
                +   +V       EY  +  A          +   P   LD        + +   ++
Sbjct: 13857 PIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITRN 13916

Query: 525   YIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRV 584
              + + W +P  DGG  + GY ++K ++ + SW + N   V    F VT L+EG  Y FR+
Sbjct: 13917 SVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRI 13976

Query: 585   RAVNKMG-IGFPSRVSE----------PVAALDPAEKARL-----------------KSR 616
             RA N  G I  PS  +E          P   LDP  K  L                 K  
Sbjct: 13977 RAKNTAGAISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPL 14036

Query: 617   PSAPWT---------------------------------GQIIVTEEEPS----EGI--- 636
             P + W+                                 G+  +T   P     E +   
Sbjct: 14037 PKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVT 14096

Query: 637   ---VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPV 692
                VPGPP  + ++  +     L+W PP + G   I  Y +EK E     W  V+ +  +
Sbjct: 14097 VLDVPGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSED--I 14154

Query: 693   KSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTD 752
             +S R     L +G  Y FRV   N  G GEP ++  V +V D+   P  P K   S  T 
Sbjct: 14155 QSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQSEPVKMV-DRFGPPGPPEKPEVSNVTK 14213

Query: 753   TSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFR 810
              +  VSW+   D    E+ GY++E     S +W      PV   R    GL  G +Y FR
Sbjct: 14214 NTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFR 14273

Query: 811   VRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEIT 870
             V A N AG+   S+ S+++ +K A  PP PP +    ++ + S  L W +P   GG EIT
Sbjct: 14274 VSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEIT 14333

Query: 871   GYYVNYREVIDGVPGKW-REANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAV 929
             GY V +++V D     W ++    A+    + + +L+    Y F+++A+N AG+G P+ +
Sbjct: 14334 GYVVEHQKVGDEA---WIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVI 14390

Query: 930   SE 931
              +
Sbjct: 14391 PD 14392



 Score =  190 bits (482), Expect = 1e-47
 Identities = 163/618 (26%), Positives = 264/618 (42%), Gaps = 62/618 (10%)

Query: 526   IIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVR 585
             + + W +P  DGG+ I GY +++ E+    W +CN T ++   F VT L E + Y FRV 
Sbjct: 19329 VSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVF 19388

Query: 586   AVNKM-GIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDL 644
             A N    +  PS  + P+   D  E  R+       +   I+V           G    +
Sbjct: 19389 ARNAADSVSEPSESTGPIIVKDDVEPPRVMM--DVKFRDVIVVKA---------GEVLKI 19437

Query: 645   SVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAE 704
             +   A R   V+SW                  + G E  +R  TE+ + +    L  + +
Sbjct: 19438 NADIAGRPLPVISW-----------------AKDGIEIEERARTEI-ISTDNHTLLTVKD 19479

Query: 705   GKSYCFRVRCSNSAGVGEPSEATEVTVVGDK-LDIPKAP-GKIIPSRNTDTSVVVSW-EE 761
                 C R          +    T    V  K LD P  P G +  +  T     +SW   
Sbjct: 19480 ----CIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRP 19535

Query: 762   SKDAKELVGYYI-EASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLS 820
              +D    + YYI E        W  C    ++ +      L+ G  YIFRV  VN  G+ 
Sbjct: 19536 QEDGGADIDYYIVEKRETSHLAWTICEGE-LQMTSCKVTKLLKGNEYIFRVTGVNKYGVG 19594

Query: 821   EYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVI 880
             E   +S AI+       PSPP  +      ++SM L W +P+  GG+EI+GY +  RE  
Sbjct: 19595 E-PLESVAIKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSEISGYIIERREKN 19653

Query: 881   DGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTI 940
                  +W   N K V +   K + L+E   Y+++V A N AGL  PS  S   + E+  +
Sbjct: 19654 SL---RWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAED-PV 19709

Query: 941   AVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIK 1000
              +P PP   K  +  K ++ + W  P+  G  P+TGY V+ K  K+ +  W+  +  +++
Sbjct: 19710 FLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYK--KSDDTDWK-TSIQSLR 19766

Query: 1001  NVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPG----------TKEVVV 1050
                  + GL  G  YVFRV+++N+ G   PSD + P +A+ R             K ++V
Sbjct: 19767 GTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIV 19826

Query: 1051  NVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLG 1110
                    +++ F   +  P     WSK    T+   R  V++  ++T +T ++   +D G
Sbjct: 19827 KAGASFTMTVPF---RGRPVPNVLWSKP--DTDLRTRAYVDTTDSRTSLTIENANRNDSG 19881

Query: 1111  IYSCDVTDTDGIASSYLI 1128
              Y+  + +    AS  L+
Sbjct: 19882 KYTLTIQNVLSAASLTLV 19899



 Score =  189 bits (481), Expect = 1e-47
 Identities = 203/854 (23%), Positives = 338/854 (39%), Gaps = 114/854 (13%)

Query: 294   VKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRAS 353
             V+    I G P P   W  +   I    +   Y +E+      L I  C   DT +Y+ +
Sbjct: 11156 VRFPAIIRGVPVPTAKWTTDGSEIKTDEH---YTVETDNFSSVLTIKNCLRRDTGEYQIT 11212

Query: 354   AMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF-GVTPYGYASRFEIHFDDKFD 412
               N  G  +    + V    G            T P++   VTP                
Sbjct: 11213 VSNAAGSKTVAVHLTVLDVPGP----------PTGPINILDVTP---------------- 11246

Query: 413   VSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHL 472
                    E M++  +    P+     P I +           W        +  L   HL
Sbjct: 11247 -------EHMTISWQ---PPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHL 11296

Query: 473   NKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQ 532
              K  E  Y  RVR                        P+ P      +  ++   +SW  
Sbjct: 11297 QKGCE--YVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTL 11354

Query: 533   PAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGI 592
             P  DGGSPI GY++++ EV T  W + N TP+   +F VTGL EG +Y FRV A N  G+
Sbjct: 11355 PKSDGGSPITGYYMERREV-TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGL 11413

Query: 593   GFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRS 652
               PS  S+P+ A           RP  P                 PGPP +  + + +R 
Sbjct: 11414 SKPSPSSDPIKAC----------RPIKP-----------------PGPPINPKLKDKSRE 11446

Query: 653   YVVLSWKPPGQRGHEGIMYFVEKCEA-GTENWQRVNTELPVKSPRFALFDLAEGKSYCFR 711
                L W  P   G   I+ +V +C+  GT  W R+N +  ++   F +  L EG  Y FR
Sbjct: 11447 TADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFR 11506

Query: 712   VRCSNSAGVGEPSEATEVTVVGDKLDIPKAP-----GKIIPSRNTDTSVVVSWEESKDAK 766
             ++ +N  G GEP E  E  +  D L  P+         +I  R   T  +++  + +   
Sbjct: 11507 IKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEP 11566

Query: 767   ELVGYYIEASVAGSGKWEPCNNNP-----VKGSRFTCHGLVTGQSYIFRVRAVNAAGLSE 821
             ++        +    + +   + P     +K +    HG      YI     ++A   S 
Sbjct: 11567 DITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHG-----KYI-----ISAKNSSG 11616

Query: 822   YSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVID 881
             ++Q S  + V   +  P P  ++      +++  + W+ P   GG+EIT + V YR+   
Sbjct: 11617 HAQGSAIVNV---LDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRK--- 11670

Query: 882   GVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIA 941
               P +   + V +   +    +NL  N  Y F+V A N  G+G P+  ++        I 
Sbjct: 11671 --PNQKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVG-PTIETKTPILAINPID 11727

Query: 942   VPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKN 1001
              PG P +L  ++  K  + L+W+ P + G +P   Y V+ +  K  +D W  +++ +IK 
Sbjct: 11728 RPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVE-RRLKGSDD-WERVHKGSIKE 11785

Query: 1002  VYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVIS-- 1059
              +  V    E   Y FRV+  N+ G    SD         +   ++ V+++   GV++  
Sbjct: 11786 THYMVDRCVENQIYEFRVQTKNEGG---ESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVK 11842

Query: 1060  ----LNFECD-KMTPKSEFSWSKDYVSTE--DSPRLEVESKGNKTKMTFKDLGMDDLGIY 1112
                 +  E   +  P  E +W+KD  +T+   SPR++++++ + +K +       D G Y
Sbjct: 11843 AGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKY 11902

Query: 1113  SCDVTDTDGIASSY 1126
                 T+T G   +Y
Sbjct: 11903 VVTATNTAGSFVAY 11916



 Score =  189 bits (481), Expect = 1e-47
 Identities = 170/620 (27%), Positives = 261/620 (42%), Gaps = 78/620 (12%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVR--MGEYYEQYSAY 496
             P+  W + G  + PS   Q   +   + LT  +  ++D G YTI      G   E     
Sbjct: 14037 PKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVT 14096

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
             V       ++ G P  P+++  + A K    ++W  P  DGGSPI  Y ++K E     W
Sbjct: 14097 VL------DVPGPPG-PVEISNVSAEK--ATLTWTPPLEDGGSPIKSYILEKRETSRLLW 14147

Query: 557   SQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSR 616
             +  ++  ++  R   T LI+G  YIFRV AVN  G G P + SEPV  +D       +  
Sbjct: 14148 TVVSE-DIQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQ-SEPVKMVD-------RFG 14198

Query: 617   PSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEK 675
             P                    PGPP    V+  T++   +SWK P   G   I  Y VE+
Sbjct: 14199 P--------------------PGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVER 14238

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
              E  +  W R   + PV   R  +  L EG +Y FRV   N AG+G PSEA++  ++ D 
Sbjct: 14239 REKKSLRWVRA-IKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDA 14297

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKW-EPCNNNPVK 792
                P  P     +  T  S  ++W +       E+ GY +E    G   W +      ++
Sbjct: 14298 AYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALR 14357

Query: 793   GSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRD 852
              ++F    L T + Y FR+ A+N AG+ E +   +   V+  +AP     D       R 
Sbjct: 14358 ITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAP-----DFELDAELRR 14412

Query: 853   SMVLGWKQPDKIGGAEITGYYVNYREVIDGVPG---KWREANVKAVSE------EAYKIS 903
             ++V+              G  +     I G P     W + N+   +       E++ + 
Sbjct: 14413 TLVVR------------AGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESFTLL 14460

Query: 904   NLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQW 963
              + E   Y      M +     P+     F      +  PGP  +L+ +++ KDS+ L W
Sbjct: 14461 IIPECNRYDTGKFVMTIEN---PAGKKSGF-VNVRVLDTPGPVLNLRPTDITKDSVTLHW 14516

Query: 964   KPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAIN 1023
               P+  G + +T Y V+ +EA  K   +        K  Y KV GL EG  Y FRV A N
Sbjct: 14517 DLPLIDGGSRITNYIVEKREATRK--SYSTATTKCHKCTY-KVTGLSEGCEYFFRVMAEN 14573

Query: 1024  QAGVGKPSDLAGPVVAETRP 1043
             + G+G+P++   PV A   P
Sbjct: 14574 EYGIGEPTETTEPVKASEAP 14593



 Score =  189 bits (480), Expect = 2e-47
 Identities = 175/614 (28%), Positives = 265/614 (43%), Gaps = 107/614 (17%)

Query: 462  GERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEA 521
            G ++ L      ++D G Y I         +++A      A  E+   P   LD+K +  
Sbjct: 8784 GTKSELIIKDALRKDHGRYVITAT-NSCGSKFAA------ARVEVFDVPGPVLDLKPVVT 8836

Query: 522  NKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYI 581
            N+   +++W  P  DGGS I G+ I++ +    +W Q  +T  + ++  +TGL+EG+ Y 
Sbjct: 8837 NRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIET--ERSKCDITGLLEGQEYK 8894

Query: 582  FRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPP 641
            FRV A NK G G P  +  P+ A+DP                               GPP
Sbjct: 8895 FRVIAKNKFGCGPPVEIG-PILAVDPL------------------------------GPP 8923

Query: 642  TD---LSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRF 697
            T    L+ TE T+S + L WK P   G   I  Y +EK      +++RVN  L   +  F
Sbjct: 8924 TSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRL-CPTTSF 8982

Query: 698  ALFDLAEGKSYCFRVRCSNSAGVGEPSEATEV---------------TVVGDKLDIPKAP 742
             + +L E + Y FRV+  N  G  EPS    V               +V GD + +    
Sbjct: 8983 LVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGE 9042

Query: 743  GKIIPSRNTDTSV-VVSW-------EESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGS 794
               IP+  T   +  + W       E+  DA ++    +  S A +    P      KG+
Sbjct: 9043 PVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGT 9102

Query: 795  RFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSM 854
                          + V A N  G    +   E  +       PSPP ++   +   +S 
Sbjct: 9103 --------------YTVTASNRLGSVFRNVHVEVYD------RPSPPRNLAVTDIKAESC 9142

Query: 855  VLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQ 914
             L W  P   GG+EIT Y ++ R+       +W E    AV E+ Y I  L  N  Y+F+
Sbjct: 9143 YLTWDAPLDNGGSEITHYVIDKRDA-SRKKAEWEEVTNTAV-EKRYGIWKLIPNGQYEFR 9200

Query: 915  VAAMNMAGLGAPSAVSECFKCEEWTI----AVPGPPHSLKCSEVRKDSLVLQWKPPVHSG 970
            V A+N  G+       EC K ++  I     +PGPP   K     K S+++ W PP+ +G
Sbjct: 9201 VRAVNKYGIS-----DEC-KSDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNG 9254

Query: 971  RTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLK-----VRGLKEGVSYVFRVRAINQA 1025
             +P+TGY+++ +E  +    W  ++ A I  V LK     V  L EGV Y FR  AIN A
Sbjct: 9255 GSPITGYWLEKREEGS--PYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAA 9312

Query: 1026 GVGKPSDLAGPVVA 1039
            G+G PS+ + P VA
Sbjct: 9313 GIGPPSEPSDPEVA 9326



 Score =  189 bits (480), Expect = 2e-47
 Identities = 195/781 (24%), Positives = 325/781 (41%), Gaps = 123/781 (15%)

Query: 276   APEFIIKP------RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIE 329
             A + +I+P       S++V   +++K+   I+G P+P +TW K+ +P+       +  + 
Sbjct: 16851 AKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLK---QTTRINVT 16907

Query: 330   SRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRY----KG--EFDETRFHA 383
                 + TL I     +D  QY  +  NV G+ +A   +V        KG  +FD+     
Sbjct: 16908 DSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDV---- 16963

Query: 384   GASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQW 443
              A ++ LS+    Y    +   +   K D +                             
Sbjct: 16964 SAESITLSWNPPLYTGGCQITNYIVQKRDTT----------------------------- 16994

Query: 444   YRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV---FVR 500
                      + W     +  R TL  + L    E  Y  R+     Y Q  A      V 
Sbjct: 16995 --------TTVWDVVSATVARTTLKVTKLKTGTE--YQFRIFAENRYGQSFALESDPIVA 17044

Query: 501   DADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCN 560
                 +  G P  P        +KD ++I W +P  +GGSP++GY +++ E  +  W++ N
Sbjct: 17045 QYPYKEPGPPGTPF---ATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVN 17101

Query: 561   DTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAP 620
              T +   +F    L EG  Y FRV A N +G+G  S+ SE   A DP +           
Sbjct: 17102 KTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDP---------- 17151

Query: 621   WTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAG 679
                              PG P  + V    R+ + L W  P   G   I  Y VEK +  
Sbjct: 17152 -----------------PGTPEPIMVK---RNEITLQWTKPVYDGGSMITGYIVEKRDLP 17191

Query: 680   TENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAG-VGEPSEATEVTVVGDKLDI 738
                W + +    +++ +F +  L E + Y FRV   N+AG + +PS++T      D++++
Sbjct: 17192 DGRWMKASFTNVIET-QFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVEL 17250

Query: 739   PKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEAS--VAGSGKWEPCNNNPVKGSRF 796
             P+     +  +  DT VV + E  +   ++ G  +     + G  + E      +K + F
Sbjct: 17251 PRIS---MDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDF 17307

Query: 797   TCHGLVT------GQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESF 850
                 +V       G  YI  +RA N AG   +  +   ++V     PP  P  +T + S 
Sbjct: 17308 KALLIVKDAIRIDGGQYI--LRASNVAGSKSFPVN---VKVLDRPGPPEGPVQVTGVTSE 17362

Query: 851   RDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMV 910
             + S+   W  P + GG++I+ Y V  RE        W     + V+  + K++ L E   
Sbjct: 17363 KCSLT--WSPPLQDGGSDISHYVVEKRETSRLA---WTVVASEVVTN-SLKVTKLLEGNE 17416

Query: 911   YQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSG 970
             Y F++ A+N  G+G P   +       + +  PGPP SL+ + + KDS+ + W  P   G
Sbjct: 17417 YVFRIMAVNKYGVGEPLESAPVLMKNPFVL--PGPPKSLEVTNIAKDSMTVCWNRPDSDG 17474

Query: 971   RTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKP 1030
              + + GY V+ ++      +W   N+  I ++ L+V GL E   Y FRV A N AGVG+P
Sbjct: 17475 GSEIIGYIVEKRDRSG--IRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEP 17532

Query: 1031  S 1031
             S
Sbjct: 17533 S 17533



 Score =  188 bits (478), Expect = 3e-47
 Identities = 179/629 (28%), Positives = 266/629 (42%), Gaps = 86/629 (13%)

Query: 439   PEIQWYRN-GVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
             PE++W R+ G  L  +    T        L   ++N+ D G Y + V      +  SA+V
Sbjct: 15518 PEVKWARDHGESLDKASIEST---SSYTLLIVGNVNRFDSGKYILTVENSSGSK--SAFV 15572

Query: 498   FVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
              VR  D      P  P D+K  E  K  + ++W  P +DGGS I  Y ++K E    ++S
Sbjct: 15573 NVRVLDT-----PGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYS 15627

Query: 558   ----QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARL 613
                  C+ T  K     V  L EG SY FRV A N+ GIG P+  +E V A +       
Sbjct: 15628 TVATNCHKTSWK-----VDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASER------ 15676

Query: 614   KSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YF 672
                                     P PP  +++ + TR+ V LSW+ P   G   I+ Y 
Sbjct: 15677 ------------------------PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYI 15712

Query: 673   VEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVV 732
             VE    G++ W    T   VK     +  L +G+ Y FRV   N  G+ +P + + V V+
Sbjct: 15713 VEMQTKGSDKWATCAT---VKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLS-VPVI 15768

Query: 733   GDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVK 792
                L IP A   +      +T  V++ E+ K     +G    A       W   +N P+K
Sbjct: 15769 AKDLVIPPAFKLLF-----NTFTVLAGEDLKVDVPFIGRPTPAVT-----WHK-DNVPLK 15817

Query: 793   GSRFTCHGLVTGQSYIFRVRAVNAAGLSEY-----SQDSEAIEVKAAIA--PPSPPC-DI 844
              +    +   T  + +  ++      +  Y     +   EAIE    I    P PP   +
Sbjct: 15818 QTT-RVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPV 15876

Query: 845   TCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISN 904
                E   DS+ L W  P   GG+ I  Y V  R   D     W+  +   V+    K   
Sbjct: 15877 KMDEVTADSITLSWGPPKYDGGSSINNYIVEKR---DTSTTTWQIVSA-TVARTTIKACR 15932

Query: 905   LKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWK 964
             LK    YQF++AA N    G  + ++      ++   VPGPP +   +   +DS+ +QW 
Sbjct: 15933 LKTGCEYQFRIAAENR--YGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWN 15990

Query: 965   PPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQ 1024
              P+  G + V GY ++ KE  +    W  LN+  I     K  GL+EGV Y FRV A N 
Sbjct: 15991 EPISDGGSRVIGYHLERKERNS--ILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENI 16048

Query: 1025  AGVGKPSDLAGPVVAE---TRPGTKEVVV 1050
              G+GKPS ++   VA      PG  E ++
Sbjct: 16049 VGIGKPSKVSECYVARDPCDPPGRPEAII 16077



 Score =  186 bits (473), Expect = 1e-46
 Identities = 204/782 (26%), Positives = 323/782 (41%), Gaps = 112/782 (14%)

Query: 474  KEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQP 533
            + D GLY I+V       +    V V D        P  P++    +  K  ++  W+ P
Sbjct: 8401 RPDHGLYMIKVENDHGIAKAPCTVSVLDT-------PGPPINFVFEDIRKTSVLCKWEPP 8453

Query: 534  AVDGGSPILGYFIDKCE-VGTDS-WSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMG 591
              DGGS I+ Y ++K +    DS W     T ++  ++ VT LIEG+ Y+FRVRA N+ G
Sbjct: 8454 LDDGGSEIINYTLEKKDKTKPDSEWIVVTST-LRHCKYSVTKLIEGKEYLFRVRAENRFG 8512

Query: 592  IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATR 651
             G P  VS+P+ A DP                              P  P    V + T 
Sbjct: 8513 PG-PPCVSKPLVAKDPFGP---------------------------PDAPDKPIVEDVTS 8544

Query: 652  SYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFR 711
            + +++ W  P   G   + Y++EK E  + +W RVN  L + + +  +  L EG +Y FR
Sbjct: 8545 NSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSL-LNALKANVDGLLEGLTYVFR 8603

Query: 712  VRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTS---VVVSWEES--KDAK 766
            V   N+AG G+ S  ++     D +     PG  IP R TDTS   + + WE        
Sbjct: 8604 VCAENAAGPGKFSPPSDPKTAHDPI---SPPGPPIP-RVTDTSSTTIELEWEPPAFNGGG 8659

Query: 767  ELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDS 826
            E+VGY+++  + G+ +W  C    +K  ++T   +  G  Y  RV AVNAAG      ++
Sbjct: 8660 EIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGP-PGET 8718

Query: 827  EAIEVKAAIAPPSPPCDITCLESFR---------DSMVLGWKQPDKIGGAEITGYYVNYR 877
            + + V     PP+   D++     +          ++V G   P K+   E  G     R
Sbjct: 8719 QPVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKE-EGELDKDR 8777

Query: 878  EVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEE 937
             VID         NV   SE   K +  K++   ++ + A N  G    +A  E F    
Sbjct: 8778 VVID---------NVGTKSELIIKDALRKDH--GRYVITATNSCGSKFAAARVEVFD--- 8823

Query: 938  WTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEA 997
                VPGP   LK     +   +L W  P   G + +TG+ ++ K+AK     WR   E 
Sbjct: 8824 ----VPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKM--HTWRQPIET 8877

Query: 998  AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPG----TKEVVVNVD 1053
              +     + GL EG  Y FRV A N+ G G P ++ GP++A    G     + +     
Sbjct: 8878 --ERSKCDITGLLEGQEYKFRVIAKNKFGCGPPVEI-GPILAVDPLGPPTSPERLTYTER 8934

Query: 1054 DDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYS 1113
                I+L+++  +    S            D P  E  +K      +F    +D+  +Y 
Sbjct: 8935 TKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYE 8994

Query: 1114 CDVTDTDGIASS-------YLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRF 1166
              V   + I  S        +I ++E+   + L    +  T+ VK+   V I        
Sbjct: 8995 FRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHI-------- 9046

Query: 1167 WMQAEKLSG--NAKVNYIFNEKEIFEGPK-----YKMHIDRNTGIIEMFMEKLQDEDEGT 1219
                  ++G    K+ +  NE  + E P       K  + R+    E+ + K   ED+GT
Sbjct: 9047 ---PADVTGLPMPKIEWSKNE-TVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGT 9102

Query: 1220 YT 1221
            YT
Sbjct: 9103 YT 9104



 Score =  186 bits (473), Expect = 1e-46
 Identities = 159/643 (24%), Positives = 266/643 (41%), Gaps = 71/643 (11%)

Query: 411   FDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFS 470
             FD    + GE++ +   V   P      P + W+++GV +     ++        +L   
Sbjct: 21593 FDGLIIKSGESLRIKALVQGRPV-----PRVTWFKDGVEIEKRMNMEITDVLGSTSLFVR 21647

Query: 471   HLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISW 530
                ++  G+YT+  +      +    V V+D   ++ G       ++      + + + W
Sbjct: 21648 DATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGP------IRFTNITGEKMTLWW 21701

Query: 531   KQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKM 590
               P  DG +PI  Y I+K E    +W+   D   +   +    LI G  Y FRV AVNK 
Sbjct: 21702 DAPLNDGCAPITHYIIEKRETSRLAWALIEDK-CEAQSYTAIKLINGNEYQFRVSAVNKF 21760

Query: 591   GIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEAT 650
             G+G P   S+PV A                   QI  T        VP  P     +  T
Sbjct: 21761 GVGRPLD-SDPVVA-------------------QIQYT--------VPDAPGIPEPSNIT 21792

Query: 651   RSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYC 709
              + + L+W +P    G E   Y +E+ E  +  W +V ++ P+   RF +  L EG  Y 
Sbjct: 21793 GNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYE 21852

Query: 710   FRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEES--KDAKE 767
             F V   N+AGVG  S  + +    + ++ P  P  +  +  + T+V + W +       E
Sbjct: 21853 FHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGME 21912

Query: 768   LVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSE 827
             ++GY IE   A  G W   N      +R+T   L  G+ Y FRV A+N AG  +  + + 
Sbjct: 21913 IIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTG 21972

Query: 828   AIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKW 887
              I  KA     +P  DI    +F+ + V+         GA I  +               
Sbjct: 21973 TI--KAVDRLTAPELDIDA--NFKQTHVVR-------AGASIRLFIAYQGRPTPTAVWSK 22021

Query: 888   REANVKAVSE-------EAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTI 940
              ++N+   ++           + N   N   ++ +   N +G       S+        +
Sbjct: 22022 PDSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSG-------SKSITFTVKVL 22074

Query: 941   AVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIK 1000
               PGPP  +   +V + S  L W  P+  G   +  Y V+ +EA  +   W+ ++E   +
Sbjct: 22075 DTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRR--SWQVISEKCTR 22132

Query: 1001  NVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRP 1043
              ++ KV  L EGV Y FRV A+N+ GVG+P ++  P+VA  +P
Sbjct: 22133 QIF-KVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQP 22174



 Score =  186 bits (473), Expect = 1e-46
 Identities = 215/868 (24%), Positives = 351/868 (40%), Gaps = 112/868 (12%)

Query: 274   LHAPEFIIKP---RSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIES 330
             L APE  I     ++H V    +++L  +  G P P   W K    +++ A+     I +
Sbjct: 21980 LTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRAD-----IHT 22034

Query: 331   RYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPL 390
                  TL +  C+  D  +Y  +  N  G  S   +V V    G              P+
Sbjct: 22035 TDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGP-----------PGPI 22083

Query: 391   SFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPL 450
             +F     G A+                +   +  G R      I H+  E +        
Sbjct: 22084 TFKDVTRGSATLMW-------------DAPLLDGGAR------IHHYVVEKR------EA 22118

Query: 451   SPSKWVQTLWSGERATLTFSHLNKEDEGL-YTIRVRMGEYYEQYSAYVFVRDADAEIEGA 509
             S   W Q +   E+ T     +N   EG+ Y  RV     Y     Y       A  + A
Sbjct: 22119 SRRSW-QVI--SEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPA 22175

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P   LDV  ++ +K   +++W +P  DGGS I GY ++  + G+D W +   T  K   F
Sbjct: 22176 PPRRLDV--VDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHT--KQLTF 22231

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTG---QII 626
              V  L+E   Y FRV+A N  G   P      V   +P      +  P+A  TG   Q+I
Sbjct: 22232 TVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEP------QIEPTADLTGITNQLI 22285

Query: 627   VTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRV 686
               +         G P  + V  + R    ++WK    R        +++ +  +    + 
Sbjct: 22286 TCK--------AGSPFTIDVPISGRPAPKVTWKLEEMR--------LKETDRVSITTTKD 22329

Query: 687   NTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKII 746
              T L VK       D   G S  + +   N+AGV   + +  V V+G    +    G I 
Sbjct: 22330 RTTLTVK-------DSMRGDSGRYFLTLENTAGV--KTFSVTVVVIGRPGPV---TGPIE 22377

Query: 747   PSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTG 804
              S  +  S V+SW E KD    E+  Y +E   +G+  W+  N++ VK ++     L   
Sbjct: 22378 VSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSS-VKRTQIKVTHLTKY 22436

Query: 805   QSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKI 864
               Y FRV + N  G+S+   +S  I  +    PPS P          ++M + W++P   
Sbjct: 22437 MEYSFRVSSENRFGVSK-PLESAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHD 22495

Query: 865   GGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLG 924
             GG++I GY+V  +E    +   W + N     E  YK++ L E + YQF+  A+N AG+ 
Sbjct: 22496 GGSKIIGYWVEKKERNTIL---WVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVS 22552

Query: 925   APSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKE- 983
               S  S     +   +  PG P   + ++V + ++ L W  P + G + V GY ++ K  
Sbjct: 22553 KASEASRPIMAQN-PVDAPGRP---EVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPV 22608

Query: 984   AKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGV-GKPSDLAGPVVA--E 1040
             ++  + +W   N   + + +  V  L EG +Y FRV A N AGV  K S+  GPV    E
Sbjct: 22609 SEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDE 22668

Query: 1041  TRPGTKEVVVNVDDDGVISLNFECDKM-------TPKSEFSWSKDYVSTEDSPRLEVESK 1093
               P   E+   +  D ++++    D +        P+ +  W+K     +   ++ ++  
Sbjct: 22669 YAPPKAELDARLHGD-LVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYT 22727

Query: 1094  GNKTKMTFKDLGMDDLGIYSCDVTDTDG 1121
             G +     K     D G Y+  V +  G
Sbjct: 22728 GKRATAVIKFCDRSDSGKYTLTVKNASG 22755



 Score =  186 bits (472), Expect = 2e-46
 Identities = 178/662 (26%), Positives = 274/662 (41%), Gaps = 105/662 (15%)

Query: 418  EGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDE 477
            EGE +S+       P      P + W+++G  +  S  +        A L      + D 
Sbjct: 8028 EGEKLSIPVPFRAVPV-----PTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADA 8082

Query: 478  GLYTIRV--RMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAV 535
            G+YTI +  ++G               + ++ G P    D+K  +  K    ++W+ P  
Sbjct: 8083 GIYTITLENKLGSA---------TASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEF 8133

Query: 536  DGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFP 595
            DGG+PIL Y +++ E G  ++        K + + V  LI    Y FRV+AVNK+G G  
Sbjct: 8134 DGGTPILHYVLERREAGRRTYIPVMSGENKLS-WTVKDLIPNGEYFFRVKAVNKVGGGEY 8192

Query: 596  SRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVV 655
              +  PV A DP +                            P PP D+ V   T   + 
Sbjct: 8193 IELKNPVIAQDPKQP---------------------------PDPPVDVEVHNPTAEAMT 8225

Query: 656  LSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRC 714
            ++WKPP   G   IM Y +EK   G E W+R N  L V    +    L EGK Y FRVR 
Sbjct: 8226 ITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHL-VPILTYTAKGLEEGKEYQFRVRA 8284

Query: 715  SNSAGVGEPSEATEVTVVGDKLDIPKA--------------------PGKIIPSRN--TD 752
             N+AG+ EPS AT  T   D +D PK                      G   P+     D
Sbjct: 8285 ENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYPTITWIKD 8344

Query: 753  TSVVVSWEESKDAKELV----GYYIE-----------ASVAGSGKWEPCNNNPVKGSRFT 797
             +V+V  E  K A  LV    G   E            S+  S K E  +   V+ S   
Sbjct: 8345 ENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGE--SQLRVRDSLRP 8402

Query: 798  CHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLG 857
             HGL       + ++  N  G+      ++A    + +  P PP +    +  + S++  
Sbjct: 8403 DHGL-------YMIKVENDHGI------AKAPCTVSVLDTPGPPINFVFEDIRKTSVLCK 8449

Query: 858  WKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAA 917
            W+ P   GG+EI  Y +  ++     P          +    Y ++ L E   Y F+V A
Sbjct: 8450 WEPPLDDGGSEIINYTLEKKDKTK--PDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRA 8507

Query: 918  MNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGY 977
             N  G G P  VS+    ++     P  P      +V  +S++++W  P  +G +P+ GY
Sbjct: 8508 ENRFGPG-PPCVSKPLVAKD-PFGPPDAPDKPIVEDVTSNSMLVKWNEPKDNG-SPILGY 8564

Query: 978  FVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPV 1037
            +++ +E  +    W  +N++ +  +   V GL EG++YVFRV A N AG GK S  + P 
Sbjct: 8565 WLEKREVNS--THWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPK 8622

Query: 1038 VA 1039
             A
Sbjct: 8623 TA 8624



 Score =  186 bits (472), Expect = 2e-46
 Identities = 178/659 (27%), Positives = 264/659 (40%), Gaps = 81/659 (12%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P + W +   PL+    V    S    TL      K D G YTI ++     ++ +  + 
Sbjct: 13640 PSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISI- 13698

Query: 499   VRDADAEIEGAPAAPLD-VKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
                   ++ G P  P   +K  E   + + + W  P  DGGS I  Y ++K +   + W 
Sbjct: 13699 ------KVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWV 13752

Query: 558   QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRP 617
              C    V+   F VT L EG  Y FRV A NK G+G   + SEP+ A  P +        
Sbjct: 13753 TCASA-VQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLK-SEPIVARHPFD-------- 13802

Query: 618   SAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKC 676
                                VP  P   ++ +     V L+W  P + G   I  Y +E  
Sbjct: 13803 -------------------VPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFK 13843

Query: 677   EAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKL 736
             E  +  W+R N + P++   F +  L EG  Y FRV   N AGVG+PS  +E  V  D +
Sbjct: 13844 ERNSLLWKRAN-KTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPI 13902

Query: 737   DIPKAPGKIIPSRNTDTSVVVSWEESK--DAKELVGYYIEASVAGSGKWEPCNNNPVKGS 794
             D P  P  I  +RN   SV + W E K     +L GY +E     S  W   N+  V   
Sbjct: 13903 DPPGKPEVINITRN---SVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPEC 13959

Query: 795   RFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDS 853
              FT   LV G  Y FR+RA N AG +S  S+ +E I  K     P+   D T     +D 
Sbjct: 13960 AFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIVLDPT----IKDG 14015

Query: 854   MVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQF 913
             + +       +    I G  +            W +A       +  +I++   + +   
Sbjct: 14016 LTIKAGDTIVLNAISILGKPLP--------KSSWSKAGKDIRPSDITQITSTPTSSMLTI 14067

Query: 914   QVAAMNMAGLGAPSAVSEC-FKCEEWTIAV---PGPPHSLKCSEVRKDSLVLQWKPPVHS 969
             + A    AG    +A +    K E   + V   PGPP  ++ S V  +   L W PP+  
Sbjct: 14068 KYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLED 14127

Query: 970   GRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGK 1029
             G +P+  Y ++ +E       W  ++E  I++       L +G  Y+FRV A+N  G G+
Sbjct: 14128 GGSPIKSYILEKRETSRL--LWTVVSE-DIQSCRHVATKLIQGNEYIFRVSAVNHYGKGE 14184

Query: 1030  P--------SDLAGPVVAETRPGTKEVVVN---------VDDDGVISLNFECDKMTPKS 1071
             P         D  GP     +P    V  N         VDD G     +  ++   KS
Sbjct: 14185 PVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKS 14243



 Score =  186 bits (471), Expect = 2e-46
 Identities = 165/626 (26%), Positives = 258/626 (41%), Gaps = 74/626 (11%)

Query: 519   LEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTP--VKFARFPVTGLIE 576
             ++  K  + + W +P  DGGS I+GYF++ C++  D W +CN  P  +    +  TGL E
Sbjct: 12827 IDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEE 12886

Query: 577   GRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGI 636
                Y FR  A   + I  PS  S+PV  L  AE    +   S      + V         
Sbjct: 12887 KAQYQFRAIARTAVNISPPSEPSDPVTIL--AENVPPRIDLSVAMKSLLTVK-------- 12936

Query: 637   VPGPPTDLSVTEATRSYVVLSWKPPGQ--RGHEGIMYFVEKCEAGTENWQRVNTELPVKS 694
               G    L  T   +    +SWK  G   +  EGI   +++     E             
Sbjct: 12937 -AGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLE------------- 12982

Query: 695   PRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTS 754
                 LF +    S  + +   NS+G      +   T+    LD P  P  +  ++     
Sbjct: 12983 ----LFSVNRKDSGDYTITAENSSG------SKSATIKLKVLDKPGPPASVKINKMYSDR 13032

Query: 755   VVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVR 812
              ++SWE   +    E+  Y ++        W   +   V  +  +   L+ G  Y FR+ 
Sbjct: 13033 AMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVSAT-VPITSCSVEKLIEGHEYQFRIC 13091

Query: 813   AVNAAGLSEYSQDSEAIEVKAAIAPPSPP--CDITCLESF-RDSMVLGWKQPDKIGGAEI 869
             A N  G+     D    E   A  P  PP  CD   + +  +D M + WK P   GG+ I
Sbjct: 13092 AENKYGVG----DPVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPI 13147

Query: 870   TGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAV 929
             TGY +  RE        W + N K + E   K + L+E   Y+F+V A+N AG G PS  
Sbjct: 13148 TGYLLEKRET---QAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDA 13204

Query: 930   SECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKED 989
             S+     +     PGPP   K  +  + S+ L W  P + G +P+ GY V++K  +A  D
Sbjct: 13205 SKAAYARDPQYP-PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVK--RADSD 13261

Query: 990   QWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDL-------------AG 1035
              W   N    ++    +V GL E   Y FRV A+N+ G   PSD+              G
Sbjct: 13262 NWVRCNLPQNLQKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEG 13321

Query: 1036  PVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGN 1095
              + A+ R   K +++     GV    +   K  P  + +WSK  V+  D   L+++S   
Sbjct: 13322 ELDADLR---KTLILRA---GVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDF 13375

Query: 1096  KTKMTFKDLGMDDLGIYSCDVTDTDG 1121
              T +  +++   D G Y   + ++ G
Sbjct: 13376 DTFLRCENVNKYDAGKYILTLENSCG 13401



 Score =  184 bits (467), Expect = 6e-46
 Identities = 185/681 (27%), Positives = 281/681 (41%), Gaps = 137/681 (20%)

Query: 497   VFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
             VF R  DA     P  P + K  + ++  + ++W +P  DGG+P+ GY ++  E   D W
Sbjct: 18620 VFYRACDALYP--PGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEW 18677

Query: 557   SQCND-TPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPS----------RVSEPVAAL 605
             + C   T ++  +F VT L E   Y FR+ A+N  G+G P+          R+  P   L
Sbjct: 18678 TTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIEL 18737

Query: 606   DPAEKARLKSRPSAPWTGQIIVTEE---------EPSEGIV------------------- 637
             D   +  +  R SA  T ++ VT +         E +EGI+                   
Sbjct: 18738 DADLRKVVVLRASA--TLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTMLVIDN 18795

Query: 638   -------------------------------PGPPTDLSVTEATRSYVVLSWKPPGQRGH 666
                                            P  P +L++ E  +  V LSW+PP   G 
Sbjct: 18796 VTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGG 18855

Query: 667   EGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSE 725
               I  Y VEK E   + +  +       +  F + +L EG SY FRV  SN  G+G P+E
Sbjct: 18856 AKITNYIVEKRETTRKAYATITNNCTKTT--FRIENLQEGCSYYFRVLASNEYGIGLPAE 18913

Query: 726   ATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE--ESKDAKELVGYYIEASVAGSGKW 783
              TE   V +    P  PG++     T  +  + WE  ES    ++ GY +E    GS KW
Sbjct: 18914 TTEPVKVSEP---PLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKW 18970

Query: 784   EPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQ-----DSEAIEVKAAIAPP 838
               C    VK    T  GL  G+ Y+FRV AVN  G S+  Q      +  IE+K ++  P
Sbjct: 18971 STCTQ--VKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELP 19028

Query: 839   SPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEE 898
                 ++   E  +  +      P K G  + T   VN+R+  DG   K     V   S +
Sbjct: 19029 FHTFNVKAREQLKIDV------PFK-GRPQAT---VNWRK--DGQTLK-ETTRVNVSSSK 19075

Query: 899   AYKISNLKENM---VYQFQVAAMNMAG-LGAPSAVSECFKCEEWTIAVPGPPHSLKCSEV 954
                  ++KE     V  +++   N AG +  P  +          +  PGPP  ++  EV
Sbjct: 19076 TVTSLSIKEASKEDVGTYELCVSNSAGSITVPITII--------VLDRPGPPGPIRIDEV 19127

Query: 955   RKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVS 1014
               DS+ + W PP + G   ++ Y V+ KE  +    W  +++ A+    +K+  L  G  
Sbjct: 19128 SCDSITISWNPPEYDGGCQISNYIVEKKETTS--TTWHIVSQ-AVARTSIKIVRLTTGSE 19184

Query: 1015  YVFRVRAINQAGVGKPSDLAGPVVAE------TRPGTKEVV------------VNVDDDG 1056
             Y FRV A N+ G    S+ +  VVAE        PGT +VV            V V+D G
Sbjct: 19185 YQFRVCAENRYGKSSYSE-SSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGG 19243

Query: 1057  VISLNFECDKMTPKSEFSWSK 1077
                + +  +    +S   WSK
Sbjct: 19244 SRVIGYHLE-YKERSSILWSK 19263



 Score =  182 bits (462), Expect = 2e-45
 Identities = 161/687 (23%), Positives = 288/687 (41%), Gaps = 62/687 (9%)

Query: 451   SPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADA-EIEGA 509
             S   WV    +  R  L++   N ++  +Y  RV  GE   ++   +     +  +I   
Sbjct: 19948 SKKAWVSVTNNCNR--LSYKVTNLQEGAIYYFRVS-GE--NEFGVGIPAETKEGVKITEK 20002

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             P+ P  +     +KD + ++W +P  DGGS I+ Y ++  E G  +W +C     K    
Sbjct: 20003 PSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKC--AVAKSTHH 20060

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              V+GL E   Y FRV A N+ G+  P  +  PV   +  E   +  +             
Sbjct: 20061 VVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMK------------- 20107

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTE 689
               PS  +     ++L V       + +S KP  +         + +     +   R NTE
Sbjct: 20108 NFPSHTVYVRAGSNLKVD------IPISGKPLPK-------VTLSRDGVPLKATMRFNTE 20154

Query: 690   LPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAP-GKIIPS 748
             +  ++    L +     +  + +  +NS+G       T+  +    LD P  P G ++ S
Sbjct: 20155 ITAENLTINLKESVTADAGRYEITAANSSGT------TKAFINIVVLDRPGPPTGPVVIS 20208

Query: 749   RNTDTSVVVSWEESK--DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQS 806
               T+ SV + WE  K     ++  Y +      +  W   +   V  +      L TG+ 
Sbjct: 20209 DITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSAT-VARTMMKVMKLTTGEE 20267

Query: 807   YIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGG 866
             Y FR++A N  G+S++  DS  + VK     P PP         R+S+ +GW +P   GG
Sbjct: 20268 YQFRIKAENRFGISDHI-DSACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGG 20326

Query: 867   AEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAP 926
             + + GY++   E+ D     W++AN   +    +K++ +   ++Y+F+V A N AG+G P
Sbjct: 20327 SAVVGYHL---EMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVGKP 20383

Query: 927   SAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKA 986
             S  SE        I    PP +++ +++ K+S+ L W+ P   G + +TGY V+ ++   
Sbjct: 20384 SHPSE----PVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLP- 20438

Query: 987   KEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG-VGKPSDLAGPVVAETRPGT 1045
              + +W   +   +      + GL +   Y FRV A N  G +  PS++ GP+      G 
Sbjct: 20439 -DGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGG 20497

Query: 1046  KEVVVNVDDDGVISLNFECDKMT-------PKSEFSWSKDYVSTEDSPRLEVESKGNKTK 1098
               + + ++   V+                 P     W KD    + +  + VE+  +   
Sbjct: 20498 PVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLAS 20557

Query: 1099  MTFKDLGMDDLGIYSCDVTDTDGIASS 1125
             +  KD    + G Y   + +  G AS+
Sbjct: 20558 ILIKDADRLNSGCYELKLRNAMGSASA 20584



 Score =  181 bits (460), Expect = 4e-45
 Identities = 158/602 (26%), Positives = 244/602 (40%), Gaps = 104/602 (17%)

Query: 509   APAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFAR 568
             AP  P   K  +  K    + W  P  DGGS + GY ++  E G + W +  D  V+  +
Sbjct: 10048 APPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTK 10107

Query: 569   FPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSE----------PVAALDPAEKARL----- 613
               VTGL EG  Y FRVRAVN  GIG P  V++          P   LD + + R+     
Sbjct: 10108 LVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAG 10167

Query: 614   -----------KSRPSAPW-------------------TGQIIVTEEEPSEGI------- 636
                        K  P+  W                   +  +I   +   +G+       
Sbjct: 10168 GVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGVYSLLAKN 10227

Query: 637   ---------------VPGPP-TDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAG 679
                            VPGP  T       T     L+W  P   G   I  Y +EK E+ 
Sbjct: 10228 EAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESD 10287

Query: 680   TENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIP 739
                W  V     V      +  L +GK+Y FR+   NS G+G   E +E  V+ + + +P
Sbjct: 10288 RRAWTPVT--YTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVP 10345

Query: 740   KAPGKIIPSRNTDTSVVVSWEESK--DAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFT 797
             + P  +     T  +V ++W   K     E++ Y +E+ + G+ K+    N+ +   ++T
Sbjct: 10346 ERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYT 10405

Query: 798   CHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLG 857
               GL  G +Y +RV AVN  G  + S  ++ I  K  +APP+   D      FRD + + 
Sbjct: 10406 VKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLD------FRDKLTI- 10458

Query: 858   WKQPDKIGGA-EITGYYVNYREVIDGVPG---KWREANVKAVSEEAYKISNLKENMVYQF 913
                  ++G A  +TG Y        G P     W +     + ++   I      +  + 
Sbjct: 10459 -----RVGEAFALTGRY-------SGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEK 10506

Query: 914   QVAAMNMAG----LGAPSAVSECFKCEEWTIAVPGPP-HSLKCSEVRKDSLVLQWKPPVH 968
               A  + +G    +   S  S    C+   +  PGPP   +   EV KD +V+ WKPP+ 
Sbjct: 10507 IKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLD 10566

Query: 969   SGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVG 1028
              G + +T Y ++ KE    +D W  +  A+ K    KV  L EG  Y+FR+ A N  G+ 
Sbjct: 10567 DGGSKITNYIIEKKE--VGKDVWMPVTSASAKTT-CKVSKLLEGKDYIFRIHAENLYGIS 10623

Query: 1029  KP 1030
              P
Sbjct: 10624 DP 10625



 Score =  180 bits (457), Expect = 9e-45
 Identities = 195/764 (25%), Positives = 297/764 (38%), Gaps = 127/764 (16%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYR 351
             +N+K+   + G P+P VTW K      +     +   E+      L IN C   D+  Y 
Sbjct: 14709 DNIKVEIPVLGRPKPTVTWKKGD---QILKQTQRVNFETTATSTILNINECVRSDSGPYP 14765

Query: 352   ASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKF 411
              +A N+ GE+    ++ V    G            T P+ F      +            
Sbjct: 14766 LTARNIVGEVGDVITIQVHDIPGP----------PTGPIKFDEVSSDF------------ 14803

Query: 412   DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSH 471
              V+F  +      G        I ++  E++          + WV+   +  R T   + 
Sbjct: 14804 -VTFSWDPPENDGGV------PISNYVVEMR------QTDSTTWVELATTVIRTTYKATR 14850

Query: 472   LNKEDEGLYTIRVRMGEYY---EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIII 528
             L    E  Y  RV+    Y      ++   V +   ++ G P  P   +     KD + I
Sbjct: 14851 LTTGLE--YQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTP---QVTAVTKDSMTI 14905

Query: 529   SWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVN 588
             SW +P  DGGSPILGY +++ E     W   +   V    F  +GL +G +Y FRV A N
Sbjct: 14906 SWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAEN 14965

Query: 589   KMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTE 648
               G   PS+ SEP+ ALDP +                            PG P  L++T 
Sbjct: 14966 MAGKSKPSKPSEPMLALDPIDP---------------------------PGKPVPLNITR 14998

Query: 649   ATRSYVVLSW-KPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKS 707
              T   V L W KP    G +   Y VEK +     W + N    +    F +  L E  +
Sbjct: 14999 HT---VTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFS-NILENEFTVSGLTEDAA 15054

Query: 708   YCFRVRCSNSAG-VGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEE----- 761
             Y FRV   N+AG +  PSE ++     D ++ PK     +  +  DT ++ + E      
Sbjct: 15055 YEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIK---VDVKFKDTVILKAGEAFRLEA 15111

Query: 762   ------------SKDAKELVG-YYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYI 808
                         SKD KEL G   +E  +A     +   N   K S     G  T     
Sbjct: 15112 DVSGRPPPTMEWSKDGKELEGTAKLEIKIA-----DFSTNLVNKDSTRRDSGAYT----- 15161

Query: 809   FRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAE 868
               + A N  G +++        VK    P  P   +   E   +  VL W  P   GGA+
Sbjct: 15162 --LTATNPGGFAKH-----IFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAK 15214

Query: 869   ITGYYVNYREVIDGVPGKWREANVKA-VSEEAYKISNLKENMVYQFQVAAMNMAGLGAPS 927
             I  Y V  RE       +    NV + V     K++ L +   Y F+V A+N  G+G P 
Sbjct: 15215 IDHYIVQKRET-----SRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPL 15269

Query: 928   AVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAK 987
                       +    P PP + + + + KDS+V+ W  P   G + +  Y V+ ++   +
Sbjct: 15270 ESEPVLAVNPY--GPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQ 15327

Query: 988   EDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPS 1031
               +W   N+  + ++  KV GL EG  Y FR+ A N AG+  PS
Sbjct: 15328 --RWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPS 15369



 Score =  180 bits (457), Expect = 9e-45
 Identities = 166/615 (26%), Positives = 262/615 (42%), Gaps = 61/615 (9%)

Query: 432   PEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVR--MGEY 489
             P +   +P + W +    L  ++ V    +     L  +   + D G Y +  R  +GE 
Sbjct: 14716 PVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEV 14775

Query: 490   YEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKC 549
              +  +  V       +I G P  P  +K  E + D++  SW  P  DGG PI  Y ++  
Sbjct: 14776 GDVITIQVH------DIPGPPTGP--IKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMR 14827

Query: 550   EVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAE 609
             +  + +W +   T ++   +  T L  G  Y FRV+A N+ G+G P   S  + A  P +
Sbjct: 14828 QTDSTTWVELATTVIR-TTYKATRLTTGLEYQFRVKAQNRYGVG-PGITSACIVANYPFK 14885

Query: 610   KARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGI 669
                                        VPGPP    VT  T+  + +SW  P   G   I
Sbjct: 14886 ---------------------------VPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPI 14918

Query: 670   M-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATE 728
             + Y VE+ E     WQ V+  L V    F    L +G +Y FRV   N AG  +PS+ +E
Sbjct: 14919 LGYHVERKERNGILWQTVSKAL-VPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSE 14977

Query: 729   VTVVGDKLDIPKAPGKIIPSRNTDTSVVVSW--EESKDAKELVGYYIEASVAGSGKWEPC 786
               +  D +D    PGK +P   T  +V + W   E     ++  Y +E     +G+W   
Sbjct: 14978 PMLALDPID---PPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKA 15034

Query: 787   NNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIAPPSPPCDIT 845
             N + +  + FT  GL    +Y FRV A NAAG +S  S+ S+AI  +  +  P    D+ 
Sbjct: 15035 NFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDV- 15093

Query: 846   CLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNL 905
                 F+D+++L   +  ++  A+++G      E      GK  E   K   + A   +NL
Sbjct: 15094 ---KFKDTVILKAGEAFRL-EADVSGRPPPTMEW--SKDGKELEGTAKLEIKIADFSTNL 15147

Query: 906   KENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHS-LKCSEVRKDSLVLQWK 964
                   +    A  +            F  +   +  PGPP   L  +EV  +  VL W 
Sbjct: 15148 VNKDSTRRDSGAYTLTATNPGGFAKHIFNVK--VLDRPGPPEGPLAVTEVTSEKCVLSWF 15205

Query: 965   PPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQ 1024
             PP+  G   +  Y V  +E       W  +  + ++   LKV  L +G  Y+FRV A+N+
Sbjct: 15206 PPLDDGGAKIDHYIVQKRETSRL--AWTNV-ASEVQVTKLKVTKLLKGNEYIFRVMAVNK 15262

Query: 1025  AGVGKPSDLAGPVVA 1039
              GVG+P + + PV+A
Sbjct: 15263 YGVGEPLE-SEPVLA 15276



 Score =  179 bits (455), Expect = 1e-44
 Identities = 207/860 (24%), Positives = 335/860 (38%), Gaps = 131/860 (15%)

Query: 280   IIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEI 339
             ++K R+ T     +VKL   I+G P P + WYK+   +  +A      +E+   + ++ I
Sbjct: 20509 VVKYRAGT-----SVKLRAGISGKPAPTIEWYKDDKELQTNA---LVCVENTTDLASILI 20560

Query: 340   NGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGY 399
                D  ++  Y     N  G  SA   V +    G                     P G 
Sbjct: 20561 KDADRLNSGCYELKLRNAMGSASATIRVQILDKPG---------------------PPGG 20599

Query: 400   ASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTL 459
                F+    +K  + +    +            +I H+  E +        S   W    
Sbjct: 20600 PIEFKTVTAEKITLLWRPPADDGGA--------KITHYIVEKR------ETSRVVWSMVS 20645

Query: 460   WSGERATLTFSHLNKEDEGLYTIRV----RMGEYYEQYSAYVFVRDADAEIEGAPAAPLD 515
                E   +T + + K +E ++ +R      +GE  E  S  V  ++A     G P  P  
Sbjct: 20646 EHLEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDS--VVAKNAFVT-PGPPGIP-- 20700

Query: 516   VKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLI 575
              +  +  K+ + + W +P  DGGS I GYF++K +  +  W +     ++  R  VTGL 
Sbjct: 20701 -EVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLT 20759

Query: 576   EGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEG 635
             E   Y +RV AVN  G G  S  SE   A DP +                          
Sbjct: 20760 ENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDP------------------------- 20794

Query: 636   IVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKS 694
               PGPP  + + ++T+S + L W  P   G   +  Y VE  +   E W  V+T+  V++
Sbjct: 20795 --PGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRT 20852

Query: 695   PRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTS 754
               + + +L  G +Y FRV   N AG GEP E  E     D L+ P+    +       TS
Sbjct: 20853 TEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVA----LRTS 20908

Query: 755   VVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAV 814
             V+   +  +D + L+ +  +     +  W     N    +R++     T  S +  +  V
Sbjct: 20909 VIA--KAGEDVQVLIPF--KGRPPPTVTWRKDEKNLGSDARYSIEN--TDSSSLLTIPQV 20962

Query: 815   NAAGLSEY---------SQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIG 865
                   +Y            S  + VK  +  P+    +      R ++ L W  P   G
Sbjct: 20963 TRNDTGKYILTIENGVGEPKSSTVSVK-VLDTPAACQKLQVKHVSRGTVTLLWDPPLIDG 21021

Query: 866   GAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGA 925
             G+ I  Y +  R   D     W   + K  S  ++K+ +L E   + F+V A N  G+G 
Sbjct: 21022 GSPIINYVIEKR---DATKRTWSVVSHKC-SSTSFKLIDLSEKTPFFFRVLAENEIGIGE 21077

Query: 926   PSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAK 985
             P   +E  K  E    VP P   L   +  K S++L W  P   G + +T Y V   E K
Sbjct: 21078 PCETTEPVKAAE----VPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVV---ERK 21130

Query: 986   AKEDQ-WRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETR-- 1042
              K +Q W   +    K   ++V  LKE     FRV A N+ G+  P  + GP+  +    
Sbjct: 21131 GKGEQTWS--HAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTI-GPITVKELII 21187

Query: 1043  ---------PGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESK 1093
                      PG  +V V +  +  + L +   K  PK   SW KD +  ++S  +     
Sbjct: 21188 TPEVDLSDIPGA-QVTVRIGHNVHLELPY---KGKPKPSISWLKDGLPLKESEFVRFSKT 21243

Query: 1094  GNKTKMTFKDLGMDDLGIYS 1113
              NK  ++ K+   +  G Y+
Sbjct: 21244 ENKITLSIKNAKKEHGGKYT 21263



 Score =  179 bits (454), Expect = 2e-44
 Identities = 174/639 (27%), Positives = 266/639 (41%), Gaps = 71/639 (11%)

Query: 500   RDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQC 559
             RDA  +    P   +D+K    +K    I WK+P  DGGS I+GY +D      + W + 
Sbjct: 13503 RDA-VKASQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFL-TEENKWQRV 13560

Query: 560   NDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDP--AEKARLKSRP 617
               +     ++    L EG+ Y FRV A N+ G G PS ++  V A D   A    LK  P
Sbjct: 13561 MKS--LSLQYSAKDLTEGKEYTFRVSAENENGEGTPSEIT--VVARDDVVAPDLDLKGLP 13616

Query: 618   SAPWTGQIIVTEEEPSEGIVP--GPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEK 675
                +    +  E       +P  G P              +SWK               K
Sbjct: 13617 DLCY----LAKENSNFRLKIPIKGKPAPS-----------VSWK---------------K 13646

Query: 676   CEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK 735
              E       RV+ E    +    ++D  +  +  + +   N AG  E +    + VVG K
Sbjct: 13647 GEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGT--ISIKVVG-K 13703

Query: 736   LDIPKAPGKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKG 793
               IP  P K      T  ++ + W   KD    E+  Y +E   + + KW  C +  V+ 
Sbjct: 13704 PGIPTGPIKF--DEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCAS-AVQK 13760

Query: 794   SRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDS 853
             + F    L  G  Y FRV A N  G+ E    SE I  +     P  P     ++   DS
Sbjct: 13761 TTFRVTRLHEGMEYTFRVSAENKYGVGE-GLKSEPIVARHPFDVPDAPPPPNIVDVRHDS 13819

Query: 854   MVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQF 913
             + L W  P K GG+ ITGY++ ++E    +   W+ AN   +    +K++ L E + Y+F
Sbjct: 13820 VSLTWTDPKKTGGSPITGYHLEFKERNSLL---WKRANKTPIRMRDFKVTGLTEGLEYEF 13876

Query: 914   QVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTP 973
             +V A+N+AG+G PS  SE     +  I  PG P  +    + ++S+ L W  P + G   
Sbjct: 13877 RVMAINLAGVGKPSLPSEPVVALD-PIDPPGKPEVIN---ITRNSVTLIWTEPKYDGGHK 13932

Query: 974   VTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG-VGKPSD 1032
             +TGY V+ ++  +K   W   N   +      V  L EG  Y FR+RA N AG +  PS+
Sbjct: 13933 LTGYIVEKRDLPSK--SWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSE 13990

Query: 1033  LAGPVVAETR---------PGTKE-VVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVST 1082
                 ++ +           P  K+ + +   D  V++      K  PKS  SWSK     
Sbjct: 13991 STETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKS--SWSKAGKDI 14048

Query: 1083  EDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1121
               S   ++ S    + +T K     D G Y+   T+  G
Sbjct: 14049 RPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFG 14087



 Score =  179 bits (453), Expect = 2e-44
 Identities = 161/559 (28%), Positives = 239/559 (42%), Gaps = 51/559 (9%)

Query: 508  GAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFA 567
            G P +P  +   E  K  I + WK+P  +GGSPI GY I+K       + + N       
Sbjct: 8921 GPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTT 8980

Query: 568  RFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALD---PAEKARLKSRPSAPWTGQ 624
             F V  L E + Y FRV+AVN++G   PS     V   D   P  K RL  R        
Sbjct: 8981 SFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDT----- 9035

Query: 625  IIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQ 684
            I V   EP    +P   T L + +       + W     +    I    +  +   E   
Sbjct: 9036 IKVKAGEPVH--IPADVTGLPMPK-------IEWS----KNETVIEKPTDALQITKEEVS 9082

Query: 685  RVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGK 744
            R   +  +  P+    D        + V  SN  G    +   EV       D P  P  
Sbjct: 9083 RSEAKTELSIPKAVREDKGT-----YTVTASNRLGSVFRNVHVEV------YDRPSPPRN 9131

Query: 745  IIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGK--WEPCNNNPVKGSRFTCHG 800
            +  +     S  ++W+   D    E+  Y I+   A   K  WE   N  V+  R+    
Sbjct: 9132 LAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVE-KRYGIWK 9190

Query: 801  LVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQ 860
            L+    Y FRVRAVN  G+S+  + S+ + ++     P PP     L   + SM++ W  
Sbjct: 9191 LIPNGQYEFRVRAVNKYGISDECK-SDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTP 9249

Query: 861  PDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYK-----ISNLKENMVYQFQV 915
            P   GG+ ITGY++  RE  +G P  W   +   +++   K     +  L E + YQF+ 
Sbjct: 9250 PLDNGGSPITGYWLEKRE--EGSP-YWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRA 9306

Query: 916  AAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVT 975
             A+N AG+G PS  S+     +  I  PGPP   +  +  K S+ L WKPP   G +P+ 
Sbjct: 9307 MAINAAGIGPPSEPSDPEVAGD-PIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIK 9365

Query: 976  GYFVDLKEAKAKEDQWRGLNEA--AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDL 1033
            GY V+++E    +  W+ +NE    I      V  LKE   Y FRV+A+N+AG  +PSD 
Sbjct: 9366 GYIVEMQEEGTTD--WKRVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDT 9423

Query: 1034 AGPVVAETRPGTKEVVVNV 1052
             G + A       EV +++
Sbjct: 9424 TGEIPATDIQEEPEVFIDI 9442



 Score =  178 bits (452), Expect = 3e-44
 Identities = 172/622 (27%), Positives = 261/622 (41%), Gaps = 83/622 (13%)

Query: 439  PEIQWYRNGVPLS-PSKWVQTLW-----SGERATLTFSHLNKEDEGLYTIRV--RMGEYY 490
            P+I+W +N   +  P+  +Q        S  +  L+     +ED+G YT+    R+G  +
Sbjct: 9056 PKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVF 9115

Query: 491  EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCE 550
                     R+   E+   P+ P ++   +   +   ++W  P  +GGS I  Y IDK +
Sbjct: 9116 ---------RNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRD 9166

Query: 551  VGTD--SWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPA 608
                   W +  +T V+  R+ +  LI    Y FRVRAVNK GI    + S+ V   DP 
Sbjct: 9167 ASRKKAEWEEVTNTAVE-KRYGIWKLIPNGQYEFRVRAVNKYGISDECK-SDKVVIQDPY 9224

Query: 609  EKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEG 668
                                        +PGPP    V   T+  +++SW PP   G   
Sbjct: 9225 R---------------------------LPGPPGKPKVLARTKGSMLVSWTPPLDNGGSP 9257

Query: 669  IM-YFVEKCEAGTENWQRVN----TELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEP 723
            I  Y++EK E G+  W RV+    T++ +K   F +  L EG  Y FR    N+AG+G P
Sbjct: 9258 ITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPP 9317

Query: 724  SEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE-ESKD-AKELVGYYIEASVAGSG 781
            SE ++  V GD +  P  P        T +S+ + W+  +KD    + GY +E    G+ 
Sbjct: 9318 SEPSDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTT 9377

Query: 782  KWEPCNNNPVKGSRFTCHGLVTG----QSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAP 837
             W+   N P K    TC  +V      + Y FRV+AVN AG SE S  +  I        
Sbjct: 9378 DWKRV-NEPDK-LITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEE 9435

Query: 838  PSPPCDI---TCLESFRDSMVLGWKQPDKIGGAEITGYYVNY-----REVIDGVPGKWRE 889
            P    DI    CL     S +   + P  I G         +     + + DGV     +
Sbjct: 9436 PEVFIDIGAQDCLVCKAGSQI---RIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPED 9492

Query: 890  ANVK-AVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHS 948
            A ++ A +     I   K +   ++ + A N AG        +   C    + VPGPP  
Sbjct: 9493 AQLETAENSSVIIIPECKRSHTGKYSITAKNKAG-------QKTANCRVKVMDVPGPPKD 9545

Query: 949  LKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRG 1008
            LK S++ + S  L WK P   G   + GY ++ +    K   W  +N       ++ V  
Sbjct: 9546 LKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGK--AWTKVNPDCGSTTFV-VPD 9602

Query: 1009 LKEGVSYVFRVRAINQAGVGKP 1030
            L     Y FRVRA N+ G+G P
Sbjct: 9603 LLSEQQYFFRVRAENRFGIGPP 9624



 Score =  178 bits (451), Expect = 4e-44
 Identities = 171/643 (26%), Positives = 272/643 (42%), Gaps = 79/643 (12%)

Query: 438   QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
             +P I W ++G+PL  +  +    S +  TL+    +K+D G Y I V       Q +A +
Sbjct: 16886 KPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITV--ANVVGQKTASI 16943

Query: 498   FVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
              +   D      P  P  VK  + + + I +SW  P   GG  I  Y + K +  T  W 
Sbjct: 16944 EIVTLDK--PDPPKGP--VKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWD 16999

Query: 558   QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRP 617
               + T V      VT L  G  Y FR+ A N+ G  F +  S+P+ A  P ++       
Sbjct: 17000 VVSAT-VARTTLKVTKLKTGTEYQFRIFAENRYGQSF-ALESDPIVAQYPYKE------- 17050

Query: 618   SAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKC 676
                                 PGPP     T  ++  +V+ W  P   G   ++ Y +E+ 
Sbjct: 17051 --------------------PGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERK 17090

Query: 677   EAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKL 736
             E  +  W +VN  + +   +F   +L EG  Y FRV   N  GVG+ S+ +E  V  D  
Sbjct: 17091 ERNSILWTKVNKTI-IHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPC 17149

Query: 737   DIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCNNNPVKGS 794
             D P  P  I+  RN    + + W +        + GY +E      G+W   +   V  +
Sbjct: 17150 DPPGTPEPIMVKRN---EITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIET 17206

Query: 795   RFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDS 853
             +FT  GL   Q Y FRV A NAAG +S+ S  +  I  K  +  P    D      FRD+
Sbjct: 17207 QFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMD----PKFRDT 17262

Query: 854   MVLGWKQPDKIGGAEITG-------YYVNYREVIDGVPGKWREANVKA--VSEEAYKISN 904
             +V+   +  ++  A++ G       +    +E+ +    + +  + KA  + ++A +I  
Sbjct: 17263 IVVNAGETFRL-EADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDG 17321

Query: 905   LKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHS-LKCSEVRKDSLVLQW 963
                    Q+ + A N+AG       S+ F      +  PGPP   ++ + V  +   L W
Sbjct: 17322 ------GQYILRASNVAG-------SKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTW 17368

Query: 964   KPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAIN 1023
              PP+  G + ++ Y V+ +E       W  +    + N  LKV  L EG  YVFR+ A+N
Sbjct: 17369 SPPLQDGGSDISHYVVEKRETSRL--AWTVVASEVVTN-SLKVTKLLEGNEYVFRIMAVN 17425

Query: 1024  QAGVGKPSDLA-----GPVVAETRPGTKEVVVNVDDDGVISLN 1061
             + GVG+P + A      P V    P + EV     D   +  N
Sbjct: 17426 KYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWN 17468



 Score =  177 bits (449), Expect = 7e-44
 Identities = 155/641 (24%), Positives = 273/641 (42%), Gaps = 58/641 (9%)

Query: 505   EIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPV 564
             ++   P  P  +   +  ++ + +SW +P  DGGS I+ Y ++     ++ WS+C    V
Sbjct: 16754 KVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSEC--ARV 16811

Query: 565   KFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQ 624
             K  +  +T L +G  Y+FRV AVN+ G   P  ++ P+ A D   +  +K   S      
Sbjct: 16812 KSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFS------ 16865

Query: 625   IIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQ 684
                     S  +  G    + V  + R    ++W   G                  +   
Sbjct: 16866 --------SYSVQVGQDLKIEVPISGRPKPTITWTKDG---------------LPLKQTT 16902

Query: 685   RVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGK 744
             R+N    +     ++ +  +     + +  +N   VG+ + + E+  + DK D PK P K
Sbjct: 16903 RINVTDSLDLTTLSIKETHKDDGGQYGITVANV--VGQKTASIEIVTL-DKPDPPKGPVK 16959

Query: 745   IIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLV 802
                   +  S+ +SW         ++  Y ++     +  W+  +   V  +      L 
Sbjct: 16960 F--DDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSAT-VARTTLKVTKLK 17016

Query: 803   TGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPD 862
             TG  Y FR+ A N  G S ++ +S+ I  +     P PP         +DSMV+ W +P 
Sbjct: 17017 TGTEYQFRIFAENRYGQS-FALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPV 17075

Query: 863   KIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAG 922
               GG+ + GY++  +E    +   W + N   + +  +K  NL+E + Y+F+V A N+ G
Sbjct: 17076 NNGGSPVIGYHLERKERNSIL---WTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVG 17132

Query: 923   LGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLK 982
             +G  S  SEC+   +     PG P  +    V+++ + LQW  PV+ G + +TGY V+ +
Sbjct: 17133 VGKASKNSECYVARD-PCDPPGTPEPIM---VKRNEITLQWTKPVYDGGSMITGYIVEKR 17188

Query: 983   EAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG-VGKPSDLAGPVVAET 1041
             +    + +W   +   +      V GL E   Y FRV A N AG + KPSD  GP+ A+ 
Sbjct: 17189 DLP--DGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKD 17246

Query: 1042  RPGTKEVVVNVDDDGVISLN------FECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKG 1094
                   + ++      I +N       E D    P     W +     E+S R E+++  
Sbjct: 17247 EVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTD 17306

Query: 1095  NKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKR 1135
              K  +  KD    D G Y    ++  G + S+ ++ + L R
Sbjct: 17307 FKALLIVKDAIRIDGGQYILRASNVAG-SKSFPVNVKVLDR 17346



 Score =  176 bits (445), Expect = 2e-43
 Identities = 165/624 (26%), Positives = 272/624 (43%), Gaps = 67/624 (10%)

Query: 519   LEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGR 578
             ++  ++ I + W  P  DGGS I+GY I+K + G + W +CN T V   ++ VTGL  G 
Sbjct: 21492 IDVTRETITLKWNPPLRDGGSKIVGYSIEKRQ-GNERWVRCNFTDVSECQYTVTGLSPGD 21550

Query: 579   SYIFRVRAVNKMG-IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIV 637
              Y FR+ A N +G I  PS+ S  +   D      ++  P             E  +G++
Sbjct: 21551 RYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGP-------------EYFDGLI 21597

Query: 638   PGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRF 697
                   +   E+ R   ++  +P  +     + +F +    G E  +R+N E+       
Sbjct: 21598 ------IKSGESLRIKALVQGRPVPR-----VTWFKD----GVEIEKRMNMEITDVLGST 21642

Query: 698   ALF--DLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKII-PSRNTDTS 754
             +LF  D        + V   N++G    S   E+     K+ +   PGK++ P R T+ +
Sbjct: 21643 SLFVRDATRDHRGVYTVEAKNASG----SAKAEI-----KVKVQDTPGKVVGPIRFTNIT 21693

Query: 755   ---VVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIF 809
                + + W+   +     +  Y IE        W    +   +   +T   L+ G  Y F
Sbjct: 21694 GEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDK-CEAQSYTAIKLINGNEYQF 21752

Query: 810   RVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEI 869
             RV AVN  G+     DS+ +  +     P  P          +S+ L W +P+  GG+EI
Sbjct: 21753 RVSAVNKFGVGR-PLDSDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEI 21811

Query: 870   TGYYVNYREVIDGVPGKW-REANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSA 928
               Y +  RE       +W +  + + +SE  +K++ L E   Y+F V A N AG+G  S 
Sbjct: 21812 QQYILERREKKST---RWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASG 21868

Query: 929   VSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKE 988
             +S   KC E  +  PGPP  +K ++  K ++ L+W  PV  G   + GY +++   KA  
Sbjct: 21869 ISRLIKCRE-PVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEM--CKADL 21925

Query: 989   DQWRGLN-EAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKE 1047
               W  +N EA +K  Y  V  L+ G  Y FRV AIN AG G   ++ G + A  R    E
Sbjct: 21926 GDWHKVNAEACVKTRY-TVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPE 21984

Query: 1048  VVV-------NVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMT 1100
             + +       +V   G     F   +  P     WSK    +  S R ++ +  + + +T
Sbjct: 21985 LDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKP--DSNLSLRADIHTTDSFSTLT 22042

Query: 1101  FKDLGMDDLGIYSCDVTDTDGIAS 1124
              ++   +D G Y+  V +  G  S
Sbjct: 22043 VENCNRNDAGKYTLTVENNSGSKS 22066



 Score =  175 bits (443), Expect = 4e-43
 Identities = 164/643 (25%), Positives = 264/643 (41%), Gaps = 81/643 (12%)

Query: 412   DVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSH 471
             DV   R G+T+ +  RV   PE     P+I W + G  L   K V  +    R  L    
Sbjct: 11544 DVITVRVGQTIRILARVKGRPE-----PDITWTKEGKVLVREKRVDLIQDLPRVELQIKE 11598

Query: 472   LNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWK 531
               + D G Y I  +    + Q SA V V D        P    ++K     K+   ISW+
Sbjct: 11599 AVRADHGKYIISAKNSSGHAQGSAIVNVLDR-------PGPCQNLKVTNVTKENCTISWE 11651

Query: 532   QPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMG 591
              P  +GGS I  + ++  +     WS       K  R     L+    Y FRV A NK+G
Sbjct: 11652 NPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTK--RLIKANLLANNEYYFRVCAENKVG 11709

Query: 592   IGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATR 651
             +G       P+ A++P ++                           PG P +L + +  +
Sbjct: 11710 VGPTIETKTPILAINPIDR---------------------------PGEPENLHIADKGK 11742

Query: 652   SYVVLSWKPPG-QRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCF 710
             ++V L W+ P    G   + Y VE+   G+++W+RV+    +K   + +    E + Y F
Sbjct: 11743 TFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKG-SIKETHYMVDRCVENQIYEF 11801

Query: 711   RVRCSNSAGVGEPSEATEVTVVGDK----LDIPKAPGKIIPSRNT---DTSV------VV 757
             RV+  N  G  +  +  EV V  D     LD+  +    + + +T   +  V       V
Sbjct: 11802 RVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEV 11861

Query: 758   SWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAA 817
             +W + KDA +L        V    + +    +  K  R        G  Y+  V A N A
Sbjct: 11862 AWTKDKDATDLTR---SPRVKIDTRADSSKFSLTKAKRSD------GGKYV--VTATNTA 11910

Query: 818   GLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYR 877
             G         A      +  P P  ++  ++   D   + W  P+  GG EI  Y +   
Sbjct: 11911 G------SFVAYATVNVLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKC 11964

Query: 878   EVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEE 937
             E    V   W   +   ++     ++ L E   Y F+V A N  G G P+         +
Sbjct: 11965 ETKRMV---WSTYSATVLTPGT-TVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTK 12020

Query: 938   WTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEA 997
             +    PG P   + ++V K+ + + W PP + G   +TGYF++ KE  +   +W  +N++
Sbjct: 12021 YD--KPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHST--RWVPVNKS 12076

Query: 998   AIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAE 1040
             AI    +KV+ L     Y FRV+A N+ G+G+PS  + PVVA+
Sbjct: 12077 AIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAK 12119



 Score =  174 bits (440), Expect = 8e-43
 Identities = 163/620 (26%), Positives = 263/620 (42%), Gaps = 82/620 (13%)

Query: 438   QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
             +P I W ++G+PL  S++V+   +  + TL+  +  KE  G YT+ +            V
Sbjct: 21220 KPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITV 21279

Query: 498   FVRDADAEIEGAPAAPL-DVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSW 556
                       G P+ P   ++  E   D +I+SW  P  +GG  I  Y I+K E    +W
Sbjct: 21280 ITL-------GPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNW 21332

Query: 557   SQ-CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKS 615
                C+   V    F V  L++   Y FRVRA N+ G+                       
Sbjct: 21333 KMVCSS--VARTTFKVPNLVKDAEYQFRVRAENRYGV----------------------- 21367

Query: 616   RPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYF-VE 674
               S P    IIV + +     +PGPP    +   T   + L+W  P   G   +  F VE
Sbjct: 21368 --SQPLVSSIIVAKHQFR---IPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVE 21422

Query: 675   KCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGD 734
             K E  +  WQ+VNT  P+    +    L EG  Y FRV   NSAG+  PS+ ++ T+   
Sbjct: 21423 KKERNSILWQKVNTS-PISGREYRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLAVS 21481

Query: 735   KLDIPKAPGKIIPSRNTDTSVVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVK 792
              +D P  P  I  +R T   + + W         ++VGY IE    G+ +W  CN   V 
Sbjct: 21482 PVDPPGTPDYIDVTRET---ITLKWNPPLRDGGSKIVGYSIEKR-QGNERWVRCNFTDVS 21537

Query: 793   GSRFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIAPPSPPCDITCLESFR 851
               ++T  GL  G  Y FR+ A NA G +S  SQ S  I  +    PP     +     + 
Sbjct: 21538 ECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPI----VEFGPEYF 21593

Query: 852   DSMVLGWKQPDKIGGAEITGYYVNYREVIDGVP---GKWREANVKAVSEEAYKISNLKEN 908
             D +++             +G  +  + ++ G P     W +  V+       +I+++  +
Sbjct: 21594 DGLIIK------------SGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGS 21641

Query: 909   MVYQFQVAAMNMAGL-------GAPSAVSEC-FKCEEWTIAVPGPPHSLKCSEVRKDSLV 960
                  + A  +  G+        + SA +E   K ++    V GP   ++ + +  + + 
Sbjct: 21642 TSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGP---IRFTNITGEKMT 21698

Query: 961   LQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVR 1020
             L W  P++ G  P+T Y ++ +E       W  + +      Y  ++ L  G  Y FRV 
Sbjct: 21699 LWWDAPLNDGCAPITHYIIEKRETSRL--AWALIEDKCEAQSYTAIK-LINGNEYQFRVS 21755

Query: 1021  AINQAGVGKPSDLAGPVVAE 1040
             A+N+ GVG+P D + PVVA+
Sbjct: 21756 AVNKFGVGRPLD-SDPVVAQ 21774



 Score =  172 bits (437), Expect = 2e-42
 Identities = 226/950 (23%), Positives = 372/950 (39%), Gaps = 134/950 (14%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P++ W    + L  +  V    + +R TLT     + D G Y + +      + +S  V 
Sbjct: 22305 PKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVV 22364

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             V      + G    P++V  + A     ++SW +P   GG+ I  Y ++K E GT +W  
Sbjct: 22365 VIGRPGPVTG----PIEVSSVSAES--CVLSWGEPKDGGGTEITNYIVEKRESGTTAWQL 22418

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
              N + VK  +  VT L +   Y FRV + N+ G+  P   S P+ A  P           
Sbjct: 22419 VNSS-VKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE-SAPIIAEHPF---------- 22466

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                              + P  PT   V   + + + + W+ P   G   I+ Y+VEK E
Sbjct: 22467 -----------------VPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKE 22509

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
               T  W + N ++P     + +  L EG  Y FR    N+AGV + SEA+   +  + +D
Sbjct: 22510 RNTILWVKEN-KVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVD 22568

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIE---ASVAGSGKWEPCNNNPVKGS 794
              P  P     +R+T  S++ S        ++VGY IE    S  G G+W  CN   V  +
Sbjct: 22569 APGRPEVTDVTRST-VSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDN 22627

Query: 795   RFTCHGLVTGQSYIFRVRAVNAAG-LSEYSQDSEAIEVKAAIAPPSPPCDITC---LESF 850
              FT   L  G +Y FRV A NAAG +S+ S+ +  +  +   APP    D      L + 
Sbjct: 22628 FFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTI 22687

Query: 851   R-------DSMVLGWKQPDKI---GGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAY 900
             R       D+ V G  +P  I   G  E+        ++ + V  ++      AV +   
Sbjct: 22688 RAGSDLVLDAAVGGKPEPKIIWTKGDKEL--------DLCEKVSLQYTGKRATAVIKFCD 22739

Query: 901   KISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLV 960
             +  + K      + +   N +G  A S + +        +  PGP   L  S V ++   
Sbjct: 22740 RSDSGK------YTLTVKNASGTKAVSVMVK-------VLDSPGPCGKLTVSRVTQEKCT 22786

Query: 961   LQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVR 1020
             L W  P   G   +T Y V+ +E       W  +        Y+  R +K    Y+FRVR
Sbjct: 22787 LAWSLPQEDGGAEITHYIVERRETSRL--NWVIVEGECPTLSYVVTRLIKNN-EYIFRVR 22843

Query: 1021  AINQAGVGKPSDLAGPVVA--------------ETRPGTKEVVVN----VDDDGVISLNF 1062
             A+N+ G G P + + P+VA              E   G + +++       D G    N+
Sbjct: 22844 AVNKYGPGVPVE-SEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNY 22902

Query: 1063  ECDKMTPKSEFSW---SKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDT 1119
               DK   KS   W   +KDYV  +            + K+T    G D    Y   VT  
Sbjct: 22903 LVDKREKKS-LRWTRVNKDYVVYD-----------TRLKVTSLMEGCD----YQFRVTAV 22946

Query: 1120  DGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKV 1179
             +   +S   +  E    ++   E  +   P  +   V+  +      W +     G   V
Sbjct: 22947 NAAGNS---EPSEASNFIS-CREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIV 23002

Query: 1180  NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVG 1239
              Y+   +E      Y++H +      E  +  L+   +  Y+F++           V V 
Sbjct: 23003 GYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQK--YSFRV---------AAVNVK 23051

Query: 1240  DVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVA-NIKKETHIVWYKD 1298
              + +  +  AE +  E I        + L   VT      L+  V+ + +    I W K 
Sbjct: 23052 GMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQ 23111

Query: 1299  EREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLV 1348
               +++     D  +    L++ + ++ DAG Y +  ++  GK KS   LV
Sbjct: 23112 GIDLASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGK-KSATVLV 23160



 Score =  169 bits (427), Expect = 3e-41
 Identities = 167/626 (26%), Positives = 253/626 (40%), Gaps = 57/626 (9%)

Query: 509   APAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFAR 568
             AP+ P  +  ++  K  + ++W +P  DGGS I GY I+    G+D W+    T VK   
Sbjct: 14592 APSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHI--TTVKGLE 14649

Query: 569   FPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVT 628
               V  L EG  Y F+V AVN  G   P R S PV   +      L  R       ++++ 
Sbjct: 14650 CVVRNLTEGEEYTFQVMAVNSAGRSAP-RESRPVIVKEQTMLPELDLRGIYQ---KLVIA 14705

Query: 629   EEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNT 688
             +         G    + +    R    ++WK               K +   +  QRVN 
Sbjct: 14706 KA--------GDNIKVEIPVLGRPKPTVTWK---------------KGDQILKQTQRVNF 14742

Query: 689   ELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAP-GKIIP 747
             E    S    + +     S  + +   N   VGE  +   + V     DIP  P G I  
Sbjct: 14743 ETTATSTILNINECVRSDSGPYPLTARNI--VGEVGDVITIQVH----DIPGPPTGPIKF 14796

Query: 748   SRNTDTSVVVSWE--ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQ 805
                +   V  SW+  E+     +  Y +E     S  W       ++ + +    L TG 
Sbjct: 14797 DEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTVIR-TTYKATRLTTGL 14855

Query: 806   SYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIG 865
              Y FRV+A N  G+      S  I        P PP         +DSM + W +P   G
Sbjct: 14856 EYQFRVKAQNRYGVGP-GITSACIVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDG 14914

Query: 866   GAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGA 925
             G+ I GY+V  +E  +G+   W+  +   V    +K S L + + Y+F+V A NMAG   
Sbjct: 14915 GSPILGYHVERKER-NGI--LWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSK 14971

Query: 926   PSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAK 985
             PS  SE     +  I  PG P  L    + + ++ L+W  P ++G   +T Y V+ ++  
Sbjct: 14972 PSKPSEPMLALD-PIDPPGKPVPLN---ITRHTVTLKWAKPEYTGGFKITSYIVEKRDLP 15027

Query: 986   AKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG-VGKPSDLAGPVVAETRPG 1044
                 +W   N + I      V GL E  +Y FRV A N AG +  PS+ +  +       
Sbjct: 15028 --NGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVE 15085

Query: 1045  TKEVVVNVD-DDGVI-----SLNFECDKM-TPKSEFSWSKDYVSTEDSPRLEVESKGNKT 1097
               ++ V+V   D VI     +   E D    P     WSKD    E + +LE++     T
Sbjct: 15086 APKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFST 15145

Query: 1098  KMTFKDLGMDDLGIYSCDVTDTDGIA 1123
              +  KD    D G Y+   T+  G A
Sbjct: 15146 NLVNKDSTRRDSGAYTLTATNPGGFA 15171



 Score =  168 bits (425), Expect = 4e-41
 Identities = 215/837 (25%), Positives = 338/837 (40%), Gaps = 135/837 (16%)

Query: 292   ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESR-YGM------HTLEINGCDF 344
             E  +L C I G P P + WY+           GK +I+SR Y M      HTL +   + 
Sbjct: 24176 EAAQLSCQIVGRPLPDIKWYRF----------GKELIQSRKYKMSSDGRTHTLTVMTEEQ 24225

Query: 345   EDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFE 404
             ED   Y   A N  GE+   + ++++         +FH G    PL              
Sbjct: 24226 EDEGVYTCIATNEVGEVETSSKLLLQA------TPQFHPG---YPLK------------- 24263

Query: 405   IHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGER 464
                 +K+   +G  G T+ L    +  P      P + W+     L  S+ + T+ + E 
Sbjct: 24264 ----EKY---YGAVGSTLRLHVMYIGRPV-----PAMTWFHGQKLLQNSENI-TIENTEH 24310

Query: 465   AT-LTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDA--DAEIEGAPAAPLDVKCLEA 521
              T L   ++ +        +   G+Y  Q S      DA  D EI+  P  P     +EA
Sbjct: 24311 YTHLVMKNVQR--------KTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEA 24362

Query: 522   N-KDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSY 580
               K+  +ISWK PA DGGS I  Y ++KCE    +  Q   + +      +  L E   Y
Sbjct: 24363 LLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGY 24422

Query: 581   IFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGP 640
              FRV A N  GI  P  VS  V    P EK                           PG 
Sbjct: 24423 YFRVSAQNTFGISDPLEVSSVVIIKSPFEK---------------------------PGA 24455

Query: 641   PTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFAL 699
             P   ++T  T+   V++WKPP   G   I  Y++EK E     W  V TE  ++   F++
Sbjct: 24456 PGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTE-EIRETVFSV 24514

Query: 700   FDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIP-KAPGKIIPSRNTD----TS 754
              +L EG  Y FRV+C N  G  E SE +E   +  K D+P +AP      RN +    ++
Sbjct: 24515 KNLIEGLEYEFRVKCENLGGESEWSEISE--PITPKSDVPIQAPHFKEELRNLNVRYQSN 24572

Query: 755   VVVSWEESKDAKELVGYYIEAS--VAGSGKWEPCNNNPVKGS--RFTCHGLVTGQSYIFR 810
               +  + +   K +V +Y +    +A   K+        KG   +     +    + +++
Sbjct: 24573 ATLVCKVTGHPKPIVKWYRQGKEIIADGLKY---RIQEFKGGYHQLIIASVTDDDATVYQ 24629

Query: 811   VRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEIT 870
             VRA N  G S     S  +EV A I  P     +  + + R   V+  K P   G  +  
Sbjct: 24630 VRATNQGG-SVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGE-VVSIKIPFS-GKPDPV 24686

Query: 871   GYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVS 930
               +   +++ID   G ++    ++ +   +  + ++      + V A N  G+       
Sbjct: 24687 ITWQKGQDLIDN-NGHYQVIVTRSFTSLVFP-NGVERKDAGFYVVCAKNRFGIDQ----- 24739

Query: 931   ECFKCEEWTIA-VPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKED 989
                K  E  +A VP PP  +K S+V +DS+ L W  P   G + +T Y V+  +     +
Sbjct: 24740 ---KTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVE--KCATTAE 24794

Query: 990   QWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVV 1049
             +W  + +A  +     V  L    SY FRV A N+ G+ KPS+ + P + +     K   
Sbjct: 24795 RWLRVGQA--RETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKE---DKTRA 24849

Query: 1050  VNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLE-------VESKGNKTKM 1099
             +N D++   +      K +  S     + Y+  ED  R E       VE+   KT M
Sbjct: 24850 MNYDEEVDETREVSMTKASHSSTKELYEKYMIAEDLGRGEFGIVHRCVETSSKKTYM 24906



 Score =  167 bits (423), Expect = 7e-41
 Identities = 186/737 (25%), Positives = 305/737 (41%), Gaps = 84/737 (11%)

Query: 638   PGPPTD-LSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSP 695
             PGPP   +     +   + LSW PP   G   I  Y +EK EA  + W  V++E   K  
Sbjct: 9845  PGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSE--PKEC 9902

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSV 755
              + +  L EG  Y FR+   N  G+GEP ++ E     +   +P AP K   S  T  S+
Sbjct: 9903  TYTIPKLLEGHEYVFRIMAQNKYGIGEPLDS-EPETARNLFSVPGAPDKPTVSSVTRNSM 9961

Query: 756   VVSWEESK--DAKELVGYYIEASVAGSGKWEPCNNNPVK----GSRFTCHGLVTGQSYIF 809
              V+WEE +      + GY++E     S +W+  N +P+K    G  +   GL+ G  Y F
Sbjct: 9962  TVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQF 10021

Query: 810   RVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEI 869
             RV A+NAAG+   S  S+    +  IAPP PP      +  + S  L W  P K GG+++
Sbjct: 10022 RVYAINAAGVGPASLPSDPATARDPIAPPGPPFP-KVTDWTKSSADLEWSPPLKDGGSKV 10080

Query: 870   TGYYVNYREVIDGVPGK--WREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPS 927
             TGY V Y+E      GK  W +   K V      ++ LKE   Y+F+V A+N+AG+G P 
Sbjct: 10081 TGYIVEYKE-----EGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPG 10135

Query: 928   AVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVH-----SGRTPVTGYFVDLK 982
              V++  + ++  ++   P   L  S   +D +V+     +      SG+ P T   V   
Sbjct: 10136 EVTDVIEMKDRLVS---PDLQLDASV--RDRIVVHAGGVIRIIAYVSGKPPPT---VTWN 10187

Query: 983   EAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPS------DLAGP 1036
               +    Q   +   AI +  + ++  +     V+ + A N+AG  K +      D+ GP
Sbjct: 10188 MNERTLPQEATIETTAISSSMV-IKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGP 10246

Query: 1037  VVAETRPGTKEVVVNVDDDGVISLNF--ECDKMTPKSEFSWSKDYVSTEDSPRLEVESKG 1094
             V      GT  +  N+ ++      F  E D  +P + +   K     E   R       
Sbjct: 10247 V------GTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEK----RESDRRAWTPVTY 10296

Query: 1095  NKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSEL 1154
               T+      G+     Y   +   + I     ++  E    L +      P  P   +L
Sbjct: 10297 TVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEA---LVIREPITVPERP--EDL 10351

Query: 1155  AVEILEKGQVRFWMQAEKLSGNAKV-NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQ 1213
              V+ + K  V       K  G +++ NY+   + I      K H   N  ++        
Sbjct: 10352 EVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLI---GTEKFHKVTNDNLLSRKYTVKG 10408

Query: 1214  DEDEGTYTFQLQ------DGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEY 1267
              ++  TY +++        GK +  +  +   D         +F+ +  IR  G  F   
Sbjct: 10409 LKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIRV-GEAFA-- 10465

Query: 1268  LSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKK-- 1325
                 +TG  +   K KV+         W+KDE ++  D++   K    TL + +   K  
Sbjct: 10466 ----LTGRYSGKPKPKVS---------WFKDEADVLEDDRTHIKTTPATLALEKIKAKRS 10512

Query: 1326  DAGIYEVILKDDRGKDK 1342
             D+G Y V++++  G  K
Sbjct: 10513 DSGKYCVVVENSTGSRK 10529



 Score =  167 bits (423), Expect = 7e-41
 Identities = 226/924 (24%), Positives = 354/924 (38%), Gaps = 117/924 (12%)

Query: 439   PEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVF 498
             P  +W + G  +S    + T  S     L     ++ D G Y + +       + + Y+ 
Sbjct: 23794 PICKWTKEGQDISKRAMIAT--SETHTELVIKEADRGDSGTYDLVLE--NKCGKKAVYIK 23849

Query: 499   VRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQ 558
             VR   +    +P  PL+   ++     + +SW+ PA DGG+ ILGY +++ EV   +W  
Sbjct: 23850 VRVIGSP--NSPEGPLEYDDIQVRS--VRVSWRPPADDGGADILGYILERREVPKAAWYT 23905

Query: 559   CNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPS 618
               D+ V+     V GL E   Y FRV A N+ GI  P +  EPV    P           
Sbjct: 23906 I-DSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTP----------- 23953

Query: 619   APWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
                    +   E PS      PP    V + T+S V LSW  P   G   +  Y++E+ E
Sbjct: 23954 -------LNPPEPPS-----NPP---EVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKE 23998

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
               T+ W R N +  + +  + +  L     Y FR+   N  G+ E S A+E  V  D  D
Sbjct: 23999 TSTDKWVRHN-KTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFD 24057

Query: 738   IPKAPGKIIPSRNTDTSVVVSWE--ESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSR 795
              P  PG++     +  SV + WE  E    KE++GY++E   +G   W+  N   +K  +
Sbjct: 24058 KPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQ 24117

Query: 796   FTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMV 855
             FT  GL+    Y FRV A N  GLS   +   A+ +K  +     P         R  M 
Sbjct: 24118 FTIGGLLEATEYEFRVFAENETGLSRPRR--TAMSIKTKLTSGEAP-------GIRKEMK 24168

Query: 856   LGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQV 915
                    K+G A      +  R + D    KW     + +    YK+S+           
Sbjct: 24169 ---DVTTKLGEAAQLSCQIVGRPLPD---IKWYRFGKELIQSRKYKMSSDGRTHTLTVMT 24222

Query: 916   AAMNMAGLGAPSAVSECFKCEEWTIAV--------PGPPHSLKCSEVRKDSLVLQWKPPV 967
                   G+    A +E  + E  +  +        PG P   K       +L L     +
Sbjct: 24223 EEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLH---VM 24279

Query: 968   HSGR-TPVTGYFVDLKEAKAKE----DQWRGLNEAAIKNVYLKVRG--LKEGVSYVF-RV 1019
             + GR  P   +F   K  +  E    +         +KNV  K      K  +S VF  V
Sbjct: 24280 YIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTV 24339

Query: 1020  RAINQAGV-GKPSDLAGPVVAETRPGTKEVV---VNVDDDGVISLNFECDKMTPKSEFSW 1075
              AI    +  KP    GP+V E       V+      DD G    N+  +K   K    W
Sbjct: 24340 DAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEW 24399

Query: 1076  SKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKR 1135
                           V S  + T     +L  +    +     +T GI+     D  E+  
Sbjct: 24400 QL------------VSSAISVTTCRIVNLTENAGYYFRVSAQNTFGIS-----DPLEVSS 24442

Query: 1136  LLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKV-NYIFNEKEIFEGPKY 1194
             ++ +    + P  P K  +   + +   V  W +     G AK+ NY   ++E     K 
Sbjct: 24443 VVIIKSPFEKPGAPGKPTITA-VTKDSCVVAW-KPPASDGGAKIRNYYLEKRE----KKQ 24496

Query: 1195  KMHIDRNTGIIEMFMEKLQDEDEG-TYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQR 1253
                I   T  I   +  +++  EG  Y F++   K  N        ++ + +  +++   
Sbjct: 24497 NKWISVTTEEIRETVFSVKNLIEGLEYEFRV---KCENLGGESEWSEISEPITPKSD--- 24550

Query: 1254  QEWIRKQGPHFVEYL-SWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVD----EKH 1308
                +  Q PHF E L +  V  + N  L CKV    K   + WY+  +EI  D       
Sbjct: 24551 ---VPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPI-VKWYRQGKEIIADGLKYRIQ 24606

Query: 1309  DFKDGICTLLITEFSKKDAGIYEV 1332
             +FK G   L+I   +  DA +Y+V
Sbjct: 24607 EFKGGYHQLIIASVTDDDATVYQV 24630



 Score =  160 bits (404), Expect = 1e-38
 Identities = 162/640 (25%), Positives = 260/640 (40%), Gaps = 84/640 (13%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARF 569
             PA   D+   ++ K  +I+SW +P  DGGS I  Y +++   G  +WS    +  K    
Sbjct: 21091 PAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGIS--KTCEI 21148

Query: 570   PVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTE 629
              V+ L E     FRV A N+ G+      S+PV                 P T + ++  
Sbjct: 21149 EVSQLKEQSVLEFRVFAKNEKGL------SDPVTI--------------GPITVKELIIT 21188

Query: 630   EEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTE 689
              E     +PG    + +       +    KP                   + +W  +   
Sbjct: 21189 PEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKP-----------------SISW--LKDG 21229

Query: 690   LPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSE---------ATEVTVVGDKLDIPK 740
             LP+K   F  F   E K     ++ +     G+ +          A  +TV+   L  P 
Sbjct: 21230 LPLKESEFVRFSKTENK-ITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVI--TLGPPS 21286

Query: 741   AP-GKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPVKGSRFT 797
              P G I        SV++SW+  +D    E+  Y IE        W+   ++ V  + F 
Sbjct: 21287 KPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCSS-VARTTFK 21345

Query: 798   CHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLG 857
                LV    Y FRVRA N  G+S+    S  I  K     P PP          D M L 
Sbjct: 21346 VPNLVKDAEYQFRVRAENRYGVSQ-PLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLT 21404

Query: 858   WKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAA 917
             W  P   GG+E+TG++V  +E    +   W++ N   +S   Y+ + L E + YQF+V A
Sbjct: 21405 WDAPVYDGGSEVTGFHVEKKERNSIL---WQKVNTSPISGREYRATGLVEGLDYQFRVYA 21461

Query: 918   MNMAGLGAPSAVSECFKCEEWTIAVP--GPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVT 975
              N AGL +PS  S      ++T+AV    PP +    +V ++++ L+W PP+  G + + 
Sbjct: 21462 ENSAGLSSPSDPS------KFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIV 21515

Query: 976   GYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG-VGKPSDLA 1034
             GY ++ ++     ++W   N   +      V GL  G  Y FR+ A N  G +  PS  +
Sbjct: 21516 GYSIEKRQG---NERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSS 21572

Query: 1035  GPVVAETRPGTKEVVVNVDD---DGVISLNFECDKM------TPKSEFSWSKDYVSTEDS 1085
             G ++  TR      +V       DG+I  + E  ++       P    +W KD V  E  
Sbjct: 21573 GIIM--TRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKR 21630

Query: 1086  PRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASS 1125
               +E+      T +  +D   D  G+Y+ +  +  G A +
Sbjct: 21631 MNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKA 21670



 Score =  159 bits (401), Expect = 3e-38
 Identities = 182/772 (23%), Positives = 309/772 (40%), Gaps = 102/772 (13%)

Query: 274   LHAPEFIIKP-RSHTVWEK--ENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIES 330
             L  PE  +K   SHTV+ +   N+K+   I+G P P+VT  ++ VP+       ++  E 
Sbjct: 20099 LEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATM---RFNTEI 20155

Query: 331   RYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPL 390
                  T+ +      D  +Y  +A N  G   A+ ++VV              G  T P+
Sbjct: 20156 TAENLTINLKESVTADAGRYEITAANSSGTTKAFINIVVLD----------RPGPPTGPV 20205

Query: 391   SFG-VTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVP 449
                 +T      ++E     K+D            G +V     +K              
Sbjct: 20206 VISDITEESVTLKWE---PPKYDG-----------GSQVTNYILLKR------------E 20239

Query: 450   LSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRV--RMGEYYEQYSAYVFVRDADAEIE 507
              S + W +   +  R  +    L   +E  + I+   R G      SA V V+       
Sbjct: 20240 TSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVK-LPYTTP 20298

Query: 508   GAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFA 567
             G P+ P         ++ I + W +P  +GGS ++GY ++  +  +  W + N   ++  
Sbjct: 20299 GPPSTPW---VTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTT 20355

Query: 568   RFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIV 627
              F VT +  G  Y FRV A N  G+G PS  SEPV A+D  E                  
Sbjct: 20356 HFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACE------------------ 20397

Query: 628   TEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRV 686
                         PP ++ +T+ +++ V LSW+ P   G   I  Y VE+ +     W + 
Sbjct: 20398 ------------PPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKA 20445

Query: 687   NTELPVKSPRFALFDLAEGKSYCFRVRCSNSAG-VGEPSEAT-EVTVV----GDKLDIPK 740
             +    V   +F +  L +   Y FRV   N+ G +  PSE    +T +    G  +D+P 
Sbjct: 20446 SF-TNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPL 20504

Query: 741   APGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHG 800
                +++  R   +  + +    K A  +  Y  +  +  +     C  N    +      
Sbjct: 20505 EYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNAL--VCVENTTDLASILIKD 20562

Query: 801   LVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQ 860
                  S  + ++  NA G +     S  I V+    P  P   I       + + L W+ 
Sbjct: 20563 ADRLNSGCYELKLRNAMGSA-----SATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRP 20617

Query: 861   PDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNM 920
             P   GGA+IT Y V  RE    V   W   + + + E     + + +   Y F+V A+N 
Sbjct: 20618 PADDGGAKITHYIVEKRETSRVV---WSMVS-EHLEECIITTTKIIKGNEYIFRVRAVNK 20673

Query: 921   AGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVD 980
              G+G P  +       +     PGPP   + +++ K+S+ + W  P+  G + ++GYF++
Sbjct: 20674 YGIGEP--LESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLE 20731

Query: 981   LKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSD 1032
              ++ K+    W  + +  I++   KV GL E   Y +RV A+N AG G  S+
Sbjct: 20732 KRDKKSL--GWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSE 20781



 Score =  157 bits (397), Expect = 8e-38
 Identities = 160/604 (26%), Positives = 253/604 (41%), Gaps = 69/604 (11%)

Query: 438   QPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYV 497
             Q  + W ++G  L  +  V    S    +L+    +KED G Y + V            +
Sbjct: 19051 QATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITI 19110

Query: 498   FVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
              V D        P  P  ++  E + D I ISW  P  DGG  I  Y ++K E  + +W 
Sbjct: 19111 IVLDR-------PGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWH 19163

Query: 558   QCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRP 617
               +   V      +  L  G  Y FRV A N+ G    S  S  VA             P
Sbjct: 19164 IVSQA-VARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVA-----------EYP 19211

Query: 618   SAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWK-PPGQRGHEGIMYFVEKC 676
              +P                 PGPP    V  AT+S ++++W+ P    G   I Y +E  
Sbjct: 19212 FSP-----------------PGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYK 19254

Query: 677   EAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKL 736
             E  +  W + N ++ +   +  +  L EG  Y +RV   N AG+G+ S++ E     D  
Sbjct: 19255 ERSSILWSKAN-KILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPC 19313

Query: 737   DIPKAPGKIIPSRNTDTSVVVSWEES--KDAKELVGYYIEASVAGSGKWEPCNNNPVKGS 794
             D    PG+   +  T  SV + W +       ++ GY +E      G+W  CN   ++ +
Sbjct: 19314 D---PPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQET 19370

Query: 795   RFTCHGLVTGQSYIFRVRAVNAA-GLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDS 853
              F    L   Q Y FRV A NAA  +SE S+ +  I VK  + PP    D+     FRD 
Sbjct: 19371 YFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDV----KFRDV 19426

Query: 854   MVLGWKQPDKIGGAEITGY---YVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENM- 909
             +V+   +  KI  A+I G     +++ +  DG+  + R A  + +S + + +  +K+ + 
Sbjct: 19427 IVVKAGEVLKI-NADIAGRPLPVISWAK--DGIEIEER-ARTEIISTDNHTLLTVKDCIR 19482

Query: 910   --VYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHS-LKCSEVRKDSLVLQWKPP 966
                 Q+ +   N+AG       S    C+   +  PGPP   L+ + +  +   L W  P
Sbjct: 19483 RDTGQYVLTLKNVAG-----TRSVAVNCK--VLDKPGPPAGPLEINGLTAEKCSLSWGRP 19535

Query: 967   VHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAG 1026
                G   +  Y V+ +E       W  + E  ++    KV  L +G  Y+FRV  +N+ G
Sbjct: 19536 QEDGGADIDYYIVEKRE--TSHLAWT-ICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYG 19592

Query: 1027  VGKP 1030
             VG+P
Sbjct: 19593 VGEP 19596



 Score =  149 bits (375), Expect = 3e-35
 Identities = 167/712 (23%), Positives = 271/712 (38%), Gaps = 127/712 (17%)

Query: 294   VKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRAS 353
             ++L   + G P P+VTW K  +  NV       ++++   M  L I     +D+ +Y  +
Sbjct: 12252 IRLFAIVRGRPAPKVTWRKVGID-NVVRKGQVDLVDT---MAFLVIPNSTRDDSGKYSLT 12307

Query: 354   AMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDV 413
              +N  GE + + +V V    G   + +      T        P         H+     +
Sbjct: 12308 LVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHY-----I 12362

Query: 414   SFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLN 473
                RE +  +      +TPE+K                 S  V  L  G       + +N
Sbjct: 12363 VEKREADRKTWS---TVTPEVK---------------KTSFHVTNLVPGNEYYFRVTAVN 12404

Query: 474   KEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQP 533
             +   G+ T               V   D  +E    P  P  ++  E  K+   ++W  P
Sbjct: 12405 EYGPGVPT----------DVPKPVLASDPLSE----PDPPRKLEVTEMTKNSATLAWLPP 12450

Query: 534   AVDGGSPILGYFID--KCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMG 591
               DGG+ I GY     + E   D W++ +   VK     VTGL EG+ Y FRV A N +G
Sbjct: 12451 LRDGGAKIDGYITSYREEEQPADRWTEYS--VVKDLSLVVTGLKEGKKYKFRVAARNAVG 12508

Query: 592   IGF---------------PSRVSEPVA-ALDPAEKARL------KSRPSAPW-------- 621
             +                 P ++  P    +   +K R+      K  P+  W        
Sbjct: 12509 VSLPREAEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVV 12568

Query: 622   -----------TGQIIVTEE-------------EPSEGI-----------VPGPPTD-LS 645
                        +  I++ ++             E S G             PGPP     
Sbjct: 12569 TSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFD 12628

Query: 646   VTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSPRFALFDLAE 704
             +++       LSW  P + G   I  Y VEKC+    +W      +   S R     L  
Sbjct: 12629 ISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVG--KLIP 12686

Query: 705   GKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWE--ES 762
             G+ Y FRVR  N  G+ EP  + ++ V      +P  P     ++     + V+W+  +S
Sbjct: 12687 GQEYIFRVRAENRFGISEPLTSPKM-VAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDS 12745

Query: 763   KDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEY 822
                  ++GY IE     S  W   N+  V+ + + C GLV G  Y FR+ A+N AG S  
Sbjct: 12746 DGGSPIIGYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPP 12805

Query: 823   SQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDG 882
             S+ +E +  +  + PP  P     ++  + ++ L W +P   GG++I GY+V   +    
Sbjct: 12806 SKPTEYVTARMPVDPPGKP---EVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACK---- 12858

Query: 883   VPG-KWREANV--KAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSE 931
             +PG KW   N     + +E Y  + L+E   YQF+  A     +  PS  S+
Sbjct: 12859 LPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSD 12910



 Score =  144 bits (364), Expect = 5e-34
 Identities = 192/758 (25%), Positives = 305/758 (40%), Gaps = 92/758 (12%)

Query: 638  PGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFV-EKCEAGTEN--WQRVNTELPVKS 694
            P PP +L+VT+       L+W  P   G   I ++V +K +A  +   W+ V      K 
Sbjct: 9126 PSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEK- 9184

Query: 695  PRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTS 754
             R+ ++ L     Y FRVR  N  G+ +  ++ +V V+ D   +P  PGK      T  S
Sbjct: 9185 -RYGIWKLIPNGQYEFRVRAVNKYGISDECKSDKV-VIQDPYRLPGPPGKPKVLARTKGS 9242

Query: 755  VVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNPV-----KGSRFTCHGLVTGQSY 807
            ++VSW    D     + GY++E    GS  W   +  P+     KG  F    L+ G  Y
Sbjct: 9243 MLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKY 9302

Query: 808  IFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGA 867
             FR  A+NAAG+   S+ S+       I PP PP      +  + S+ LGWK P K GG+
Sbjct: 9303 QFRAMAINAAGIGPPSEPSDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGS 9362

Query: 868  EITGYYVNYREVIDGVPGKWREANV--KAVSEEAYKISNLKENMVYQFQVAAMNMAGLGA 925
             I GY V  +E  +G    W+  N   K ++     + NLKE   Y+F+V A+N AG   
Sbjct: 9363 PIKGYIVEMQE--EGTTD-WKRVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESE 9419

Query: 926  PSAVSECFKC----EEWTIAVP-GPPHSLKCSEVRKDSLVLQWKPPVHSGR-TPVTGYFV 979
            PS  +         EE  + +  G    L C    +  +     P V  GR TP + +  
Sbjct: 9420 PSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRI-----PAVIKGRPTPKSSWEF 9474

Query: 980  DLKEAKAKEDQWRGLNE-----AAIKNVYLKVRGLKEGVSYVFRVRAINQAGVG------ 1028
            D K  KA +D    + E      A  +  + +   K   +  + + A N+AG        
Sbjct: 9475 DGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRV 9534

Query: 1029 KPSDLAGP-----VVAETRPGTKEVVVNVDDDGVISLN-FECDKMTPKSEFSWSKDYVST 1082
            K  D+ GP     V   TR   +      DDDG   +  +  +K T   + +W+K     
Sbjct: 9535 KVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGK-AWTK----- 9588

Query: 1083 EDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHE 1142
                   V      T     DL  +    +     +  GI        E ++R  A    
Sbjct: 9589 -------VNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPV----ETIQRTTARDPI 9637

Query: 1143 HKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFE--GPKYKMHIDR 1200
            +  P  P+K  L + ++ K  V    +  K  G + V +   E   ++  G K +     
Sbjct: 9638 YP-PDPPIK--LKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQC 9694

Query: 1201 NTGIIEMFMEKLQDEDEG-TYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRK 1259
            N   +E     ++D  EG  Y F++   KA N + V          +  A     +  R 
Sbjct: 9695 NKRDVEELQFTVEDLVEGGEYEFRV---KAVNAAGVS---------KPSATVGPCDCQRP 9742

Query: 1260 QGPHFVEYLSW-EVTGECNVLLKCKVANIKKETHIVWYK------DEREISVDEKHDFK- 1311
              P  ++   + EV    NV +  K+  +   T + W+K      D +E  + + H  K 
Sbjct: 9743 DMPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPT-LTWFKAPPKKPDNKEPVLYDTHVNKL 9801

Query: 1312 --DGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKL 1347
              D  CTL+I +  + D G+Y +   ++ G     ++L
Sbjct: 9802 VVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRL 9839



 Score =  142 bits (357), Expect = 3e-33
 Identities = 127/419 (30%), Positives = 181/419 (43%), Gaps = 48/419 (11%)

Query: 637  VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSP 695
            VPGPP DL V++ TR    LSWK P   G + I  Y +EK     + W +VN +    S 
Sbjct: 9539 VPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCG--ST 9596

Query: 696  RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSV 755
             F + DL   + Y FRVR  N  G+G P E  + T   D +  P  P K+     T  +V
Sbjct: 9597 TFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTV 9656

Query: 756  VVSWEESK-DAKELVGYYIEASVA----GSGK--WEPCNNNPVKGSRFTCHGLVTGQSYI 808
             +SW+  K D    V +YI   +A    G+ K  W  CN   V+  +FT   LV G  Y 
Sbjct: 9657 HLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYE 9716

Query: 809  FRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAE 868
            FRV+AVNAAG+S+ S      + +    PPS       L+ F +                
Sbjct: 9717 FRVKAVNAAGVSKPSATVGPCDCQRPDMPPS-----IDLKEFMEVE-------------- 9757

Query: 869  ITGYYVNYREVIDGVPG---KWREANVKAVSEEAYKISNLKENMVYQFQVAAM------- 918
              G  VN    I GVP     W +A  K    +   + +   N +       +       
Sbjct: 9758 -EGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRR 9816

Query: 919  NMAGLGAPSAVSECFKCEEW----TIAVPGPP-HSLKCSEVRKDSLVLQWKPPVHSGRTP 973
            +  GL   +AV+      +      +  PGPP   +K   V  D + L W PP   G + 
Sbjct: 9817 SDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSK 9876

Query: 974  VTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSD 1032
            +T Y ++ +EA  K   W  ++    +  Y  +  L EG  YVFR+ A N+ G+G+P D
Sbjct: 9877 ITNYVIEKREANRK--TWVHVSSEPKECTY-TIPKLLEGHEYVFRIMAQNKYGIGEPLD 9932



 Score =  139 bits (349), Expect = 3e-32
 Identities = 161/644 (25%), Positives = 249/644 (38%), Gaps = 133/644 (20%)

Query: 510   PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDT-PVKFAR 568
             P  P  ++  ++ K  I + W +P  DGGS + GY ++  +   + W+  +    V+   
Sbjct: 20795 PGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTE 20854

Query: 569   FPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARL--------------- 613
             + V+ L  G +Y FRV AVN  G G P  ++EPV A D  E   +               
Sbjct: 20855 YVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAG 20914

Query: 614   -----------KSRPSAPW---------------------------------TGQIIVTE 629
                        +  P+  W                                 TG+ I+T 
Sbjct: 20915 EDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTI 20974

Query: 630   E----EPSEGIV-------PGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCE 677
             E    EP    V       P     L V   +R  V L W PP   G   I+ Y +EK +
Sbjct: 20975 ENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRD 21034

Query: 678   AGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLD 737
             A    W  V+ +    S  F L DL+E   + FRV   N  G+GEP E TE     +   
Sbjct: 21035 ATKRTWSVVSHKC--SSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAE--- 21089

Query: 738   IPKAPGKIIPSRNTDTSVVVSWEESK--DAKELVGYYIEASVAGSGKWEPCNNNPVKGSR 795
             +P     +    +T TSV++SW +        +  Y +E    G   W         G  
Sbjct: 21090 VPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHA------GIS 21143

Query: 796   FTCHGLVTG---QSYI-FRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFR 851
              TC   V+    QS + FRV A N  GLS+       I VK  I   +P  D++      
Sbjct: 21144 KTCEIEVSQLKEQSVLEFRVFAKNEKGLSD-PVTIGPITVKELII--TPEVDLS------ 21194

Query: 852   DSMVLGWKQPDKIGGAEIT---GYYVNYREVIDGVPG---KWREANVKAVSEEAYKISNL 905
                         I GA++T   G+ V+      G P     W +  +     E  + S  
Sbjct: 21195 -----------DIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKT 21243

Query: 906   KENMVYQFQVAAMNMAG---LGAPSAVSECFKCEEWTIAVPGPPHS----LKCSEVRKDS 958
             +  +    + A     G   +   +AV  C      T+   GPP      ++  E++ DS
Sbjct: 21244 ENKITLSIKNAKKEHGGKYTVILDNAV--CRIAVPITVITLGPPSKPKGPIRFDEIKADS 21301

Query: 959   LVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFR 1018
             ++L W  P  +G   +T Y ++ +E    +  W+ +  +  +  + KV  L +   Y FR
Sbjct: 21302 VILSWDVPEDNGGGEITCYSIEKRE--TSQTNWKMVCSSVARTTF-KVPNLVKDAEYQFR 21358

Query: 1019  VRAINQAGVGKPSDLAGPVVAETR-----PGTKEVVVNVDDDGV 1057
             VRA N+ GV +P  ++  +VA+ +     P  K V+ NV  DG+
Sbjct: 21359 VRAENRYGVSQPL-VSSIIVAKHQFRIPGPPGKPVIYNVTSDGM 21401



 Score =  134 bits (338), Expect = 5e-31
 Identities = 127/462 (27%), Positives = 199/462 (43%), Gaps = 40/462 (8%)

Query: 638   PGPPTD-LSVTEATRSYVVLSWKPPGQRGHEGIM-YFVEKCEAGTENWQRVNTELPVKSP 695
             PGPPT  + +++ T   V L W+PP   G   +  Y + K E  T  W  V+    V   
Sbjct: 20198 PGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSAT--VART 20255

Query: 696   RFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDI--PKAPGKIIPSRNTDT 753
                +  L  G+ Y FR++  N  G+ +  ++  VTV   KL    P  P     +  T  
Sbjct: 20256 MMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTV---KLPYTTPGPPSTPWVTNVTRE 20312

Query: 754   SVVVSWEE--SKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRV 811
             S+ V W E  S     +VGY++E     S  W+  N   ++ + F    +  G  Y FRV
Sbjct: 20313 SITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRV 20372

Query: 812   RAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITG 871
              A NAAG+ + S  SE +    AI    PP ++   +  ++S+ L W+QP   GG++ITG
Sbjct: 20373 YAENAAGVGKPSHPSEPV---LAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITG 20429

Query: 872   YYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAG-LGAPSAVS 930
             Y V  R++ D   G+W +A+   V+E  + IS L +N  Y+F+V A N  G +  PS V 
Sbjct: 20430 YIVERRDLPD---GRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVV 20486

Query: 931   ECFKCEEWTIAVPGPPHSLKCSEVRK--DSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKE 988
                 C + +   P     L+ +EV K      ++ +  +     P   ++ D KE +   
Sbjct: 20487 GPITCID-SYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNA 20545

Query: 989   ----DQWRGLNEAAIKNV--------YLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGP 1036
                 +    L    IK+          LK+R      S   RV+ ++     KP    GP
Sbjct: 20546 LVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILD-----KPGPPGGP 20600

Query: 1037  VVAETRPGTKEVVV--NVDDDGVISLNFECDKMTPKSEFSWS 1076
             +  +T    K  ++     DDG   +     +    S   WS
Sbjct: 20601 IEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWS 20642



 Score =  129 bits (323), Expect = 3e-29
 Identities = 123/466 (26%), Positives = 184/466 (39%), Gaps = 48/466 (10%)

Query: 502  ADAEIEG----APAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWS 557
            +D E+ G     P  P   +  +  K  I + WK PA DGGSPI GY ++  E GT  W 
Sbjct: 9321 SDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWK 9380

Query: 558  QCN--DTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKS 615
            + N  D  +      V  L E R Y FRV+AVN+ G   PS  +  + A D  E+  +  
Sbjct: 9381 RVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFI 9440

Query: 616  RPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGH---EGIMYF 672
               A          +     ++ G PT  S           SW+  G+      +G+   
Sbjct: 9441 DIGAQDCLVCKAGSQIRIPAVIKGRPTPKS-----------SWEFDGKAKKAMKDGVHDI 9489

Query: 673  VEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVV 732
             E  +  T             S    + +     +  + +   N AG    +   +V   
Sbjct: 9490 PEDAQLETAE----------NSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKV--- 9536

Query: 733  GDKLDIPKAPGKIIPSRNTDTSVVVSWEESKD--AKELVGYYIEASVAGSGKWEPCNNNP 790
               +D+P  P  +  S  T  S  +SW+   D     + GY IE        W   N  P
Sbjct: 9537 ---MDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVN--P 9591

Query: 791  VKGSR-FTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLES 849
              GS  F    L++ Q Y FRVRA N  G+    +  +    +  I PP PP  +     
Sbjct: 9592 DCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLI 9651

Query: 850  FRDSMVLGWKQPDKIGGAEITGYYVNYR--EVIDGVPGKWREANVKAVSEEAYKISNLKE 907
             ++++ L WK P   GG+ +T Y V     +        WR+ N + V E  + + +L E
Sbjct: 9652 TKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVE 9711

Query: 908  NMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSE 953
               Y+F+V A+N AG+  PSA      C+      P  P S+   E
Sbjct: 9712 GGEYEFRVKAVNAAGVSKPSATVGPCDCQR-----PDMPPSIDLKE 9752



 Score =  109 bits (273), Expect = 2e-23
 Identities = 85/306 (27%), Positives = 139/306 (45%), Gaps = 18/306 (5%)

Query: 829   IEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWR 888
             ++V+    P  P   I      ++S V+ WK P   GG+ IT Y V   E  +G   +W+
Sbjct: 24343 LDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGA--EWQ 24400

Query: 889   EANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHS 948
               +  A+S    +I NL EN  Y F+V+A N  G+  P  VS     +      PG P  
Sbjct: 24401 LVS-SAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKS-PFEKPGAPGK 24458

Query: 949   LKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRG 1008
                + V KDS V+ WKPP   G   +  Y+++ +E K  +++W  +    I+     V+ 
Sbjct: 24459 PTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKK--QNKWISVTTEEIRETVFSVKN 24516

Query: 1009  LKEGVSYVFRVRAINQAGVGKPSDLAGPVVAET-----RPGTKEVVVNVDDDGVISLNFE 1063
             L EG+ Y FRV+  N  G  + S+++ P+  ++      P  KE + N++     +    
Sbjct: 24517 LIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLV 24576

Query: 1064  CDKMT--PKSEFSW---SKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTD 1118
             C K+T  PK    W    K+ ++     R++ E KG   ++    +  DD  +Y    T+
Sbjct: 24577 C-KVTGHPKPIVKWYRQGKEIIADGLKYRIQ-EFKGGYHQLIIASVTDDDATVYQVRATN 24634

Query: 1119  TDGIAS 1124
               G  S
Sbjct: 24635 QGGSVS 24640



 Score = 94.0 bits (232), Expect = 1e-18
 Identities = 83/340 (24%), Positives = 135/340 (39%), Gaps = 45/340 (13%)

Query: 274   LHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKY-IIESRY 332
             + AP F  + R+  V  + N  L C + G P+P V WY+      + A+  KY I E + 
Sbjct: 24553 IQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGK--EIIADGLKYRIQEFKG 24610

Query: 333   GMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSF 392
             G H L I     +D   Y+  A N  G +S  AS+ V+         + H   +   +  
Sbjct: 24611 GYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVE------VPAKIHLPKTLEGMGA 24664

Query: 393   GVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSP 452
                  G     +I F  K D                          P I W +    +  
Sbjct: 24665 VHALRGEVVSIKIPFSGKPD--------------------------PVITWQKGQDLIDN 24698

Query: 453   SKWVQTLWSGERATLTFSH-LNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPA 511
             +   Q + +    +L F + + ++D G Y +  +     +Q       +  + ++   P 
Sbjct: 24699 NGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQ-------KTVELDVADVPD 24751

Query: 512   APLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPV 571
              P  VK  + ++D + ++W +PA DGGS I  Y ++KC    + W +      +  R+ V
Sbjct: 24752 PPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQ--ARETRYTV 24809

Query: 572   TGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKA 611
               L    SY FRV A NK G+  PS  SEP    +   +A
Sbjct: 24810 INLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRA 24849



 Score = 77.8 bits (190), Expect = 8e-14
 Identities = 58/224 (25%), Positives = 109/224 (48%), Gaps = 17/224 (7%)

Query: 157   ERIKEAAAYIAQRNLLASEEGITTSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTA 216
             E +K++AA   +++++  E  IT + Q++   +T A  ++ +++ S    Q    + + A
Sbjct: 26634 EEVKKSAATSLEKSIVHEE--ITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIA 26691

Query: 217   SRQSVV----SKQATSALQQEETSEKKSRKVVIREKAER-----LSLRKTLEETET--YH 265
                 V       + T++ +         + + I++ + R       + KT E      Y 
Sbjct: 26692 GATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYD 26751

Query: 266   AKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGK 325
               L+++ L  AP FI +PRS  + E +NV   C I+G P P + W+KN +PI++ +N   
Sbjct: 26752 LTLSKE-LSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVS- 26809

Query: 326   YIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGELSAYASVVV 369
               I     +++LEI      D+ +Y   A N +G+ SA AS++V
Sbjct: 26810 --ISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV 26851



 Score = 77.0 bits (188), Expect = 1e-13
 Identities = 112/520 (21%), Positives = 196/520 (37%), Gaps = 54/520 (10%)

Query: 1062 FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1121
            FEC+   P     W KD    + + R++++ +    ++      M D G Y+  V     
Sbjct: 3031 FECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYT--VVAGGN 3088

Query: 1122 IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQ--VRFWMQAEKLSGNAKV 1179
            ++++ L  E    R+ ++  E             V+++EK +  V F +  + +  +   
Sbjct: 3089 VSTAKLFVEGRDVRIRSIKKE-------------VQVIEKQRAVVEFEVNEDDVDAHWYK 3135

Query: 1180 NYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVG 1239
            + I    ++ E  KY   ++R   I  MF+ + +  D G YTF        N S+V L  
Sbjct: 3136 DGIEINFQVQERHKYV--VERR--IHRMFISETRQSDAGEYTFVA----GRNRSSVTLYV 3187

Query: 1240 DVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDE 1299
            +  +  Q   E Q       +   F                 C V + + +  I WYK+E
Sbjct: 3188 NAPEPPQVLQELQPVTVQSGKPARF-----------------CAVISGRPQPKISWYKEE 3230

Query: 1300 REISVDEKHDF-KDGI-CTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMM 1357
            + +S   K  F  DG   TLL+ E   +DA +Y    K+D G   +   L  E  + +  
Sbjct: 3231 QLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSP 3290

Query: 1358 EVCKKIALSA--TDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTG 1415
            +    +   A  T L+   T+EG            DLKV+W      I+ S   +     
Sbjct: 3291 DQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFE 3350

Query: 1416 EQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLK-QAAIAEKN 1474
            +   L+I E  P D+G Y     +       T +LS + + +        +   +++   
Sbjct: 3351 DTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEGFSKFEENTSNSQWHVSLSVSF 3410

Query: 1475 RARVLGGLPDVV------TIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFE 1528
            +   LG  P  +       +  G+ +     V G P PE+ W  N++ +         FE
Sbjct: 3411 KKEPLGQKPSFIQPLSSLRVHNGETVRFHARVSGIPKPEIQWFHNQQLILPTKDVVFHFE 3470

Query: 1529 AGR-TAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSV 1567
                 A   I    +  +G+Y     N  G  T   T++V
Sbjct: 3471 ESTGMALMLIVDAYSEHAGQYSCKAANSAGEATCAATLTV 3510



 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 104/533 (19%), Positives = 203/533 (38%), Gaps = 97/533 (18%)

Query: 1062 FECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTDG 1121
            F C+  T  ++  W ++  +  DS +  +  K     +  +D  +DD   Y+  +T+  G
Sbjct: 6287 FNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRG 6346

Query: 1122 ----IASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNA 1177
                 A++ +++EE+L+ +            P+K    +E +EK  V FW +  +L  N 
Sbjct: 6347 ENVKSAANLIVEEEDLRIV-----------EPLKD---IETMEKKSVTFWCKVNRL--NV 6390

Query: 1178 KVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVL 1237
             + +  N +E+    +    +D+   ++ +  +     DEG Y       K+     ++ 
Sbjct: 6391 TLKWTKNGEEVPFDNRVSYRVDKYKHMLTI--KDCGFPDEGEYIVTAGQDKSVAELLII- 6447

Query: 1238 VGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECN-VLLKCKVANIKKETHIVWY 1296
                                 +    FVE+L  +   E +  +  C+++  +++ ++ WY
Sbjct: 6448 ---------------------EAPTEFVEHLEDQTVTEFDDAVFSCQLS--REKANVKWY 6484

Query: 1297 KDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKE-- 1354
            ++ REI   +K+ F+             KD  I+ +I+KD R  D+       E  K   
Sbjct: 6485 RNGREIKEGKKYKFE-------------KDGSIHRLIIKDCRLDDECEYACGVEDRKSRA 6531

Query: 1355 --LMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTG 1412
               + E+  +I     D+     A G  +        + ++V W  N   +   D+ +  
Sbjct: 6532 RLFVEEIPVEIIRPPQDIL---EAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMM 6588

Query: 1413 VTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQAAIAE 1472
              G+   LQI +  P D+G+Y     D                 EA A+ +      I  
Sbjct: 6589 SEGKIHRLQICDIKPRDQGEYRFIAKD----------------KEARAKLELAAAPKIKT 6632

Query: 1473 KNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGRT 1532
             ++  V         +  GK L +       P  E  W K  + L++     +   A +T
Sbjct: 6633 ADQDLV---------VDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTK---TIDTTAEQT 6680

Query: 1533 AYFTINGVSTAD