BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|30410047 late cornified envelope 2C [Homo sapiens] (110 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|30410047 late cornified envelope 2C [Homo sapiens] 268 5e-73 gi|30410043 late cornified envelope 2D [Homo sapiens] 259 2e-70 gi|7657685 late cornified envelope 2B [Homo sapiens] 254 8e-69 gi|30410045 late cornified envelope 2A [Homo sapiens] 229 5e-61 gi|239752912 PREDICTED: hypothetical protein [Homo sapiens] 176 5e-45 gi|30387650 late cornified envelope 1E [Homo sapiens] 176 5e-45 gi|30387646 late cornified envelope 1F [Homo sapiens] 174 2e-44 gi|30410035 late cornified envelope 5A [Homo sapiens] 172 5e-44 gi|30387652 late cornified envelope 1C [Homo sapiens] 172 7e-44 gi|30387648 late cornified envelope 1D [Homo sapiens] 171 9e-44 gi|30387656 late cornified envelope 1B [Homo sapiens] 169 6e-43 gi|30387654 late cornified envelope 1A [Homo sapiens] 167 1e-42 gi|30387642 late cornified envelope 4A [Homo sapiens] 134 2e-32 gi|14211869 late cornified envelope 3D [Homo sapiens] 118 1e-27 gi|30410033 late cornified envelope 3E [Homo sapiens] 117 2e-27 gi|30410041 late cornified envelope 3B [Homo sapiens] 112 8e-26 gi|30410037 late cornified envelope 3C [Homo sapiens] 102 7e-23 gi|30410039 late cornified envelope 3A [Homo sapiens] 100 3e-22 gi|62945419 small proline-rich protein 2F [Homo sapiens] 57 3e-09 gi|62122851 small proline-rich protein 2G [Homo sapiens] 56 7e-09 gi|83582817 small proline-rich protein 2E [Homo sapiens] 55 9e-09 gi|9506923 cysteine-rich C-terminal 1 [Homo sapiens] 54 4e-08 gi|83582815 small proline-rich protein 1B [Homo sapiens] 54 4e-08 gi|45827734 small proline-rich protein 1A [Homo sapiens] 54 4e-08 gi|58082087 late cornified envelope-like proline-rich 1 [Homo sa... 52 8e-08 gi|5174693 small proline-rich protein 2A [Homo sapiens] 52 1e-07 gi|62955831 small proline-rich protein 2B [Homo sapiens] 52 1e-07 gi|13994372 keratin associated protein 17-1 [Homo sapiens] 50 5e-07 gi|169212028 PREDICTED: keratin-associated protein 9-2-like 2-li... 49 9e-07 gi|153218552 keratin associated protein 9.8 [Homo sapiens] 49 1e-06 >gi|30410047 late cornified envelope 2C [Homo sapiens] Length = 110 Score = 268 bits (686), Expect = 5e-73 Identities = 110/110 (100%), Positives = 110/110 (100%) Query: 1 MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSS 60 MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSS Sbjct: 1 MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSS 60 Query: 61 GGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC 110 GGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC Sbjct: 61 GGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC 110 >gi|30410043 late cornified envelope 2D [Homo sapiens] Length = 110 Score = 259 bits (663), Expect = 2e-70 Identities = 106/110 (96%), Positives = 106/110 (96%) Query: 1 MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSS 60 MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPC PAVSSCCGPSSGSCCGPSS Sbjct: 1 MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCSPAVSSCCGPSSGSCCGPSS 60 Query: 61 GGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC 110 GGCCSSG GGC LSHHRPRLFHRRRHQSPDCCESEPSG SGCCHSSGGCC Sbjct: 61 GGCCSSGGGGCCLSHHRPRLFHRRRHQSPDCCESEPSGASGCCHSSGGCC 110 >gi|7657685 late cornified envelope 2B [Homo sapiens] Length = 110 Score = 254 bits (650), Expect = 8e-69 Identities = 104/110 (94%), Positives = 105/110 (95%) Query: 1 MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSS 60 MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKC PQCPAPC PAVSSCCGP SG CCGPSS Sbjct: 1 MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCLPQCPAPCSPAVSSCCGPISGGCCGPSS 60 Query: 61 GGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC 110 GGCC+SGAGGC LSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC Sbjct: 61 GGCCNSGAGGCCLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC 110 >gi|30410045 late cornified envelope 2A [Homo sapiens] Length = 106 Score = 229 bits (583), Expect = 5e-61 Identities = 96/110 (87%), Positives = 96/110 (87%), Gaps = 4/110 (3%) Query: 1 MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSS 60 MSCQQNQQQCQPPPKCPPKC PPKCPPKC PQCPAPC P VSSCCGPSSG CCG SS Sbjct: 1 MSCQQNQQQCQPPPKCPPKC----PPKCPPKCRPQCPAPCPPPVSSCCGPSSGGCCGSSS 56 Query: 61 GGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC 110 GGCCSSG GGC LSHHRPRLFHR RHQSPDCCE EPSGGSGCCHSSG CC Sbjct: 57 GGCCSSGGGGCCLSHHRPRLFHRHRHQSPDCCECEPSGGSGCCHSSGDCC 106 >gi|239752912 PREDICTED: hypothetical protein [Homo sapiens] Length = 118 Score = 176 bits (445), Expect = 5e-45 Identities = 80/119 (67%), Positives = 85/119 (71%), Gaps = 10/119 (8%) Query: 1 MSCQQNQQQCQPPPKCPPKCTPKCP-PKCPPKCPPQCP---APCFPAVSSCCGPSSGSCC 56 MSCQQ+QQQCQPPPKC PKC PKCP PKCPPKCPP+CP + C + CCG SSG C Sbjct: 1 MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSC 60 Query: 57 GPSSGGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCC-----HSSGGCC 110 G SSGGCCSSG GGC LSHHR HR R QS DCC S+PSGGS CC SGGCC Sbjct: 61 GSSSGGCCSSGGGGCCLSHHRHHRSHRHRPQSSDCC-SQPSGGSSCCGGGSGQHSGGCC 118 >gi|30387650 late cornified envelope 1E [Homo sapiens] Length = 118 Score = 176 bits (445), Expect = 5e-45 Identities = 80/119 (67%), Positives = 85/119 (71%), Gaps = 10/119 (8%) Query: 1 MSCQQNQQQCQPPPKCPPKCTPKCP-PKCPPKCPPQCP---APCFPAVSSCCGPSSGSCC 56 MSCQQ+QQQCQPPPKC PKC PKCP PKCPPKCPP+CP + C + CCG SSG C Sbjct: 1 MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSC 60 Query: 57 GPSSGGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCC-----HSSGGCC 110 G SSGGCCSSG GGC LSHHR HR R QS DCC S+PSGGS CC SGGCC Sbjct: 61 GSSSGGCCSSGGGGCCLSHHRHHRSHRHRPQSSDCC-SQPSGGSSCCGGGSGQHSGGCC 118 >gi|30387646 late cornified envelope 1F [Homo sapiens] Length = 118 Score = 174 bits (440), Expect = 2e-44 Identities = 78/119 (65%), Positives = 83/119 (69%), Gaps = 10/119 (8%) Query: 1 MSCQQNQQQCQPPPKCPPKCTPKCP-PKCPPKCPPQCP---APCFPAVSSCCGPSSGSCC 56 MSCQQ+QQQCQPPPKC PKC PKCP PKCPPKCPP+CP + C + CCG SSG CC Sbjct: 1 MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGCC 60 Query: 57 GPSSGGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCC-----HSSGGCC 110 GGCCSSG GGC LSHHR R HR R QS DCC S+PS GS CC SGGCC Sbjct: 61 SSGGGGCCSSGGGGCCLSHHRRRRSHRHRPQSSDCC-SQPSAGSSCCGGGSGQHSGGCC 118 >gi|30410035 late cornified envelope 5A [Homo sapiens] Length = 118 Score = 172 bits (436), Expect = 5e-44 Identities = 79/122 (64%), Positives = 82/122 (67%), Gaps = 16/122 (13%) Query: 1 MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSS 60 MSCQQ+QQQCQPPPKC TPKCPPKC PKCPP+CP C P S+ C P SCCG SS Sbjct: 1 MSCQQSQQQCQPPPKC----TPKCPPKCTPKCPPKCPPKCPPQCSAPCPPPVSSCCGSSS 56 Query: 61 GGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCES------------EPSGGSGCCHSSGG 108 GGCCSS GGC LSHHRPR RRR QS CC S SGGSGCCHSSGG Sbjct: 57 GGCCSSEGGGCCLSHHRPRQSLRRRPQSSSCCGSGSGQQSGGSSCCHSSGGSGCCHSSGG 116 Query: 109 CC 110 CC Sbjct: 117 CC 118 >gi|30387652 late cornified envelope 1C [Homo sapiens] Length = 118 Score = 172 bits (435), Expect = 7e-44 Identities = 79/119 (66%), Positives = 84/119 (70%), Gaps = 10/119 (8%) Query: 1 MSCQQNQQQCQPPPKCPPKCTPKCP-PKCPPKCPPQCP---APCFPAVSSCCGPSSGSCC 56 MSCQQ+QQQCQPPPKC PKC PKCP PKCPPKCPP+CP + C + CCG SSG C Sbjct: 1 MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSC 60 Query: 57 GPSSGGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCC-----HSSGGCC 110 G SSGGCCSSG GGC LSHHR R H R QS CC S+PSGGS CC SGGCC Sbjct: 61 GSSSGGCCSSGGGGCCLSHHRRRRSHCHRPQSSGCC-SQPSGGSSCCGGGSGQHSGGCC 118 >gi|30387648 late cornified envelope 1D [Homo sapiens] Length = 114 Score = 171 bits (434), Expect = 9e-44 Identities = 79/116 (68%), Positives = 84/116 (72%), Gaps = 8/116 (6%) Query: 1 MSCQQNQQQCQPPPKCPPKCTPKCP-PKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPS 59 MSCQQ+QQQCQPPPKC PKCTPKCP PKCPPKCPP + C + CCG SSG CG + Sbjct: 1 MSCQQSQQQCQPPPKCTPKCTPKCPAPKCPPKCPP-VSSCCSVSSGGCCGSSSGGGCGSN 59 Query: 60 SGGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCC-----HSSGGCC 110 SGGCCSSG GGC LSHHR HRRR QS DCC S+PSGGS CC SGGCC Sbjct: 60 SGGCCSSGGGGCCLSHHRRHRSHRRRPQSSDCC-SQPSGGSSCCGGGSSQHSGGCC 114 >gi|30387656 late cornified envelope 1B [Homo sapiens] Length = 118 Score = 169 bits (427), Expect = 6e-43 Identities = 78/119 (65%), Positives = 83/119 (69%), Gaps = 10/119 (8%) Query: 1 MSCQQNQQQCQPPPKCPPKCTPKC-PPKCPPKCPPQCP---APCFPAVSSCCGPSSGSCC 56 MSCQQNQQQCQPPPKC PKC PKC P+CPPKCPP+CP + C + CCG SSG C Sbjct: 1 MSCQQNQQQCQPPPKCIPKCPPKCLTPRCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSC 60 Query: 57 GPSSGGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCC-----HSSGGCC 110 G SSGGCCSSG GGC LSHHR R H R QS CC S+PSGGS CC SGGCC Sbjct: 61 GSSSGGCCSSGGGGCCLSHHRRRRSHCHRPQSSGCC-SQPSGGSSCCGGGSGQHSGGCC 118 >gi|30387654 late cornified envelope 1A [Homo sapiens] Length = 110 Score = 167 bits (424), Expect = 1e-42 Identities = 80/116 (68%), Positives = 83/116 (71%), Gaps = 12/116 (10%) Query: 1 MSCQQNQQQCQPPPKCPPKCTPKCPPKCP-PKCPPQCPAPCFPAVSSCCGPSSGSCCGPS 59 MSCQQ+QQQCQPPPKC TPKCPPKCP PKCPP+CP C P VSSCC SSG CCG S Sbjct: 1 MSCQQSQQQCQPPPKC----TPKCPPKCPTPKCPPKCPPKC-PPVSSCCSVSSGGCCGSS 55 Query: 60 SGGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCC-----HSSGGCC 110 SGG CSSG GGC LSHHR HR R QS CC S+PSGGS CC SGGCC Sbjct: 56 SGGGCSSGGGGCCLSHHRRHRSHRHRLQSSGCC-SQPSGGSSCCGGDSGQHSGGCC 110 >gi|30387642 late cornified envelope 4A [Homo sapiens] Length = 99 Score = 134 bits (336), Expect = 2e-32 Identities = 66/113 (58%), Positives = 72/113 (63%), Gaps = 17/113 (15%) Query: 1 MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSS 60 MSCQQNQQQCQPPPKCP PK PPKCP +C + C P +SSCCG SSG C Sbjct: 1 MSCQQNQQQCQPPPKCPI-------PKYPPKCPSKCASSCPPPISSCCGSSSGGC----- 48 Query: 61 GGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCES---EPSGGSGCCHSSGGCC 110 GCCSS GGC LSHHR H R +S +C S + SGGSGCC S GGCC Sbjct: 49 -GCCSSEGGGCCLSHHRHHRSHCHRPKSSNCYGSGSGQQSGGSGCC-SGGGCC 99 >gi|14211869 late cornified envelope 3D [Homo sapiens] Length = 92 Score = 118 bits (295), Expect = 1e-27 Identities = 62/113 (54%), Positives = 66/113 (58%), Gaps = 24/113 (21%) Query: 1 MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSS 60 MSCQQNQQQCQPPPKCP PKCPPK P QC P SSG C PSS Sbjct: 1 MSCQQNQQQCQPPPKCPS-------PKCPPKSPVQCLPPA----------SSG--CAPSS 41 Query: 61 GGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCE---SEPSGGSGCCHSSGGCC 110 GGC S GGC L+HHR HR R Q P+ C+ + GGSGC H SGGCC Sbjct: 42 GGCGPSSEGGCFLNHHRRH--HRCRRQRPNSCDRGSGQQGGGSGCGHGSGGCC 92 >gi|30410033 late cornified envelope 3E [Homo sapiens] Length = 92 Score = 117 bits (294), Expect = 2e-27 Identities = 60/113 (53%), Positives = 66/113 (58%), Gaps = 24/113 (21%) Query: 1 MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSS 60 MSCQQNQ+QCQPPPKCP PKCPP+ P C P SS C PSSG C GPSS Sbjct: 1 MSCQQNQKQCQPPPKCPS-----------PKCPPKNPVQCLPPASSGCAPSSGGC-GPSS 48 Query: 61 GGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCE---SEPSGGSGCCHSSGGCC 110 GGC L+HHR HR R Q + C+ + GGSGCCH SGGCC Sbjct: 49 -------EGGCFLNHHRRH--HRCRRQRSNSCDRGSGQQGGGSGCCHGSGGCC 92 >gi|30410041 late cornified envelope 3B [Homo sapiens] Length = 95 Score = 112 bits (279), Expect = 8e-26 Identities = 57/113 (50%), Positives = 62/113 (54%), Gaps = 21/113 (18%) Query: 1 MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSS 60 MSCQQNQQQCQP PKCP PKCPP+ A C P SSCC P G C GPSS Sbjct: 1 MSCQQNQQQCQPLPKCPS-----------PKCPPKSSAQCLPPASSCCAPRPGCCGGPSS 49 Query: 61 GGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCE---SEPSGGSGCCHSSGGCC 110 GGC LSHHR HR R QS + C+ + G S C + SGGCC Sbjct: 50 -------EGGCCLSHHRCCRSHRCRRQSSNSCDRGSGQQDGASDCGYGSGGCC 95 >gi|30410037 late cornified envelope 3C [Homo sapiens] Length = 94 Score = 102 bits (254), Expect = 7e-23 Identities = 56/113 (49%), Positives = 61/113 (53%), Gaps = 22/113 (19%) Query: 1 MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSS 60 MSCQQNQQQCQPPP CP PKCPP+ PA C P SS C SSG CGPSS Sbjct: 1 MSCQQNQQQCQPPPSCPS-----------PKCPPKSPAQCLPPPSSDCALSSGG-CGPSS 48 Query: 61 GGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCE---SEPSGGSGCCHSSGGCC 110 GC LSHHR H+ R Q + C+ + GGS H SGGCC Sbjct: 49 -------ESGCCLSHHRHFRSHQCRRQRSNSCDRGSGQQGGGSCRGHGSGGCC 94 >gi|30410039 late cornified envelope 3A [Homo sapiens] Length = 89 Score = 100 bits (249), Expect = 3e-22 Identities = 56/113 (49%), Positives = 59/113 (52%), Gaps = 27/113 (23%) Query: 1 MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSS 60 MSCQQNQQQCQPPPKCP K PA C P SS C PSSG CGPSS Sbjct: 1 MSCQQNQQQCQPPPKCPAK----------------SPAQCLPPASSSCAPSSGG-CGPSS 43 Query: 61 GGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCE---SEPSGGSGCCHSSGGCC 110 C LSHHR R HR R QS + C+ + G S C HSS GCC Sbjct: 44 -------ERSCCLSHHRCRRSHRCRCQSSNSCDRGSGQQGGSSSCGHSSAGCC 89 >gi|62945419 small proline-rich protein 2F [Homo sapiens] Length = 72 Score = 57.0 bits (136), Expect = 3e-09 Identities = 29/47 (61%), Positives = 30/47 (63%), Gaps = 5/47 (10%) Query: 1 MSCQQNQ--QQCQPPPKCP-PKCTPKC-PPKCPPKCPP-QCPAPCFP 42 MS QQ Q Q CQPPP CP PKC C PPKCP CPP +CP C P Sbjct: 1 MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPP 47 Score = 34.7 bits (78), Expect = 0.017 Identities = 15/24 (62%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Query: 4 QQNQQQCQPPPKCPPKCTPKCPPK 27 QQ QQ+C P PP C PKCPPK Sbjct: 48 QQCQQKCPPVTPSPP-CQPKCPPK 70 >gi|62122851 small proline-rich protein 2G [Homo sapiens] Length = 73 Score = 55.8 bits (133), Expect = 7e-09 Identities = 33/62 (53%), Positives = 33/62 (53%), Gaps = 9/62 (14%) Query: 1 MSCQQNQ--QQCQPPPKCPPKCTPKCPPKC-PPKCP-PQCPAPCFPAVSSCCGPSSGSCC 56 MS QQ Q Q CQPPP CP TPKCP C PPKCP P P PC P C P C Sbjct: 1 MSYQQQQCKQPCQPPPVCP---TPKCPEPCPPPKCPEPYLPPPCPP--EHCPPPPCQDKC 55 Query: 57 GP 58 P Sbjct: 56 PP 57 Score = 26.6 bits (57), Expect = 4.6 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 8/28 (28%) Query: 8 QQCQPPP---KCPP-----KCTPKCPPK 27 + C PPP KCPP C K PPK Sbjct: 44 EHCPPPPCQDKCPPVQPYPPCQQKYPPK 71 >gi|83582817 small proline-rich protein 2E [Homo sapiens] Length = 72 Score = 55.5 bits (132), Expect = 9e-09 Identities = 36/74 (48%), Positives = 36/74 (48%), Gaps = 17/74 (22%) Query: 1 MSCQQNQ--QQCQPPPKCP-PKCT-----PKCP-----PKCPPKCPP-QCPAPCFPAVSS 46 MS QQ Q Q CQPPP CP PKC PKCP PKCP CPP QC C P S Sbjct: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKCPPVTPS 60 Query: 47 CCGPSSGSCCGPSS 60 P C P S Sbjct: 61 ---PPCQPKCPPKS 71 >gi|9506923 cysteine-rich C-terminal 1 [Homo sapiens] Length = 99 Score = 53.5 bits (127), Expect = 4e-08 Identities = 30/82 (36%), Positives = 34/82 (41%), Gaps = 6/82 (7%) Query: 29 PPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSSGGCCSSGAGGCSLSHHRPRLFHRRRHQS 88 P CP P P + SSCCG G CCG S GCC S + C PR R+R Sbjct: 21 PAPCPAPAPTPAPASSSSCCGSGRG-CCGDS--GCCGSSSTSCCCF---PRRRRRQRSSG 74 Query: 89 PDCCESEPSGGSGCCHSSGGCC 110 CC + S GCC Sbjct: 75 CCCCGGGSQRSQRSNNRSSGCC 96 Score = 51.2 bits (121), Expect = 2e-07 Identities = 38/113 (33%), Positives = 46/113 (40%), Gaps = 24/113 (21%) Query: 6 NQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSSGGCCS 65 + QQ K K + + P CP P PA + SSCCG G CCG S GCC Sbjct: 2 SSQQSAVSAKGFSKGSSQGPAPCPAPAPTPAPA----SSSSCCGSGRG-CCGDS--GCCG 54 Query: 66 SGAGGCSLSHHRPRLFHRRRHQSPDCC---------ESEPSGGSGCCHSSGGC 109 S + C R RRR +S CC + + SGCC GC Sbjct: 55 SSSTSCCCFPRR-----RRRQRSSGCCCCGGGSQRSQRSNNRSSGCC---SGC 99 Score = 26.2 bits (56), Expect = 6.0 Identities = 12/35 (34%), Positives = 15/35 (42%), Gaps = 5/35 (14%) Query: 81 FHRRRHQSPDCCESE-----PSGGSGCCHSSGGCC 110 F + Q P C + P+ S CC S GCC Sbjct: 13 FSKGSSQGPAPCPAPAPTPAPASSSSCCGSGRGCC 47 >gi|83582815 small proline-rich protein 1B [Homo sapiens] Length = 89 Score = 53.5 bits (127), Expect = 4e-08 Identities = 25/55 (45%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 4 QQNQQQCQPPPK--CPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCC 56 QQ +Q CQPPP+ C PK C PK P C P+ P PC P V C P C Sbjct: 19 QQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVPEPC 73 Score = 50.8 bits (120), Expect = 2e-07 Identities = 27/75 (36%), Positives = 30/75 (40%), Gaps = 9/75 (12%) Query: 1 MSCQQNQQQCQPPPK---------CPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPS 51 MS QQ +Q C PPP+ C P C PK C P+ P PC P V C P Sbjct: 1 MSSQQQKQPCTPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPK 60 Query: 52 SGSCCGPSSGGCCSS 66 C P C S Sbjct: 61 VPEPCHPKVPEPCPS 75 >gi|45827734 small proline-rich protein 1A [Homo sapiens] Length = 89 Score = 53.5 bits (127), Expect = 4e-08 Identities = 25/55 (45%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 4 QQNQQQCQPPPK--CPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCC 56 QQ +Q CQPPP+ C PK C PK P C P+ P PC P V C P C Sbjct: 19 QQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCQPKVPEPC 73 Score = 49.7 bits (117), Expect = 5e-07 Identities = 26/75 (34%), Positives = 30/75 (40%), Gaps = 9/75 (12%) Query: 1 MSCQQNQQQCQPPPK---------CPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPS 51 M+ QQ +Q C PPP+ C P C PK C P+ P PC P V C P Sbjct: 1 MNSQQQKQPCTPPPQPQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPK 60 Query: 52 SGSCCGPSSGGCCSS 66 C P C S Sbjct: 61 VPEPCQPKVPEPCPS 75 >gi|58082087 late cornified envelope-like proline-rich 1 [Homo sapiens] Length = 98 Score = 52.4 bits (124), Expect = 8e-08 Identities = 20/33 (60%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 11 QPPPKCPPK-CTPKCPPKCPPKCPPQCPAPCFP 42 Q P CPP+ CT CPPKCP CP CP PC P Sbjct: 64 QSPSSCPPQPCTKPCPPKCPSSCPHACPPPCPP 96 Score = 48.5 bits (114), Expect = 1e-06 Identities = 17/39 (43%), Positives = 18/39 (46%) Query: 1 MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAP 39 + C PP C C PKCP CP CPP CP P Sbjct: 59 LPCPSQSPSSCPPQPCTKPCPPKCPSSCPHACPPPCPPP 97 Score = 45.4 bits (106), Expect = 1e-05 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 6/48 (12%) Query: 8 QQCQPPPKCPPKCTPKCPPKCPPK-----CPPQCPAPCFPAVSSCCGP 50 ++C PPKC P C + P CPP+ CPP+CP+ C A C P Sbjct: 50 EKCPAPPKCLP-CPSQSPSSCPPQPCTKPCPPKCPSSCPHACPPPCPP 96 Score = 41.6 bits (96), Expect = 1e-04 Identities = 29/77 (37%), Positives = 30/77 (38%), Gaps = 20/77 (25%) Query: 13 PPKCPPKCTPKCPPKCPP------------KCP-PQCPAP--CFPAVS---SCCGPSSGS 54 P C PKC KC KC P KCP +CPAP C P S S C P Sbjct: 16 PKNCDPKCEQKCESKCQPSCLKKLLQRCFEKCPWEKCPAPPKCLPCPSQSPSSCPPQ--P 73 Query: 55 CCGPSSGGCCSSGAGGC 71 C P C SS C Sbjct: 74 CTKPCPPKCPSSCPHAC 90 >gi|5174693 small proline-rich protein 2A [Homo sapiens] Length = 72 Score = 52.0 bits (123), Expect = 1e-07 Identities = 30/58 (51%), Positives = 32/58 (55%), Gaps = 13/58 (22%) Query: 1 MSCQQNQ--QQCQPPPKCP-PKCT-----PKCP-----PKCPPKCPPQCPAPCFPAVS 45 MS QQ Q Q CQPPP CP PKC PKCP PKCP CPPQ +P V+ Sbjct: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVT 58 Score = 35.0 bits (79), Expect = 0.013 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 3/28 (10%) Query: 12 PPPKCPPKCTPKCPPKCPPKCPPQCPAP 39 PPPKCP C P+ +C K PP P+P Sbjct: 37 PPPKCPQPCPPQ---QCQQKYPPVTPSP 61 >gi|62955831 small proline-rich protein 2B [Homo sapiens] Length = 72 Score = 52.0 bits (123), Expect = 1e-07 Identities = 30/58 (51%), Positives = 32/58 (55%), Gaps = 13/58 (22%) Query: 1 MSCQQNQ--QQCQPPPKCP-PKCT-----PKCP-----PKCPPKCPPQCPAPCFPAVS 45 MS QQ Q Q CQPPP CP PKC PKCP PKCP CPPQ +P V+ Sbjct: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVT 58 Score = 27.7 bits (60), Expect = 2.1 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Query: 8 QQCQ---PPPKCPPKCTPKCPPK 27 QQCQ PP P C PK PPK Sbjct: 48 QQCQQKYPPVTPSPPCQPKYPPK 70 Score = 25.8 bits (55), Expect = 7.8 Identities = 10/21 (47%), Positives = 10/21 (47%) Query: 3 CQQNQQQCQPPPKCPPKCTPK 23 CQQ P P C PK PK Sbjct: 50 CQQKYPPVTPSPPCQPKYPPK 70 >gi|13994372 keratin associated protein 17-1 [Homo sapiens] Length = 105 Score = 49.7 bits (117), Expect = 5e-07 Identities = 31/95 (32%), Positives = 33/95 (34%), Gaps = 22/95 (23%) Query: 16 CPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSSGGCCSSGAGGCSLSH 75 CP C C + C +C C P CCG SCCG GC SG GG Sbjct: 4 CPGDCFTCCTQE--QNCCEECC--CQPGCCGCCG----SCCGCGGSGCGGSGCGGSCC-- 53 Query: 76 HRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC 110 CC S G GC GGCC Sbjct: 54 ------------GSSCCGSGCGGCGGCGGCGGGCC 76 Score = 43.9 bits (102), Expect = 3e-05 Identities = 34/108 (31%), Positives = 36/108 (33%), Gaps = 32/108 (29%) Query: 2 SCQQNQQQCQPPPKCPPKCTPKCPPKCP---PKCPPQ-CPAPCFPAVSSCCGPSSGSC-- 55 +C +Q C C P C C C C C C SSCCG G C Sbjct: 10 TCCTQEQNCCEECCCQPGCCGCCGSCCGCGGSGCGGSGCGGSC--CGSSCCGSGCGGCGG 67 Query: 56 CGPSSGGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCC 103 CG GGCC S G S CC GSGCC Sbjct: 68 CGGCGGGCCGSSCCGSS------------------CC------GSGCC 91 >gi|169212028 PREDICTED: keratin-associated protein 9-2-like 2-like [Homo sapiens] Length = 160 Score = 48.9 bits (115), Expect = 9e-07 Identities = 39/114 (34%), Positives = 45/114 (39%), Gaps = 24/114 (21%) Query: 10 CQP---PPKCPPKC--TPKCPPKCPPKC--PPQCPAPCFPAV---SSCCGPSS-GSCCGP 58 CQP P C C T C P C C P C PC+ + SSCCG +S GS CG Sbjct: 48 CQPYCHPTCCQNTCCRTTCCQPTCVTSCCQPSCCSTPCYQPICCGSSCCGQTSCGSSCGQ 107 Query: 59 SSGGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHS--SGGCC 110 SS C+ + R +H P C S GS CC CC Sbjct: 108 SS---------SCAPVYCRRTCYHPTTVCLPGCLNQ--SCGSSCCQPCYCPACC 150 >gi|153218552 keratin associated protein 9.8 [Homo sapiens] Length = 159 Score = 48.5 bits (114), Expect = 1e-06 Identities = 36/114 (31%), Positives = 42/114 (36%), Gaps = 23/114 (20%) Query: 10 CQPPPKCPPKCT------PKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGS-------CC 56 C P C P C P C P C C C P V+SCC PS S CC Sbjct: 27 CSSTPCCQPSCCVSSCCQPCCRPTC---CQNTCCQPI--CVTSCCQPSCCSTPCCQPTCC 81 Query: 57 GPSSGGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC 110 G +S G + C+ + R +H P C S GS CC CC Sbjct: 82 GQTSCGSSCGQSSSCAPVYCRRTCYHPTTVCLPGCLNQ--SCGSNCCQP---CC 130 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.321 0.138 0.541 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,218,971 Number of Sequences: 37866 Number of extensions: 568398 Number of successful extensions: 9333 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 445 Number of HSP's successfully gapped in prelim test: 404 Number of HSP's that attempted gapping in prelim test: 4348 Number of HSP's gapped (non-prelim): 3235 length of query: 110 length of database: 18,247,518 effective HSP length: 80 effective length of query: 30 effective length of database: 15,218,238 effective search space: 456547140 effective search space used: 456547140 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.