Guide to the Human Genome
Home | Table of Contents | Search text | Search genes | Search sequences | Purchase | FAQ | Blog | Help

Search of human proteins with 155969693

BLASTP 2.2.11 [Jun-05-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|155969693 myomesin family, member 3 [Homo sapiens]
         (1437 letters)

Database: hs.faa 
           37,866 sequences; 18,247,518 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|155969693 myomesin family, member 3 [Homo sapiens]                2914   0.0  
gi|156104903 myomesin 2 [Homo sapiens]                               1118   0.0  
gi|140560917 myomesin 1 isoform b [Homo sapiens]                     1029   0.0  
gi|140560919 myomesin 1 isoform a [Homo sapiens]                      746   0.0  
gi|110349719 titin isoform N2-A [Homo sapiens]                        274   4e-73
gi|110349717 titin isoform novex-2 [Homo sapiens]                     274   4e-73
gi|110349713 titin isoform novex-1 [Homo sapiens]                     274   4e-73
gi|110349715 titin isoform N2-B [Homo sapiens]                        274   4e-73
gi|253970427 immunoglobulin superfamily, member 22 [Homo sapiens]     164   7e-40
gi|148839296 immunoglobulin-like and fibronectin type III domain...   160   8e-39
gi|222352127 sidekick 2 [Homo sapiens]                                128   5e-29
gi|148596957 myosin binding protein C, cardiac [Homo sapiens]         119   3e-26
gi|46049110 myosin binding protein C, slow type isoform 4 [Homo ...   114   9e-25
gi|46049125 myosin binding protein C, slow type isoform 2 [Homo ...   114   9e-25
gi|45976288 myosin binding protein C, slow type isoform 1 [Homo ...   114   9e-25
gi|133908641 myosin binding protein C, fast type [Homo sapiens]       112   3e-24
gi|104487297 protein tyrosine phosphatase, receptor type, sigma ...   103   2e-21
gi|46049119 myosin binding protein C, slow type isoform 3 [Homo ...   102   2e-21
gi|157311649 neogenin homolog 1 [Homo sapiens]                        102   3e-21
gi|109633041 protein tyrosine phosphatase, receptor type, F isof...   100   1e-20
gi|109633039 protein tyrosine phosphatase, receptor type, F isof...   100   1e-20
gi|119220552 sidekick 1 [Homo sapiens]                                 99   2e-20
gi|104487006 protein tyrosine phosphatase, receptor type, sigma ...    99   4e-20
gi|110431348 deleted in colorectal carcinoma [Homo sapiens]            97   9e-20
gi|18860892 protein tyrosine phosphatase, receptor type, D isofo...    97   1e-19
gi|75709184 contactin 3 [Homo sapiens]                                 96   2e-19
gi|4506309 protein tyrosine phosphatase, receptor type, D isofor...    96   2e-19
gi|18860890 protein tyrosine phosphatase, receptor type, D isofo...    96   2e-19
gi|104487002 protein tyrosine phosphatase, receptor type, D isof...    91   6e-18
gi|18860894 protein tyrosine phosphatase, receptor type, D isofo...    91   6e-18

>gi|155969693 myomesin family, member 3 [Homo sapiens]
          Length = 1437

 Score = 2914 bits (7554), Expect = 0.0
 Identities = 1437/1437 (100%), Positives = 1437/1437 (100%)

Query: 1    MTLPHSLGGAGDPRPPQAMEVHRLEHRQEEEQKEERQHSLRMGSSVRRRTFRSSEEEHEF 60
            MTLPHSLGGAGDPRPPQAMEVHRLEHRQEEEQKEERQHSLRMGSSVRRRTFRSSEEEHEF
Sbjct: 1    MTLPHSLGGAGDPRPPQAMEVHRLEHRQEEEQKEERQHSLRMGSSVRRRTFRSSEEEHEF 60

Query: 61   SAADYALAAALALTASSELSWEAQLRRQTSAVELEERGQKRVGFGNDWERTEIAFLQTHR 120
            SAADYALAAALALTASSELSWEAQLRRQTSAVELEERGQKRVGFGNDWERTEIAFLQTHR
Sbjct: 61   SAADYALAAALALTASSELSWEAQLRRQTSAVELEERGQKRVGFGNDWERTEIAFLQTHR 120

Query: 121  LLRQRRDWKTLRRRTEEKVQEAKELRELCYGRGPWFWIPLRSHAVWEHTTVLLTCTVQAS 180
            LLRQRRDWKTLRRRTEEKVQEAKELRELCYGRGPWFWIPLRSHAVWEHTTVLLTCTVQAS
Sbjct: 121  LLRQRRDWKTLRRRTEEKVQEAKELRELCYGRGPWFWIPLRSHAVWEHTTVLLTCTVQAS 180

Query: 181  PPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQAS 240
            PPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQAS
Sbjct: 181  PPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQAS 240

Query: 241  SFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVLD 300
            SFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVLD
Sbjct: 241  SFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVLD 300

Query: 301  AESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYV 360
            AESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYV
Sbjct: 301  AESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYV 360

Query: 361  LVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWI 420
            LVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWI
Sbjct: 361  LVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWI 420

Query: 421  ACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIP 480
            ACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIP
Sbjct: 421  ACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIP 480

Query: 481  FDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSV 540
            FDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSV
Sbjct: 481  FDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSV 540

Query: 541  IGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPA 600
            IGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPA
Sbjct: 541  IGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPA 600

Query: 601  TLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTV 660
            TLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTV
Sbjct: 601  TLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTV 660

Query: 661  PGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGW 720
            PGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGW
Sbjct: 661  PGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGW 720

Query: 721  KPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWA 780
            KPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWA
Sbjct: 721  KPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWA 780

Query: 781  GVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSF 840
            GVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSF
Sbjct: 781  GVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSF 840

Query: 841  QEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKP 900
            QEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKP
Sbjct: 841  QEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKP 900

Query: 901  GAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKE 960
            GAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKE
Sbjct: 901  GAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKE 960

Query: 961  PGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERG 1020
            PGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERG
Sbjct: 961  PGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERG 1020

Query: 1021 EVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTA 1080
            EVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTA
Sbjct: 1021 EVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTA 1080

Query: 1081 QLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTC 1140
            QLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTC
Sbjct: 1081 QLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTC 1140

Query: 1141 KVTNTKKETRFQWFFQRAEMPDGQYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDT 1200
            KVTNTKKETRFQWFFQRAEMPDGQYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDT
Sbjct: 1141 KVTNTKKETRFQWFFQRAEMPDGQYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDT 1200

Query: 1201 ILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKR 1260
            ILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKR
Sbjct: 1201 ILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKR 1260

Query: 1261 LESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEH 1320
            LESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEH
Sbjct: 1261 LESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEH 1320

Query: 1321 QRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDR 1380
            QRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDR
Sbjct: 1321 QRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDR 1380

Query: 1381 YRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELKSM 1437
            YRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELKSM
Sbjct: 1381 YRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELKSM 1437


>gi|156104903 myomesin 2 [Homo sapiens]
          Length = 1465

 Score = 1118 bits (2892), Expect = 0.0
 Identities = 600/1420 (42%), Positives = 860/1420 (60%), Gaps = 27/1420 (1%)

Query: 30   EEQKEERQHSLRMGSSVRRRTFRSSEEEHEFSAADYALAAALALTASSELSWEAQLRRQT 89
            +E   +++ S +  S        SS+     ++    +    A   S++   E + R + 
Sbjct: 30   DEYASKKRASTQASSQKSLSQRSSSQRASSQTSLGGTICRVCAKRVSTQEDEEQENRSRY 89

Query: 90   SAVELEERGQKRVGFGNDWERTEIAFLQTHRLLRQRRDWKTLRRRTEEKVQEAKELRELC 149
             ++       KR  F ++    E          R + D   +++  E+K+   +   E  
Sbjct: 90   QSLVAAYGEAKRQRFLSELAHLEEDVHLARSQARDKLDKYAIQQMMEDKLAWERHTFEER 149

Query: 150  YGRGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNN 209
              R P   + LRSH VWE  +V L  TVQ  P P V WYK+ + I  +    GKYRI +N
Sbjct: 150  ISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLIC-QAAEPGKYRIESN 208

Query: 210  YGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFK----RS 265
            YG+ +LEI R   +D+ATY+    NAHGQ S+ A V+VR + G +  F S         S
Sbjct: 209  YGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLS 268

Query: 266  TFGP----SVEFTSVLKPVFAREKEPFSLSC--LFSEDVLDAES-IQWFRDGSLLRSSRR 318
            +  P     V+F       F RE E  +L C  L + D+   +   +W+RD  LL+ S+ 
Sbjct: 269  SMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDDVLLKESKW 328

Query: 319  RKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLN 378
             K+ + + QASL  S  +K+DEGLY +R+ S  G  + S ++ VRDA+    GAPG+P++
Sbjct: 329  TKMFFGEGQASLSFSHLHKDDEGLYTLRIVSRGGVSDHSAFLFVRDADPLVTGAPGAPMD 388

Query: 379  VRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLV 438
            ++C D NRD +I+TW PP+ T  +P+  Y ++RC+  +  W+ C++AP   C+ P+ GL 
Sbjct: 389  LQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYPVTGLF 448

Query: 439  EGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTV 498
            EG+SY FRVRA++  G S PS+ S+ V   D    RR   +  +   +I I  D  E   
Sbjct: 449  EGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRRLQAVHLEGEKEIAIYQDDLEGDA 508

Query: 499  TIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSP 558
             +P PPT VHASEI   YVVL+WE P+PR + PL Y +EKSV+GSG+W+ +++++ VRSP
Sbjct: 509  QVPGPPTGVHASEISRNYVVLSWEPPTPRGKDPLMYFIEKSVVGSGSWQRVNAQTAVRSP 568

Query: 559  RFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSV 618
            R+AV DL + KSYVFRV + N++GLS+PSE + PI  +        P +V A R+T+TSV
Sbjct: 569  RYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTVVPSAPGRVLASRNTKTSV 628

Query: 619  SLTWD-PVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVS 677
             + WD P  + +LLGYY+     GT+ W+  N+KPI   RF V GL TG++Y F V++V+
Sbjct: 629  VVQWDRPKHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYIFRVKAVN 688

Query: 678  EAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLD 737
              G+ E+S  ++ I+V+ AL  PS PYG  LLNC  + M +GWK PK  GG  ILGY+LD
Sbjct: 689  AVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLD 748

Query: 738  QHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEW 797
            + +    +WH VN  P    +  V  L EG  YEF+  A N AG+GE S PS  F+C+ W
Sbjct: 749  KREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAW 808

Query: 798  TMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPIS 857
            TMP+PGP YD+   EVR TSLV+ W+ P+Y G+ PV+GY V F+EE + +W  V     +
Sbjct: 809  TMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTA 868

Query: 858  GTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEVGVDEEGFIYL 917
              +L+VSDLQ GK+YVF+V+A+N+ G+G+PS  ++PVL+E +PG  EI  GVDE+G IYL
Sbjct: 869  NRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYL 928

Query: 918  AFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDAD 977
             F+  E  D+S+F W K Y+   D +R KIE   + SK+ LK P  EDLGTYSV V+D D
Sbjct: 929  GFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTD 988

Query: 978  EDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAEL 1037
              +S+S  L  EELE+L  LS+EI+NP I L S    +I ++G VR WL+ E LSP A  
Sbjct: 989  -GVSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASY 1047

Query: 1038 HLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVD 1097
              I N++E+  S   +I  D+  G++E+++   S E++G+YT Q+ DGKAK+Q +L L+ 
Sbjct: 1048 RFIINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIG 1107

Query: 1098 DDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQR 1157
            D F  +L +A+ +R+++ RKQGP+F   L W VTE+C+V+L CKV NTKKET F+W    
Sbjct: 1108 DAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVFKWL--- 1164

Query: 1158 AEMPDGQYDPET------GTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDA 1211
                D  Y+ ET      G   L I +LSKKD G Y+A + DDRG+D +IL++ G   D 
Sbjct: 1165 --KDDVLYETETLPNLERGICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYDD 1222

Query: 1212 IFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGT 1271
            +   + R+   SA+PLK+  T EGIR+   +KY+  E MK  W HKD ++ S + +R G 
Sbjct: 1223 MILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTDE-MKVNWCHKDAKISSSEHMRIGG 1281

Query: 1272 TLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEK 1331
            + +  WL I +P + DKGKYT EI  GK+  Q S DLSGQAF++A AE Q+ K  A  EK
Sbjct: 1282 SEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQFKAAAFAEK 1341

Query: 1332 NRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTE-V 1390
            NR +++ GLPDV TIME KTL LTC V G+P PE+ W KNDQ +   + + ++V   + V
Sbjct: 1342 NRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYV 1401

Query: 1391 TITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDE 1430
            ++TI+ V SEDSG+Y + +KNKYG E   VT+SV+KHG++
Sbjct: 1402 SMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKHGEK 1441


>gi|140560917 myomesin 1 isoform b [Homo sapiens]
          Length = 1589

 Score = 1029 bits (2661), Expect = 0.0
 Identities = 575/1427 (40%), Positives = 840/1427 (58%), Gaps = 54/1427 (3%)

Query: 34   EERQHSLRMGSSVRRRTFRSSEEEHEFSAADYALAAALALTASSELSWEAQLRRQTSAVE 93
            EE   + +  ++ ++ T        + S A     A+   TAS +       ++ TSA++
Sbjct: 175  EEGITTSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQ---SVVSKQATSALQ 231

Query: 94   LEERGQKRVGFGNDWERTEIAFLQTHRLLRQRRDWKTLRRRTEEKVQEAKELRELCYGRG 153
             EE  +K+                   ++R++ +  +LR+  EE      +L E      
Sbjct: 232  QEETSEKK---------------SRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHA 276

Query: 154  PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLL 213
            P F I  RSH VWE   V L C++   P P+VTWYKN   I+      GKY I + YG+ 
Sbjct: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHA-NPGKYIIESRYGMH 335

Query: 214  SLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRS------TF 267
            +LEI  C  ED+A Y     N  G+ S++A V+V+ Y G+   FD   F         +F
Sbjct: 336  TLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGE---FDETRFHAGASTMPLSF 392

Query: 268  GPS---------VEFTSVLKPVFAREKEPFSLSC--LFSEDVLDAE-SIQWFRDGSLLRS 315
            G +         + F       F RE E  SL C  + + ++   +  IQW+R+G  L  
Sbjct: 393  GVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSP 452

Query: 316  SRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGS 375
            S+  + L++  +A+L  S   KEDEGLY +RV       + S YV VRDA+AE  GAP +
Sbjct: 453  SKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAA 512

Query: 376  PLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQ 435
            PL+V+CL+ N+D +I++W  P+   G+PI  Y I++C+  +  W  C++ P    R P+ 
Sbjct: 513  PLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVT 572

Query: 436  GLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDH-DAARRKTEIPFDLGNKITISTDAF 494
            GL+EG+SY FRVRA++++G   PS+ SE V   D  + AR K+        +I ++ +  
Sbjct: 573  GLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEP 632

Query: 495  EDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESP 554
             + + +P PPT++  +E   +YVVL+W+ P  R    + Y +EK   G+  W+ +++E P
Sbjct: 633  SEGI-VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELP 691

Query: 555  VRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPP-PAQVQAFRD 613
            V+SPRFA+ DL + KSY FRVR  N  G+ +PSE +E + + G    +P  P ++   R+
Sbjct: 692  VKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATE-VTVVGDKLDIPKAPGKIIPSRN 750

Query: 614  TQTSVSLTWDPVKDP-ELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFC 672
            T TSV ++W+  KD  EL+GYYI +   G+ +W+  NN P++G+RFT  GL TG+ Y F 
Sbjct: 751  TDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFR 810

Query: 673  VRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKIL 732
            VR+V+ AG+ E S  +E I VK A+A PS P     L   ++ MV+GWK P + GG +I 
Sbjct: 811  VRAVNAAGLSEYSQDSEAIEVKAAIAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEIT 870

Query: 733  GYFLDQH---DSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPS 789
            GY+++     D     W   N + +     K+S+L E   Y+F+  A N AG+G  SA S
Sbjct: 871  GYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVS 930

Query: 790  SLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGS--EQ 847
              F+C+EWT+  PGPP+ ++ SEVR  SLVLQW+PP++ G  PVTGY V  +E  +  +Q
Sbjct: 931  ECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQ 990

Query: 848  WKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEV 907
            W+ +    I   +L+V  L+ G SYVF+V+A+N AG+G+PS    PV+ E +PG  E+ V
Sbjct: 991  WRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEVVV 1050

Query: 908  GVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLG 967
             VD++G I L FE  +    SEF WSKDY    D  R+++E K NK+K+  K+ G++DLG
Sbjct: 1051 NVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDLGMDDLG 1110

Query: 968  TYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLE 1027
             YS  VTD D  I++S+ + EEEL++L  LSHE + P + + S   ++ILE+G+VR W++
Sbjct: 1111 IYSCDVTDTD-GIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVRFWMQ 1169

Query: 1028 VEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKA 1087
             EKLS  A+++ IFN KEIF  P  K++ DR  G++E+ ++ L +ED+G+YT QLQDGKA
Sbjct: 1170 AEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKA 1229

Query: 1088 KNQITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKK 1147
             N  T+ LV D F KL ++A+ +R++W RKQGP+F   L W+VT +C V L CKV N KK
Sbjct: 1230 TNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKK 1289

Query: 1148 ETRFQWFFQRAEMP-DGQYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTG 1206
            ET   W+    E+  D ++D + G   L I E SKKD GIY  ++ DDRG+D + L L  
Sbjct: 1290 ETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVD 1349

Query: 1207 DALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDR 1266
            +A   +  E+ +  ALSAT LKIQ T EGI+++S V YY VE +K  W H    +   DR
Sbjct: 1350 EAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYY-VEDLKVNWSHNGSAIRYSDR 1408

Query: 1267 IRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTL 1326
            ++TG T ++IWL I +P  +DKGKY +E+  GK   Q + DLSGQA+++A AE QRLK  
Sbjct: 1409 VKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQRLKQA 1468

Query: 1327 AIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVR 1386
            AI EKNRA+V+ GLPDV TI E K L LTC V GDP PE+SWLKN++ +   D   ++  
Sbjct: 1469 AIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFE 1528

Query: 1387 -GTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPK 1432
             G     TI  V++ DSG+YG+ VKNKYGSET   T+SVF   +E +
Sbjct: 1529 AGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEAR 1575


>gi|140560919 myomesin 1 isoform a [Homo sapiens]
          Length = 1685

 Score =  746 bits (1925), Expect = 0.0
 Identities = 427/1094 (39%), Positives = 620/1094 (56%), Gaps = 68/1094 (6%)

Query: 360  VLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEW 419
            ++V + E      PG P ++   +  R  ++L+W PP   RG+    Y +E+C+  +  W
Sbjct: 625  IIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQ-RGHEGIMYFVEKCEAGTENW 683

Query: 420  IACH-EAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTE 478
               + E P  + R  +  L EG+SY FRVR  +  G   PS+A+E+ V+GD         
Sbjct: 684  QRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDK-------- 735

Query: 479  IPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEK 538
                               + IP  P  +  S   +  VV++WEE S   +  + Y +E 
Sbjct: 736  -------------------LDIPKAPGKIIPSRNTDTSVVVSWEE-SKDAKELVGYYIEA 775

Query: 539  SVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGP 598
            SV GSG WE  ++ +PV+  RF    L   +SY+FRVRA+N  GLS+ S+ SE I ++  
Sbjct: 776  SVAGSGKWEPCNN-NPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAA 834

Query: 599  PATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRF 658
                  P    A  D    ++ +                 +V  +   T     + G++ 
Sbjct: 835  IGGGVSPDVCPALSDEPGGLTAS---------------RGRVHEASPPTFQKDALLGSKP 879

Query: 659  TVPGLRTGKEY--EFCVRSVSEA-----------GVGESSAATEPIRVKQALATPSAPYG 705
              P L +  +   +  V  VSE               +  + ++P++ K   A PS P  
Sbjct: 880  NKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCD 939

Query: 706  FALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQH---DSEELDWHAVNQQPIPTRVCKVS 762
               L   ++ MV+GWK P + GG +I GY+++     D     W   N + +     K+S
Sbjct: 940  ITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKIS 999

Query: 763  DLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQW 822
            +L E   Y+F+  A N AG+G  SA S  F+C+EWT+  PGPP+ ++ SEVR  SLVLQW
Sbjct: 1000 NLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQW 1059

Query: 823  EPPLYMGAGPVTGYHVSFQEEGS--EQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMN 880
            +PP++ G  PVTGY V  +E  +  +QW+ +    I   +L+V  L+ G SYVF+V+A+N
Sbjct: 1060 KPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAIN 1119

Query: 881  SAGLGQPSMPTDPVLLEDKPGAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPL 940
             AG+G+PS    PV+ E +PG  E+ V VD++G I L FE  +    SEF WSKDY    
Sbjct: 1120 QAGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTE 1179

Query: 941  DPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHE 1000
            D  R+++E K NK+K+  K+ G++DLG YS  VTD D  I++S+ + EEEL++L  LSHE
Sbjct: 1180 DSPRLEVESKGNKTKMTFKDLGMDDLGIYSCDVTDTD-GIASSYLIDEEELKRLLALSHE 1238

Query: 1001 IRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREK 1060
             + P + + S   ++ILE+G+VR W++ EKLS  A+++ IFN KEIF  P  K++ DR  
Sbjct: 1239 HKFPTVPVKSELAVEILEKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNT 1298

Query: 1061 GLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGP 1120
            G++E+ ++ L +ED+G+YT QLQDGKA N  T+ LV D F KL ++A+ +R++W RKQGP
Sbjct: 1299 GIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGP 1358

Query: 1121 YFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMP-DGQYDPETGTGLLCIEEL 1179
            +F   L W+VT +C V L CKV N KKET   W+    E+  D ++D + G   L I E 
Sbjct: 1359 HFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEF 1418

Query: 1180 SKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIF 1239
            SKKD GIY  ++ DDRG+D + L L  +A   +  E+ +  ALSAT LKIQ T EGI+++
Sbjct: 1419 SKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLY 1478

Query: 1240 SKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGK 1299
            S V YY VE +K  W H    +   DR++TG T ++IWL I +P  +DKGKY +E+  GK
Sbjct: 1479 SFVTYY-VEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGK 1537

Query: 1300 EVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVS 1359
               Q + DLSGQA+++A AE QRLK  AI EKNRA+V+ GLPDV TI E K L LTC V 
Sbjct: 1538 TGHQKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVW 1597

Query: 1360 GDPTPEISWLKNDQPVTFLDRYRMEVR-GTEVTITIEKVNSEDSGRYGVFVKNKYGSETG 1418
            GDP PE+SWLKN++ +   D   ++   G     TI  V++ DSG+YG+ VKNKYGSET 
Sbjct: 1598 GDPPPEVSWLKNEKALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETS 1657

Query: 1419 QVTISVFKHGDEPK 1432
              T+SVF   +E +
Sbjct: 1658 DFTVSVFIPEEEAR 1671



 Score =  455 bits (1171), Expect = e-127
 Identities = 383/1444 (26%), Positives = 665/1444 (46%), Gaps = 138/1444 (9%)

Query: 34   EERQHSLRMGSSVRRRTFRSSEEEHEFSAADYALAAALALTASSELSWEAQLRRQTSAVE 93
            EE   + +  ++ ++ T        + S A     A+   TAS +       ++ TSA++
Sbjct: 175  EEGITTSKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQ---SVVSKQATSALQ 231

Query: 94   LEERGQKRVGFGNDWERTEIAFLQTHRLLRQRRDWKTLRRRTEEKVQEAKELRELCYGRG 153
             EE  +K+                   ++R++ +  +LR+  EE      +L E      
Sbjct: 232  QEETSEKK---------------SRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHA 276

Query: 154  PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLL 213
            P F I  RSH VWE   V L C++   P P+VTWYKN   I+      GKY I + YG+ 
Sbjct: 277  PEFIIKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHA-NPGKYIIESRYGMH 335

Query: 214  SLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRS------TF 267
            +LEI  C  ED+A Y     N  G+ S++A V+V+ Y G+   FD   F         +F
Sbjct: 336  TLEINGCDFEDTAQYRASAMNVKGELSAYASVVVKRYKGE---FDETRFHAGASTMPLSF 392

Query: 268  GPS---------VEFTSVLKPVFAREKEPFSLSC--LFSEDVLDAE-SIQWFRDGSLLRS 315
            G +         + F       F RE E  SL C  + + ++   +  IQW+R+G  L  
Sbjct: 393  GVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSP 452

Query: 316  SRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGS 375
            S+  + L++  +A+L  S   KEDEGLY +RV       + S YV VRDA+AE  GAP +
Sbjct: 453  SKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYYEQYSAYVFVRDADAEIEGAPAA 512

Query: 376  PLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQ 435
            PL+V+CL+ N+D +I++W  P+   G+PI  Y I++C+  +  W  C++ P    R P+ 
Sbjct: 513  PLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVT 572

Query: 436  GLVEGQSYRFRVRAISRVGSSVPSKASELVVMGD-HDAARRKTEIPFDLGNKITISTDAF 494
            GL+EG+SY FRVRA++++G   PS+ SE V   D  + AR K+        +I ++ +  
Sbjct: 573  GLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEP 632

Query: 495  EDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESP 554
             + + +P PPT++  +E   +YVVL+W+ P  R    + Y +EK   G+  W+ +++E P
Sbjct: 633  SEGI-VPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELP 691

Query: 555  VRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLP-PPAQVQAFRD 613
            V+SPRFA+ DL + KSY FRVR  N  G+ +PSE +E + + G    +P  P ++   R+
Sbjct: 692  VKSPRFALFDLAEGKSYCFRVRCSNSAGVGEPSEATE-VTVVGDKLDIPKAPGKIIPSRN 750

Query: 614  TQTSVSLTWDPVKD-PELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFC 672
            T TSV ++W+  KD  EL+GYYI +   G+ +W+  NN P++G+RFT  GL TG+ Y F 
Sbjct: 751  TDTSVVVSWEESKDAKELVGYYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFR 810

Query: 673  VRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKIL 732
            VR+V+ AG+ E S  +E I VK A+    +P     L+     +            G++ 
Sbjct: 811  VRAVNAAGLSEYSQDSEAIEVKAAIGGGVSPDVCPALSDEPGGLT--------ASRGRVH 862

Query: 733  GYFLDQHDSEELDWHAVNQQPIP--------TRVCKVSDLHEGHFYEFRARAANWAGVGE 784
                     + L     N+  +P        T V KVS+  +        +AA      +
Sbjct: 863  EASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPPPQKAA-----PQ 917

Query: 785  LSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQE-- 842
              + S   + K    P P PP D+   E    S+VL W+ P  +G   +TGY+V+++E  
Sbjct: 918  GKSKSDPLKKKTDRAP-PSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVI 976

Query: 843  EG-SEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED--- 898
            +G   +W+      +S    ++S+L+    Y FQV AMN AGLG PS  ++    E+   
Sbjct: 977  DGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTI 1036

Query: 899  -KPG-AHEIEVGVDEEGFIYLAFEAP----EAPDSSEFQWSKDYKGPLDPQRVKIEDKVN 952
              PG  H ++     +  + L ++ P      P +  F   K+ K   D  R   E  + 
Sbjct: 1037 AVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAI- 1095

Query: 953  KSKVILKEPGLEDLGTYSVIVTDADE-DISASHTLTEEELEKLKKLSHEIRNPVIKLISG 1011
               V LK  GL++  +Y   V   ++  +     L    + + +  + E+          
Sbjct: 1096 -KNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGTKEV---------- 1144

Query: 1012 WNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLS 1071
              +++ + G + L  E +K++P +E    ++   + +  + ++  + +    ++  ++L 
Sbjct: 1145 -VVNVDDDGVISLNFECDKMTPKSEFS--WSKDYVSTEDSPRLEVESKGNKTKMTFKDLG 1201

Query: 1072 EEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVT 1131
             +D G Y+  + D       +  L+D++    L++  A   + K    P  +  L  ++ 
Sbjct: 1202 MDDLGIYSCDVTD--TDGIASSYLIDEE---ELKRLLALSHEHKFPTVP-VKSELAVEIL 1255

Query: 1132 EDCQVQLTCKVTNTKKETRFQWFFQRAEMPDG-----QYDPETGTGLLCIEELSKKDKGI 1186
            E  QV+   +        +  + F   E+ +G       D  TG   + +E+L  +D+G 
Sbjct: 1256 EKGQVRFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGT 1315

Query: 1187 YRAMVSDDRGEDDTILDLTGDALDAIFTE--------LGRIGALSATPLKIQGTEEGIRI 1238
            Y   + D +  + + + L GD    +  E        + + G      L  + T E   +
Sbjct: 1316 YTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGE-CNV 1374

Query: 1239 FSKVKYYNV-EYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAA 1297
              K K  N+ +     W+  ++ +   ++      +  + +     KD+   +  L+   
Sbjct: 1375 LLKCKVANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDR 1434

Query: 1298 GKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIE---KNRAKVVRGLPDVATIMEDKTLCL 1354
            GK+  +L   L  +AF++ M E  +   L+  +   ++ A+ ++    V   +ED     
Sbjct: 1435 GKDKSRLK--LVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDL---- 1488

Query: 1355 TCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYG 1414
                      +++W  N   + + DR +  V G ++ + I +    D G+Y   V   + 
Sbjct: 1489 ----------KVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKY---VMELFD 1535

Query: 1415 SETG 1418
             +TG
Sbjct: 1536 GKTG 1539



 Score = 40.8 bits (94), Expect = 0.009
 Identities = 25/98 (25%), Positives = 45/98 (45%), Gaps = 3/98 (3%)

Query: 1341 PDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTF---LDRYRMEVRGTEVTITIEKV 1397
            P   T+ E + + L C ++G P P ++W KN  P+       +Y +E R    T+ I   
Sbjct: 283  PRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGC 342

Query: 1398 NSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
            + ED+ +Y     N  G  +   ++ V ++  E  E +
Sbjct: 343  DFEDTAQYRASAMNVKGELSAYASVVVKRYKGEFDETR 380



 Score = 35.8 bits (81), Expect = 0.31
 Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 13/82 (15%)

Query: 165  VWEHTTVLLTCTVQASPPPQVTWYKNDTRIDP-----RLFRAGKYRITNNYGLLSLEIRR 219
            + E   + LTC V   PPP+V+W KN+  +         F AG+             I  
Sbjct: 1584 IQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNLKFEAGR--------TAYFTING 1635

Query: 220  CAIEDSATYTVRVKNAHGQASS 241
             +  DS  Y + VKN +G  +S
Sbjct: 1636 VSTADSGKYGLVVKNKYGSETS 1657


>gi|110349719 titin isoform N2-A [Homo sapiens]
          Length = 33423

 Score =  274 bits (701), Expect = 4e-73
 Identities = 215/831 (25%), Positives = 361/831 (43%), Gaps = 81/831 (9%)

Query: 169   TTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATY 228
             T + L  TV   P P++TW    T+ D  L +  +  I N     ++ I      D+ TY
Sbjct: 13706 TKIELPATVTGKPEPKITW----TKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTY 13761

Query: 229   TVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPF 288
              +   N  G+A++  +V V    G  A FD               T V            
Sbjct: 13762 IIEAVNVCGRATAVVEVNVLDKPGPPAAFD--------------ITDVTNE--------- 13798

Query: 289   SLSCLFS----EDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYM 344
               SCL +     D   ++   +  +     S    K+  T +  + K +      E ++ 
Sbjct: 13799 --SCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFR 13856

Query: 345   VRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPI 404
             V   + +G  E      +      +P  PG P  +   D+ +D + LTW  P D  G+PI
Sbjct: 13857 VAAENMYGVGEPVQASPITAKYQFDP--PGPPTRLEPSDITKDAVTLTWCEPDDDGGSPI 13914

Query: 405   TAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASEL 464
             T Y +ER   ++ +W+ C++ P       ++GL   + YRFRV A +  G   PSK++E 
Sbjct: 13915 TGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEP 13974

Query: 465   VVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEP 524
             +++                           +D +  P PP      ++ +  V L W +P
Sbjct: 13975 ILI---------------------------KDPIDPPWPPGKPTVKDVGKTSVRLNWTKP 14007

Query: 525   SPRDRAPL-TYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGL 583
                  A + +Y +E    G+  W  ++   P  + +  +  L + + Y FRVRA+N+ G 
Sbjct: 14008 EHDGGAKIESYVIEMLKTGTDEWVRVAEGVP--TTQHLLPGLMEGQEYSFRVRAVNKAGE 14065

Query: 584   SDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWD-PVKD--PELLGYYIYSRKV 640
             S+PSEPS+P+  R       PP  ++    T+ +  L W  P KD    +  Y +  R V
Sbjct: 14066 SEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDV 14125

Query: 641   GTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATP 700
                 WQTV+   ++ T+ TV  L  G  Y F V + +  G  + +   + +  K    TP
Sbjct: 14126 RRKGWQTVDTT-VKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTP 14184

Query: 701   SAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCK 760
               PY  A+++  K  + + W+PPK  GG  I  Y +++ +     W    +   P    +
Sbjct: 14185 GPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFR 14244

Query: 761   VSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVL 820
             V+D+ EG   +F+ RA N AGVG  S P+ +   ++ T P P PP D+  ++     + +
Sbjct: 14245 VTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSP-PSPPLDLHVTDAGRKHIAI 14303

Query: 821   QWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSD-LQPGKSYVFQVQAM 879
              W+PP   G  P+ GYHV     G+E+W  V   PI     +V + + P K YV +V+A+
Sbjct: 14304 AWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAV 14363

Query: 880   NSAGLGQPSMPTDPVLLED---KP----GAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQW 932
             N+ G+ +PS  ++ V+ +D   KP      H+I V   E+  I + F A   P  S   W
Sbjct: 14364 NAIGVSEPSEISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVS---W 14420

Query: 933   SKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISAS 983
              KD K      R+ +++    + + + +    D G Y++ + +     +AS
Sbjct: 14421 HKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATAS 14471



 Score =  227 bits (579), Expect = 5e-59
 Identities = 173/602 (28%), Positives = 259/602 (43%), Gaps = 86/602 (14%)

Query: 373   PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRC 432
             P  P NV+  D   + + LTW PP +  G+ I  Y +ERC   S +W+AC E P    + 
Sbjct: 13588 PDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGE-PVAETKM 13646

Query: 433   PIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARR----------------- 475
              + GL EG+ Y +RV+A++R G+S PS+ +E +   D   A                   
Sbjct: 13647 EVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGT 13706

Query: 476   KTEIPFDLGNK-------------------ITISTDAFEDTVTI---------------- 500
             K E+P  +  K                   ITI     + TVTI                
Sbjct: 13707 KIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAV 13766

Query: 501   -----------------PSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIG 542
                              P PP     +++     +L W  P     + +T Y +E+    
Sbjct: 13767 NVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATD 13826

Query: 543   SGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALR---GPP 599
             S  W  +S  S V+   F    L   K Y+FRV A N YG+ +P + S PI  +    PP
Sbjct: 13827 SEVWHKLS--STVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQAS-PITAKYQFDPP 13883

Query: 600   ATLPPPAQVQAFRDTQTSVSLTW-DPVKD--PELLGYYIYSRKVGTSEWQTVNNKPIQGT 656
                 PP +++    T+ +V+LTW +P  D    + GY++      T +W   N  P++ T
Sbjct: 13884 G---PPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDT 13940

Query: 657   RFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEM 716
              + V GL   K+Y F V + + AG G+ S +TEPI +K  +  P  P    + + GK  +
Sbjct: 13941 TYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSV 14000

Query: 717   VIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARA 776
              + W  P+  GG KI  Y ++   +   +W  V  + +PT    +  L EG  Y FR RA
Sbjct: 14001 RLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRV-AEGVPTTQHLLPGLMEGQEYSFRVRA 14059

Query: 777   ANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGY 836
              N AG  E S PS    C+E   P P PP  +    +   +  L+W  P   G  P+T Y
Sbjct: 14060 VNKAGESEPSEPSDPVLCREKLYP-PSPPRWLEVINITKNTADLKWTVPEKDGGSPITNY 14118

Query: 837   HVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLL 896
              V  ++   + W+ V    +  T   V+ L  G  YVF+V A N+ G    +   D VL 
Sbjct: 14119 IVEKRDVRRKGWQTVDT-TVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLA 14177

Query: 897   ED 898
             +D
Sbjct: 14178 KD 14179



 Score =  221 bits (564), Expect = 3e-57
 Identities = 228/925 (24%), Positives = 366/925 (39%), Gaps = 96/925 (10%)

Query: 194   IDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVK--NAHGQASSFAKVLVRTYL 251
             ++ RL    K+    N  LLS +     +++  TY  RV   N  GQ             
Sbjct: 16753 LESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQ------------- 16799

Query: 252   GKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGS 311
             GK +     I  +    P          +  R  E F+L+  +S        + WF+D +
Sbjct: 16800 GKPSFCTKPITCKDELAPPTLHLDFRDKLTIRVGEAFALTGRYSGK--PKPKVSWFKDEA 16857

Query: 312   LLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPG 371
              +    R  I  T    +L+     + D G Y V V +  G R+    V V D     PG
Sbjct: 16858 DVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVD----RPG 16913

Query: 372   APGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCR 431
              P  P++    +V +D ++++W PP D  G+ IT Y IE+ +     W+    A   T  
Sbjct: 16914 PPVGPVSFD--EVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKT-T 16970

Query: 432   CPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITIST 491
             C +  L+EG+ Y FR+ A +  G S P  +  +                           
Sbjct: 16971 CKVSKLLEGKDYIFRIHAENLYGISDPLVSDSMKA------------------------- 17005

Query: 492   DAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISS 551
                +D   +P  P     +E+ +   ++ W +P    +    Y LEK    S  W  ++ 
Sbjct: 17006 ---KDRFRVPDAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKRETMSKRWARVTK 17062

Query: 552   ESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAF 611
             +      +F V DL +   Y FRV A N+ G+ DPS PS+P+  + P A   PP   +A 
Sbjct: 17063 DPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAI 17122

Query: 612   RDTQTSVSLTWDPVK---DPELLGYYIYSRKVGTSEWQTVNNKP--IQGTRFTVPGLRTG 666
               T  SV LTW P +     ++LGY +  +KVG  EW+  N+ P     T++ V GLR G
Sbjct: 17123 DTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDG 17182

Query: 667   KEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRR 726
             + Y+F V +V+ AG  + +   EP+ VK  L  P         N  + + +       + 
Sbjct: 17183 QTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPEL---ILDANMAREQHI-------KV 17232

Query: 727   GGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELS 786
             G    L   +      ++ W     +  PT+  ++     G   E R  A    G+  L+
Sbjct: 17233 GDTLRLSAIIKGVPFPKVTWKK-EDRDAPTK-ARIDVTPVGSKLEIRNAAHEDGGIYSLT 17290

Query: 787   ----APSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQE 842
                 A S     K   + +PGPP D+  SE+R  S  L W+ PL  G   +T Y V  ++
Sbjct: 17291 VENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRD 17350

Query: 843   EGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLG------QPSMPTDPVLL 896
               S QW P++      +H     L  G  Y+F+V A N  G G      +P    DP+  
Sbjct: 17351 VASAQWSPLSATSKKKSHF-AKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHP 17409

Query: 897   EDKP-GAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQ-WSKDYKGPLDPQRVKIEDKVNKS 954
                P   H ++V   E   + L +  P+    S    +  +Y+       +K +   N  
Sbjct: 17410 PGPPKDLHHVDVDKTE---VSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKTVTNLE 17466

Query: 955   KVILKEPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNI 1014
              V+    GL+   TY   V  A+  +      T   +E  +KL        +KLI G   
Sbjct: 17467 CVV---TGLQQGKTYRFRV-KAENIVGLGLPDTTIPIECQEKLVPPSVELDVKLIEGL-- 17520

Query: 1015  DILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEED 1074
              +++ G    +  + +  P        +  EI +  +  +  D    +  + I+N    D
Sbjct: 17521 -VVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSV--LTIKNCLRRD 17577

Query: 1075  KGSY--TAQLQDGKAKNQITLTLVD 1097
              G Y  T     G     + LT++D
Sbjct: 17578 TGEYQITVSNAAGSKTVAVHLTVLD 17602



 Score =  213 bits (542), Expect = 1e-54
 Identities = 170/663 (25%), Positives = 296/663 (44%), Gaps = 72/663 (10%)

Query: 338   EDEGLYMVRVPSPFG---PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWA 394
             E +  + VR  + FG   P E       RD        P  P+ ++   + ++ + L+W 
Sbjct: 15978 EQQYFFRVRAENRFGIGPPVETIQRTTARDPIYP----PDPPIKLKIGLITKNTVHLSWK 16033

Query: 395   PPSDTRGNPITAYTIERCQGE-----SGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRA 449
             PP +  G+P+T Y +E    +        W  C++      +  ++ LVEG  Y FRV+A
Sbjct: 16034 PPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKA 16093

Query: 450   ISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHA 509
             ++  G S PS       +G  D  R       DL   + +     E+   +     N+ A
Sbjct: 16094 VNAAGVSKPS-----ATVGPCDCQRPDMPPSIDLKEFMEV-----EEGTNV-----NIVA 16138

Query: 510   SEIREAYVVLAWEEPSPR---DRAPLTYSLE-KSVIGSGTWEAISSESPVRSPRFAVLDL 565
                   +  L W +  P+   ++ P+ Y      ++   T   +  +S            
Sbjct: 16139 KIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQS------------ 16186

Query: 566   EKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPV 625
              +  + ++ + A+N  G +        +   GPP     P + ++    Q  ++L+W P 
Sbjct: 16187 RRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVG---PIKFESVSADQ--MTLSWFPP 16241

Query: 626   KDP---ELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVG 682
             KD    ++  Y I  R+     W  V+++P + T +T+P L  G EY F + + ++ G+G
Sbjct: 16242 KDDGGSKITNYVIEKREANRKTWVHVSSEPKECT-YTIPKLLEGHEYVFRIMAQNKYGIG 16300

Query: 683   ESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSE 742
             E    +EP   +   + P AP    + +  +N M + W+ P+  GG  + GY+L+  D+ 
Sbjct: 16301 EP-LDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTT 16359

Query: 743   ELDWHAVNQQPIPTRVC----KVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWT 798
                W  VN+ PI         KV+ L EG  Y+FR  A N AGVG  S PS     ++  
Sbjct: 16360 SKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPI 16419

Query: 799   MPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISG 858
              P PGPP+  + ++   +S  L+W PPL  G   VTGY V ++EEG E+W+      + G
Sbjct: 16420 AP-PGPPFP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRG 16477

Query: 859   THLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEVGVDEEGFI--- 915
             T L V+ L+ G  Y F+V+A+N AG+G+P   TD + ++D+  + ++++       I   
Sbjct: 16478 TKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVH 16537

Query: 916   ------YLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTY 969
                    +A+ + + P +    W+ + +    PQ   IE     S +++K       G Y
Sbjct: 16538 AGGVIRIIAYVSGKPPPT--VTWNMNER--TLPQEATIETTAISSSMVIKNCQRSHQGVY 16593

Query: 970   SVI 972
             S++
Sbjct: 16594 SLL 16596



 Score =  206 bits (524), Expect = 1e-52
 Identities = 222/873 (25%), Positives = 358/873 (41%), Gaps = 94/873 (10%)

Query: 139   VQEAKELRELCYGRGPWF--WIPLRSH--AVWEHTTVLLTCTVQASPPPQVTWYKNDTRI 194
             V E  E+ E    + P     I L +H   V E   + +    +A P P V+W+K+   +
Sbjct: 14368 VSEPSEISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEV 14427

Query: 195   DPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKD 254
                   + +  + N++    LE+ +    D+  YT+ ++N  G A++   V V    G  
Sbjct: 14428 KA----SDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPC 14483

Query: 255   AGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLR 314
                 +    +S                         SC  + +  + +         L R
Sbjct: 14484 KDIKASDITKS-------------------------SCKLTWEPPEFDGGTPILHYVLER 14518

Query: 315   SSRRRKILYTDRQASLKVSCTYKE--DEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGA 372
                 R+          K+S T K+    G Y  RV +           L     A++P  
Sbjct: 14519 REAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQ 14578

Query: 373   PGSP-LNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCR 431
             P  P ++V   +   + + +TW PP    G+ I  Y IE+       W  C+E       
Sbjct: 14579 PPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILT 14638

Query: 432   CPIQGLVEGQSYRFRVRAISRVGSSVPSKASE-----------LVVMGDHDAARRKTEIP 480
                +GL EG+ Y+FRVRA +  G S PS+A+             V++      +R  EI 
Sbjct: 14639 YTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIA 14698

Query: 481   FDL---GNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLE 537
              D    G+     T   ++ V +P       A  +R     +  EEP      PLT  L 
Sbjct: 14699 LDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFV---LPLTQRLS 14755

Query: 538   KSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRG 597
                   G       ES +R     V D  +    ++ ++  N +G++        +   G
Sbjct: 14756 IDNSKKG-------ESQLR-----VRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPG 14803

Query: 598   PPATLPPPAQVQAFRDTQ-TSVSLTWDPVKDP---ELLGYYIYSRKVGT--SEWQTVNNK 651
             PP           F D + TSV   W+P  D    E++ Y +  +      SEW  V + 
Sbjct: 14804 PPINF-------VFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTST 14856

Query: 652   PIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNC 711
              ++  +++V  L  GKEY F VR+ +  G G     ++P+  K     P AP    + + 
Sbjct: 14857 -LRHCKYSVTKLIEGKEYLFRVRAENRFGPGPP-CVSKPLVAKDPFGPPDAPDKPIVEDV 14914

Query: 712   GKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYE 771
               N M++ W  PK  G   ILGY+L++ +     W  VN+  +      V  L EG  Y 
Sbjct: 14915 TSNSMLVKWNEPKDNGS-PILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYV 14973

Query: 772   FRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAG 831
             FR  A N AG G+ S PS      +   P PGPP   R ++  +T++ L+WEPP + G G
Sbjct: 14974 FRVCAENAAGPGKFSPPSDPKTAHDPISP-PGPPIP-RVTDTSSTTIELEWEPPAFNGGG 15031

Query: 832   PVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPT 891
              + GY V  Q  G+ +W   T   I      V +++ G  Y  +V A+N+AG G P   T
Sbjct: 15032 EIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPG-ET 15090

Query: 892   DPVLLED--KPGAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQ------WSKDYKGPLDPQ 943
              PV + +  +P A E++V V + G   +A +    P     +      W+K+ +G LD  
Sbjct: 15091 QPVTVAEPQEPPAVELDVSV-KGGIQIMAGKTLRIPAVVTGRPVPTKVWTKE-EGELDKD 15148

Query: 944   RVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDA 976
             RV I++   KS++I+K+   +D G Y +  T++
Sbjct: 15149 RVVIDNVGTKSELIIKDALRKDHGRYVITATNS 15181



 Score =  201 bits (512), Expect = 3e-51
 Identities = 209/819 (25%), Positives = 323/819 (39%), Gaps = 106/819 (12%)

Query: 179   ASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQ 238
             A P  +  W+K +  +  +        I       S  I      D   Y + ++N HG+
Sbjct: 13025 AYPKAEAEWFKENEPLSTKT-------IDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGK 13077

Query: 239   ASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDV 298
             A  F  + V                       ++    ++ +   E     +S  + E +
Sbjct: 13078 AEGFINLKV-----------------------IDVPGPVRNLEVTETFDGEVSLAWEEPL 13114

Query: 299   LDAES--IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGL-YMVRVPSPFGPRE 355
              D  S  I +  +   ++  R+  +L TDR  S + + T  +  G+ Y+ RV +      
Sbjct: 13115 TDGGSKIIGYVVERRDIK--RKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSA------ 13166

Query: 356   QSTYVLVRDAEAENP-------GAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYT 408
             ++        E +NP         PG PLNV   DVNR  + LTW PP    G  IT Y 
Sbjct: 13167 RNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYV 13226

Query: 409   IERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMG 468
             IE     S  W              +  +VEGQ Y FRVRA +R+G   PS A+  V + 
Sbjct: 13227 IELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVA 13286

Query: 469   DHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRD 528
             D                            +  PSPP N+ +S+  ++ V L WE P    
Sbjct: 13287 D---------------------------PIERPSPPVNLTSSDQTQSSVQLKWEPPLKDG 13319

Query: 529   RAP-LTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPS 587
              +P L Y +E+   G   W   + +  V    + V  LEK   Y++RV A N+ G+SDPS
Sbjct: 13320 GSPILGYIIERCEEGKDNWIRCNMKL-VPELTYKVTGLEKGNKYLYRVSAENKAGVSDPS 13378

Query: 588   EPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQT 647
             E   P  L    A + P   + AF+D    +      V +P  +          T+ W  
Sbjct: 13379 EILGP--LTADDAFVEPTMDLSAFKDGLEVI------VPNPITILVPSTGYPRPTATWCF 13430

Query: 648   VNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVK-----QALATPSA 702
              +     G R  +  L    E        S+ G+           +        +A PSA
Sbjct: 13431 GDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSA 13490

Query: 703   PYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVS 762
             P      +  K+ + + W+PP   GG  + GY +++ +     W  V    +      V 
Sbjct: 13491 PKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV-MDFVTDLEFTVP 13549

Query: 763   DLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQ--PGPPYDVRASEVRATSLVL 820
             DL +G  Y F+  A N  G GE   P+ + E    + P   P PP +V+  +  A S+ L
Sbjct: 13550 DLVQGKEYLFKVCARNKCGPGE---PAYVDEPVNMSTPATVPDPPENVKWRDRTANSIFL 13606

Query: 821   QWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPG-PISGTHLRVSDLQPGKSYVFQVQAM 879
              W+PP   G   + GY V     GS++W  V  G P++ T + V+ L+ GK Y ++V+A+
Sbjct: 13607 TWDPPKNDGGSRIKGYIVERCPRGSDKW--VACGEPVAETKMEVTGLEEGKWYAYRVKAL 13664

Query: 880   NSAGLGQPSMPTDPVLLEDKPGAHEIEVGVD-EEGFIYLAFEAPEAP------DSSEFQW 932
             N  G  +PS PT+ +   D   A EI + V    G    A    E P         +  W
Sbjct: 13665 NRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITW 13724

Query: 933   SKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSV 971
             +K        +R+ IE+   KS V + +    D GTY +
Sbjct: 13725 TKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYII 13763



 Score =  199 bits (506), Expect = 2e-50
 Identities = 177/674 (26%), Positives = 281/674 (41%), Gaps = 59/674 (8%)

Query: 376   PLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQ 435
             P NVR  D++++ + L+W  P+   G+ IT Y +ER     G W           +  I 
Sbjct: 26771 PRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIIS 26830

Query: 436   GLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFE 495
             GL +   Y FRV A + VGS   S  SE+V                     IT       
Sbjct: 26831 GLTQNSQYEFRVFARNAVGSI--SNPSEVV-------------------GPITCIDSYGG 26869

Query: 496   DTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPV 555
               + +P   T V       +  + A     P   AP T    K      T   +  E+  
Sbjct: 26870 PVIDLPLEYTEVVKYRAGTSVKLRAGISGKP---AP-TIEWYKDDKELQTNALVCVENTT 26925

Query: 556   RSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQ 615
                   + D ++  S  + ++  N  G +  +   + +   GPP        ++    T 
Sbjct: 26926 DLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPG-----GPIEFKTVTA 26980

Query: 616   TSVSLTWDPVKDP---ELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFC 672
               ++L W P  D    ++  Y +  R+     W  V+   ++    T   +  G EY F 
Sbjct: 26981 EKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEH-LEECIITTTKIIKGNEYIFR 27039

Query: 673   VRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKIL 732
             VR+V++ G+GE    ++ +  K A  TP  P    +    KN M + W  P   GG  I 
Sbjct: 27040 VRAVNKYGIGEP-LESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDIS 27098

Query: 733   GYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLF 792
             GYFL++ D + L W  V ++ I     KV+ L E   Y++R  A N AG G  S PS  +
Sbjct: 27099 GYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFY 27158

Query: 793   ECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPV- 851
             +  +   P PGPP  +R ++   +S+ L W  P+Y G   VTGY V  ++   E+W  V 
Sbjct: 27159 KAADPIDP-PGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVS 27217

Query: 852   TPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEVGV-- 909
             T G +  T   VS+L+PG +Y F+V A+N AG G+P    +PV  +D   A EI++ V  
Sbjct: 27218 TKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVAL 27277

Query: 910   --------DEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEP 961
                      E+  + + F+    P  +   W KD K      R  IE+  + S + + + 
Sbjct: 27278 RTSVIAKAGEDVQVLIPFKGRPPPTVT---WRKDEKNLGSDARYSIENTDSSSLLTIPQV 27334

Query: 962   GLEDLGTYSVIVTDA-----DEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDI 1016
                D G Y + + +         +S     T    +KL ++ H  R  V  L   W+  +
Sbjct: 27335 TRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKL-QVKHVSRGTVTLL---WDPPL 27390

Query: 1017  LERGEVRLWLEVEK 1030
             ++ G   +   +EK
Sbjct: 27391 IDGGSPIINYVIEK 27404



 Score =  193 bits (491), Expect = 9e-49
 Identities = 171/677 (25%), Positives = 283/677 (41%), Gaps = 77/677 (11%)

Query: 238   QASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSED 297
             +A S + ++++    KD+G+ S   + S+   + +   V+       + PF +S + +  
Sbjct: 18949 KADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDA-- 19006

Query: 298   VLDAESIQW---FRDGS-------LLRSSRRRKILYTDRQASLKVSCTYKE----DEGLY 343
               DA S+ W     DG        + +    R    T   +  K SC   +     E ++
Sbjct: 19007 --DACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIF 19064

Query: 344   MVRVPSPFGPREQSTYVLVRDAEAENP-GAPGSPLNVRCLDVNRDCLILTWAPPSDTRGN 402
              VR  + FG  E  T   +    A+ P G P  P N R   VN+DC+ + W  P    G+
Sbjct: 19065 RVRAENRFGISEPLTSPKM---VAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGS 19121

Query: 403   PITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKAS 462
             PI  Y IER +  S  W+  ++    +   P  GLVEG  Y FR+ A+++ GSS PSK +
Sbjct: 19122 PIIGYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPT 19181

Query: 463   ELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWE 522
             E V             +P D                    PP      ++ ++ V L W 
Sbjct: 19182 EYVT----------ARMPVD--------------------PPGKPEVIDVTKSTVSLIWA 19211

Query: 523   EPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPR--FAVLDLEKKKSYVFRVRAMN 579
              P     + +  Y +E   +    W   ++ +P + P+  +    LE+K  Y FR  A  
Sbjct: 19212 RPKHDGGSKIIGYFVEACKLPGDKWVRCNT-APHQIPQEEYTATGLEEKAQYQFRAIART 19270

Query: 580   QYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRK 639
                +S PSEPS+P+ +      +PP   +     +  +V    +   D  + G     + 
Sbjct: 19271 AVNISPPSEPSDPVTILA--ENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFG-----KP 19323

Query: 640   VGTSEWQTVNN--KPIQGTRFTVPGLRTGKEYEFCVRSVSEAG----VGESSAATEPIRV 693
             + T  W+      KP +G +  +   R     E    +  ++G      E+S+ ++   +
Sbjct: 19324 MPTVSWKKDGTLLKPAEGIKMAMQ--RNLCTLELFSVNRKDSGDYTITAENSSGSKSATI 19381

Query: 694   K-QALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQ 752
             K + L  P  P    +     +  ++ W+PP   GG +I  Y +D+ ++   +W  V+  
Sbjct: 19382 KLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVS-A 19440

Query: 753   PIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMP-QPGPPYDVRAS 811
              +P   C V  L EGH Y+FR  A N  GVG+            +  P +  PP     S
Sbjct: 19441 TVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDPPV---IS 19497

Query: 812   EVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKS 871
              +    + + W+PP   G  P+TGY +  +E  +  W  V   PI    L+ + LQ G  
Sbjct: 19498 NITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTE 19557

Query: 872   YVFQVQAMNSAGLGQPS 888
             Y F+V A+N AG G+PS
Sbjct: 19558 YEFRVTAINKAGPGKPS 19574



 Score =  192 bits (487), Expect = 3e-48
 Identities = 216/903 (23%), Positives = 365/903 (40%), Gaps = 121/903 (13%)

Query: 154   PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLL 213
             P   +P  ++++     + +   V   P P ++W K+    +P L +  +  +       
Sbjct: 24312 PSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDG---EP-LKQTTRVNVEETATST 24367

Query: 214   SLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAG---FDSEIFKRSTFGPS 270
              L I+    +D   YTV   N+ G A+    V+V    G   G   FD           S
Sbjct: 24368 VLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEV---------S 24418

Query: 271   VEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASL 330
              +F      V + E   ++  C  S  +++       RD +   ++    +  T  + ++
Sbjct: 24419 ADFV-----VISWEPPAYTGGCQISNYIVEK------RDTT---TTTWHMVSATVARTTI 24464

Query: 331   KVSCTYKEDEGLYMVRVPSPFGPRE--QSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDC 388
             K++      E  + +   + +G      S  V+V+    E PG PG+P       +++D 
Sbjct: 24465 KITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKE-PGPPGTPF---VTSISKDQ 24520

Query: 389   LILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVR 448
             +++ W  P +  G  I  Y +E+ +  S  W+  ++ P    +    GL EG  Y F+V 
Sbjct: 24521 MLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVS 24580

Query: 449   AISRVGSSVPSKASELVVMGD---------------HDAARRKTEIPFDLGNKIT---IS 490
             A + VG   PSK SE  V  D               ++   +  +  +D G+KIT   + 
Sbjct: 24581 AENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVE 24640

Query: 491   TDAFEDTVTIPSPPTNVHASEI---------REAYVVLA------WEEPSP-------RD 528
                  D   + +  TNV  +E          R  + V+A      + EPS        RD
Sbjct: 24641 KKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARD 24700

Query: 529   R-------------------APLTYSLEKSVIGSG----TWEAISSESPVRSPRFAVLDL 565
                                 A  T+ LE  + G       W     E    + R  +   
Sbjct: 24701 EIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKST 24760

Query: 566   EKKKSYVFRVRAMNQYG-----LSDPS-EPSEPIALRGPPATLPPPAQVQAFRDTQTSVS 619
              +K + V +       G     LS+     S PI ++      PP   ++    T     
Sbjct: 24761 IQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCY 24820

Query: 620   LTWDP-VKD--PELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSV 676
             L W+P ++D    +  Y I  R+     W  V+ + +Q   + V  L  G EY F V +V
Sbjct: 24821 LAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTE-VQALNYKVTKLLPGNEYIFRVMAV 24879

Query: 677   SEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFL 736
             ++ G+GE    + P+        P  P    +    K+ MV+ W  P   GG +I GY L
Sbjct: 24880 NKYGIGEP-LESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYIL 24938

Query: 737   DQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKE 796
             ++ D E + W   N++ +     +V+ L EGH YEFR  A N AGVGE S PS  +   +
Sbjct: 24939 EKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACD 24998

Query: 797   WTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP- 855
                P PGPP + + ++   +S+ L W  P+Y G  PV GY V  +E  +++W   TP   
Sbjct: 24999 ALYP-PGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTG 25057

Query: 856   ISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEVGVDEEGFI 915
             + G    V+ L+    Y F++ A+NS G+G+P+     V+ +++    EIE+  D    +
Sbjct: 25058 LQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVV 25117

Query: 916   YL-------AFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGT 968
              L        F   +     E +W K  +G L   R +IE   + + +++      D G 
Sbjct: 25118 VLRASATLRLFVTIKGRPEPEVKWEK-AEGIL-TDRAQIEVTSSFTMLVIDNVTRFDSGR 25175

Query: 969   YSV 971
             Y++
Sbjct: 25176 YNL 25178



 Score =  191 bits (486), Expect = 3e-48
 Identities = 201/819 (24%), Positives = 336/819 (41%), Gaps = 89/819 (10%)

Query: 170   TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT 229
             T+ L+  ++  P P+VTW K D R  P      K RI        LEIR  A ED   Y+
Sbjct: 17235 TLRLSAIIKGVPFPKVTWKKED-RDAPT-----KARIDVTPVGSKLEIRNAAHEDGGIYS 17288

Query: 230   VRVKNAHGQASSFAKVLVRTYLGKDAGFD-SEIFKRSTFGPSVEFTSVLKPVFAREKEPF 288
             + V+N  G  +   KVLV    G     + SEI K S +                 KEP 
Sbjct: 17289 LTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCY--------------LTWKEPL 17334

Query: 289   ----SLSCLFSEDVLDAESIQWFR-DGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
                 S+   +  +  D  S QW     +  + S   K L    Q   +V+   +   G +
Sbjct: 17335 DDGGSVITNYVVERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPF 17394

Query: 344   MVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNP 403
              V  P P           ++  +  +P  PG P ++  +DV++  + L W  P    G+P
Sbjct: 17395 -VETPKP-----------IKALDPLHP--PGPPKDLHHVDVDKTEVSLVWNKPDRDGGSP 17440

Query: 404   ITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASE 463
             IT Y +E  +  + +WI           C + GL +G++YRFRV+A + VG  +P     
Sbjct: 17441 ITGYLVEYQEEGTQDWIKFKTVTN--LECVVTGLQQGKTYRFRVKAENIVGLGLPD---- 17494

Query: 464   LVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEE 523
                          T IP +   K+     + E  V +         + +R   ++     
Sbjct: 17495 -------------TTIPIECQEKLV--PPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPV 17539

Query: 524   PSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGL 583
             P+ +      ++ + S I   T E  + E+   S    + +  ++ +  +++   N  G 
Sbjct: 17540 PTAK------WTTDGSEIK--TDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGS 17591

Query: 584   SDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDP---ELLGYYIYSRKV 640
                +     + + GPP        +     T   ++++W P KD     ++ Y +  +  
Sbjct: 17592 KTVAVHLTVLDVPGPPT-----GPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDT 17646

Query: 641   GTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATP 700
                 W  V++   + T+  +P L+ G EY F VR+ ++ GVG    +T P   K   + P
Sbjct: 17647 RKDTWGVVSSGSSK-TKLKIPHLQKGCEYVFRVRAENKIGVGPPLDST-PTVAKHKFSPP 17704

Query: 701   SAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCK 760
             S P    + +  +N   + W  PK  GG  I GY++++ +     W  VN+ PI     +
Sbjct: 17705 SPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREVTG-KWVRVNKTPIADLKFR 17763

Query: 761   VSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVL 820
             V+ L+EG+ YEFR  A N AG+ + S  S   +      P PGPP + +  +    +  L
Sbjct: 17764 VTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKP-PGPPINPKLKDKSRETADL 17822

Query: 821   QWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP-ISGTHLRVSDLQPGKSYVFQVQAM 879
              W  PL  G  P+ GY V  Q+ G+ QW  +     I     RV  L  G  Y F+++A 
Sbjct: 17823 VWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAA 17882

Query: 880   NSAGLGQPSMPTDPVLLEDKPGAHEIEVGVD-------EEGFIYLAFEAPEAPDSSEFQW 932
             N  G G+P    + V+ +D     E+E+ V          G         +     +  W
Sbjct: 17883 NIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITW 17942

Query: 933   SKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSV 971
             +K+ K  +  +RV +   + + ++ +KE    D G Y +
Sbjct: 17943 TKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYII 17981



 Score =  189 bits (480), Expect = 2e-47
 Identities = 164/614 (26%), Positives = 260/614 (42%), Gaps = 54/614 (8%)

Query: 373   PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRC 432
             PG P     +++ R+ + L W  P    G+ +T Y +E+    S  W+  +      C  
Sbjct: 20277 PGKP---EVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAF 20333

Query: 433   PIQGLVEGQSYRFRVRAISRVGS-SVPSKASELVVMGDHDAARRKTEIPFDLGNKITIST 491
              +  LVEG  Y FR+RA +  G+ S PS+++E ++  D      + E P       TI  
Sbjct: 20334 TVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKD------EYEAP-------TIVL 20380

Query: 492   D-AFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAIS 550
             D   +D +TI +  T V       A  +L   +P P+       S  K+       +   
Sbjct: 20381 DPTIKDGLTIKAGDTIV-----LNAISILG--KPLPKS------SWSKAGKDIRPSDITQ 20427

Query: 551   SESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQA 610
               S   S    +    +K +  + + A N +G          + + GPP        V+ 
Sbjct: 20428 ITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPPGP------VEI 20481

Query: 611   FRDTQTSVSLTWDPVKDP---ELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGK 667
                +    +LTW P  +     +  Y +  R+     W TV ++ IQ  R     L  G 
Sbjct: 20482 SNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLW-TVVSEDIQSCRHVATKLIQGN 20540

Query: 668   EYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRG 727
             EY F V +V+  G GE    +EP+++      P  P    + N  KN   + WK P   G
Sbjct: 20541 EYIFRVSAVNHYGKGEP-VQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDG 20599

Query: 728   GGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSA 787
             G +I GY +++ + + L W    + P+    CKV+ L EG  YEFR  A N AG+G  S 
Sbjct: 20600 GSEITGYHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSE 20659

Query: 788   PSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQ 847
              S     K+   P PGPP +   ++    S  L W  P Y G   +TGY V  Q+ G E 
Sbjct: 20660 ASDSVLMKDAAYP-PGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEA 20718

Query: 848   W-KPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIE 906
             W K  T   +  T   V DLQ  + Y F++ A+N AG+G+P++  D  ++E +  A + E
Sbjct: 20719 WIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVE-REMAPDFE 20777

Query: 907   VGVD-------EEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILK 959
             +  +         G     F   +   + E  W+KD        R  IE+  + + +I+ 
Sbjct: 20778 LDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINL--KNRANIENTESFTLLIIP 20835

Query: 960   EPGLEDLGTYSVIV 973
             E    D G + + +
Sbjct: 20836 ECNRYDTGKFVMTI 20849



 Score =  189 bits (479), Expect = 2e-47
 Identities = 201/842 (23%), Positives = 336/842 (39%), Gaps = 108/842 (12%)

Query: 170   TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT 229
             T +L   ++  P P V W K+   ++     A +  I +     +L ++ C   D   Y 
Sbjct: 24724 TFVLEADIRGKPIPDVVWSKDGKELEET---AARMEIKSTIQKTTLVVKDCIRTDGGQYI 24780

Query: 230   VRVKNAHGQASSFAKVLVRTYLG------KDAGFDSEIFKRSTFGPSVEFTSVLKPVFAR 283
             +++ N  G  S    V V    G      K  G  +E    +   P  +  + +      
Sbjct: 24781 LKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIE 24840

Query: 284   EKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQA-SLKVSCTYKEDEGL 342
             ++E   LS              W +             + T+ QA + KV+     +E +
Sbjct: 24841 KRETSRLS--------------WTQ-------------VSTEVQALNYKVTKLLPGNEYI 24873

Query: 343   YMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGN 402
             + V   + +G  E      V       P  PG P       + +D +++TWA P D  G 
Sbjct: 24874 FRVMAVNKYGIGEPLESGPVTACNPYKP--PGPPSTPEVSAITKDSMVVTWARPVDDGGT 24931

Query: 403   PITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKAS 462
              I  Y +E+   E   W  C++      R  + GL EG SY FRV A +  G   PS+ S
Sbjct: 24932 EIEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPS 24991

Query: 463   ELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWE 522
                    + A                       D +  P PP+N   ++   + V LAW 
Sbjct: 24992 VF-----YRAC----------------------DALYPPGPPSNPKVTDTSRSSVSLAWS 25024

Query: 523   EPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQY 581
             +P     AP+  Y +E     +  W   +  + ++  +F V  L++   Y FR+ A+N  
Sbjct: 25025 KPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSE 25084

Query: 582   GLSDPSE-PSEPIALRG--PP-----ATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGY 633
             G+ +P+  P   +A     PP     A L     ++A    +  V++   P  +PE+   
Sbjct: 25085 GVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFVTIKGRP--EPEV--- 25139

Query: 634   YIYSRKVGTSEWQTVNNKPIQGTR-FTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIR 692
                  K   +E    +   I+ T  FT+  +     ++    +++      S  A   +R
Sbjct: 25140 -----KWEKAEGILTDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVR 25194

Query: 693   VKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQ 752
             V   L +PSAP    +    K+ + + W+PP   GG KI  Y +++ ++    +  +   
Sbjct: 25195 V---LDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNN 25251

Query: 753   PIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASE 812
                T   ++ +L EG  Y FR  A+N  G+G    P+   E  + + P P PP  V   +
Sbjct: 25252 CTKT-TFRIENLQEGCSYYFRVLASNEYGIG---LPAETTEPVKVSEP-PLPPGRVTLVD 25306

Query: 813   VRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSY 872
             V   +  ++WE P   G   +TGY V  Q +GSE+W   T   +      +S L  G+ Y
Sbjct: 25307 VTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCT--QVKTLEATISGLTAGEEY 25364

Query: 873   VFQVQAMNSAGLGQPSMPTDPVLLED---KPGA----HEIEVGVDEEGFIYLAFEA-PEA 924
             VF+V A+N  G   P     PV+  D   KP      H   V   E+  I + F+  P+A
Sbjct: 25365 VFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKIDVPFKGRPQA 25424

Query: 925   PDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASH 984
                    W KD +   +  RV +      + + +KE   ED+GTY + V+++   I+   
Sbjct: 25425 ----TVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPI 25480

Query: 985   TL 986
             T+
Sbjct: 25481 TI 25482



 Score =  186 bits (471), Expect = 2e-46
 Identities = 162/628 (25%), Positives = 268/628 (42%), Gaps = 63/628 (10%)

Query: 373   PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRC 432
             PG P+    L++ R  + L WA P  T G  IT+Y +E+    +G W+  + +       
Sbjct: 21360 PGKPVP---LNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEF 21416

Query: 433   PIQGLVEGQSYRFRVRAISRVGS-SVPSKASELVVMGDH-DAARRKTEIPFDLGNKITIS 490
              + GL E  +Y FRV A +  G+ S PS+ S+ +   D  +A + K ++ F     I  +
Sbjct: 21417 TVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFK-DTVILKA 21475

Query: 491   TDAF--EDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEA 548
              +AF  E  V+   PPT             + W +         T  LE  +    T   
Sbjct: 21476 GEAFRLEADVSGRPPPT-------------MEWSKDGKELEG--TAKLEIKIADFST-NL 21519

Query: 549   ISSESPVRSPRFAVLDLEKKKSY---VFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPP 605
             ++ +S  R      L       +   +F V+ +++ G                    PP 
Sbjct: 21520 VNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPG--------------------PPE 21559

Query: 606   AQVQAFRDTQTSVSLTWDPVKDP---ELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPG 662
               +     T     L+W P  D    ++  Y +  R+     W  V ++ +Q T+  V  
Sbjct: 21560 GPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASE-VQVTKLKVTK 21618

Query: 663   LRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKP 722
             L  G EY F V +V++ GVGE    +EP+        P  P    +    K+ MV+ W  
Sbjct: 21619 LLKGNEYIFRVMAVNKYGVGEP-LESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGH 21677

Query: 723   PKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGV 782
             P   GG +I+ Y +++ D     W   N++ +     KVS L EGH YEFR  A N AG+
Sbjct: 21678 PDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGI 21737

Query: 783   GELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQE 842
                S  S  ++  + T+ +PGPP + R  +   +S+ + W  P+Y G   +TGY V    
Sbjct: 21738 SAPSPTSPFYKACD-TVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIAL 21796

Query: 843   EGSEQWKPVT-PGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPG 901
                ++W+ VT P  +  T   ++ L   + Y  ++ AMNS GLG+P++       ED+  
Sbjct: 21797 PEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRML 21856

Query: 902   AHEIEVGVDEEGFIYL-------AFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKS 954
               EIE+  D    + +        F   +   + E +W++D+   LD  +  IE   + +
Sbjct: 21857 PPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLD--KASIESTSSYT 21914

Query: 955   KVILKEPGLEDLGTYSVIVTDADEDISA 982
              +I+      D G Y + V ++    SA
Sbjct: 21915 LLIVGNVNRFDSGKYILTVENSSGSKSA 21942



 Score =  184 bits (466), Expect = 7e-46
 Identities = 263/1176 (22%), Positives = 454/1176 (38%), Gaps = 191/1176 (16%)

Query: 318   RRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPL 377
             + +I  T   + L++     ED G+Y + V +P G +  S  VLV D        PG P 
Sbjct: 17262 KARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDK-------PGPPR 17314

Query: 378   NVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGL 437
             ++   ++ +D   LTW  P D  G+ IT Y +ER    S +W               + L
Sbjct: 17315 DLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHFA-KHL 17373

Query: 438   VEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDT 497
              EG  Y FRV A ++ G                         PF    K   + D     
Sbjct: 17374 NEGNQYLFRVAAENQYGRG-----------------------PFVETPKPIKALDPLHP- 17409

Query: 498   VTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVR 556
                P PP ++H  ++ +  V L W +P     +P+T Y +E    G+  W    +   V 
Sbjct: 17410 ---PGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKT---VT 17463

Query: 557   SPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQT 616
             +    V  L++ K+Y FRV+A N  GL  P + + PI  +     L PP+     +  + 
Sbjct: 17464 NLECVVTGLQQGKTYRFRVKAENIVGLGLP-DTTIPIECQ---EKLVPPSVELDVKLIEG 17519

Query: 617   SVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVP--GLRTGKEYEFCVR 674
              V      V+ P +    I    V T++W T  ++      +TV      +    + C+R
Sbjct: 17520 LVVKAGTTVRFPAI----IRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLR 17575

Query: 675   -SVSEAGVGESSAA-TEPIRVK-QALATPSAPYG-FALLNCGKNEMVIGWKPPKRRGGGK 730
                 E  +  S+AA ++ + V    L  P  P G   +L+     M I W+PPK  GG  
Sbjct: 17576 RDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSP 17635

Query: 731   ILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGE-LSAPS 789
             ++ Y +++ D+ +  W  V+     T++ K+  L +G  Y FR RA N  GVG  L +  
Sbjct: 17636 VINYIVEKQDTRKDTWGVVSSGSSKTKL-KIPHLQKGCEYVFRVRAENKIGVGPPLDSTP 17694

Query: 790   SLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWK 849
             ++ + K      P PP     +++   +  + W  P   G  P+TGY++  + E + +W 
Sbjct: 17695 TVAKHK---FSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYME-RREVTGKWV 17750

Query: 850   PVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLL--EDKPGAHEIEV 907
              V   PI+    RV+ L  G +Y F+V A N AGL +PS  +DP+      KP    I  
Sbjct: 17751 RVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKPPGPPINP 17810

Query: 908   GVDEEGFIYLAFEAPEAPDSSEFQWSK---DYKGPLDPQRVKIE-------DKVNKSKVI 957
              + ++           + ++++  W+K   D   P+    V+ +       +++NK ++I
Sbjct: 17811 KLKDK-----------SRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELI 17859

Query: 958   ----LKEPGLEDLGTYSVIVTDAD-----------EDISASHTLTEEELEKLKKLSHEIR 1002
                  + PGL +   Y   +  A+           E + A   L   E+E    L    R
Sbjct: 17860 RQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVE----LDVTCR 17915

Query: 1003  NPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGL 1062
             + VI +  G  I IL R + R         P  ++      K +     ++++  ++   
Sbjct: 17916 D-VITVRVGQTIRILARVKGR---------PEPDITWTKEGKVLVRE--KRVDLIQDLPR 17963

Query: 1063  VEVIIQNLSEEDKGSY--TAQLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGP 1120
             VE+ I+     D G Y  +A+   G A+    + ++D                   + GP
Sbjct: 17964 VELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLD-------------------RPGP 18004

Query: 1121  YFERPLQWKVTEDCQVQLTCKVTNTKKE-TRFQWFFQRAEMPDGQYDPETGTGLLCIEEL 1179
                  +     E+C +     + N   E T F   +++             T  L    L
Sbjct: 18005 CQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIKANL 18064

Query: 1180  SKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIF 1239
                ++  +R    +  G   TI   T                L+  P+   G  E + I 
Sbjct: 18065 LANNEYYFRVCAENKVGVGPTIETKTP--------------ILAINPIDRPGEPENLHIA 18110

Query: 1240  SKVKYYNVEYMKTTW-------------FHKDKRLESGD---RIRTGTTLDEIWLHILDP 1283
              K K +   Y+K  W             +H ++RL+  D   R+  G+  +         
Sbjct: 18111 DKGKTF--VYLK--WRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKET-------- 18158

Query: 1284  KDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLP-- 1341
                    Y ++     ++ +       +  E    + + +    +++++  K V  L   
Sbjct: 18159 ------HYMVDRCVENQIYEFRVQTKNEGGESDWVKTEEV----VVKEDLQKPVLDLKLS 18208

Query: 1342  DVATIMEDKTLCLTCIVSGDPTPEISWLKNDQ--PVTFLDRYRMEVRGTEVTITIEKVNS 1399
              V T+    T+ L   V G P PE++W K+     +T   R +++ R      ++ K   
Sbjct: 18209 GVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKR 18268

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
              D G+Y V   N  GS     T++V       + LK
Sbjct: 18269 SDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLK 18304



 Score =  182 bits (463), Expect = 2e-45
 Identities = 207/847 (24%), Positives = 333/847 (39%), Gaps = 107/847 (12%)

Query: 170   TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT 229
             T  L   V   P P + W + D  I+     + +  I N      L ++     D   Y 
Sbjct: 23642 TFRLEADVHGKPLPTIEWLRGDKEIE----ESARCEIKNTDFKALLIVKDAIRIDGGQYI 23697

Query: 230   VRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFS 289
             +R  N  G  S    V V    G   G              V+ T V       EK   +
Sbjct: 23698 LRASNVAGSKSFPVNVKVLDRPGPPEG-------------PVQVTGVTS-----EKCSLT 23739

Query: 290   LSCLFSEDVLD-AESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVP 348
              S    +   D +  +   R+ S L  +     + T+   SLKV+   + +E ++ +   
Sbjct: 23740 WSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTN---SLKVTKLLEGNEYVFRIMAV 23796

Query: 349   SPFGPRE--QSTYVLVRDAEAENPGA-PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPIT 405
             + +G  E  +S  VL++     NP   PG P ++   ++ +D + + W  P    G+ I 
Sbjct: 23797 NKYGVGEPLESAPVLMK-----NPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEII 23851

Query: 406   AYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELV 465
              Y +E+       WI C++      R  + GL E   Y FRV A +  G   PS A    
Sbjct: 23852 GYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPA---- 23907

Query: 466   VMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPS 525
                                   T+   A  D V  P PPTN H  +  +  + LAW +P 
Sbjct: 23908 ----------------------TVYYKAC-DPVFKPGPPTNAHIVDTTKNSITLAWGKPI 23944

Query: 526   PRDRAP-LTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLS 584
                 +  L Y +E        W+ ++ ++ +R  RF +  L + + Y  RV A+N+ GL 
Sbjct: 23945 YDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLG 24004

Query: 585   D----PSEPSEPIALRGPPATLPPPAQ----VQAFRDTQTSVSLTWDPVKDPELLGYYIY 636
             +    P        L  P   L    +    V+A    +  +     P   PE+     +
Sbjct: 24005 EATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPT--PEIT----W 24058

Query: 637   SRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQA 696
             SR+ G    +    K +  T+ ++         ++ ++  + +G   S +A   ++V   
Sbjct: 24059 SREEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSG---SKSAFVTVKV--- 24112

Query: 697   LATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPT 756
             L TP  P   A+    K+   + W+PP   GG K+  Y +D+ +S    +  V+ +   T
Sbjct: 24113 LDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKT 24172

Query: 757   RVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRAT 816
                KV +L EG  Y FR  A N  GVG    P    +  +   P P PP  V  ++V  T
Sbjct: 24173 SF-KVENLTEGAIYYFRVMAENEFGVG---VPVETVDAVKAAEP-PSPPGKVTLTDVSQT 24227

Query: 817   SLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQV 876
             S  L WE P + G   V GY V  Q +G+E+W  V    +   +  V+ L  G+ Y F+V
Sbjct: 24228 SASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKV--CNAVVTGLSSGQEYQFRV 24285

Query: 877   QAMNSAGLGQPSMPTDPVLLEDKP---------GAHEIEVGVDEEGFIYLAFEAPE-APD 926
             +A N  G   P +   PV+ +D             + I+ G D      L  E P     
Sbjct: 24286 KAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGED------LKIEIPVIGRP 24339

Query: 927   SSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTL 986
                  W KD +      RV +E+    + + +KE   +D G Y+V  T++    +A+  L
Sbjct: 24340 RPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAG--TATENL 24397

Query: 987   TEEELEK 993
             +   LEK
Sbjct: 24398 SVIVLEK 24404



 Score =  182 bits (461), Expect = 3e-45
 Identities = 197/775 (25%), Positives = 320/775 (41%), Gaps = 86/775 (11%)

Query: 249   TYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFARE--KEPFSLSCLFSEDVL-DAESIQ 305
             T L     +   IF  + +G S    S   P+ A+   KEP      F+  +  D+  IQ
Sbjct: 23385 TKLKTGTEYQFRIFAENRYGQSFALES--DPIVAQYPYKEPGPPGTPFATAISKDSMVIQ 23442

Query: 306   WFRD---------GSLLRSSRRRKILYTDRQASLKVSCTYKE---DEGL-YMVRVPSP-- 350
             W            G  L    R  IL+T    ++     +K    +EG+ Y  RV +   
Sbjct: 23443 WHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENI 23502

Query: 351   --FGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYT 408
                G   +++   V     + PG P  P+ V+     R+ + L W  P    G+ IT Y 
Sbjct: 23503 VGVGKASKNSECYVARDPCDPPGTP-EPIMVK-----RNEITLQWTKPVYDGGSMITGYI 23556

Query: 409   IERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGS-SVPSKASELVVM 467
             +E+     G W+          +  + GL E Q Y FRV A +  G+ S PS ++  +  
Sbjct: 23557 VEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPI-- 23614

Query: 468   GDHDAARRKTEIPFDLGNKITISTD-AFEDTVTIPSPPT-NVHASEIREAYVVLAWEEPS 525
                  A+ + E+P        IS D  F DT+ + +  T  + A    +    + W    
Sbjct: 23615 ----TAKDEVELP-------RISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRG- 23662

Query: 526   PRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSD 585
                        +K +  S   E  +++         V D  +     + +RA N  G   
Sbjct: 23663 -----------DKEIEESARCEIKNTDF---KALLIVKDAIRIDGGQYILRASNVAG--- 23705

Query: 586   PSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWD-PVKD--PELLGYYIYSRKVGT 642
                 S P+ ++      PP   VQ    T    SLTW  P++D   ++  Y +  R+   
Sbjct: 23706 --SKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSR 23763

Query: 643   SEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSA 702
               W  V ++ +  +   V  L  G EY F + +V++ GVGE    + P+ +K     P  
Sbjct: 23764 LAWTVVASEVVTNS-LKVTKLLEGNEYVFRIMAVNKYGVGE-PLESAPVLMKNPFVLPGP 23821

Query: 703   PYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVS 762
             P    + N  K+ M + W  P   GG +I+GY +++ D   + W   N++ I     +V+
Sbjct: 23822 PKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVT 23881

Query: 763   DLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQW 822
              L E H YEFR  A N AGVGE S P++++      + +PGPP +    +    S+ L W
Sbjct: 23882 GLTEDHEYEFRVSAENAAGVGEPS-PATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAW 23940

Query: 823   EPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP-ISGTHLRVSDLQPGKSYVFQVQAMNS 881
               P+Y G   + GY V   +   E+W+ VTP   +  T   +S L   + Y  +V A+N 
Sbjct: 23941 GKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNK 24000

Query: 882   AGLGQPSMPTDPVLLEDKPGAHEIE----------VGVDEEGFIYLAFEAPEAPDSSEFQ 931
              GLG+ +     V  EDK  A E++          V       I++ F+    P   E  
Sbjct: 24001 VGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTP---EIT 24057

Query: 932   WSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTL 986
             WS++     D  +V+IE  VN +++ +      D G Y + + ++    SA  T+
Sbjct: 24058 WSREEGEFTD--KVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTV 24110



 Score =  181 bits (459), Expect = 4e-45
 Identities = 191/817 (23%), Positives = 328/817 (40%), Gaps = 91/817 (11%)

Query: 169   TTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATY 228
             T VL   ++   P P+ +W K    I P    +   +IT+      L I+    +D+  Y
Sbjct: 20395 TIVLNAISILGKPLPKSSWSKAGKDIRP----SDITQITSTPTSSMLTIKYATRKDAGEY 20450

Query: 229   TVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPF 288
             T+   N  G      KV V    G               GP VE ++V     + EK   
Sbjct: 20451 TITATNPFGTKVEHVKVTVLDVPGPP-------------GP-VEISNV-----SAEKATL 20491

Query: 289   SLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTY------KEDEGL 342
             + +    +     +S        +L      ++L+T     ++ SC +      + +E +
Sbjct: 20492 TWTPPLEDGGSPIKSY-------ILEKRETSRLLWTVVSEDIQ-SCRHVATKLIQGNEYI 20543

Query: 343   YMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGN 402
             + V   + +G  E      V+  +   P  PG P      +V ++   ++W  P D  G+
Sbjct: 20544 FRVSAVNHYGKGEPVQSEPVKMVDRFGP--PGPPEKPEVSNVTKNTATVSWKRPVDDGGS 20601

Query: 403   PITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKAS 462
              IT Y +ER + +S  W+   + P    RC + GL EG +Y FRV A +R G   PS+AS
Sbjct: 20602 EITGYHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEAS 20661

Query: 463   ELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWE 522
             + V+M                           +D    P PP+N H ++  +    LAW 
Sbjct: 20662 DSVLM---------------------------KDAAYPPGPPSNPHVTDTTKKSASLAWG 20694

Query: 523   EPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQY 581
             +P       +T Y +E   +G   W   ++ + +R  +F V DL+ K+ Y FR+ A+N  
Sbjct: 20695 KPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDA 20754

Query: 582   GLSDPSE-PSEPIALRGPPATLPPPAQVQAFRDTQTSVSL-TWDPVKDPELLGYYIYSRK 639
             G+ +P+  P   I  R         A+++     +  +S+  + P+K             
Sbjct: 20755 GVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDN 20814

Query: 640   VGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALAT 699
             +       + N     T   +P        +F +   + AG     +    +RV   L T
Sbjct: 20815 INLKNRANIENTE-SFTLLIIPECNRYDTGKFVMTIENPAG---KKSGFVNVRV---LDT 20867

Query: 700   PSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVC 759
             P         +  K+ + + W  P   GG +I  Y +++ ++    +     +       
Sbjct: 20868 PGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTK-CHKCTY 20926

Query: 760   KVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLV 819
             KV+ L EG  Y FR  A N  G+GE +  +   +  E     P PP  +   ++  +++ 
Sbjct: 20927 KVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASE----APSPPDSLNIMDITKSTVS 20982

Query: 820   LQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAM 879
             L W  P + G   +TGY +  Q +GS+QW  +T   + G    V +L  G+ Y FQV A+
Sbjct: 20983 LAWPKPKHDGGSKITGYVIEAQRKGSDQWTHIT--TVKGLECVVRNLTEGEEYTFQVMAV 21040

Query: 880   NSAGLGQPSMPTDPVLLEDKPGAHEIEV-GVDEEGFIYLAFE--APEAP----DSSEFQW 932
             NSAG   P   + PV+++++    E+++ G+ ++  I  A +    E P          W
Sbjct: 21041 NSAGRSAP-RESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTW 21099

Query: 933   SKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTY 969
              K  +     QRV  E     + + + E    D G Y
Sbjct: 21100 KKGDQILKQTQRVNFETTATSTILNINECVRSDSGPY 21136



 Score =  181 bits (458), Expect = 6e-45
 Identities = 156/580 (26%), Positives = 239/580 (41%), Gaps = 71/580 (12%)

Query: 341   GLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTR 400
             G Y +   +  G +  +  V V D        PG P +++  D+ R    L+W  P D  
Sbjct: 15887 GKYSITAKNKAGQKTANCRVKVMDV-------PGPPKDLKVSDITRGSCRLSWKMPDDDG 15939

Query: 401   GNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSK 460
             G+ I  Y IE+   +   W   +   G T    +  L+  Q Y FRVRA +R G   P +
Sbjct: 15940 GDRIKGYVIEKRTIDGKAWTKVNPDCGST-TFVVPDLLSEQQYFFRVRAENRFGIGPPVE 15998

Query: 461   ASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLA 520
                                        TI      D +  P PP  +    I +  V L+
Sbjct: 15999 ---------------------------TIQRTTARDPIYPPDPPIKLKIGLITKNTVHLS 16031

Query: 521   WEEPSPRDRAPLTYSLEKSVIGSGT------WEAISSESPVRSPRFAVLDLEKKKSYVFR 574
             W+ P     +P+T+ + + +    T      W   +    V   +F V DL +   Y FR
Sbjct: 16032 WKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRD-VEELQFTVEDLVEGGEYEFR 16090

Query: 575   VRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRD----TQTSVSLTWDPVKDPEL 630
             V+A+N  G+S PS    P   + P   +PP   ++ F +    T  ++      V  P L
Sbjct: 16091 VKAVNAAGVSKPSATVGPCDCQRP--DMPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPTL 16148

Query: 631   LGYYIYSRKVGTSE---WQTVNNKPIQGTRFT--VPGLRTGKEYEFCVRSVSEAGVGESS 685
               +    +K    E   + T  NK +     T  +P  R      + + +V+  G     
Sbjct: 16149 TWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLG----- 16203

Query: 686   AATEPIRVKQALATPSAPYG-FALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEEL 744
              A++ +R+   L  P  P G     +   ++M + W PPK  GG KI  Y +++ ++   
Sbjct: 16204 TASKEMRL-NVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEKREANRK 16262

Query: 745   DWHAVNQQPIPTRVC--KVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQP 802
              W  V+ +P   + C   +  L EGH Y FR  A N  G+GE     S  E        P
Sbjct: 16263 TWVHVSSEP---KECTYTIPKLLEGHEYVFRIMAQNKYGIGE--PLDSEPETARNLFSVP 16317

Query: 803   GPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPIS----G 858
             G P     S V   S+ + WE P Y G  PVTGY +  ++  S++WK V   PI     G
Sbjct: 16318 GAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLG 16377

Query: 859   THLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED 898
                +V+ L  G  Y F+V A+N+AG+G  S+P+DP    D
Sbjct: 16378 VSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARD 16417



 Score =  181 bits (458), Expect = 6e-45
 Identities = 157/619 (25%), Positives = 252/619 (40%), Gaps = 78/619 (12%)

Query: 304   IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVR 363
             I W +    LR      I  TD    L+     K D G Y++ + +  G +E +  V V 
Sbjct: 19725 ITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVL 19784

Query: 364   DAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACH 423
             D        PG P+NV   ++++D   +TW PP    G+PI  Y +++   E   W    
Sbjct: 19785 DT-------PGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTVT 19837

Query: 424   EAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDL 483
                  T    +  L EG+SY FRV A +  G   P +                       
Sbjct: 19838 TECSKTS-FRVANLEEGKSYFFRVFAENEYGIGDPGE----------------------- 19873

Query: 484   GNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGS 543
                   + DA + + T P P  ++    + ++   + W++P     + +   +   +   
Sbjct: 19874 ------TRDAVKASQT-PGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTEE 19926

Query: 544   GTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSE---------PSEPIA 594
               W+ +       S +++  DL + K Y FRV A N+ G   PSE          +  + 
Sbjct: 19927 NKWQRVMKSL---SLQYSAKDLTEGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLD 19983

Query: 595   LRGPPATLPPPAQVQAFR-----DTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVN 649
             L+G P       +   FR       + + S++W   +DP           + T    +V 
Sbjct: 19984 LKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDP-----------LATDTRVSVE 20032

Query: 650   NKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALL 709
             +  +  T   V   +     ++ +   + AG  E + +   I+V      P+ P  F  +
Sbjct: 20033 SSAVN-TTLIVYDCQKSDAGKYTITLKNVAGTKEGTIS---IKVVGKPGIPTGPIKFDEV 20088

Query: 710   NCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHF 769
                   M + W PPK  GG +I  Y L++ DS    W       +     +V+ LHEG  
Sbjct: 20089 TA--EAMTLKWAPPKDDGGSEITNYILEKRDSVNNKW-VTCASAVQKTTFRVTRLHEGME 20145

Query: 770   YEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMG 829
             Y FR  A N  GVGE      +     + +P   PP ++   +VR  S+ L W  P   G
Sbjct: 20146 YTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNI--VDVRHDSVSLTWTDPKKTG 20203

Query: 830   AGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSM 889
               P+TGYH+ F+E  S  WK     PI     +V+ L  G  Y F+V A+N AG+G+PS+
Sbjct: 20204 GSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSL 20263

Query: 890   PTDPVLL---EDKPGAHEI 905
             P++PV+     D PG  E+
Sbjct: 20264 PSEPVVALDPIDPPGKPEV 20282



 Score =  181 bits (458), Expect = 6e-45
 Identities = 201/832 (24%), Positives = 324/832 (38%), Gaps = 115/832 (13%)

Query: 173   LTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRV 232
             L   V   PPP + W K+   ++       K  I       +L  +     DS  YT+  
Sbjct: 21481 LEADVSGRPPPTMEWSKDGKELEG----TAKLEIKIADFSTNLVNKDSTRRDSGAYTLTA 21536

Query: 233   KNAHGQASSFAKVLVRTYLGKDAG------FDSEIFKRSTFGPSVEFTSVLKPVFAREKE 286
              N  G A     V V    G   G        SE    S F P  +  + +     +++E
Sbjct: 21537 TNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRE 21596

Query: 287   PFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVR 346
                L+              W    S ++ ++            LKV+   K +E ++ V 
Sbjct: 21597 TSRLA--------------WTNVASEVQVTK------------LKVTKLLKGNEYIFRVM 21630

Query: 347   VPSPFGPRE--QSTYVLVRDAEAENP-GAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNP 403
               + +G  E  +S  VL     A NP G P  P N     + +D +++ W  P    G+ 
Sbjct: 21631 AVNKYGVGEPLESEPVL-----AVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSE 21685

Query: 404   ITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASE 463
             I  Y +ER       WI C++      R  + GL EG  Y FR+ A +  G S PS  S 
Sbjct: 21686 IINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTS- 21744

Query: 464   LVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEE 523
                             PF              DTV  P PP N    +   + + +AW +
Sbjct: 21745 ----------------PFYKAC----------DTVFKPGPPGNPRVLDTSRSSISIAWNK 21778

Query: 524   PSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYG 582
             P     + +T Y +E ++     W+ ++  + +++  + +  L + + Y  R+ AMN  G
Sbjct: 21779 PIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEG 21838

Query: 583   LSDPS-EPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLT-------WDPVKD---PELL 631
             L +P+  P  P   +     LPP  ++ A  D +  V++        + P+K    PE+ 
Sbjct: 21839 LGEPALVPGTP---KAEDRMLPPEIELDA--DLRKVVTIRACCTLRLFVPIKGRPAPEVK 21893

Query: 632   GYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPI 691
                 ++R  G S  +         T   V  +      ++ +   + +G   S +A   +
Sbjct: 21894 ----WARDHGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSG---SKSAFVNV 21946

Query: 692   RVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQ 751
             RV   L TP  P    +    K  + + W PP   GG KI  Y +++ +S    +  V  
Sbjct: 21947 RV---LDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVAT 22003

Query: 752   QPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRAS 811
                 T   KV  L EG  Y FR  A N  G+G  +  +   +  E    +P PP  +   
Sbjct: 22004 NCHKTS-WKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASE----RPLPPGKITLM 22058

Query: 812   EVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKS 871
             +V   S+ L WE P + G   + GY V  Q +GS++W   T   +  T   ++ L  G+ 
Sbjct: 22059 DVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKW--ATCATVKVTEATITGLIQGEE 22116

Query: 872   YVFQVQAMNSAGLGQPSMPTDPVLLEDK--PGAHEI-----EVGVDEEGFIYLAFEAPEA 924
             Y F+V A N  G+  P   + PV+ +D   P A ++      V   E+  + + F     
Sbjct: 22117 YSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPT 22176

Query: 925   PDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDA 976
             P      W KD        RV  E   N S + +K+   ED+G Y V +T++
Sbjct: 22177 P---AVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNS 22225



 Score =  179 bits (454), Expect = 2e-44
 Identities = 155/612 (25%), Positives = 260/612 (42%), Gaps = 65/612 (10%)

Query: 303   SIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLV 362
             ++ W +DG+LL+ +   K+       +L++    ++D G Y +   +  G +  +  + V
Sbjct: 19326 TVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKV 19385

Query: 363   RDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIAC 422
              D        PG P +V+   +  D  +L+W PP +  G+ IT Y +++ +     W A 
Sbjct: 19386 LDK-------PGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNW-AQ 19437

Query: 423   HEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFD 482
               A      C ++ L+EG  Y+FR+ A ++ G   P      +    +D   R       
Sbjct: 19438 VSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRC------ 19491

Query: 483   LGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVI 541
                                 PP     S I + ++ ++W+ P+    +P+T Y LEK   
Sbjct: 19492 -------------------DPPV---ISNITKDHMTVSWKPPADDGGSPITGYLLEKRET 19529

Query: 542   GSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPAT 601
              +  W  ++ + P+         L++   Y FRV A+N+ G   PS+ S+    R P   
Sbjct: 19530 QAVNWTKVNRK-PIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYP 19588

Query: 602   LPPPAQVQAFRDTQTSVSLTW-DPVKD--PELLGYYIYSRKVGTSEWQTVN-NKPIQGTR 657
               PPA  + +  T++SVSL+W  P  D    ++GY +  ++  +  W   N  + +Q TR
Sbjct: 19589 PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTR 19648

Query: 658   FTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMV 717
             F V GL    +Y+F V +V++ G  + S   +    K  L  P       L    +  ++
Sbjct: 19649 FEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADL----RKTLI 19704

Query: 718   IGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEF-RARA 776
             +      R G    L   +      ++ W   N   +  R     D+    F  F R   
Sbjct: 19705 L------RAGVTMRLYVPVKGRPPPKITWSKPN---VNLRDRIGLDIKSTDFDTFLRCEN 19755

Query: 777   ANWAGVGE--LSAPSSLFECKEWT-----MPQPGPPYDVRASEVRATSLVLQWEPPLYMG 829
              N    G+  L+  +S  + KE+T     +  PGPP +V   E+   S  + WEPP+  G
Sbjct: 19756 VNKYDAGKYILTLENSCGK-KEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDG 19814

Query: 830   AGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSM 889
               P+  Y V  ++   + W  VT    S T  RV++L+ GKSY F+V A N  G+G P  
Sbjct: 19815 GSPIINYVVQKRDAERKSWSTVTT-ECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGE 19873

Query: 890   PTDPVLLEDKPG 901
               D V     PG
Sbjct: 19874 TRDAVKASQTPG 19885



 Score =  179 bits (454), Expect = 2e-44
 Identities = 197/755 (26%), Positives = 292/755 (38%), Gaps = 105/755 (13%)

Query: 167   EHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSA 226
             E++   L   ++  P P V+W K +   DP L    +  + ++    +L +  C   D+ 
Sbjct: 19996 ENSNFRLKIPIKGKPAPSVSWKKGE---DP-LATDTRVSVESSAVNTTLIVYDCQKSDAG 20051

Query: 227   TYTVRVKNAHGQASSFAKVLVRTYLGKDAG---FDSEIFKRSTFGPSVEFTSVLKPVFAR 283
              YT+ +KN  G       + V    G   G   FD    +  T          LK    +
Sbjct: 20052 KYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMT----------LKWAPPK 20101

Query: 284   EKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKI-LYTDRQASLKVSCTYKEDEGL 342
             +     ++    E   D+ + +W    S ++ +  R   L+   + + +VS   K   G 
Sbjct: 20102 DDGGSEITNYILEK-RDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGE 20160

Query: 343   YMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGN 402
              +   P            +V     + P AP  P     +DV  D + LTW  P  T G+
Sbjct: 20161 GLKSEP------------IVARHPFDVPDAPPPP---NIVDVRHDSVSLTWTDPKKTGGS 20205

Query: 403   PITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKAS 462
             PIT Y +E  +  S  W   ++ P       + GL EG  Y FRV AI+  G   PS  S
Sbjct: 20206 PITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPS 20265

Query: 463   ELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWE 522
             E VV  D          P D                    PP       I    V L W 
Sbjct: 20266 EPVVALD----------PID--------------------PPGKPEVINITRNSVTLIWT 20295

Query: 523   EPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQY 581
             EP       LT Y +EK  + S +W   +  + V    F V DL +   Y FR+RA N  
Sbjct: 20296 EPKYDGGHKLTGYIVEKRDLPSKSWMKANHVN-VPECAFTVTDLVEGGKYEFRIRAKNTA 20354

Query: 582   G-LSDPSEPSEPIALR----GPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIY 636
             G +S PSE +E I  +     P   L P       +D      LT        L    I 
Sbjct: 20355 GAISAPSESTETIICKDEYEAPTIVLDP-----TIKD-----GLTIKAGDTIVLNAISIL 20404

Query: 637   SRKVGTSEWQTVNN--KPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESS-AATEPIRV 693
              + +  S W       +P   T+ T     T       ++  +    GE +  AT P   
Sbjct: 20405 GKPLPKSSWSKAGKDIRPSDITQIT----STPTSSMLTIKYATRKDAGEYTITATNPFGT 20460

Query: 694   K------QALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWH 747
             K        L  P  P    + N    +  + W PP   GG  I  Y L++ ++  L W 
Sbjct: 20461 KVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWT 20520

Query: 748   AVNQQPIPTRVCK--VSDLHEGHFYEFRARAANWAGVGE--LSAPSSLFECKEWTMPQPG 803
              V++     + C+   + L +G+ Y FR  A N  G GE   S P  + +        PG
Sbjct: 20521 VVSED---IQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQSEPVKMVD----RFGPPG 20573

Query: 804   PPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRV 863
             PP     S V   +  + W+ P+  G   +TGYHV  +E+ S +W      P+S    +V
Sbjct: 20574 PPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDLRCKV 20633

Query: 864   SDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED 898
             + LQ G +Y F+V A N AG+G PS  +D VL++D
Sbjct: 20634 TGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKD 20668



 Score =  179 bits (453), Expect = 2e-44
 Identities = 150/611 (24%), Positives = 255/611 (41%), Gaps = 62/611 (10%)

Query: 304   IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVR 363
             I W +DG  +    R +I+ TD    L V    + D G Y++ + +  G R     V V 
Sbjct: 25821 ISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRS----VAVN 25876

Query: 364   DAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACH 423
                 + PG P  PL +  L   +    L+W  P +  G  I  Y +E+ +     W  C 
Sbjct: 25877 CKVLDKPGPPAGPLEINGLTAEK--CSLSWGRPQEDGGADIDYYIVEKRETSHLAWTIC- 25933

Query: 424   EAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDL 483
             E       C +  L++G  Y FRV  +++ G   P ++  +  +                
Sbjct: 25934 EGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLESVAIKAL---------------- 25977

Query: 484   GNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIG 542
                         D  T+PSPPT++  + + +  + L W  P     + ++ Y +E+    
Sbjct: 25978 ------------DPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSEISGYIIERREKN 26025

Query: 543   SGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATL 602
             S  W  + ++ PV   R     L +   Y +RV A N  GLS PSE S  I    P    
Sbjct: 26026 SLRWVRV-NKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLP 26084

Query: 603   PPPAQVQAFRDTQTSVSLTW-DPVKD--PELLGYYIYSRKVGTSEWQTVNNKPIQGTRFT 659
              PP++ +     +T++++ W  P+ D    + GY +  +K   ++W+T + + ++GT +T
Sbjct: 26085 SPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKT-SIQSLRGTEYT 26143

Query: 660   VPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATP-----SAPYGFALLNCGKN 714
             + GL TG EY F V+SV++ G  + S +++P   K+    P     S      ++  G +
Sbjct: 26144 ISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGAS 26203

Query: 715   -EMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFR 773
               M + ++       G+ +   L      +L   A            + + +     ++ 
Sbjct: 26204 FTMTVPFR-------GRPVPNVLWSKPDTDLRTRAYVDTTDSRTSLTIENANRNDSGKYT 26256

Query: 774   ARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPV 833
                 N      LSA S     K   +  PGPP ++   +V   S VL W+ P   G  PV
Sbjct: 26257 LTIQN-----VLSAASLTLVVK--VLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPV 26309

Query: 834   TGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDP 893
               YH+  +E   + W  VT    +    +V++LQ G  Y F+V   N  G+G P+   + 
Sbjct: 26310 KNYHIEKREASKKAWVSVT-NNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEG 26368

Query: 894   VLLEDKPGAHE 904
             V + +KP   E
Sbjct: 26369 VKITEKPSPPE 26379



 Score =  179 bits (453), Expect = 2e-44
 Identities = 190/806 (23%), Positives = 301/806 (37%), Gaps = 147/806 (18%)

Query: 171   VLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTV 230
             V L   +   PPP  +W+   ++    L  + +  +  +  +  L IR   I D+  YT+
Sbjct: 29756 VELVIPIAGRPPPAASWFFAGSK----LRESERVTVETHTKVAKLTIRETTIRDTGEYTL 29811

Query: 231   RVKNAHGQASSFAKVLVRTYLGKDAG------FDSEIFKRSTFGPSVEFTSVLKPVFARE 284
              +KN  G  S   KV++    G   G       D+     S   P ++  + L      +
Sbjct: 29812 ELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPELDGGAPLSGYVVEQ 29871

Query: 285   KEPFSLSCLFSEDVLDAESIQWFR-DGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
             +              DA    W     S+ RS+ +   L    +   +V+ T +   G Y
Sbjct: 29872 R--------------DAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFGIGSY 29917

Query: 344   MVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNP 403
             +           QS  +  R +       PG P  ++  DV+RD + LTW PP D  G+ 
Sbjct: 29918 L-----------QSEVIECRSSIR----IPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQ 29962

Query: 404   ITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASE 463
             +T Y +ER +  +  W+  ++ P    R    GL EG  Y  RV AI+  GS  PS+ S+
Sbjct: 29963 VTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSK 30022

Query: 464   LVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEE 523
              +V                             D +  P  P N   ++     V LAW  
Sbjct: 30023 PIVA---------------------------MDPIAPPGKPQNPRVTDTTRTSVSLAWSV 30055

Query: 524   PSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYG 582
             P     + +T Y +E   +    W   ++ +P +   + +  L +   Y FRV A N  G
Sbjct: 30056 PEDEGGSKVTGYLIEMQKVDQHEWTKCNT-TPTKIREYTLTHLPQGAEYRFRVLACNAGG 30114

Query: 583   LSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGT 642
                P EP+E       P T                       VK  E+L Y  Y      
Sbjct: 30115 ---PGEPAEV------PGT-----------------------VKVTEMLEYPDYELDERY 30142

Query: 643   SEWQTVNNKPIQGTRFTVPGLRTGKEYEFCV-----RSVSEAGVGESSAATEPIRVKQAL 697
              E   V    +   R T+P    GK +  C      + +S+  +  +S     + +K+A 
Sbjct: 30143 QEGIFVRQGGV--IRLTIP--IKGKPFPICKWTKEGQDISKRAMIATSETHTELVIKEAD 30198

Query: 698   ATPSAPYGFALLN-CGKNEMVI---------------------------GWKPPKRRGGG 729
                S  Y   L N CGK  + I                            W+PP   GG 
Sbjct: 30199 RGDSGTYDLVLENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGA 30258

Query: 730   KILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPS 789
              ILGY L++ +  +  W+ ++ +   T +  V  L E   Y FR  A N  G+ +     
Sbjct: 30259 DILGYILERREVPKAAWYTIDSRVRGTSLV-VKGLKENVEYHFRVSAENQFGISKPLKSE 30317

Query: 790   SLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWK 849
                  K    P   P       +V  +S+ L W  P   G   VTGY++  +E  +++W 
Sbjct: 30318 EPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWV 30377

Query: 850   PVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED------KPGAH 903
                   I+ T   V+ L P   Y F++ A N  GL + S  ++PV+ +D      +PG  
Sbjct: 30378 RHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPG-- 30435

Query: 904   EIEVGVDEEGFIYLAFEAPEAPDSSE 929
             E+E+    +  + L +E PE     E
Sbjct: 30436 ELEILSISKDSVTLQWEKPECDGGKE 30461



 Score =  177 bits (450), Expect = 5e-44
 Identities = 215/843 (25%), Positives = 344/843 (40%), Gaps = 113/843 (13%)

Query: 170   TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRIT-NNYGLLS-LEIRRCAIEDSAT 227
             T+ +   V   P P   W K +  +D       K R+  +N G  S L I+    +D   
Sbjct: 15121 TLRIPAVVTGRPVPTKVWTKEEGELD-------KDRVVIDNVGTKSELIIKDALRKDHGR 15173

Query: 228   YTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEP 287
             Y +   N+ G   + A+V V         FD         GP ++    LKPV    K  
Sbjct: 15174 YVITATNSCGSKFAAARVEV---------FDVP-------GPVLD----LKPVVTNRK-- 15211

Query: 288   FSLSCLFS----EDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
                 CL +    ED   +E   +  +    +    R+ + T+R +   ++   +  E  +
Sbjct: 15212 ---MCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETER-SKCDITGLLEGQEYKF 15267

Query: 344   MVRVPSPFG--PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRG 401
              V   + FG  P  +   +L  D      G P SP  +   +  +  + L W  P    G
Sbjct: 15268 RVIAKNKFGCGPPVEIGPILAVDPL----GPPTSPERLTYTERTKSTITLDWKEPRSNGG 15323

Query: 402   NPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKA 461
             +PI  Y IE+ + +  ++   ++    T    ++ L E Q Y FRV+A++ +G S PS  
Sbjct: 15324 SPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLP 15383

Query: 462   SELVVMGDHDAARRKTEIPFDLGNKITISTDAFE----DTVTIPSPPTNVHASEIREAYV 517
               +V+  D        E+P  +  ++++  D  +    + V IP+  T +   +I  +  
Sbjct: 15384 LNVVIQDD--------EVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKN 15435

Query: 518   VLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRA 577
                 E+P+  D   +T   ++ V  S     +S    VR         E K +Y   V A
Sbjct: 15436 ETVIEKPT--DALQIT---KEEVSRSEAKTELSIPKAVR---------EDKGTYT--VTA 15479

Query: 578   MNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQT-SVSLTWDPVKD---PELLGY 633
              N+ G    +   E      PP  L       A  D +  S  LTWD   D    E+  Y
Sbjct: 15480 SNRLGSVFRNVHVEVYDRPSPPRNL-------AVTDIKAESCYLTWDAPLDNGGSEITHY 15532

Query: 634   YIYSRKVG--TSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPI 691
              I  R      +EW+ V N  ++  R+ +  L    +YEF VR+V++ G+ +    ++ +
Sbjct: 15533 VIDKRDASRKKAEWEEVTNTAVE-KRYGIWKLIPNGQYEFRVRAVNKYGISD-ECKSDKV 15590

Query: 692   RVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQ 751
              ++     P  P    +L   K  M++ W PP   GG  I GY+L++ +     W  V++
Sbjct: 15591 VIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSR 15650

Query: 752   QPIPTRV------CKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPP 805
              PI T+V        V  L EG  Y+FRA A N AG+G  S PS      +   P PGPP
Sbjct: 15651 API-TKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFP-PGPP 15708

Query: 806   YDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP--ISGTHLRV 863
                   +   +S+ L W+PP   G  P+ GY V  QEEG+  WK V      I+     V
Sbjct: 15709 SCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCECVV 15768

Query: 864   SDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEVGVDEEGF--------- 914
              +L+  + Y F+V+A+N AG  +PS  T  +   D     E+ + +  +           
Sbjct: 15769 PNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQI 15828

Query: 915   -IYLAFEAPEAPDSSEFQWSKDYKGPLD-----PQRVKIEDKVNKSKVILKEPGLEDLGT 968
              I    +    P SS     K  K   D     P+  ++E   N S +I+ E      G 
Sbjct: 15829 RIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHTGK 15888

Query: 969   YSV 971
             YS+
Sbjct: 15889 YSI 15891



 Score =  177 bits (450), Expect = 5e-44
 Identities = 197/851 (23%), Positives = 347/851 (40%), Gaps = 100/851 (11%)

Query: 150   YGRGPWFWIPLRSHAVWEH---TTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRI 206
             YG GP   +PL    V ++   T+V L   +   P P + WYK+D  +           +
Sbjct: 26867 YG-GPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVC----V 26921

Query: 207   TNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRST 266
              N   L S+ I+     +S  Y ++++NA G AS+  +V +    G   G     FK  T
Sbjct: 26922 ENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPIE--FKTVT 26979

Query: 267   FGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDR 326
                + + T + +P      +  +    +  +  +   + W    S++       I+ T +
Sbjct: 26980 ---AEKITLLWRPP---ADDGGAKITHYIVEKRETSRVVW----SMVSEHLEECIITTTK 27029

Query: 327   QASLKVSCTYKEDEGLYMVRVPSPFGPRE--QSTYVLVRDAEAENPGAPGSPLNVRCLDV 384
                       K +E ++ VR  + +G  E  +S  V+ ++A    PG PG P       +
Sbjct: 27030 --------IIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAFV-TPGPPGIP---EVTKI 27077

Query: 385   NRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYR 444
              ++ + + W+ P    G+ I+ Y +E+   +S  W    +      R  + GL E   Y+
Sbjct: 27078 TKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQ 27137

Query: 445   FRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPP 504
             +RV A++  G    S+ SE      + AA                      D +  P PP
Sbjct: 27138 YRVCAVNAAGQGPFSEPSEF-----YKAA----------------------DPIDPPGPP 27170

Query: 505   TNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVL 563
               +  ++  ++ + L W +P     + +T Y +E        W  +S++  VR+  + V 
Sbjct: 27171 AKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVS 27230

Query: 564   DLEKKKSYVFRVRAMNQYGLSDPSEPSEPI----ALRGPPATLPPPAQ----VQAFRDTQ 615
             +L+   +Y FRV A+N  G  +P E +EP+     L  P   L    +     +A  D Q
Sbjct: 27231 NLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQ 27290

Query: 616   TSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRS 675
               +     P   P  + +    + +G+    ++ N     +  T+P +      ++ +  
Sbjct: 27291 VLIPFKGRP---PPTVTWRKDEKNLGSDARYSIENTD-SSSLLTIPQVTRNDTGKYIL-- 27344

Query: 676   VSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYF 735
               E GVGE  ++T  ++V   L TP+A     + +  +  + + W PP   GG  I+ Y 
Sbjct: 27345 TIENGVGEPKSSTVSVKV---LDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYV 27401

Query: 736   LDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECK 795
             +++ D+ +  W  V+ +   T   K+ DL E   + FR  A N  G+GE    +   +  
Sbjct: 27402 IEKRDATKRTWSVVSHKCSSTSF-KLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAA 27460

Query: 796   EWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP 855
             E     P P  D+   +   TS++L W  P + G   +T Y V  + +G + W     G 
Sbjct: 27461 E----VPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHA--GI 27514

Query: 856   ISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQP----------SMPTDPVLLEDKPGAHEI 905
                  + VS L+      F+V A N  GL  P           + T  V L D PGA ++
Sbjct: 27515 SKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPGA-QV 27573

Query: 906   EVGVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLED 965
              V +     + L ++    P  S   W KD     + + V+     NK  + +K    E 
Sbjct: 27574 TVRIGHNVHLELPYKGKPKPSIS---WLKDGLPLKESEFVRFSKTENKITLSIKNAKKEH 27630

Query: 966   LGTYSVIVTDA 976
              G Y+VI+ +A
Sbjct: 27631 GGKYTVILDNA 27641



 Score =  177 bits (450), Expect = 5e-44
 Identities = 161/611 (26%), Positives = 259/611 (42%), Gaps = 76/611 (12%)

Query: 304   IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVR 363
             I W + G  L S  R  I  T+  + L V    + D G Y +   +  G +  +  V V 
Sbjct: 29478 ITWSKQGIDLAS--RAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVY 29535

Query: 364   DAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACH 423
             D        PG   +V+  +V+RD + +TW  P+   G P+  Y +E+ +       A  
Sbjct: 29536 DT-------PGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREA------AMR 29582

Query: 424   EAPGGTCRCP-----IQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTE 478
                  T +C      I GLVEG  Y FRV   +  G   P + S+ V++ +         
Sbjct: 29583 AFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSE--------- 29633

Query: 479   IPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLE 537
                                  +P  P  +   ++ ++ V LAWE+P     + LT Y LE
Sbjct: 29634 ---------------------VPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLE 29672

Query: 538   KSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIA--- 594
                 G+  W  + +  P       V  L + + Y+FR+RA N+ G+S+P E    +    
Sbjct: 29673 ACKAGTERWMKVVTLKPT-VLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQD 29731

Query: 595   LRGPP----ATLPPPA-QVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTV- 648
             LR  P    +T+P     V A R  +  + +   P   P    ++    K+  SE  TV 
Sbjct: 29732 LRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRP---PPAASWFFAGSKLRESERVTVE 29788

Query: 649   NNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYG-FA 707
              +  +         +R   EY   +++V       +   +E I+V   L  P  P G   
Sbjct: 29789 THTKVAKLTIRETTIRDTGEYTLELKNV-------TGTTSETIKV-IILDKPGPPTGPIK 29840

Query: 708   LLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEG 767
             +       + I W+PP+  GG  + GY ++Q D+    W  V++  +     K + L EG
Sbjct: 29841 IDEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSES-VTRSTFKFTRLTEG 29899

Query: 768   HFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLY 827
             + Y FR  A N  G+G     S + EC+  ++  PGPP  ++  +V    + L W PP  
Sbjct: 29900 NEYVFRVAATNRFGIGSY-LQSEVIECRS-SIRIPGPPETLQIFDVSRDGMTLTWYPPED 29957

Query: 828   MGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQP 887
              G   VTGY V  +E  +++W  V   P++ T  R + L  G  Y  +V A+N+ G G+P
Sbjct: 29958 DGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKP 30017

Query: 888   SMPTDPVLLED 898
             S P+ P++  D
Sbjct: 30018 SRPSKPIVAMD 30028



 Score =  175 bits (443), Expect = 3e-43
 Identities = 264/1228 (21%), Positives = 457/1228 (37%), Gaps = 184/1228 (14%)

Query: 301   AESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYV 360
             A +I+W++D   L+++    +  T   AS+ +    + + G Y +++ +  G    +  V
Sbjct: 26901 APTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRV 26960

Query: 361   LVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWI 420
              + D     PG PG P+  + +   +  + L W PP+D  G  IT Y +E+ +     W 
Sbjct: 26961 QILD----KPGPPGGPIEFKTVTAEK--ITLLWRPPADDGGAKITHYIVEKRETSRVVWS 27014

Query: 421   ACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIP 480
                E     C      +++G  Y FRVRA+++ G   P ++  +V               
Sbjct: 27015 MVSEHLE-ECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVA-------------- 27059

Query: 481   FDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKS 539
                           ++    P PP     ++I +  + + W  P     + ++ Y LEK 
Sbjct: 27060 --------------KNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKR 27105

Query: 540   VIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPP 599
                S  W  +  E+ +R  R  V  L +   Y +RV A+N  G    SEPSE      P 
Sbjct: 27106 DKKSLGWFKVLKET-IRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPI 27164

Query: 600   ATLPPPAQVQAFRDTQTSVSLTWD-PVKD--PELLGYYIYSRKVGTSEWQTVNNK-PIQG 655
                 PPA+++    T++S++L W  PV D    + GY +  R+    EW TV+ K  ++ 
Sbjct: 27165 DPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRT 27224

Query: 656   TRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFAL-----LN 710
             T + V  L+ G  Y F V +V+ AG GE     EP++ K  L  P      AL       
Sbjct: 27225 TEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAK 27284

Query: 711   CGKNEMVI----GWKPPKR--RGGGKILG----YFLDQHDSEELDWHAVNQQPIPTRVCK 760
              G++  V+    G  PP    R   K LG    Y ++  DS  L                
Sbjct: 27285 AGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSL--------------LT 27330

Query: 761   VSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVL 820
             +  +      ++     N  GVGE    SS    K   +  P     ++   V   ++ L
Sbjct: 27331 IPQVTRNDTGKYILTIEN--GVGE--PKSSTVSVK--VLDTPAACQKLQVKHVSRGTVTL 27384

Query: 821   QWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMN 880
              W+PPL  G  P+  Y +  ++     W  V+    S T  ++ DL     + F+V A N
Sbjct: 27385 LWDPPLIDGGSPIINYVIEKRDATKRTWSVVSH-KCSSTSFKLIDLSEKTPFFFRVLAEN 27443

Query: 881   SAGLGQPSMPTDPVLLEDKPGA-HEIEVGVDEEGFIYLAFEAPEAPDSS---EFQWSKDY 936
               G+G+P   T+PV   + P    ++ +    +  + L++  P+    S   E+   +  
Sbjct: 27444 EIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKG 27503

Query: 937   KGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKK 996
             KG        I          LKE  + +   ++       + ++    +T +EL     
Sbjct: 27504 KGEQTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIG-PITVKEL----- 27557

Query: 997   LSHEIRNPVIKL--ISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKI 1054
                 I  P + L  I G  + +     V L L   K  P   +  + +   +  S    +
Sbjct: 27558 ----IITPEVDLSDIPGAQVTVRIGHNVHLELPY-KGKPKPSISWLKDGLPLKES--EFV 27610

Query: 1055  NFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDD----------FDKLL 1104
              F + +  + + I+N  +E  G YT  L +   +  + +T++             FD++ 
Sbjct: 27611 RFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKGPIRFDEI- 27669

Query: 1105  RKADAKRRDW-----------------KRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKK 1147
              KAD+    W                 KR+          WK+      + T KV N  K
Sbjct: 27670 -KADSVILSWDVPEDNGGGEITCYSIEKRETSQ-----TNWKMVCSSVARTTFKVPNLVK 27723

Query: 1148  ETRFQWFFQRAEMPDGQYDPETGTGLLCIEEL---SKKDKGIYRAMVSD----------- 1193
             +  +Q F  RAE   G   P   + ++   +        K +   + SD           
Sbjct: 27724 DAEYQ-FRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVY 27782

Query: 1194  DRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTT 1253
             D G + T   +     ++I  +      +S    +  G  EG+    +V   N   + + 
Sbjct: 27783 DGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGLSSP 27842

Query: 1254  WFHKDKRLESGDRIRTGT---------TLDEIWLHILDPKDSDKGKYTLEIAAGKE--VR 1302
                    L        GT         T+   W   L    S    Y++E   G E  VR
Sbjct: 27843 SDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVGYSIEKRQGNERWVR 27902

Query: 1303  QLSTDLS-----------GQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIME--- 1348
                TD+S           G  +E  +     + T++   ++   ++    +V  I+E   
Sbjct: 27903 CNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGP 27962

Query: 1349  ----------DKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGT--EVTITIEK 1396
                        ++L +  +V G P P ++W K+   V    R  ME+       ++ +  
Sbjct: 27963 EYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDG--VEIEKRMNMEITDVLGSTSLFVRD 28020

Query: 1397  VNSEDSGRYGVFVKNKYGSETGQVTISV 1424
                +  G Y V  KN  GS   ++ + V
Sbjct: 28021 ATRDHRGVYTVEAKNASGSAKAEIKVKV 28048



 Score =  174 bits (442), Expect = 4e-43
 Identities = 161/669 (24%), Positives = 276/669 (41%), Gaps = 89/669 (13%)

Query: 305   QWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRD 364
             +W  DGS +++     +   +  + L +    + D G Y + V +  G +  + ++ V D
Sbjct: 17543 KWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLD 17602

Query: 365   AEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHE 424
                  PG P  P+N+  LDV  + + ++W PP D  G+P+  Y +E+       W     
Sbjct: 17603 V----PGPPTGPINI--LDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSS 17656

Query: 425   APGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLG 484
                 T +  I  L +G  Y FRVRA +++G   P                        L 
Sbjct: 17657 GSSKT-KLKIPHLQKGCEYVFRVRAENKIGVGPP------------------------LD 17691

Query: 485   NKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGS 543
             +  T++   F      PSPP     ++I E    ++W  P     +P+T Y +E+  + +
Sbjct: 17692 STPTVAKHKFSP----PSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREV-T 17746

Query: 544   GTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLP 603
             G W  + +++P+   +F V  L +  +Y FRV A N  GLS PS  S+PI    P     
Sbjct: 17747 GKWVRV-NKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKPPG 17805

Query: 604   PPAQVQAFRDTQTSVSLTW-DPVKD--PELLGYYIYSRKVGTSEWQTVN-NKPIQGTRFT 659
             PP   +    ++ +  L W  P+ D    +LGY +  +K GT++W  +N ++ I+   F 
Sbjct: 17806 PPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFR 17865

Query: 660   VPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNC-------- 711
             VPGL  G EY F +++ +  G GE     E +  K  L  P         +         
Sbjct: 17866 VPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQT 17925

Query: 712   --------GKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSD 763
                     G+ E  I W        GK+L         + +D      Q +P    ++ +
Sbjct: 17926 IRILARVKGRPEPDITWTKE-----GKVL------VREKRVDL----IQDLPRVELQIKE 17970

Query: 764   LHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWE 823
                    ++   A N +G  + SA  ++ +       +PGP  +++ + V   +  + WE
Sbjct: 17971 AVRADHGKYIISAKNSSGHAQGSAIVNVLD-------RPGPCQNLKVTNVTKENCTISWE 18023

Query: 824   PPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAG 883
              PL  G   +T + V +++   + W  V         L  ++L     Y F+V A N  G
Sbjct: 18024 NPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTK--RLIKANLLANNEYYFRVCAENKVG 18081

Query: 884   LGQPSMPTDPVLL---EDKPGAHE-IEVGVDEEGFIYLAFEAPEAPDSS---EFQWSKDY 936
             +G       P+L     D+PG  E + +    + F+YL +  P+    S    +   +  
Sbjct: 18082 VGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRL 18141

Query: 937   KGPLDPQRV 945
             KG  D +RV
Sbjct: 18142 KGSDDWERV 18150



 Score =  174 bits (442), Expect = 4e-43
 Identities = 147/610 (24%), Positives = 257/610 (42%), Gaps = 64/610 (10%)

Query: 305   QWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRD 364
             +W +    + +S    +   D  + L +    ++D G Y +   +  G   Q   V+V D
Sbjct: 18931 KWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMD 18990

Query: 365   AEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHE 424
             A    PG P  P ++   D++ D   L+W  P +  G+ IT Y +E+C    G+W+    
Sbjct: 18991 A----PGPPQPPFDIS--DIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALA 19044

Query: 425   APGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLG 484
             +   T  C +  L+ GQ Y FRVRA +R G S P  + ++V            + PF   
Sbjct: 19045 SVTKT-SCRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMV-----------AQFPFG-- 19090

Query: 485   NKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGS 543
                            +PS P N   +++ +  + +AW+ P     +P+  Y +E+    S
Sbjct: 19091 ---------------VPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNS 19135

Query: 544   GTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLP 603
               W   ++++ VRS  +    L +   Y FR+ A+N+ G S PS+P+E +  R P   + 
Sbjct: 19136 LLW-VKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMP---VD 19191

Query: 604   PPAQVQAFRDTQTSVSLTWDPVK---DPELLGYYIYSRKVGTSEWQTVNNKP--IQGTRF 658
             PP + +    T+++VSL W   K     +++GY++ + K+   +W   N  P  I    +
Sbjct: 19192 PPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEY 19251

Query: 659   TVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVI 718
             T  GL    +Y+F   + +   +   S  ++P+ +      P      A+    K+ + +
Sbjct: 19252 TATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAM----KSLLTV 19307

Query: 719   GWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEF----RA 774
                   + G    L   +       + W        P    K++        E     R 
Sbjct: 19308 ------KAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRK 19361

Query: 775   RAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVT 834
              + ++    E S+ S     K   + +PGPP  V+ +++ +   +L WEPPL  G   +T
Sbjct: 19362 DSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEIT 19421

Query: 835   GYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPV 894
              Y V  +E     W  V+   +  T   V  L  G  Y F++ A N  G+G P   T+P 
Sbjct: 19422 NYIVDKRETSRPNWAQVS-ATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVF-TEPA 19479

Query: 895   LLE---DKPG 901
             + +   D PG
Sbjct: 19480 IAKNPYDPPG 19489



 Score =  174 bits (442), Expect = 4e-43
 Identities = 140/540 (25%), Positives = 234/540 (43%), Gaps = 43/540 (7%)

Query: 373   PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRC 432
             PG+P     +DV R+ + L W PP    G+ I  Y+IE+ QG    W+ C+      C+ 
Sbjct: 27858 PGTP---DYIDVTRETITLKWNPPLRDGGSKIVGYSIEKRQGNE-RWVRCNFTDVSECQY 27913

Query: 433   PIQGLVEGQSYRFRVRAISRVGS-SVPSKASELVVMGDHDAARRKTEIPFDLGNKITIST 491
              + GL  G  Y FR+ A + VG+ S PS++S +++  D +        P      +    
Sbjct: 27914 TVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVP------PI-----VEFGP 27962

Query: 492   DAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISS 551
             + F+  +        + A         + W +        +   +   V+GS +      
Sbjct: 27963 EYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEIT-DVLGSTS------ 28015

Query: 552   ESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAF 611
                       V D  +    V+ V A N  G    ++    + ++  P  +  P  ++  
Sbjct: 28016 --------LFVRDATRDHRGVYTVEAKNASG---SAKAEIKVKVQDTPGKVVGP--IRFT 28062

Query: 612   RDTQTSVSLTWD-PVKD--PELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKE 668
               T   ++L WD P+ D    +  Y I  R+     W  + +K  +   +T   L  G E
Sbjct: 28063 NITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDK-CEAQSYTAIKLINGNE 28121

Query: 669   YEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGG 728
             Y+F V +V++ GVG     ++P+  +     P AP      N   N + + W  P+  GG
Sbjct: 28122 YQFRVSAVNKFGVGRP-LDSDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGG 28180

Query: 729   GKILGYFLDQHDSEELDW-HAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSA 787
              +I  Y L++ + +   W   ++++PI     KV+ L EG+ YEF   A N AGVG  S 
Sbjct: 28181 SEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASG 28240

Query: 788   PSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQ 847
              S L +C+E   P PGPP  V+ ++   T++ L+W  P++ G   + GY +   +     
Sbjct: 28241 ISRLIKCREPVNP-PGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGD 28299

Query: 848   WKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEV 907
             W  V       T   V+DLQ G+ Y F+V A+N AG G     T  +   D+  A E+++
Sbjct: 28300 WHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDI 28359



 Score =  174 bits (440), Expect = 7e-43
 Identities = 169/657 (25%), Positives = 270/657 (41%), Gaps = 90/657 (13%)

Query: 295   SEDVLDAE-------SIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRV 347
             S+ VLDA         I W +    L    +  + YT ++A+  +    + D G Y + V
Sbjct: 29063 SDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTV 29122

Query: 348   PSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAY 407
              +  G +  S  V V D       +PG    +    V ++   L W+ P +  G  IT Y
Sbjct: 29123 KNASGTKAVSVMVKVLD-------SPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHY 29175

Query: 408   TIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVM 467
              +ER +     W+   E    T    +  L++   Y FRVRA+++ G  VP ++  +V  
Sbjct: 29176 IVERRETSRLNWVIV-EGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVA- 29233

Query: 468   GDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEP-SP 526
                                         ++ TIPSPP         + ++++ W +P S 
Sbjct: 29234 ---------------------------RNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESD 29266

Query: 527   RDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDP 586
                    Y ++K    S  W  ++ +  V   R  V  L +   Y FRV A+N  G S+P
Sbjct: 29267 GGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEP 29326

Query: 587   SEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTW-DPVKD--PELLGYYIYSRKVGTS 643
             SE S  I+ R P  T  PP+  +    T+ S+SL W  P+ D   +++GY +  ++  T 
Sbjct: 29327 SEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTD 29386

Query: 644   EWQTVN-NKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATP-- 700
             +W  V+ N  I+ T FTVP L+ G++Y F V +V+  G+ E S +   I   + +  P  
Sbjct: 29387 QWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPDL 29446

Query: 701   --------------SAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDW 746
                            A     +   G+   VI W    ++G        +D  +S  L  
Sbjct: 29447 ELADDLKKTVTIRAGASLRLMVSVSGRPPPVITW---SKQGIDLASRAIIDTTESYSL-- 29501

Query: 747   HAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPY 806
                        V KV+    G   ++   A N +G    +    +++        PGP  
Sbjct: 29502 ---------LIVDKVNRYDAG---KYTIEAENQSGKKSATVLVKVYD-------TPGPCP 29542

Query: 807   DVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDL 866
              V+  EV   S+ + WE P   G  PV  Y V  +E     +K VT    S T  R+S L
Sbjct: 29543 SVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREAAMRAFKTVTT-KCSKTLYRISGL 29601

Query: 867   QPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKP-GAHEIEVGVDEEGFIYLAFEAP 922
               G  Y F+V   N  G+G+P   +D VL+ + P    ++EV    +  + LA+E P
Sbjct: 29602 VEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKP 29658



 Score =  173 bits (439), Expect = 9e-43
 Identities = 167/665 (25%), Positives = 277/665 (41%), Gaps = 93/665 (13%)

Query: 299   LDAESIQWFRDGSLLRSSR------RRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFG 352
             L    I+W ++ +++          + ++  ++ +  L +    +ED+G Y V   +  G
Sbjct: 15425 LPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLG 15484

Query: 353   PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIER- 411
                ++ +V V D        P  P N+   D+  +   LTW  P D  G+ IT Y I++ 
Sbjct: 15485 SVFRNVHVEVYDR-------PSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKR 15537

Query: 412   -CQGESGEWIACHEAPGGTC---RCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVM 467
                 +  EW    E    T    R  I  L+    Y FRVRA+++ G S   K+ ++V+ 
Sbjct: 15538 DASRKKAEW----EEVTNTAVEKRYGIWKLIPNGQYEFRVRAVNKYGISDECKSDKVVI- 15592

Query: 468   GDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPR 527
                                        +D   +P PP         +  ++++W  P   
Sbjct: 15593 ---------------------------QDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDN 15625

Query: 528   DRAPLT-YSLEKSVIGSGTWEAIS----SESPVRSPRFAVLDLEKKKSYVFRVRAMNQYG 582
               +P+T Y LEK   GS  W  +S    ++  ++   F V  L +   Y FR  A+N  G
Sbjct: 15626 GGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAG 15685

Query: 583   LSDPSEPSEPIALRGPPATLPPPAQVQAFRD-TQTSVSLTWDP-VKD--PELLGYYIYSR 638
             +  PSEPS+P  + G P   P P      +D T++S+SL W P  KD    + GY +  +
Sbjct: 15686 IGPPSEPSDP-EVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQ 15744

Query: 639   KVGTSEWQTVN--NKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQA 696
             + GT++W+ VN  +K I      VP L+  ++Y F V++V+EAG  E S  T  I     
Sbjct: 15745 EEGTTDWKRVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDI 15804

Query: 697   LATPSAPYGFALLNCG--------KNEMVIGWKPPKRRG---GGKILGYFLDQ-HDSEEL 744
                P         +C         +   VI  +P  +      GK      D  HD  E 
Sbjct: 15805 QEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPE- 15863

Query: 745   DWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGP 804
                A  +    + V  + +    H  ++   A N AG            C+   M  PGP
Sbjct: 15864 --DAQLETAENSSVIIIPECKRSHTGKYSITAKNKAG-------QKTANCRVKVMDVPGP 15914

Query: 805   PYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVS 864
             P D++ S++   S  L W+ P   G   + GY +  +    + W  V P   S T + V 
Sbjct: 15915 PKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFV-VP 15973

Query: 865   DLQPGKSYVFQVQAMNSAGLGQP------SMPTDPVLLEDKPGAHEIEVGVDEEGFIYLA 918
             DL   + Y F+V+A N  G+G P      +   DP+   D P   ++++G+  +  ++L+
Sbjct: 15974 DLLSEQQYFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPP--IKLKIGLITKNTVHLS 16031

Query: 919   FEAPE 923
             ++ P+
Sbjct: 16032 WKPPK 16036



 Score =  173 bits (439), Expect = 9e-43
 Identities = 182/737 (24%), Positives = 287/737 (38%), Gaps = 93/737 (12%)

Query: 177   VQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAH 236
             VQ  P P+VTW+K+   I+ R+       IT+  G  SL +R    +    YTV  KNA 
Sbjct: 27982 VQGRPVPRVTWFKDGVEIEKRM----NMEITDVLGSTSLFVRDATRDHRGVYTVEAKNAS 28037

Query: 237   GQASSFAKVLVRTYLGKDAG---FDSEIFKRSTFGPSVEFTSVLKPV---FAREKEPFSL 290
             G A +  KV V+   GK  G   F +   ++ T            P+      ++E   L
Sbjct: 28038 GSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRL 28097

Query: 291   SCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSP 350
             +    ED  +A+S    +             L    +   +VS   K   G         
Sbjct: 28098 AWALIEDKCEAQSYTAIK-------------LINGNEYQFRVSAVNKFGVG--------- 28135

Query: 351   FGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIE 410
                R   +  +V   +   P APG P      ++  + + LTWA P    G+ I  Y +E
Sbjct: 28136 ---RPLDSDPVVAQIQYTVPDAPGIP---EPSNITGNSITLTWARPESDGGSEIQQYILE 28189

Query: 411   RCQGESGEWI-ACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGD 469
             R + +S  W+    + P    R  + GL EG  Y F V A +  G    S  S L+    
Sbjct: 28190 RREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLI---- 28245

Query: 470   HDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEP-SPRD 528
                                       + V  P PPT V  ++  +  V L W +P     
Sbjct: 28246 -----------------------KCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGG 28282

Query: 529   RAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSE 588
                + Y +E      G W  +++E+ V++ R+ V DL+  + Y FRV A+N  G  D  E
Sbjct: 28283 MEIIGYIIEMCKADLGDWHKVNAEACVKT-RYTVTDLQAGEEYKFRVSAINGAGKGDSCE 28341

Query: 589   PSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEW-QT 647
              +  I  +       P   + A    QT V      ++    L      R   T+ W + 
Sbjct: 28342 VTGTI--KAVDRLTAPELDIDA-NFKQTHVVRAGASIR----LFIAYQGRPTPTAVWSKP 28394

Query: 648   VNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAG-----VGESSAATEPIRVKQALATPSA 702
              +N  ++    T     T    E C R  ++AG     V  +S +       + L TP  
Sbjct: 28395 DSNLSLRADIHTTDSFST-LTVENCNR--NDAGKYTLTVENNSGSKSITFTVKVLDTPGP 28451

Query: 703   PYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVS 762
             P      +  +    + W  P   GG +I  Y +++ ++    W  ++++    ++ KV+
Sbjct: 28452 PGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISEK-CTRQIFKVN 28510

Query: 763   DLHEGHFYEFRARAANWAGVGE-LSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQ 821
             DL EG  Y FR  A N  GVGE    P  +   +     QP PP  +   +   +S VL 
Sbjct: 28511 DLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATE-----QPAPPRRLDVVDTSKSSAVLA 28565

Query: 822   WEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNS 881
             W  P + G   +TGY +  +++GS+ W  V  G        V  L     Y F+V+A N 
Sbjct: 28566 WLKPDHDGGSRITGYLLEMRQKGSDFW--VEAGHTKQLTFTVERLVEKTEYEFRVKAKND 28623

Query: 882   AGLGQPSMPTDPVLLED 898
             AG  +P      V++++
Sbjct: 28624 AGYSEPREAFSSVIIKE 28640



 Score =  172 bits (437), Expect = 2e-42
 Identities = 153/644 (23%), Positives = 258/644 (40%), Gaps = 86/644 (13%)

Query: 373   PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRC 432
             PG P N R  D  R  + L W+ P D  G+ +T Y IE  + +  EW  C+  P      
Sbjct: 30033 PGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREY 30092

Query: 433   PIQGLVEGQSYRFRVRAISRVGSSVPS------KASELVVMGDHDAARRKTEIPF-DLGN 485
              +  L +G  YRFRV A +  G   P+      K +E++   D++   R  E  F   G 
Sbjct: 30093 TLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQGG 30152

Query: 486   KITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAW----EEPSPRDRAPLTYSLEKSVI 541
              I +       T+ I   P           + +  W    ++ S R     + +  + VI
Sbjct: 30153 VIRL-------TIPIKGKP-----------FPICKWTKEGQDISKRAMIATSETHTELVI 30194

Query: 542   ------GSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIAL 595
                    SGT++ +                  KK+   +VR      +  P+ P  P+  
Sbjct: 30195 KEADRGDSGTYDLVLENKC------------GKKAVYIKVRV-----IGSPNSPEGPLE- 30236

Query: 596   RGPPATLPPPAQVQAFRDTQT-SVSLTWDPVKDP---ELLGYYIYSRKVGTSEWQTVNNK 651
                            + D Q  SV ++W P  D    ++LGY +  R+V  + W T++++
Sbjct: 30237 ---------------YDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSR 30281

Query: 652   PIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFA-LLN 710
              ++GT   V GL+   EY F V + ++ G+ +   + EP+  K  L  P  P     +L+
Sbjct: 30282 -VRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVLD 30340

Query: 711   CGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFY 770
               K+ + + W  PK  GG ++ GY++++ ++    W   N+  I T +  V+ L     Y
Sbjct: 30341 VTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEY 30400

Query: 771   EFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGA 830
             +FR  A N  G+ E S  S    CK+    +P  P ++    +   S+ LQWE P   G 
Sbjct: 30401 QFRIIAQNDVGLSETSPASEPVVCKD-PFDKPSQPGELEILSISKDSVTLQWEKPECDGG 30459

Query: 831   GPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMP 890
               + GY V +++ G   WK      I      +  L     Y F+V A N  GL +P   
Sbjct: 30460 KEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRT 30519

Query: 891   TDPVLLE----DKPGAH----EIEVGVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDP 942
                +  +    + PG      ++   + E   +         PD    +W +  K  +  
Sbjct: 30520 AMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPD---IKWYRFGKELIQS 30576

Query: 943   QRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTL 986
             ++ K+        + +     ED G Y+ I T+   ++  S  L
Sbjct: 30577 RKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKL 30620



 Score =  172 bits (436), Expect = 2e-42
 Identities = 159/611 (26%), Positives = 255/611 (41%), Gaps = 65/611 (10%)

Query: 304   IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTY--KEDEGLYMVRVPSPFGPREQSTYVL 361
             + W +D      +R  ++    R  S K S T   + D G Y+V   +  G       V 
Sbjct: 18233 VAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVN 18292

Query: 362   VRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIA 421
             V D        PG   N++ +DV+ D   + W PP D  G  I  Y +E+C+ +   W +
Sbjct: 18293 VLDK-------PGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVW-S 18344

Query: 422   CHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPF 481
              + A   T    +  L+EG  Y FRVRA +++G+  P+++  ++    +D   R      
Sbjct: 18345 TYSATVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYDKPGR------ 18398

Query: 482   DLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSV 540
                                P PP     +++ +  + + W  P       +T Y LEK  
Sbjct: 18399 -------------------PDPP---EVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKE 18436

Query: 541   IGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPA 600
               S  W  ++ +S +   R  V +L     Y FRV+A N+ G+ +PS PS P+  + P  
Sbjct: 18437 KHSTRWVPVN-KSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIE 18495

Query: 601   TLPPPAQVQAFRDTQTSVSLTWD-PVKD--PELLGYYIYSR-KVGTSE----WQTVNNKP 652
                PP   +    T+ S++L W  PV D    ++GY +  R K+  +     W+  N   
Sbjct: 18496 PPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAA 18555

Query: 653   -IQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNC 711
              +    FTV  L   +EYEF V + ++ G+G  +   E I+ K+ L  P        L+ 
Sbjct: 18556 QLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEID-----LDA 18610

Query: 712   GKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYE 771
                ++VI      R G    L   +    + ++ W  V    +  R  +V  +    F  
Sbjct: 18611 SMRKLVI-----VRAGCPIRLFAIVRGRPAPKVTWRKVGIDNV-VRKGQVDLVDTMAFLV 18664

Query: 772   FRARAANWAGVGELSAPSSLFECKEW----TMPQPGPPYDVRASEVRATSLVLQWEPPLY 827
                   + +G   L+  +   E   +     +  PGP  D++ S+V  TS  + W PP  
Sbjct: 18665 IPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPEN 18724

Query: 828   MGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQP 887
              G   VT Y V  +E   + W  VTP  +  T   V++L PG  Y F+V A+N  G G P
Sbjct: 18725 DGGSQVTHYIVEKREADRKTWSTVTP-EVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVP 18783

Query: 888   SMPTDPVLLED 898
             +    PVL  D
Sbjct: 18784 TDVPKPVLASD 18794



 Score =  172 bits (435), Expect = 3e-42
 Identities = 157/594 (26%), Positives = 245/594 (41%), Gaps = 57/594 (9%)

Query: 310   GSLLRSSRRRKILYTDRQASLKVSCTYKED---EGL------YMVRVPSPFGPREQSTYV 360
             G L+    R  +L+     +L  S  Y      EGL      Y +       P + + YV
Sbjct: 19125 GYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYV 19184

Query: 361   LVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWI 420
               R    + PG P        +DV +  + L WA P    G+ I  Y +E C+    +W+
Sbjct: 19185 TAR-MPVDPPGKP------EVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWV 19237

Query: 421   ACHEAPGGTCR--CPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTE 478
              C+ AP    +      GL E   Y+FR  A + V  S PS+ S+ V           T 
Sbjct: 19238 RCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPV-----------TI 19286

Query: 479   IPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEK 538
             +  ++  +I +S  A +  +T+ +  TNV             + +P P      T S +K
Sbjct: 19287 LAENVPPRIDLSV-AMKSLLTVKAG-TNVCLD-------ATVFGKPMP------TVSWKK 19331

Query: 539   SVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGP 598
                     E I            +  + +K S  + + A N  G    +   + +   GP
Sbjct: 19332 DGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGP 19391

Query: 599   PATLPPPAQVQAFRDTQTSVSLTWDPVKDP---ELLGYYIYSRKVGTSEWQTVNNKPIQG 655
             PA+      V+  +       L+W+P  +    E+  Y +  R+     W  V+   +  
Sbjct: 19392 PAS------VKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVS-ATVPI 19444

Query: 656   TRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNE 715
             T  +V  L  G EY+F + + ++ GVG+    TEP   K     P       + N  K+ 
Sbjct: 19445 TSCSVEKLIEGHEYQFRICAENKYGVGDP-VFTEPAIAKNPYDPPGRCDPPVISNITKDH 19503

Query: 716   MVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRAR 775
             M + WKPP   GG  I GY L++ +++ ++W  VN++PI  R  K + L EG  YEFR  
Sbjct: 19504 MTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVT 19563

Query: 776   AANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTG 835
             A N AG G+ S  S     ++   P PGPP   +  +   +S+ L W  P Y G  P+ G
Sbjct: 19564 AINKAGPGKPSDASKAAYARDPQYP-PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIG 19622

Query: 836   YHVSFQEEGSEQW-KPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPS 888
             Y V  +   S+ W +   P  +  T   V+ L     Y F+V A+N  G   PS
Sbjct: 19623 YLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPS 19676



 Score =  171 bits (432), Expect = 6e-42
 Identities = 194/832 (23%), Positives = 310/832 (37%), Gaps = 116/832 (13%)

Query: 169   TTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATY 228
             T V L  TV   P P V+W K+ T + P    A   ++     L +LE+     +DS  Y
Sbjct: 19311 TNVCLDATVFGKPMPTVSWKKDGTLLKP----AEGIKMAMQRNLCTLELFSVNRKDSGDY 19366

Query: 229   TVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPF 288
             T+  +N+ G  S+  K+ V    G  A              SV+   +         EP 
Sbjct: 19367 TITAENSSGSKSATIKLKVLDKPGPPA--------------SVKINKMYSDRAMLSWEP- 19411

Query: 289   SLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVP 348
                     +   +E   +  D          ++  T    S  V    +  E  + +   
Sbjct: 19412 ------PLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAE 19465

Query: 349   SPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCL-DVNRDCLILTWAPPSDTRGNPITAY 407
             + +G  +    V    A A+NP  P    +   + ++ +D + ++W PP+D  G+PIT Y
Sbjct: 19466 NKYGVGDP---VFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGY 19522

Query: 408   TIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVM 467
              +E+ + ++  W   +  P         GL EG  Y FRV AI++ G   PS AS+    
Sbjct: 19523 LLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKA--- 19579

Query: 468   GDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPR 527
                 A  R  + P                    P PP      +   + V L+W +P+  
Sbjct: 19580 ----AYARDPQYP--------------------PGPPAFPKVYDTTRSSVSLSWGKPAYD 19615

Query: 528   DRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDP 586
               +P+  Y +E     S  W   +    ++  RF V  L +   Y FRV A+N+ G SDP
Sbjct: 19616 GGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLMEDTQYQFRVYAVNKIGYSDP 19675

Query: 587   SEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQ 646
             S+  +      P   L PP                 +   D +L    I    V    + 
Sbjct: 19676 SDVPDK---HYPKDILIPP-----------------EGELDADLRKTLILRAGVTMRLYV 19715

Query: 647   TVNNKPIQGTRFTVPGLRTGKEYEFCVRSVS-------------EAG-----VGESSAAT 688
              V  +P     ++ P +         ++S               +AG     +  S    
Sbjct: 19716 PVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKK 19775

Query: 689   EPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHA 748
             E   V + L TP  P    +    K+   + W+PP   GG  I+ Y + + D+E   W  
Sbjct: 19776 EYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWST 19835

Query: 749   VNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDV 808
             V  +   T   +V++L EG  Y FR  A N  G+G+        +  +     PGP  D+
Sbjct: 19836 VTTECSKTSF-RVANLEEGKSYFFRVFAENEYGIGDPGETRDAVKASQ----TPGPVVDL 19890

Query: 809   RASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQP 868
             +   V  +S  + W+ P   G   + GY V F  E   +W+ V             DL  
Sbjct: 19891 KVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTE-ENKWQRVMKS--LSLQYSAKDLTE 19947

Query: 869   GKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEV-GVDEEGFIYLAFEAP----- 922
             GK Y F+V A N  G G PS  T  V+  D   A ++++ G+ +    YLA E       
Sbjct: 19948 GKEYTFRVSAENENGEGTPSEIT--VVARDDVVAPDLDLKGLPD--LCYLAKENSNFRLK 20003

Query: 923   ---EAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSV 971
                +   +    W K         RV +E     + +I+ +    D G Y++
Sbjct: 20004 IPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTI 20055



 Score =  171 bits (432), Expect = 6e-42
 Identities = 199/832 (23%), Positives = 332/832 (39%), Gaps = 126/832 (15%)

Query: 177   VQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAH 236
             ++  P P+VTW K++  +  R        I N      L I  C   D+  + + ++N  
Sbjct: 20800 IKGRPAPEVTWTKDNINLKNRA------NIENTESFTLLIIPECNRYDTGKFVMTIENPA 20853

Query: 237   GQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSE 296
             G+ S F  V V                  T GP +     L+P               ++
Sbjct: 20854 GKKSGFVNVRVL----------------DTPGPVLN----LRP---------------TD 20878

Query: 297   DVLDAESIQWFRDGSLLRS-SRRRKILYTDRQASLKV---------SCTYKE---DEGL- 342
                D+ ++ W  D  L+   SR    +   R+A+ K           CTYK     EG  
Sbjct: 20879 ITKDSVTLHW--DLPLIDGGSRITNYIVEKREATRKSYSTATTKCHKCTYKVTGLSEGCE 20936

Query: 343   YMVRVPSPFGPREQSTYVLVRDAEAENP----GAPGSPLNVRCLDVNRDCLILTWAPPSD 398
             Y  RV +      ++ Y +    E   P     AP  P ++  +D+ +  + L W  P  
Sbjct: 20937 YFFRVMA------ENEYGIGEPTETTEPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKH 20990

Query: 399   TRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVP 458
               G+ IT Y IE  +  S +W       G    C ++ L EG+ Y F+V A++  G S P
Sbjct: 20991 DGGSKITGYVIEAQRKGSDQWTHITTVKG--LECVVRNLTEGEEYTFQVMAVNSAGRSAP 21048

Query: 459   SKASELVVMGDHDAARRKTEIP-FDLGN---KITISTDAFEDTVTIPSPPTNVHASEIRE 514
              ++  ++V       + +T +P  DL     K+ I+       V IP             
Sbjct: 21049 RESRPVIV-------KEQTMLPELDLRGIYQKLVIAKAGDNIKVEIP------------- 21088

Query: 515   AYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFR 574
                VL   +P+      +T+     ++     + ++ E+   S    + +  +  S  + 
Sbjct: 21089 ---VLGRPKPT------VTWKKGDQILKQT--QRVNFETTATSTILNINECVRSDSGPYP 21137

Query: 575   VRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDP---ELL 631
             + A N  G     E  + I ++      PP   ++    +   V+ +WDP ++     + 
Sbjct: 21138 LTARNIVG-----EVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPIS 21192

Query: 632   GYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPI 691
              Y +  R+  ++ W  +    I+ T +    L TG EY+F V++ +  GVG    +   I
Sbjct: 21193 NYVVEMRQTDSTTWVELATTVIR-TTYKATRLTTGLEYQFRVKAQNRYGVGPGITSA-CI 21250

Query: 692   RVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQ 751
                     P  P    +    K+ M I W  P   GG  ILGY +++ +   + W  V++
Sbjct: 21251 VANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSK 21310

Query: 752   QPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRAS 811
               +P  + K S L +G  YEFR  A N AG  + S PS      +   P PG P  +  +
Sbjct: 21311 ALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDP-PGKPVPLNIT 21369

Query: 812   EVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKS 871
                 T   L+W  P Y G   +T Y V  ++  + +W       I      VS L    +
Sbjct: 21370 RHTVT---LKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAA 21426

Query: 872   YVFQVQAMNSAG-LGQPSMPTDPVLLEDKPGAHEIEVGVD-EEGFIYLAFEA--PEAPDS 927
             Y F+V A N+AG +  PS P+D +   D   A +I+V V  ++  I  A EA   EA  S
Sbjct: 21427 YEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVS 21486

Query: 928   SE----FQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTD 975
                    +WSKD K      +++I+     + ++ K+    D G Y++  T+
Sbjct: 21487 GRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATN 21538



 Score =  170 bits (431), Expect = 8e-42
 Identities = 188/740 (25%), Positives = 291/740 (39%), Gaps = 96/740 (12%)

Query: 170   TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT 229
             T+ +   V+  P P +TW    T+    L R  +  +  +   + L+I+     D   Y 
Sbjct: 17925 TIRILARVKGRPEPDITW----TKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYI 17980

Query: 230   VRVKNA--HGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGP--SVEFTSVLKPVFAREK 285
             +  KN+  H Q S+   VL R                   GP  +++ T+V K       
Sbjct: 17981 ISAKNSSGHAQGSAIVNVLDRP------------------GPCQNLKVTNVTKE------ 18016

Query: 286   EPFSLSCLFS-EDVLD--AESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGL 342
                  +C  S E+ LD     I  F       + +   I+ +D    L  +     +E  
Sbjct: 18017 -----NCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIKANLLANNEYY 18071

Query: 343   YMVRVPSPFGPR---EQSTYVLVRDAEAENP-GAPGSPLNVRCLDVNRDCLILTWAPPSD 398
             + V   +  G     E  T +L     A NP   PG P N+   D  +  + L W  P  
Sbjct: 18072 FRVCAENKVGVGPTIETKTPIL-----AINPIDRPGEPENLHIADKGKTFVYLKWRRPDY 18126

Query: 399   TRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVP 458
               G+P  +Y +ER    S +W   H+         +   VE Q Y FRV+  +  G S  
Sbjct: 18127 DGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDW 18186

Query: 459   SKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVV 518
              K  E+VV  D     +K  +   L   +T+      DT+ +        A    + +  
Sbjct: 18187 VKTEEVVVKED----LQKPVLDLKLSGVLTVKAG---DTIRL-------EAGVRGKPFPE 18232

Query: 519   LAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAM 578
             +AW +   +D   LT S             +  ++   S +F++   ++     + V A 
Sbjct: 18233 VAWTKD--KDATDLTRS-----------PRVKIDTRADSSKFSLTKAKRSDGGKYVVTAT 18279

Query: 579   NQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDP---ELLGYYI 635
             N  G          +   GP   L     V + R T     + WDP +D    E+  Y +
Sbjct: 18280 NTAGSFVAYATVNVLDKPGPVRNLKI-VDVSSDRCT-----VCWDPPEDDGGCEIQNYIL 18333

Query: 636   YSRKVGTSEWQTVNNKPIQ-GTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVK 694
                +     W T +   +  GT  TV  L  G EY F VR+ ++ G G  + + +P+  K
Sbjct: 18334 EKCETKRMVWSTYSATVLTPGT--TVTRLIEGNEYIFRVRAENKIGTGPPTES-KPVIAK 18390

Query: 695   QALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPI 754
                  P  P    +    K EM + W PP+  GG  I GYFL++ +     W  VN+  I
Sbjct: 18391 TKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAI 18450

Query: 755   PTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVR 814
             P R  KV +L   H Y+FR +A N  G+GE S PS     K+   P PGPP + R  +  
Sbjct: 18451 PERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEP-PGPPTNFRVVDTT 18509

Query: 815   ATSLVLQWEPPLYMGAGPVTGYHVSFQEE-----GSEQWKPV-TPGPISGTHLRVSDLQP 868
               S+ L W  P+Y G  P+ GY V  + +       E WK       +      V+ L  
Sbjct: 18510 KHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDE 18569

Query: 869   GKSYVFQVQAMNSAGLGQPS 888
              + Y F+V A N  G+G+P+
Sbjct: 18570 NQEYEFRVCAQNQVGIGRPA 18589



 Score =  170 bits (430), Expect = 1e-41
 Identities = 149/565 (26%), Positives = 249/565 (44%), Gaps = 50/565 (8%)

Query: 353   PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERC 412
             P + S   + RD   + PG P        + V R+ + L W  P+   G+ IT Y +E+ 
Sbjct: 22426 PSKVSECYVARDP-CDPPGRP------EAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKK 22478

Query: 413   QGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGS-SVPSKASELVVMGDHD 471
             +   G W+             + GLVE   Y FRV A +  G  S PS+++  +      
Sbjct: 22479 ELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAIT----- 22533

Query: 472   AARRKTEIPFDLGNKITISTDA-FEDTVTIPSPPT-NVHASEIREAYVVLAWEEPSPRDR 529
              AR + + P        IS D  ++DT+ + +  +  V A    +    + W +      
Sbjct: 22534 -ARDEVDPP-------RISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGD--QE 22583

Query: 530   APLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEP 589
                T  LE       T  ++     V S  +    L+ K     R   +N   L  P  P
Sbjct: 22584 LSNTARLEIKSTDFATSLSVKDAVRVDSGNYI---LKAKNVAGERSVTVNVKVLDRPGPP 22640

Query: 590   SEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDP-VKD--PELLGYYIYSRKVGTSEWQ 646
               P+ + G                T    +L W P ++D   +++ Y +  R+     W 
Sbjct: 22641 EGPVVISGV---------------TAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVW- 22684

Query: 647   TVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGF 706
             TV +  +Q     V  L  G EY F + +V++ GVGE    +EP+  K     P AP   
Sbjct: 22685 TVVDANVQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEP-LESEPVVAKNPFVVPDAPKAP 22743

Query: 707   ALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHE 766
              +    K+ M++ W+ P   GG +ILGY L++ D E + W   +++ I     +V+ L E
Sbjct: 22744 EVTTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIE 22803

Query: 767   GHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPL 826
              H YEFR  A N AG+ E S PS+  +  +  + +PGPP + +  ++  +S+ L W  P+
Sbjct: 22804 NHDYEFRVSAENAAGLSEPSPPSAYQKACD-PIYKPGPPNNPKVIDITRSSVFLSWSKPI 22862

Query: 827   YMGAGPVTGYHVSFQEEGSEQWKPVTPGP-ISGTHLRVSDLQPGKSYVFQVQAMNSAGLG 885
             Y G   + GY V   +    +W   TP   I+ T++ V  L     Y F++ A+N AG+G
Sbjct: 22863 YDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVG 22922

Query: 886   QPSMPTDPVLLEDKPGAHEIEVGVD 910
             + +    P+++E+K  A +I++ ++
Sbjct: 22923 EHADVPGPIIVEEKLEAPDIDLDLE 22947



 Score =  169 bits (427), Expect = 2e-41
 Identities = 153/602 (25%), Positives = 252/602 (41%), Gaps = 55/602 (9%)

Query: 307   FRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGL-YMVRVPSP----FGPREQSTYVL 361
             +++ S +  S+  KIL  D Q  +KVS     DEGL Y  RV +      G   +S   +
Sbjct: 25625 YKERSSILWSKANKILIADTQ--MKVSGL---DEGLMYEYRVYAENIAGIGKCSKSCEPV 25679

Query: 362   VRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIA 421
                   + PG P         ++ R  + L W+ P    G  IT Y +ER +   G W+ 
Sbjct: 25680 PARDPCDPPGQP------EVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLK 25733

Query: 422   CHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGS-SVPSKASELVVMGDHDAARRKTEIP 480
             C+          +  L E Q Y FRV A +   S S PS+++  +++ D           
Sbjct: 25734 CNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKD----------- 25782

Query: 481   FDLGNKITISTDAFEDTVTIPSPPT-NVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKS 539
              D+     +    F D + + +     ++A        V++W     +D   +       
Sbjct: 25783 -DVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWA----KDGIEIEERARTE 25837

Query: 540   VIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPP 599
             +I +     ++ +  +R      + L  K     R  A+N   L  P  P+ P+ + G  
Sbjct: 25838 IISTDNHTLLTVKDCIRRDTGQYV-LTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGL- 25895

Query: 600   ATLPPPAQVQAFRDTQTSVSLTWD-PVKDPEL-LGYYIYSRKVGTSEWQTVNNKPIQGTR 657
                           T    SL+W  P +D    + YYI  ++  +    T+    +Q T 
Sbjct: 25896 --------------TAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQMTS 25941

Query: 658   FTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMV 717
               V  L  G EY F V  V++ GVGE   +   I+       PS P    + +  K  M 
Sbjct: 25942 CKVTKLLKGNEYIFRVTGVNKYGVGEPLESVA-IKALDPFTVPSPPTSLEITSVTKESMT 26000

Query: 718   IGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAA 777
             + W  P+  GG +I GY +++ +   L W  VN++P+     K + L EG  YE+R  A 
Sbjct: 26001 LCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAE 26060

Query: 778   NWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYH 837
             N AG+   S  S L   ++     P PP   +  +   T++ + W  PL+ G  P+TGY 
Sbjct: 26061 NAAGLSLPSETSPLIRAEDPVF-LPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYT 26119

Query: 838   VSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLE 897
             V +++     WK  +   + GT   +S L  G  YVF+V+++N  G   PS  +DP + +
Sbjct: 26120 VEYKKSDDTDWK-TSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAK 26178

Query: 898   DK 899
             ++
Sbjct: 26179 ER 26180



 Score =  169 bits (427), Expect = 2e-41
 Identities = 198/866 (22%), Positives = 338/866 (39%), Gaps = 151/866 (17%)

Query: 173   LTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRV 232
             +T   +  P P V W K DT +  R +      +       SL I      DS  YT+ +
Sbjct: 26206 MTVPFRGRPVPNVLWSKPDTDLRTRAY------VDTTDSRTSLTIENANRNDSGKYTLTI 26259

Query: 233   KNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSC 292
             +N    AS    V V                  T GP    T          ++    S 
Sbjct: 26260 QNVLSAASLTLVVKVL----------------DTPGPPTNITV---------QDVTKESA 26294

Query: 293   LFSEDVLDAESIQWFRDGSLLR--SSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVP-- 348
             + S DV + +     ++  + +  +S++  +  T+    L    T  ++  +Y  RV   
Sbjct: 26295 VLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGE 26354

Query: 349   SPFG---PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPIT 405
             + FG   P E    V + +        P  P  +    +++D + LTW  P    G+ I 
Sbjct: 26355 NEFGVGIPAETKEGVKITEK-------PSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIV 26407

Query: 406   AYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELV 465
              Y +E  +     W+ C  A   +    + GL E   Y FRV A ++ G S P +    V
Sbjct: 26408 HYVVEALEKGQKNWVKC--AVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPV 26465

Query: 466   VMGDH-------------------DAARRKTEIPFDLGN---KITISTDAFEDTVTIPSP 503
             ++ +                      +  K +IP   G    K+T+S D       +P  
Sbjct: 26466 LIKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPIS-GKPLPKVTLSRDG------VPLK 26518

Query: 504   PTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIG-SGTWEAISSESPVRSPRFAV 562
              T    +EI                   LT +L++SV   +G +E  ++ S   +  F  
Sbjct: 26519 ATMRFNTEITAEN---------------LTINLKESVTADAGRYEITAANSSGTTKAF-- 26561

Query: 563   LDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTW 622
                            +N   L  P  P+ P+ +                  T+ SV+L W
Sbjct: 26562 ---------------INIVVLDRPGPPTGPVVISDI---------------TEESVTLKW 26591

Query: 623   DPVK---DPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEA 679
             +P K     ++  Y +  R+  T+ W  V+   +  T   V  L TG+EY+F +++ +  
Sbjct: 26592 EPPKYDGGSQVTNYILLKRETSTAVWTEVS-ATVARTMMKVMKLTTGEEYQFRIKAENRF 26650

Query: 680   GVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQH 739
             G+ +   +   + VK    TP  P    + N  +  + +GW  P   GG  ++GY L+  
Sbjct: 26651 GISDHIDSA-CVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMK 26709

Query: 740   DSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPS----SLFECK 795
             D   + W   N+  I T   KV+ +  G  YEFR  A N AGVG+ S PS    ++  C+
Sbjct: 26710 DRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACE 26769

Query: 796   EWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP 855
                     PP +VR +++   S+ L W+ P + G   +TGY V  ++    +W   +   
Sbjct: 26770 --------PPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTN 26821

Query: 856   ISGTHLRVSDLQPGKSYVFQVQAMNSAG-LGQPSMPTDPVLLEDKPGAHEIEVGVD-EEG 913
             ++ T   +S L     Y F+V A N+ G +  PS    P+   D  G   I++ ++  E 
Sbjct: 26822 VTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEV 26881

Query: 914   FIYLAFEAPE------APDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLG 967
               Y A  + +         +   +W KD K       V +E+  + + +++K+    + G
Sbjct: 26882 VKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSG 26941

Query: 968   TYSVIVTDADEDISASHTLTEEELEK 993
              Y + + +A    SAS T+  + L+K
Sbjct: 26942 CYELKLRNAMG--SASATIRVQILDK 26965



 Score =  167 bits (424), Expect = 5e-41
 Identities = 199/830 (23%), Positives = 319/830 (38%), Gaps = 105/830 (12%)

Query: 173   LTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRV 232
             LT      P P+V+W+K++  +        +  I      L+LE  +    DS  Y V V
Sbjct: 16838 LTGRYSGKPKPKVSWFKDEADV----LEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVV 16893

Query: 233   KNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSC 292
             +N+ G    F +V V    G   G              V F  V K       +P     
Sbjct: 16894 ENSTGSRKGFCQVNVVDRPGPPVG-------------PVSFDEVTKDYMVISWKP----- 16935

Query: 293   LFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFG 352
                 D   ++   +  +   +       +     + + KVS   +  + ++ +   + +G
Sbjct: 16936 --PLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDYIFRIHAENLYG 16993

Query: 353   PREQSTYVLVRDAEAEN-----PGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAY 407
               +     LV D+         P AP  P+     +V +D  ++TW  P D  G PIT Y
Sbjct: 16994 ISDP----LVSDSMKAKDRFRVPDAPDQPI---VTEVTKDSALVTWNKPHD-GGKPITNY 17045

Query: 408   TIERCQGESGEWIACHEAP-GGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVV 466
              +E+ +  S  W    + P     +  +  L+EG  Y FRV A + +G   PS  S+ V 
Sbjct: 17046 ILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVF 17105

Query: 467   MGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSP 526
                                         +D +  PSPP N  A +     V L W+ P  
Sbjct: 17106 A---------------------------KDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRH 17138

Query: 527   RDRAP-LTYSLEKSVIGSGTWEAISSESPVRSP--RFAVLDLEKKKSYVFRVRAMNQYGL 583
                +  L Y +E   +G   W   ++ +P   P  ++ V  L   ++Y FRV A+N  G 
Sbjct: 17139 DGGSKILGYIVEYQKVGDEEWRR-ANHTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGE 17197

Query: 584   SDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTS 643
             SDP+   EP+ ++      PP   + A    +  +      V D   L   I        
Sbjct: 17198 SDPAHVPEPVLVK--DRLEPPELILDANMAREQHIK-----VGDTLRLSAIIKGVPFPKV 17250

Query: 644   EWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGV----GESSAATEPIRVK-QALA 698
              W+  +       R  V  +  G + E    +  + G+     E+ A ++ + VK   L 
Sbjct: 17251 TWKKEDRDAPTKARIDVTPV--GSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLD 17308

Query: 699   TPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRV 758
              P  P    +    K+   + WK P   GG  I  Y +++ D     W      P+    
Sbjct: 17309 KPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQW-----SPLSATS 17363

Query: 759   CKVS----DLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVR 814
              K S     L+EG+ Y FR  A N  G G         +  +   P PGPP D+   +V 
Sbjct: 17364 KKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHP-PGPPKDLHHVDVD 17422

Query: 815   ATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVF 874
              T + L W  P   G  P+TGY V +QEEG++ W  +    ++     V+ LQ GK+Y F
Sbjct: 17423 KTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDW--IKFKTVTNLECVVTGLQQGKTYRF 17480

Query: 875   QVQAMNSAGLGQPSMPTDPVLLEDK--PGAHEIEVGVDEEGFIYLAFEAPEAP------D 926
             +V+A N  GLG P   T P+  ++K  P + E++V +  EG +  A      P       
Sbjct: 17481 RVKAENIVGLGLPD-TTIPIECQEKLVPPSVELDVKL-IEGLVVKAGTTVRFPAIIRGVP 17538

Query: 927   SSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDA 976
                 +W+ D       +   +E     S + +K     D G Y + V++A
Sbjct: 17539 VPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNA 17588



 Score =  167 bits (422), Expect = 9e-41
 Identities = 182/748 (24%), Positives = 309/748 (41%), Gaps = 108/748 (14%)

Query: 170   TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT 229
             T+ L  T++  P P+V W K +  +  R     +  +T+++ +L ++       DS  Y 
Sbjct: 25124 TLRLFVTIKGRPEPEVKWEKAEGILTDR----AQIEVTSSFTMLVID--NVTRFDSGRYN 25177

Query: 230   VRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFS 289
             + ++N  G  ++F  V V          DS         PS      ++ V   +K+  +
Sbjct: 25178 LTLENNSGSKTAFVNVRV---------LDS---------PSAPVNLTIREV---KKDSVT 25216

Query: 290   LSCLFSEDVLDA---------ESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDE 340
             LS  +   ++D          E  +  R      ++   K  +  R  +L+  C+Y    
Sbjct: 25217 LS--WEPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKTTF--RIENLQEGCSY---- 25268

Query: 341   GLYMVRVPSPFG---PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPS 397
               + V   + +G   P E +  V V    +E P  PG    V  +DV R+   + W  P 
Sbjct: 25269 -YFRVLASNEYGIGLPAETTEPVKV----SEPPLPPG---RVTLVDVTRNTATIKWEKPE 25320

Query: 398   DTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSV 457
                G+ IT Y +E     S +W  C +    T    I GL  G+ Y FRV A++  G S 
Sbjct: 25321 SDGGSKITGYVVEMQTKGSEKWSTCTQVK--TLEATISGLTAGEEYVFRVAAVNEKGRSD 25378

Query: 458   PSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYV 517
             P +    V+  D +                       + +V +P    NV A E  +  V
Sbjct: 25379 PRQLGVPVIARDIE----------------------IKPSVELPFHTFNVKAREQLKIDV 25416

Query: 518   VLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRA 577
                      R +A + +  +   +   T   +SS   V S   ++ +  K+    + +  
Sbjct: 25417 PF-----KGRPQATVNWRKDGQTLKETTRVNVSSSKTVTS--LSIKEASKEDVGTYELCV 25469

Query: 578   MNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLG----- 632
              N  G    + P   I L  P     PP  ++    +  S++++W+P   PE  G     
Sbjct: 25470 SNSAG--SITVPITIIVLDRPG----PPGPIRIDEVSCDSITISWNP---PEYDGGCQIS 25520

Query: 633   YYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIR 692
              YI  +K  TS    + ++ +  T   +  L TG EY+F  R  +E   G+SS +     
Sbjct: 25521 NYIVEKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQF--RVCAENRYGKSSYSESSAV 25578

Query: 693   VKQALATPSAPYGFA-LLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQ 751
             V +   +P  P G   +++  K+ M++ W+ P   GG +++GY L+  +   + W   N+
Sbjct: 25579 VAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANK 25638

Query: 752   QPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRAS 811
               I     KVS L EG  YE+R  A N AG+G+ S        ++   P PG P     +
Sbjct: 25639 ILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDP-PGQP---EVT 25694

Query: 812   EVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKS 871
              +   S+ L+W  P Y G   +TGY V  +E    +W       I  T+  V++L   + 
Sbjct: 25695 NITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQR 25754

Query: 872   YVFQVQAMNSA-GLGQPSMPTDPVLLED 898
             Y F+V A N+A  + +PS  T P++++D
Sbjct: 25755 YEFRVFARNAADSVSEPSESTGPIIVKD 25782



 Score =  166 bits (421), Expect = 1e-40
 Identities = 157/618 (25%), Positives = 255/618 (41%), Gaps = 79/618 (12%)

Query: 304   IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVR 363
             ++W +   +L    R +I  T     L +    + D G Y + + +  G +     V V 
Sbjct: 25139 VKWEKAEGILTD--RAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVL 25196

Query: 364   DAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIA-C 422
             D+       P +P+N+   +V +D + L+W PP    G  IT Y +E+ +     +    
Sbjct: 25197 DS-------PSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATIT 25249

Query: 423   HEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFD 482
             +     T R  I+ L EG SY FRV A +  G  +P++ +E V + +             
Sbjct: 25250 NNCTKTTFR--IENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEP------------ 25295

Query: 483   LGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVI 541
                               P PP  V   ++      + WE+P     + +T Y +E    
Sbjct: 25296 ------------------PLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTK 25337

Query: 542   GSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRG---- 597
             GS  W   S+ + V++    +  L   + YVFRV A+N+ G SDP +   P+  R     
Sbjct: 25338 GSEKW---STCTQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIK 25394

Query: 598   PPATLP-PPAQVQAFRDTQTSVSLTWDPV------KDPELLGYYIYSRKVGTSEWQTVNN 650
             P   LP     V+A    +  V     P       KD + L     + +V  S  +TV +
Sbjct: 25395 PSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLK---ETTRVNVSSSKTVTS 25451

Query: 651   KPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLN 710
               I+       G      YE CV +        + + T PI +   L  P  P    +  
Sbjct: 25452 LSIKEASKEDVG-----TYELCVSN-------SAGSITVPITI-IVLDRPGPPGPIRIDE 25498

Query: 711   CGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFY 770
                + + I W PP+  GG +I  Y +++ ++    WH V+Q    T + K+  L  G  Y
Sbjct: 25499 VSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSI-KIVRLTTGSEY 25557

Query: 771   EFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGA 830
             +FR  A N  G    S  S++    E+    PGPP   +      +++++ W+ P+  G 
Sbjct: 25558 QFRVCAENRYGKSSYSESSAV--VAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGG 25615

Query: 831   GPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMP 890
               V GYH+ ++E  S  W       I+ T ++VS L  G  Y ++V A N AG+G+ S  
Sbjct: 25616 SRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKS 25675

Query: 891   TDPVLLE---DKPGAHEI 905
              +PV      D PG  E+
Sbjct: 25676 CEPVPARDPCDPPGQPEV 25693



 Score =  165 bits (417), Expect = 3e-40
 Identities = 191/836 (22%), Positives = 318/836 (38%), Gaps = 117/836 (13%)

Query: 177   VQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAH 236
             +   P P + W K D  +        +  I +     SL ++     DS  Y ++ KN  
Sbjct: 22567 IYGKPIPTIQWIKGDQELS----NTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVA 22622

Query: 237   GQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSE 296
             G+ S    V V    G   G            P V      +      K P         
Sbjct: 22623 GERSVTVNVKVLDRPGPPEG------------PVVISGVTAEKCTLAWKPPLQDG---GS 22667

Query: 297   DVLDAESIQWFRDGSLLRSSRRRKILYTDRQA-----SLKVSCTYKEDEGLYMVRVPSPF 351
             D+++           ++      ++++T   A     S KV+   + +E  + +   + +
Sbjct: 22668 DIINY----------IVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEYTFRIMAVNKY 22717

Query: 352   G---PREQSTYVLVRDAEAENPGA-PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAY 407
             G   P E    V      A+NP   P +P       V +D +I+ W  P+   G+ I  Y
Sbjct: 22718 GVGEPLESEPVV------AKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGY 22771

Query: 408   TIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVM 467
              +E+   E   W  CH+   G  R  + GL+E   Y FRV A +  G S PS  S     
Sbjct: 22772 VLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPS----- 22826

Query: 468   GDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPR 527
                  A +K                   D +  P PP N    +I  + V L+W +P   
Sbjct: 22827 -----AYQKAC-----------------DPIYKPGPPNNPKVIDITRSSVFLSWSKPIYD 22864

Query: 528   DRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDP 586
                 +  Y +EK  +  G W   +  + +      V  L +K  Y FR+ A+N+ G+ + 
Sbjct: 22865 GGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEH 22924

Query: 587   SEPSEPIA----LRGPPATLPPPAQVQAFRDTQTSVSLT-WDPVKD---PELLGYYIYSR 638
             ++   PI     L  P   L    +++   + +   SL  + P+K    PE+        
Sbjct: 22925 ADVPGPIIVEEKLEAPDIDLD--LELRKIINIRAGGSLRLFVPIKGRPTPEV-------- 22974

Query: 639   KVGTSEWQTVNNKPIQGTR-FTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQAL 697
             K G  + +  +   I  T  FT   L     Y+    +++      + +A   +RV   L
Sbjct: 22975 KWGKVDGEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRV---L 23031

Query: 698   ATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTR 757
              TPS P    +    K+ + I W+PP   GG KI  Y +++ ++    + AV        
Sbjct: 23032 DTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTN-CHKN 23090

Query: 758   VCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATS 817
               K+  L EG  Y FR  A N  G+G  +  +   +  E     P PP  +   +V   S
Sbjct: 23091 SWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAE----VPQPPGKITVDDVTRNS 23146

Query: 818   LVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQ 877
             + L W  P + G   +  Y V  Q + SE+W       +      +++L  G+ Y+F+V 
Sbjct: 23147 VSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSEC--ARVKSLQAVITNLTQGEEYLFRVV 23204

Query: 878   AMNSAGLGQPSMPTDPVLLED-------KP--GAHEIEVGVDEEGFIYLAFEAP-EAPDS 927
             A+N  G   P     P++ +D       KP   ++ ++VG D      L  E P      
Sbjct: 23205 AVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQD------LKIEVPISGRPK 23258

Query: 928   SEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISAS 983
                 W+KD        R+ + D ++ + + +KE   +D G Y + V +     +AS
Sbjct: 23259 PTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTAS 23314



 Score =  163 bits (413), Expect = 1e-39
 Identities = 152/616 (24%), Positives = 238/616 (38%), Gaps = 78/616 (12%)

Query: 304   IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVR 363
             + WF+DG  +      +I       SL V    ++  G+Y V   +  G  +    V V+
Sbjct: 27990 VTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQ 28049

Query: 364   DAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACH 423
             D     PG    P  +R  ++  + + L W  P +    PIT Y IE+ +     W    
Sbjct: 28050 DT----PGKVVGP--IRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIE 28103

Query: 424   EAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDL 483
             +         I+ L+ G  Y+FRV A+++ G   P  +  +V    +             
Sbjct: 28104 DKCEAQSYTAIK-LINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQY------------- 28149

Query: 484   GNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIG 542
                            T+P  P     S I    + L W  P     + +  Y LE+    
Sbjct: 28150 ---------------TVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKK 28194

Query: 543   SGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATL 602
             S  W  + S+ P+   RF V  L +   Y F V A N  G+   S  S  I  R P    
Sbjct: 28195 STRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPP 28254

Query: 603   PPPAQVQAFRDTQTSVSLTWD-PVKDP--ELLGYYIYSRKVGTSEWQTVNNKPIQGTRFT 659
              PP  V+    ++T+VSL W  PV D   E++GY I   K    +W  VN +    TR+T
Sbjct: 28255 GPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYT 28314

Query: 660   VPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIG 719
             V  L+ G+EY+F V +++ AG G+S   T  I+    L  P         N  +  +V  
Sbjct: 28315 VTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDID---ANFKQTHVV-- 28369

Query: 720   WKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKV--------SDLHEGHFYE 771
                   R G  I  +             A   +P PT V           +D+H    + 
Sbjct: 28370 ------RAGASIRLFI------------AYQGRPTPTAVWSKPDSNLSLRADIHTTDSFS 28411

Query: 772   F-------RARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEP 824
                     R  A  +    E ++ S         +  PGPP  +   +V   S  L W+ 
Sbjct: 28412 TLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDA 28471

Query: 825   PLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGL 884
             PL  G   +  Y V  +E     W+ ++    +    +V+DL  G  Y F+V A+N  G+
Sbjct: 28472 PLLDGGARIHHYVVEKREASRRSWQVISE-KCTRQIFKVNDLAEGVPYYFRVSAVNEYGV 28530

Query: 885   GQPSMPTDPVLLEDKP 900
             G+P    +P++  ++P
Sbjct: 28531 GEPYEMPEPIVATEQP 28546



 Score =  162 bits (409), Expect = 3e-39
 Identities = 184/743 (24%), Positives = 294/743 (39%), Gaps = 109/743 (14%)

Query: 177   VQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLE-IRRCAIEDSATYTVRVKNA 235
             ++  P P+V W K    +D  +  A    +T+++  L L+ + R    DS  YT+ ++N+
Sbjct: 22966 IKGRPTPEVKWGK----VDGEIRDAAIIDVTSSFTSLVLDNVNRY---DSGKYTLTLENS 23018

Query: 236   HGQASSFAKVLVRTYLGKDAGFD-SEIFKRSTF----GPSVEFTSVLKPVFAREKEPFSL 290
              G  S+F  V V            +EI K S       P ++  S +K     ++E    
Sbjct: 23019 SGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRK 23078

Query: 291   SCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSP 350
             S  ++  V +     W  D                    L+  C+Y      + V   + 
Sbjct: 23079 S--YAAVVTNCHKNSWKID-------------------QLQEGCSY-----YFRVTAENE 23112

Query: 351   FG---PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAY 407
             +G   P + +  + V    AE P  PG    +   DV R+ + L+W  P    G+ I  Y
Sbjct: 23113 YGIGLPAQTADPIKV----AEVPQPPGK---ITVDDVTRNSVSLSWTKPEHDGGSKIIQY 23165

Query: 408   TIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSS------VPSKA 461
              +E     S +W  C      + +  I  L +G+ Y FRV A++  G S      VP  A
Sbjct: 23166 IVEMQAKHSEKWSECARVK--SLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVA 23223

Query: 462   SELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAW 521
              +LV+  D   A     +      KI +           P P               + W
Sbjct: 23224 KDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGR------PKP--------------TITW 23263

Query: 522   EEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQY 581
                  +D  PL  +   +V  S     +S           + +  K     + +   N  
Sbjct: 23264 T----KDGLPLKQTTRINVTDSLDLTTLS-----------IKETHKDDGGQYGITVANVV 23308

Query: 582   GLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDP---VKDPELLGYYIYSR 638
             G    S   E + L  P    PP   V+    +  S++L+W+P       ++  Y +  R
Sbjct: 23309 GQKTAS--IEIVTLDKPD---PPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKR 23363

Query: 639   KVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAA-TEPIRVKQAL 697
                T+ W  V+   +  T   V  L+TG EY+F  R  +E   G+S A  ++PI  +   
Sbjct: 23364 DTTTTVWDVVS-ATVARTTLKVTKLKTGTEYQF--RIFAENRYGQSFALESDPIVAQYPY 23420

Query: 698   ATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTR 757
               P  P         K+ MVI W  P   GG  ++GY L++ +   + W  VN+  I   
Sbjct: 23421 KEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDT 23480

Query: 758   VCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATS 817
               K  +L EG  YEFR  A N  GVG+ S  S  +  ++   P PG P  +    V+   
Sbjct: 23481 QFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDP-PGTPEPIM---VKRNE 23536

Query: 818   LVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQ 877
             + LQW  P+Y G   +TGY V  ++    +W   +   +  T   VS L   + Y F+V 
Sbjct: 23537 ITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVI 23596

Query: 878   AMNSAG-LGQPSMPTDPVLLEDK 899
             A N+AG + +PS  T P+  +D+
Sbjct: 23597 AKNAAGAISKPSDSTGPITAKDE 23619



 Score =  162 bits (409), Expect = 3e-39
 Identities = 170/699 (24%), Positives = 266/699 (38%), Gaps = 134/699 (19%)

Query: 173   LTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRV 232
             L  +V   PPP +TW K    +  R         T +Y LL ++  +    D+  YT+  
Sbjct: 29466 LMVSVSGRPPPVITWSKQGIDLASRAI----IDTTESYSLLIVD--KVNRYDAGKYTIEA 29519

Query: 233   KNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSC 292
             +N  G+ S  A VLV+ Y               T GP          V  +E    S++ 
Sbjct: 29520 ENQSGKKS--ATVLVKVY--------------DTPGPCPS-------VKVKEVSRDSVTI 29556

Query: 293   LFSEDVLDAESIQWFRDGSLLRS---SRRRKILYTDRQASLKVSCTYKEDEGL-----YM 344
              +    +D         G+ + +    +R   +   +  + K S T     GL     Y 
Sbjct: 29557 TWEIPTIDG--------GAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYY 29608

Query: 345   VRV--PSPFG---PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDT 399
              RV   + +G   P E S  VLV +        P  P  +  +DV +  + L W  P   
Sbjct: 29609 FRVLPENIYGIGEPCETSDAVLVSEV-------PLVPAKLEVVDVTKSTVTLAWEKPLYD 29661

Query: 400   RGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPS 459
              G+ +T Y +E C+  +  W+             +  L EG+ Y FR+RA +  G S P 
Sbjct: 29662 GGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPR 29721

Query: 460   KASELVVMGD-----------------HDAARRKTEIPFDLGN----------------- 485
             +    V + D                 H  A R  E+   +                   
Sbjct: 29722 ETVTAVTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRE 29781

Query: 486   -------------KITISTDAFEDT--------------------VTIPSP--PTN-VHA 509
                          K+TI      DT                    + +  P  PT  +  
Sbjct: 29782 SERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKI 29841

Query: 510   SEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKK 568
              EI    + ++WE P     APL+ Y +E+       W  + SES  RS  F    L + 
Sbjct: 29842 DEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPV-SESVTRS-TFKFTRLTEG 29899

Query: 569   KSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKD- 627
               YVFRV A N++G+    + SE I  R       PP  +Q F  ++  ++LTW P +D 
Sbjct: 29900 NEYVFRVAATNRFGIGSYLQ-SEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDD 29958

Query: 628   --PELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESS 685
                ++ GY +  ++V    W  VN  P+  TR+   GL  G EYE  V +++  G G+ S
Sbjct: 29959 GGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPS 30018

Query: 686   AATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELD 745
               ++PI     +A P  P    + +  +  + + W  P+  GG K+ GY ++    ++ +
Sbjct: 30019 RPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHE 30078

Query: 746   WHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGE 784
             W   N  P   R   ++ L +G  Y FR  A N  G GE
Sbjct: 30079 WTKCNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGE 30117



 Score =  161 bits (407), Expect = 5e-39
 Identities = 189/778 (24%), Positives = 304/778 (39%), Gaps = 109/778 (14%)

Query: 181   PPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQAS 240
             P P VTW+K++  +  +  R       NN     L I+    ED   Y V++ N+ G+A 
Sbjct: 22175 PTPAVTWHKDNVPLK-QTTRVNAESTENNS---LLTIKDACREDVGHYVVKLTNSAGEAI 22230

Query: 241   SFAKVLVRTYLGKDAG------FDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLF 294
                 V+V    G   G        ++    S   P  +  S +      ++         
Sbjct: 22231 ETLNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKR--------- 22281

Query: 295   SEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPR 354
                  D  +  W     ++ ++  R    T +   LK  C Y+     + +   + +G  
Sbjct: 22282 -----DTSTTTW----QIVSATVART---TIKACRLKTGCEYQ-----FRIAAENRYG-- 22322

Query: 355   EQSTYVLVRDAEAENP----GAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIE 410
              +STY+      A+ P    G PG+P+       +RD + + W  P    G+ +  Y +E
Sbjct: 22323 -KSTYLNSEPTVAQYPFKVPGPPGTPVVTLS---SRDSMEVQWNEPISDGGSRVIGYHLE 22378

Query: 411   RCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDH 470
             R +  S  W+  ++ P    +    GL EG  Y FRV A + VG   PSK SE  V  D 
Sbjct: 22379 RKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARD- 22437

Query: 471   DAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRA 530
                      P D                    PP    A  +    V L W++P+    +
Sbjct: 22438 ---------PCD--------------------PPGRPEAIIVTRNSVTLQWKKPTYDGGS 22468

Query: 531   PLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGL-SDPSE 588
              +T Y +EK  +  G W   +S + +    F V  L +   Y FRV A N  G+ S+PSE
Sbjct: 22469 KITGYIVEKKELPEGRWMK-ASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSE 22527

Query: 589   PSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEW--- 645
              +  I  R     + PP      +   T V    +  K    +   IY + + T +W   
Sbjct: 22528 STGAITARD---EVDPPRISMDPKYKDTIVVHAGESFK----VDADIYGKPIPTIQWIKG 22580

Query: 646   -QTVNNK---PIQGTRF-TVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATP 700
              Q ++N     I+ T F T   ++     +     +    V    + T  ++V      P
Sbjct: 22581 DQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPP 22640

Query: 701   SAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCK 760
               P   + +   K    + WKPP + GG  I+ Y +++ ++  L W  V+   + T  CK
Sbjct: 22641 EGPVVISGVTAEK--CTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDAN-VQTLSCK 22697

Query: 761   VSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVL 820
             V+ L EG+ Y FR  A N  GVGE      +     + +P    P     + V   S+++
Sbjct: 22698 VTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPD--APKAPEVTTVTKDSMIV 22755

Query: 821   QWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMN 880
              WE P   G   + GY +  +++   +W       I    LRV+ L     Y F+V A N
Sbjct: 22756 VWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAEN 22815

Query: 881   SAGLGQPSMPT------DPVLLEDKPGAHEIEVGVD-EEGFIYLAFEAPEAPDSSEFQ 931
             +AGL +PS P+      DP+    KPG       +D     ++L++  P      E Q
Sbjct: 22816 AAGLSEPSPPSAYQKACDPIY---KPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQ 22870



 Score =  158 bits (399), Expect = 4e-38
 Identities = 183/779 (23%), Positives = 309/779 (39%), Gaps = 91/779 (11%)

Query: 327   QASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNR 386
             ++ L+V  + + D GLYM++V +  G  +    V V D        PG P+N    D+ +
Sbjct: 14763 ESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDT-------PGPPINFVFEDIRK 14815

Query: 387   DCLILTWAPPSDTRGNPITAYTIERCQGES--GEWIACHEAPGGTCRCPIQGLVEGQSYR 444
               ++  W PP D  G+ I  YT+E+        EWI         C+  +  L+EG+ Y 
Sbjct: 14816 TSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRH-CKYSVTKLIEGKEYL 14874

Query: 445   FRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPP 504
             FRVRA +R G   P  +  LV                             +D    P  P
Sbjct: 14875 FRVRAENRFGPGPPCVSKPLVA----------------------------KDPFGPPDAP 14906

Query: 505   TNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLD 564
                   ++    +++ W EP       L Y LEK  + S  W  ++ +S + + +  V  
Sbjct: 14907 DKPIVEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVN-KSLLNALKANVDG 14965

Query: 565   LEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQ-TSVSLTWD 623
             L +  +YVFRV A N  G    S PS+P     P +  PP   +    DT  T++ L W+
Sbjct: 14966 LLEGLTYVFRVCAENAAGPGKFSPPSDPKTAHDPIS--PPGPPIPRVTDTSSTTIELEWE 15023

Query: 624   PVK---DPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAG 680
             P       E++GY++  + VGT+EW     K I+  ++TV  +R G +Y+  V +V+ AG
Sbjct: 15024 PPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAG 15083

Query: 681   VGESSAATEPIRVKQALATPSAPYGFAL-----LNCGKN---EMVIGWKPPKRRGGGKIL 732
              G     T+P+ V +    P+     ++     +  GK      V+  +P   +   K  
Sbjct: 15084 EGPPGE-TQPVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEE 15142

Query: 733   GYFLDQHDSEELDWHAVNQQPIPTRV-CKVSDLHEGHFYEFRARAANWAGVGELSAPSSL 791
             G         ELD   V    + T+    + D        +   A N  G    +A   +
Sbjct: 15143 G---------ELDKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEV 15193

Query: 792   FECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPV 851
             F+        PGP  D++         +L W  P   G   +TG+ +  ++     W+  
Sbjct: 15194 FDV-------PGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQ- 15245

Query: 852   TPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGA----HEIEV 907
              P     +   ++ L  G+ Y F+V A N  G G P +   P+L  D  G       +  
Sbjct: 15246 -PIETERSKCDITGLLEGQEYKFRVIAKNKFGCGPP-VEIGPILAVDPLGPPTSPERLTY 15303

Query: 908   GVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLD-PQRVKIEDKVNKSKVILKEPGLEDL 966
                 +  I L ++ P +   S  Q     K   D P   ++  ++  +   L E  L++ 
Sbjct: 15304 TERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVE-NLDEH 15362

Query: 967   GTYSVIVTDADE------DISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERG 1020
               Y   V   +E       +  +  + ++E+    KL   +R   IK+ +G  + I    
Sbjct: 15363 QMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHI--PA 15420

Query: 1021  EVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYT 1079
             +V   L + K+  +    +I    +       +++  R +   E+ I     EDKG+YT
Sbjct: 15421 DVT-GLPMPKIEWSKNETVIEKPTDALQITKEEVS--RSEAKTELSIPKAVREDKGTYT 15476



 Score =  157 bits (398), Expect = 5e-38
 Identities = 167/617 (27%), Positives = 247/617 (40%), Gaps = 70/617 (11%)

Query: 300   DAESIQW---FRDGSL------LRSSRRRKILYTDRQASLKVSCTYKED---EGL-YMVR 346
             +A SI+W   + DG        +    R  IL+        + C YK     EGL Y  R
Sbjct: 28855 NAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFR 28914

Query: 347   VPSPFGPREQSTYVLVRDAEAENP-GAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPIT 405
               +             R   A+NP  APG P      DV R  + L W+ P+   G+ + 
Sbjct: 28915 TYALNAAGVSKASEASRPIMAQNPVDAPGRP---EVTDVTRSTVSLIWSAPAYDGGSKVV 28971

Query: 406   AYTIER---CQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKAS 462
              Y IER    +   G W+ C+          +  L EG +Y FRV A +  G  V SK S
Sbjct: 28972 GYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAG--VISKGS 29029

Query: 463   ELV--VMGDHDAARRKTEIPFDL-GNKITI--STDAFEDTVTIPSPPTNVHASEIREAYV 517
             E    V    + A  K E+   L G+ +TI   +D   D      P   +          
Sbjct: 29030 ESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKI---------- 29079

Query: 518   VLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRA 577
                W +                       E +S +   +     +   ++  S  + +  
Sbjct: 29080 --IWTKGDKE---------------LDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTV 29122

Query: 578   MNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWD-PVKD--PELLGYY 634
              N  G    S   + +   GP   L         R TQ   +L W  P +D   E+  Y 
Sbjct: 29123 KNASGTKAVSVMVKVLDSPGPCGKLT------VSRVTQEKCTLAWSLPQEDGGAEITHYI 29176

Query: 635   IYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVK 694
             +  R+     W  V  +      + V  L    EY F VR+V++ G G     +EPI  +
Sbjct: 29177 VERRETSRLNWVIVEGE-CPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVP-VESEPIVAR 29234

Query: 695   QALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPI 754
              +   PS P     +  GK  ++I W  P+  GG +I  Y +D+ + + L W  VN+  +
Sbjct: 29235 NSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYV 29294

Query: 755   --PTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASE 812
                TR+ KV+ L EG  Y+FR  A N AG  E S  S+   C+E +   PGPP   R  +
Sbjct: 29295 VYDTRL-KVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYT-PGPPSAPRVVD 29352

Query: 813   VRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPV-TPGPISGTHLRVSDLQPGKS 871
                 S+ L W  P+Y G   + GY +  QE+ ++QW  V T   I  T   V DL+ G+ 
Sbjct: 29353 TTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQK 29412

Query: 872   YVFQVQAMNSAGLGQPS 888
             Y F+V A+N  G+ + S
Sbjct: 29413 YSFRVAAVNVKGMSEYS 29429



 Score =  156 bits (395), Expect = 1e-37
 Identities = 147/576 (25%), Positives = 232/576 (40%), Gaps = 75/576 (13%)

Query: 337   KEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPP 396
             + D G Y++++ +  G +     V V D        PG P N+   +V +D   L W PP
Sbjct: 24087 RNDAGKYILKLENSSGSKSAFVTVKVLDT-------PGPPQNLAVKEVRKDSAFLVWEPP 24139

Query: 397   SDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSS 456
                 G  +  Y I++ +     +         T    ++ L EG  Y FRV A +  G  
Sbjct: 24140 IIDGGAKVKNYVIDKRESTRKAYANVSSKCSKT-SFKVENLTEGAIYYFRVMAENEFGVG 24198

Query: 457   VPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAY 516
             VP +  + V   +                               PSPP  V  +++ +  
Sbjct: 24199 VPVETVDAVKAAEP------------------------------PSPPGKVTLTDVSQTS 24228

Query: 517   VVLAWEEPS-PRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRV 575
               L WE+P        L Y +E    G+  W +I +ES V +    V  L   + Y FRV
Sbjct: 24229 ASLMWEKPEHDGGSRVLGYVVEMQPKGTEKW-SIVAESKVCNA--VVTGLSSGQEYQFRV 24285

Query: 576   RAMNQYGLSDPSEPSEPIALRG----PPATLP-PPAQVQAFRDTQTSVSLTWDP------ 624
             +A N+ G SDP     P+  +     P   LP     +QA  D +  + +   P      
Sbjct: 24286 KAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISW 24345

Query: 625   VKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGES 684
             VKD E L              QT      +    TV  ++ G + +F   +V+      +
Sbjct: 24346 VKDGEPLK-------------QTTRVNVEETATSTVLHIKEGNKDDFGKYTVT--ATNSA 24390

Query: 685   SAATEPIRVKQALATPSAPYGFALLN-CGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEE 743
               ATE + V   L  P  P G    +    + +VI W+PP   GG +I  Y +++ D+  
Sbjct: 24391 GTATENLSV-IVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTT 24449

Query: 744   LDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAP-SSLFECKEWTMPQP 802
               WH V+     T + K++ L  G  Y+FR  A N  G    SAP  S     ++   +P
Sbjct: 24450 TTWHMVSATVARTTI-KITKLKTGTEYQFRIFAENRYG---KSAPLDSKAVIVQYPFKEP 24505

Query: 803   GPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLR 862
             GPP     + +    +++QW  P+  G   + GYH+  +E+ S  W  +   PI  T  +
Sbjct: 24506 GPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFK 24565

Query: 863   VSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED 898
              + L  G  Y F+V A N  G+G+PS  ++  +  D
Sbjct: 24566 TTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARD 24601



 Score =  155 bits (393), Expect = 2e-37
 Identities = 190/829 (22%), Positives = 307/829 (37%), Gaps = 96/829 (11%)

Query: 169   TTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRI-TNNYGLLSLEIRRCAIEDSAT 227
             TTV     ++  P P   W  + + I         Y + T+N+  + L I+ C   D+  
Sbjct: 17526 TTVRFPAIIRGVPVPTAKWTTDGSEIKTD----EHYTVETDNFSSV-LTIKNCLRRDTGE 17580

Query: 228   YTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEP 287
             Y + V NA G  +    + V    G   G                      P+   +  P
Sbjct: 17581 YQITVSNAAGSKTVAVHLTVLDVPGPPTG----------------------PINILDVTP 17618

Query: 288   FSLSCLFSEDVLDAES--IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMV 345
               ++  +     D  S  I +  +    R      +     +  LK+    K  E ++ V
Sbjct: 17619 EHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRV 17678

Query: 346   RVPSPFG--PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNP 403
             R  +  G  P   ST  + +  +   P  PG P+     D+  +   ++W  P    G+P
Sbjct: 17679 RAENKIGVGPPLDSTPTVAKH-KFSPPSPPGKPV---VTDITENAATVSWTLPKSDGGSP 17734

Query: 404   ITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASE 463
             IT Y +ER +  +G+W+  ++ P    +  + GL EG +Y FRV A +  G S PS +S+
Sbjct: 17735 ITGYYMERRE-VTGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSD 17793

Query: 464   LVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEE 523
              +      A R                       +  P PP N    +       L W +
Sbjct: 17794 PI-----KACR----------------------PIKPPGPPINPKLKDKSRETADLVWTK 17826

Query: 524   PSPRDRAP-LTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYG 582
             P     +P L Y +E    G+  W  I+ +  +R   F V  L +   Y FR++A N  G
Sbjct: 17827 PLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVG 17886

Query: 583   LSDPSEPSEPIALRGPPATLPPPAQVQAF-RDTQT-----SVSLTWDPVKDPELLGYYIY 636
               +P E +E +  +      PP  ++    RD  T     ++ +       PE    +  
Sbjct: 17887 EGEPRELAESVIAKD--ILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTK 17944

Query: 637   SRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQA 696
               KV   E +    + +      +         ++ + + + +G  + SA      +   
Sbjct: 17945 EGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSA------IVNV 17998

Query: 697   LATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPT 756
             L  P       + N  K    I W+ P   GG +I  + ++     +  W  V    +  
Sbjct: 17999 LDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASD-VTK 18057

Query: 757   RVCKVSDLHEGHFYEFRARAANWAGVG---ELSAPSSLFECKEWTMPQPGPPYDVRASEV 813
             R+ K + L    +Y FR  A N  GVG   E   P          + +PG P ++  ++ 
Sbjct: 18058 RLIKANLLANNEYY-FRVCAENKVGVGPTIETKTPILAIN----PIDRPGEPENLHIADK 18112

Query: 814   RATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYV 873
               T + L+W  P Y G  P   YHV  + +GS+ W+ V  G I  TH  V      + Y 
Sbjct: 18113 GKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYE 18172

Query: 874   FQVQAMNSAGLGQPSMPTDPVLLED--KPGAHEIEVGV--DEEGFIYLAFEAPEAPDSSE 929
             F+VQ  N  G        + V+ ED  KP       GV   + G               E
Sbjct: 18173 FRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPE 18232

Query: 930   FQWSKDYKGPLD---PQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTD 975
               W+KD K   D     RVKI+ + + SK  L +    D G Y V  T+
Sbjct: 18233 VAWTKD-KDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATN 18280



 Score =  155 bits (393), Expect = 2e-37
 Identities = 194/833 (23%), Positives = 328/833 (39%), Gaps = 89/833 (10%)

Query: 161   RSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRC 220
             ++H V    ++ L    Q  P P   W K D+ +  R         T+++  L++E   C
Sbjct: 28365 QTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLR----ADIHTTDSFSTLTVE--NC 28418

Query: 221   AIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPV 280
                D+  YT+ V+N  G  S    V V                  T GP         P+
Sbjct: 28419 NRNDAGKYTLTVENNSGSKSITFTVKV----------------LDTPGPP-------GPI 28455

Query: 281   FAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDR--QASLKVSCTYKE 338
               ++    S + ++   +LD  +           +SRR   + +++  +   KV+   + 
Sbjct: 28456 TFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISEKCTRQIFKVNDLAEG 28515

Query: 339   DEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSD 398
                 + V   + +G  E   Y +     A    AP   L+V  +D ++   +L W  P  
Sbjct: 28516 VPYYFRVSAVNEYGVGE--PYEMPEPIVATEQPAPPRRLDV--VDTSKSSAVLAWLKPDH 28571

Query: 399   TRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVP 458
               G+ IT Y +E  Q  S  W+        T    ++ LVE   Y FRV+A +  G S P
Sbjct: 28572 DGGSRITGYLLEMRQKGSDFWVEAGHTKQLT--FTVERLVEKTEYEFRVKAKNDAGYSEP 28629

Query: 459   SKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVV 518
              +A   V++ +       T     + N++         T+ +P                 
Sbjct: 28630 REAFSSVIIKEPQI--EPTADLTGITNQLITCKAGSPFTIDVPI---------------- 28671

Query: 519   LAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAM 578
                   S R    +T+ LE+  +     + +S  +        V D  +  S  + +   
Sbjct: 28672 ------SGRPAPKVTWKLEEMRLKE--TDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLE 28723

Query: 579   NQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKD---PELLGYYI 635
             N  G+      S  + + G P  +  P +V +   +  S  L+W   KD    E+  Y +
Sbjct: 28724 NTAGV---KTFSVTVVVIGRPGPVTGPIEVSSV--SAESCVLSWGEPKDGGGTEITNYIV 28778

Query: 636   YSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQ 695
               R+ GT+ WQ VN+  ++ T+  V  L    EY F V S +  GV +    + PI  + 
Sbjct: 28779 EKRESGTTAWQLVNSS-VKRTQIKVTHLTKYMEYSFRVSSENRFGVSK-PLESAPIIAEH 28836

Query: 696   ALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIP 755
                 PSAP    + +   N M I W+ P   GG KI+GY++++ +   + W   N+ P  
Sbjct: 28837 PFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCL 28896

Query: 756   TRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRA 815
                 KV+ L EG  Y+FR  A N AGV + S  S     +   +  PG P     ++V  
Sbjct: 28897 ECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQN-PVDAPGRP---EVTDVTR 28952

Query: 816   TSLVLQWEPPLYMGAGPVTGYHVS---FQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSY 872
             +++ L W  P Y G   V GY +      E G  +W       +S     V+ L  G +Y
Sbjct: 28953 STVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTY 29012

Query: 873   VFQVQAMNSAG-LGQPSMPTDPVLLEDK--PGAHEIEVGVDEE------GFIYLAFEAPE 923
              F+V A N+AG + + S  T PV   D+  P   E++  +  +      G   +   A  
Sbjct: 29013 EFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVG 29072

Query: 924   APDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDA 976
                  +  W+K  K     ++V ++    ++  ++K     D G Y++ V +A
Sbjct: 29073 GKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNA 29125



 Score =  153 bits (387), Expect = 1e-36
 Identities = 148/599 (24%), Positives = 246/599 (41%), Gaps = 80/599 (13%)

Query: 324   TDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLD 383
             T    SL +    + D G Y + + +  G +  S +V VR  +  +P     P+N++  +
Sbjct: 22992 TSSFTSLVLDNVNRYDSGKYTLTLENSSGTK--SAFVTVRVLDTPSP-----PVNLKVTE 23044

Query: 384   VNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIA----CHEAPGGTCRCPIQGLVE 439
             + +D + +TW PP    G+ I  Y +E+ +     + A    CH+         I  L E
Sbjct: 23045 ITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKN-----SWKIDQLQE 23099

Query: 440   GQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVT 499
             G SY FRV A +  G  +P++ ++ + + +                              
Sbjct: 23100 GCSYYFRVTAENEYGIGLPAQTADPIKVAE------------------------------ 23129

Query: 500   IPSPPTNVHASEIREAYVVLAWEEPSPRDRAP-LTYSLEKSVIGSGTWEAISSESPVRSP 558
             +P PP  +   ++    V L+W +P     +  + Y +E     S  W   S  + V+S 
Sbjct: 23130 VPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKW---SECARVKSL 23186

Query: 559   RFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRG---PPATLP--PPAQVQAFRD 613
             +  + +L + + Y+FRV A+N+ G SDP   + PI  +     P   P      VQ  +D
Sbjct: 23187 QAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQD 23246

Query: 614   TQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLR-----TGKE 668
              +  V ++  P          I   K G    QT           T   ++      G +
Sbjct: 23247 LKIEVPISGRPKPT-------ITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQ 23299

Query: 669   YEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGG 728
             Y   V +V    VG+ +A+ E + + +    P  P  F   +     + + W PP   GG
Sbjct: 23300 YGITVANV----VGQKTASIEIVTLDKP-DPPKGPVKFD--DVSAESITLSWNPPLYTGG 23352

Query: 729   GKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAP 788
              +I  Y + + D+    W  V+     T + KV+ L  G  Y+FR  A N    G+  A 
Sbjct: 23353 CQITNYIVQKRDTTTTVWDVVSATVARTTL-KVTKLKTGTEYQFRIFAEN--RYGQSFAL 23409

Query: 789   SSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQW 848
              S     ++   +PGPP    A+ +   S+V+QW  P+  G  PV GYH+  +E  S  W
Sbjct: 23410 ESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILW 23469

Query: 849   KPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLE---DKPGAHE 904
               V    I  T  +  +L+ G  Y F+V A N  G+G+ S  ++  +     D PG  E
Sbjct: 23470 TKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPE 23528



 Score =  152 bits (385), Expect = 2e-36
 Identities = 157/622 (25%), Positives = 251/622 (40%), Gaps = 76/622 (12%)

Query: 290   LSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPS 349
             L+ +   D       +WF++   L +   + I  T  Q S ++    K D+G Y + + +
Sbjct: 13017 LTMVVPYDAYPKAEAEWFKENEPLST---KTIDTTAEQTSFRILEAKKGDKGRYKIVLQN 13073

Query: 350   PFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTI 409
               G  E    + V D        PG   N+   +     + L W  P    G+ I  Y +
Sbjct: 13074 KHGKAEGFINLKVIDV-------PGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVV 13126

Query: 410   ERCQGESGEWIACHEAPGGTCRCPIQGLVEGQ-SYRFRVRAISRVGSSVPSKASELVVMG 468
             ER   +   W+   +    +C   + GL +G   Y FRV A +RVG+  P +    V   
Sbjct: 13127 ERRDIKRKTWVLATDR-AESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPV--- 13182

Query: 469   DHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRD 528
                 AR K ++P                      PP NV  +++    V L WE P    
Sbjct: 13183 ---EARSKYDVP---------------------GPPLNVTITDVNRFGVSLTWEPPEYDG 13218

Query: 529   RAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFA--VLDLEKKKSYVFRVRAMNQYGLSD 585
              A +T Y +E     S  W+   +   VR+   +  V D+ + + Y FRVRA N+ G+  
Sbjct: 13219 GAEITNYVIELRDKTSIRWDTAMT---VRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGK 13275

Query: 586   PSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDP-VKD--PELLGYYIYSRKVGT 642
             PS  +  + +  P     PP  + +   TQ+SV L W+P +KD    +LGY I   + G 
Sbjct: 13276 PSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGK 13335

Query: 643   SEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPS- 701
               W   N K +    + V GL  G +Y + V + ++AGV + S    P+    A   P+ 
Sbjct: 13336 DNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTM 13395

Query: 702   --APYGFALLNCGKNEMVI-----GWKPPKRRG--GGKILGYFLDQHDSEELDWHAVNQQ 752
               + +   L     N + I     G+  P      G K+L    D+   + L  +A    
Sbjct: 13396 DLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETG-DRVKMKTLSAYA---- 13450

Query: 753   PIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASE 812
                  V   S+  +   Y  +         GE+             + +P  P +++  +
Sbjct: 13451 ---ELVISPSERSDKGIYTLKLENRVKTISGEIDVN---------VIARPSAPKELKFGD 13498

Query: 813   VRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSY 872
             +   S+ L WEPP   G  P+TGY V  +E   + W  V    ++     V DL  GK Y
Sbjct: 13499 ITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDF-VTDLEFTVPDLVQGKEY 13557

Query: 873   VFQVQAMNSAGLGQPSMPTDPV 894
             +F+V A N  G G+P+   +PV
Sbjct: 13558 LFKVCARNKCGPGEPAYVDEPV 13579



 Score =  151 bits (381), Expect = 5e-36
 Identities = 151/610 (24%), Positives = 237/610 (38%), Gaps = 73/610 (11%)

Query: 301   AESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYV 360
             A  ++W RD     S  +  I  T     L V    + D G Y++ V +  G +     V
Sbjct: 21889 APEVKWARDHG--ESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNV 21946

Query: 361   LVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWI 420
              V D        PG P +++  +V +  + LTW PP    G+ I  Y +E+ +     + 
Sbjct: 21947 RVLDT-------PGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYS 21999

Query: 421   A----CHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRK 476
                  CH+         +  L EG SY FRV A +  G  +P++ +E V   +       
Sbjct: 22000 TVATNCHKT-----SWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASER------ 22048

Query: 477   TEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAP-LTYS 535
                                     P PP  +   ++    V L+WE+P     +  L Y 
Sbjct: 22049 ------------------------PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYI 22084

Query: 536   LEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIAL 595
             +E    GS  W   ++   V+     +  L + + Y FRV A N+ G+SDP + S P+  
Sbjct: 22085 VEMQTKGSDKWATCAT---VKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIA 22141

Query: 596   RGPPATLPPPAQVQAFRDTQTSVSLTWDPVK-DPELLGYYIYSRKVGTSEWQTVNNKPIQ 654
             +     + PPA    F    T   L  + +K D   +G     R      W   N    Q
Sbjct: 22142 KD---LVIPPAFKLLF---NTFTVLAGEDLKVDVPFIG-----RPTPAVTWHKDNVPLKQ 22190

Query: 655   GTRFTVPGLRTGKEY---EFCVRSVSEAGVGESSAATEPIRVKQ--ALATPSAPYGFALL 709
              TR               + C   V    V  +++A E I       L  P  P G   +
Sbjct: 22191 TTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKM 22250

Query: 710   N-CGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGH 768
             +    + + + W PPK  GG  I  Y +++ D+    W  V+     T + K   L  G 
Sbjct: 22251 DEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTI-KACRLKTGC 22309

Query: 769   FYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYM 828
              Y+FR  A N    G+ +  +S     ++    PGPP     +     S+ +QW  P+  
Sbjct: 22310 EYQFRIAAEN--RYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPISD 22367

Query: 829   GAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPS 888
             G   V GYH+  +E  S  W  +   PI  T  + + L+ G  Y F+V A N  G+G+PS
Sbjct: 22368 GGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPS 22427

Query: 889   MPTDPVLLED 898
               ++  +  D
Sbjct: 22428 KVSECYVARD 22437



 Score =  148 bits (374), Expect = 3e-35
 Identities = 138/607 (22%), Positives = 241/607 (39%), Gaps = 76/607 (12%)

Query: 317   RRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSP 376
             R+ ++   D  A L +  + ++D G Y + + +P G  E++ +V VR  +      PG  
Sbjct: 18650 RKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAG--EKAVFVNVRVLDT-----PGPV 18702

Query: 377   LNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQG 436
              +++  DV +    ++WAPP +  G+ +T Y +E+ + +   W         T    +  
Sbjct: 18703 SDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVKKTS-FHVTN 18761

Query: 437   LVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFED 496
             LV G  Y FRV A++  G  VP                  T++P     K  +++D   +
Sbjct: 18762 LVPGNEYYFRVTAVNEYGPGVP------------------TDVP-----KPVLASDPLSE 18798

Query: 497   TVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVR 556
                 P PP  +  +E+ +    LAW  P     A +   +          +  +  S V+
Sbjct: 18799 ----PDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYSVVK 18854

Query: 557   SPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIA----LRGPPATLPPPAQVQAFR 612
                  V  L++ K Y FRV A N  G+S P E          L  P   +P    ++A +
Sbjct: 18855 DLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQITIKAGK 18914

Query: 613   DTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFC 672
               +                  ++Y +   T +W+   ++ +  +   V   +        
Sbjct: 18915 KLRIEA---------------HVYGKPHPTCKWKKGEDEVVTSSHLAVH--KADSSSILI 18957

Query: 673   VRSVSEAGVG------ESSAATEPIRVK----QALATPSAPYGFALLNCGKNEMVIGWKP 722
             ++ V+    G      E+S+ T+  ++K     A   P  P+  + ++   +   + W  
Sbjct: 18958 IKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDA--DACSLSWHI 19015

Query: 723   PKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGV 782
             P   GG  I  Y +++ D    DW         T  C+V  L  G  Y FR RA N  G+
Sbjct: 19016 PLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTS-CRVGKLIPGQEYIFRVRAENRFGI 19074

Query: 783   GE-LSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQ 841
              E L++P  +    ++    P  P + R ++V    + + W+ P   G  P+ GY +  +
Sbjct: 19075 SEPLTSPKMV---AQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERK 19131

Query: 842   EEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLE---D 898
             E  S  W       +  T    + L  G  Y F++ A+N AG   PS PT+ V      D
Sbjct: 19132 ERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVD 19191

Query: 899   KPGAHEI 905
              PG  E+
Sbjct: 19192 PPGKPEV 19198



 Score =  147 bits (371), Expect = 7e-35
 Identities = 168/753 (22%), Positives = 287/753 (38%), Gaps = 116/753 (15%)

Query: 159   PLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRI--DPRL-FRAGKYRITNNYGLLSL 215
             PL+     E  +V   C V       + W KN   +  D R+ +R  KY+         L
Sbjct: 12739 PLKDIETMEKKSVTFWCKVNRLNVT-LKWTKNGEEVPFDNRVSYRVDKYKHM-------L 12790

Query: 216   EIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTS 275
              I+ C   D   Y V      GQ  S A++L+                        EF  
Sbjct: 12791 TIKDCGFPDEGEYIVTA----GQDKSVAELLI-------------------IEAPTEFVE 12827

Query: 276   VLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCT 335
              L+     E +    SC  S +     +++W+R+G  ++  ++ K         L +   
Sbjct: 12828 HLEDQTVTEFDDAVFSCQLSRE---KANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDC 12884

Query: 336   YKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDV------NRDCL 389
               +DE  Y   V      R+    + V +   E    P   L     DV      N+D +
Sbjct: 12885 RLDDECEYACGVED----RKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKV 12940

Query: 390   ILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRA 449
              + W      R N +        QG+  + ++                 EG+ +R ++  
Sbjct: 12941 EVQWL-----RNNMVVV------QGDKHQMMS-----------------EGKIHRLQICD 12972

Query: 450   ISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHA 509
             I       P    E   +     AR K E    L     I T   +  V +  P T V  
Sbjct: 12973 IK------PRDQGEYRFIAKDKEARAKLE----LAAAPKIKTADQDLVVDVGKPLTMVVP 13022

Query: 510   SEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKK 569
              +   AY            +A   +  E   + + T +  + ++      F +L+ +K  
Sbjct: 13023 YD---AY-----------PKAEAEWFKENEPLSTKTIDTTAEQTS-----FRILEAKKGD 13063

Query: 570   SYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWD-PVKD- 627
                +++   N++G ++     + I + GP   L      +        VSL W+ P+ D 
Sbjct: 13064 KGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNL------EVTETFDGEVSLAWEEPLTDG 13117

Query: 628   -PELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGK-EYEFCVRSVSEAGVGESS 685
               +++GY +  R +    W    ++  +   FTV GL+ G  EY F V + +  G GE  
Sbjct: 13118 GSKIIGYVVERRDIKRKTWVLATDRA-ESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPV 13176

Query: 686   AATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELD 745
                 P+  +     P  P    + +  +  + + W+PP+  GG +I  Y ++  D   + 
Sbjct: 13177 ETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIR 13236

Query: 746   WHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPP 805
             W              V+D+ EG  Y FR RA N  GVG+ SA +   +  +  + +P PP
Sbjct: 13237 WDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVAD-PIERPSPP 13295

Query: 806   YDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSD 865
              ++ +S+   +S+ L+WEPPL  G  P+ GY +   EEG + W       +     +V+ 
Sbjct: 13296 VNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTG 13355

Query: 866   LQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED 898
             L+ G  Y+++V A N AG+  PS    P+  +D
Sbjct: 13356 LEKGNKYLYRVSAENKAGVSDPSEILGPLTADD 13388



 Score =  145 bits (365), Expect = 4e-34
 Identities = 186/848 (21%), Positives = 322/848 (37%), Gaps = 115/848 (13%)

Query: 165   VWEHTTVLLTCTVQASPPPQVTWYKNDTRI----DPRLF--RAGKYRITNNYGLLSLEIR 218
             V E T V +   ++  P P +TW+K   +     +P L+     K  + +   L+  + R
Sbjct: 16128 VEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSR 16187

Query: 219   RCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLK 278
             R    D+  YT+   N  G AS   ++ V    G   G              ++F SV  
Sbjct: 16188 R---SDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVG-------------PIKFESV-- 16229

Query: 279   PVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTY-- 336
                    +  +LS    +D   ++   +  +    R + R+  ++   +      CTY  
Sbjct: 16230 -----SADQMTLSWFPPKDDGGSKITNYVIEK---REANRKTWVHVSSEPK---ECTYTI 16278

Query: 337   ----KEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENP----GAPGSPLNVRCLDVNRDC 388
                 +  E ++ +   + +G  E        D+E E        PG+P       V R+ 
Sbjct: 16279 PKLLEGHEYVFRIMAQNKYGIGEPL------DSEPETARNLFSVPGAPDKPTVSSVTRNS 16332

Query: 389   LILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQ----GLVEGQSYR 444
             + + W  P    G+P+T Y +E     S  W   +  P       +     GL+EG  Y+
Sbjct: 16333 MTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQ 16392

Query: 445   FRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPP 504
             FRV AI+  G    S  S      D   AR                     D +  P PP
Sbjct: 16393 FRVYAINAAGVGPASLPS------DPATAR---------------------DPIAPPGPP 16425

Query: 505   TNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVL 563
                  ++  ++   L W  P     + +T Y +E    G   WE    +  VR  +  V 
Sbjct: 16426 FP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEK-GKDKEVRGTKLVVT 16483

Query: 564   DLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVS---- 619
              L++   Y FRVRA+N  G+ +P E ++ I ++     + P  Q+ A    +  V     
Sbjct: 16484 GLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKD--RLVSPDLQLDASVRDRIVVHAGGV 16541

Query: 620   ---LTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSV 676
                + +   K P  + + +  R +   +  T+    I  +   +   +   +  + + + 
Sbjct: 16542 IRIIAYVSGKPPPTVTWNMNERTL--PQEATIETTAISSS-MVIKNCQRSHQGVYSLLAK 16598

Query: 677   SEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFL 736
             +EAG  + +   + + V   + TP     F   N       + W  P+  GG  I  Y +
Sbjct: 16599 NEAGERKKTIIVDVLDVPGPVGTP-----FLAHNLTNESCKLTWFSPEDDGGSPITNYVI 16653

Query: 737   DQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKE 796
             ++ +S+   W  V    +  +   V  L +G  Y FR  A N  G+G     S     +E
Sbjct: 16654 EKRESDRRAWTPVTYT-VTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIRE 16712

Query: 797   WTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPI 856
               +  P  P D+   EV   ++ L W PP Y G   +  Y +  +  G+E++  VT   +
Sbjct: 16713 -PITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNL 16771

Query: 857   SGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDK---PGAH-----EIEVG 908
                   V  L+ G +Y ++V A+N  G G+PS  T P+  +D+   P  H     ++ + 
Sbjct: 16772 LSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIR 16831

Query: 909   VDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGT 968
             V E   +   +     P  S   W KD    L+  R  I+       +   +    D G 
Sbjct: 16832 VGEAFALTGRYSGKPKPKVS---WFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGK 16888

Query: 969   YSVIVTDA 976
             Y V+V ++
Sbjct: 16889 YCVVVENS 16896



 Score =  143 bits (360), Expect = 1e-33
 Identities = 145/603 (24%), Positives = 242/603 (40%), Gaps = 65/603 (10%)

Query: 308   RDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEA 367
             RDG  L+++ R     T    ++ +  +   D G Y +   +  G  +    ++V D   
Sbjct: 26512 RDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIVVLD--- 26568

Query: 368   ENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPG 427
               PG P  P+ +   D+  + + L W PP    G+ +T Y + + +  +  W        
Sbjct: 26569 -RPGPPTGPVVIS--DITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVA 26625

Query: 428   GTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDH-DAARRKTEIPFDLGNK 486
              T    +  L  G+ Y+FR++A +R G S            DH D+A    ++P+     
Sbjct: 26626 RTMM-KVMKLTTGEEYQFRIKAENRFGIS------------DHIDSACVTVKLPY----- 26667

Query: 487   ITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEP-SPRDRAPLTYSLEKSVIGSGT 545
                         T P PP+    + +    + + W EP S    A + Y LE     S  
Sbjct: 26668 ------------TTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSIL 26715

Query: 546   WEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPP 605
             W+  +++  +R+  F V  +     Y FRV A N  G+  PS PSEP+          PP
Sbjct: 26716 WQK-ANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAID---ACEPP 26771

Query: 606   AQVQAFRDTQTSVSLTW-DPVKD--PELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPG 662
               V+    ++ SVSL+W  P  D   ++ GY +  R +    W   +   +  T+F + G
Sbjct: 26772 RNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISG 26831

Query: 663   LRTGKEYEFCVRSVSEAG-VGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWK 721
             L    +YEF V + +  G +   S    PI    +   P            K     G  
Sbjct: 26832 LTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYR--AGTS 26889

Query: 722   PPKRRG-GGKILGYFLDQHDSEELDWHAV----NQQPIPTRVCKVSDLHEGHFYEFRARA 776
                R G  GK         D +EL  +A+    N   + + + K +D      YE + R 
Sbjct: 26890 VKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRN 26949

Query: 777   ANWAGVGELSAPSSLFECKEWTMPQPGPP-YDVRASEVRATSLVLQWEPPLYMGAGPVTG 835
             A    +G  SA       +   + +PGPP   +    V A  + L W PP   G   +T 
Sbjct: 26950 A----MGSASA-----TIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITH 27000

Query: 836   YHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVL 895
             Y V  +E     W  V+   +    +  + +  G  Y+F+V+A+N  G+G+P + +D V+
Sbjct: 27001 YIVEKRETSRVVWSMVSE-HLEECIITTTKIIKGNEYIFRVRAVNKYGIGEP-LESDSVV 27058

Query: 896   LED 898
              ++
Sbjct: 27059 AKN 27061



 Score =  141 bits (355), Expect = 5e-33
 Identities = 165/692 (23%), Positives = 269/692 (38%), Gaps = 113/692 (16%)

Query: 303   SIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLV 362
             ++ W +DG  L+ + R  +  +    SL +    KED G Y + V +  G       ++V
Sbjct: 25425 TVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIV 25484

Query: 363   RDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIAC 422
              D     PG PG    +R  +V+ D + ++W PP    G  I+ Y +E+ +  S  W   
Sbjct: 25485 LD----RPGPPGP---IRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIV 25537

Query: 423   HEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPS----------------------- 459
              +A   T    I  L  G  Y+FRV A +R G S  S                       
Sbjct: 25538 SQAVARTS-IKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVV 25596

Query: 460   ---KASELV------------VMGDHDAARRKTEIPFDLGNKITISTDAFE--------- 495
                K++ LV            V+G H   + ++ I +   NKI I+    +         
Sbjct: 25597 HATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLM 25656

Query: 496   ------------------DTVTIPS-----PPTNVHASEIREAYVVLAWEEPSPRDRAPL 532
                                   +P+     PP     + I    V L W +P     A +
Sbjct: 25657 YEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKI 25716

Query: 533   T-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQY-GLSDPSEPS 590
             T Y +E+  +  G W   +  + ++   F V +L + + Y FRV A N    +S+PSE +
Sbjct: 25717 TGYIVERRELPDGRWLKCNYTN-IQETYFEVTELTEDQRYEFRVFARNAADSVSEPSEST 25775

Query: 591   EPIALRGPPATLPPPAQVQA-FRDTQTSVSLTWDPVKDPELLGYY--IYSRKVGTSEWQT 647
              PI ++      PP   +   FRD           VK  E+L     I  R +    W  
Sbjct: 25776 GPIIVKDDVE--PPRVMMDVKFRDVIV--------VKAGEVLKINADIAGRPLPVISWAK 25825

Query: 648   VNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGE------SSAATEPIRVK-QALATP 700
                +  +  R  +  + T       V+       G+      + A T  + V  + L  P
Sbjct: 25826 DGIEIEERARTEI--ISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKP 25883

Query: 701   SAPYGFALLN-CGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVC 759
               P G   +N     +  + W  P+  GG  I  Y +++ ++  L W  + +  +    C
Sbjct: 25884 GPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAW-TICEGELQMTSC 25942

Query: 760   KVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLV 819
             KV+ L +G+ Y FR    N  GVGE     ++     +T+P P  P  +  + V   S+ 
Sbjct: 25943 KVTKLLKGNEYIFRVTGVNKYGVGEPLESVAIKALDPFTVPSP--PTSLEITSVTKESMT 26000

Query: 820   LQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAM 879
             L W  P   G   ++GY +  +E+ S +W  V   P+    ++ + L+ G  Y ++V A 
Sbjct: 26001 LCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAE 26060

Query: 880   NSAGLGQPSMPT------DPVLLEDKPGAHEI 905
             N+AGL  PS  +      DPV L   P   +I
Sbjct: 26061 NAAGLSLPSETSPLIRAEDPVFLPSPPSKPKI 26092



 Score =  140 bits (353), Expect = 9e-33
 Identities = 178/759 (23%), Positives = 305/759 (40%), Gaps = 100/759 (13%)

Query: 173   LTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRV 232
             L+C +   P P + WY    R    L ++ KY+++++    +L +     ED   YT   
Sbjct: 30552 LSCQIVGRPLPDIKWY----RFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIA 30607

Query: 233   KNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSC 292
              N  G+  + +K+L++       G+     K   +G +V  T  L  ++     P     
Sbjct: 30608 TNEVGEVETSSKLLLQATPQFHPGYP---LKEKYYG-AVGSTLRLHVMYIGRPVP----- 30658

Query: 293   LFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKV-SCTYKEDEGLYMVRVPSPF 351
                       ++ WF    LL++S    I  T+    L + +   K   G Y V++ + F
Sbjct: 30659 ----------AMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVF 30708

Query: 352   GPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIER 411
             G  +    V ++D     P  P  P+ +  L  N    +++W PP+D  G+ IT Y +E+
Sbjct: 30709 GTVDAILDVEIQD----KPDKPTGPIVIEALLKNS--AVISWKPPADDGGSWITNYVVEK 30762

Query: 412   CQGESG-EWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDH 470
             C+ + G EW     A   T  C I  L E   Y FRV A +  G S P + S +V++   
Sbjct: 30763 CEAKEGAEWQLVSSAISVT-TCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVII--- 30818

Query: 471   DAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRA 530
                    + PF+                  P  P     + + +   V+AW+ P+    A
Sbjct: 30819 -------KSPFEK-----------------PGAPGKPTITAVTKDSCVVAWKPPASDGGA 30854

Query: 531   PL-TYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEP 589
              +  Y LEK       W ++++E  +R   F+V +L +   Y FRV+  N  G S+ SE 
Sbjct: 30855 KIRNYYLEKREKKQNKWISVTTEE-IRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEI 30913

Query: 590   SEPIALRGPPATLPPPAQVQAFRDT--------QTSVSLTWDPVKDPELLGYYIYSRKVG 641
             SEPI  +        P Q   F++         Q++ +L       P+ +  +    K  
Sbjct: 30914 SEPITPKS-----DVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEI 30968

Query: 642   TSEWQTVNNKPIQG--TRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALAT 699
              ++      +  +G   +  +  +       + VR+ ++ G    +A+ E + V   +  
Sbjct: 30969 IADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLE-VEVPAKIHL 31027

Query: 700   PSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTR-- 757
             P    G   ++  + E V+  K P       ++ +       ++L  +  + Q I TR  
Sbjct: 31028 PKTLEGMGAVHALRGE-VVSIKIPFSGKPDPVITW----QKGQDLIDNNGHYQVIVTRSF 31082

Query: 758   ----VCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEV 813
                      +  +  FY   A+  N  G+ + +    + +        P PP  V+ S+V
Sbjct: 31083 TSLVFPNGVERKDAGFYVVCAK--NRFGIDQKTVELDVADV-------PDPPRGVKVSDV 31133

Query: 814   RATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYV 873
                S+ L W  P   G   +T Y V      +E+W  V  G    T   V +L    SY 
Sbjct: 31134 SRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRV--GQARETRYTVINLFGKTSYQ 31191

Query: 874   FQVQAMNSAGLGQPSMPTDPVLL-EDKPGAHEIEVGVDE 911
             F+V A N  GL +PS P++P +  EDK  A   +  VDE
Sbjct: 31192 FRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDE 31230



 Score =  139 bits (351), Expect = 1e-32
 Identities = 175/744 (23%), Positives = 286/744 (38%), Gaps = 101/744 (13%)

Query: 213   LSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVE 272
             L+  + R   +    + V+ KN  G            Y      F S I K     P+ +
Sbjct: 28601 LTFTVERLVEKTEYEFRVKAKNDAG------------YSEPREAFSSVIIKEPQIEPTAD 28648

Query: 273   FTSVLKPVFA-REKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLK 331
              T +   +   +   PF++    S     A  + W  +   L+ + R  I  T  + +L 
Sbjct: 28649 LTGITNQLITCKAGSPFTIDVPISGR--PAPKVTWKLEEMRLKETDRVSITTTKDRTTLT 28706

Query: 332   VSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLIL 391
             V  + + D G Y + + +  G +  S  V+V       PG    P+ V    V+ +  +L
Sbjct: 28707 VKDSMRGDSGRYFLTLENTAGVKTFSVTVVV----IGRPGPVTGPIEVS--SVSAESCVL 28760

Query: 392   TWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAIS 451
             +W  P D  G  IT Y +E+ +  +  W   + +   T +  +  L +   Y FRV + +
Sbjct: 28761 SWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRT-QIKVTHLTKYMEYSFRVSSEN 28819

Query: 452   RVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASE 511
             R G S P +++ ++            E PF                   PS PT      
Sbjct: 28820 RFGVSKPLESAPII-----------AEHPF-----------------VPPSAPTRPEVYH 28851

Query: 512   IREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKS 570
             +    + + WEEP     + +  Y +EK    +  W    ++ P     + V  L +   
Sbjct: 28852 VSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILW-VKENKVPCLECNYKVTGLVEGLE 28910

Query: 571   YVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWD-PVKD-- 627
             Y FR  A+N  G+S  SE S PI  + P   +  P + +    T+++VSL W  P  D  
Sbjct: 28911 YQFRTYALNAAGVSKASEASRPIMAQNP---VDAPGRPEVTDVTRSTVSLIWSAPAYDGG 28967

Query: 628   PELLGYYIYSR---KVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGV-GE 683
              +++GY I  +   +VG   W   N   +    FTV  L  G  YEF V + + AGV  +
Sbjct: 28968 SKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISK 29027

Query: 684   SSAATEPIRVKQALATPSAPYGFAL------LNCGKN---EMVIGWKPPKR---RGGGKI 731
              S +T P+  +   A P A     L      +  G +   +  +G KP  +     G K 
Sbjct: 29028 GSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDK- 29086

Query: 732   LGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSL 791
                 LD  +   L +         T V K  D  +   Y    +  N +G   +S    +
Sbjct: 29087 ---ELDLCEKVSLQYTGKR----ATAVIKFCDRSDSGKYTLTVK--NASGTKAVSVMVKV 29137

Query: 792   FECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPV 851
              +        PGP   +  S V      L W  P   G   +T Y V  +E     W  +
Sbjct: 29138 LD-------SPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNW-VI 29189

Query: 852   TPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVL------LEDKPGAHEI 905
               G        V+ L     Y+F+V+A+N  G G P + ++P++      +   PG  E 
Sbjct: 29190 VEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVP-VESEPIVARNSFTIPSPPGIPE- 29247

Query: 906   EVGVDEEGFIYLAFEAPEAPDSSE 929
             EVG  +E  I + +  PE+   +E
Sbjct: 29248 EVGTGKE-HIIIQWTKPESDGGNE 29270



 Score =  139 bits (349), Expect = 3e-32
 Identities = 185/823 (22%), Positives = 318/823 (38%), Gaps = 100/823 (12%)

Query: 181   PPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQAS 240
             PPP VTW K++  +        +Y I N      L I +    D+  Y + ++N  G+  
Sbjct: 27299 PPPTVTWRKDEKNLGSD----ARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEP- 27353

Query: 241   SFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFT-SVLKPVFAREKEPFSLSCLFSEDVL 299
                                   K ST    V  T +  + +  +     +++ L+   ++
Sbjct: 27354 ----------------------KSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLI 27391

Query: 300   DAES--IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQ- 356
             D  S  I +  +           + +     S K+    ++    + V   +  G  E  
Sbjct: 27392 DGGSPIINYVIEKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPC 27451

Query: 357   STYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGES 416
              T   V+ AE     AP   L+++  D  +  +IL+W  P    G+ IT Y +ER +G+ 
Sbjct: 27452 ETTEPVKAAEVP---APIRDLSMK--DSTKTSVILSWTKPDFDGGSVITEYVVER-KGK- 27504

Query: 417   GEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRK 476
             GE    H     TC   +  L E     FRV A +  G S P     + V          
Sbjct: 27505 GEQTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITV---------- 27554

Query: 477   TEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWE-EPSP-----RDRA 530
                      ++ I+ +   D   IP     V        ++ L ++ +P P     +D  
Sbjct: 27555 --------KELIITPEV--DLSDIPGAQVTVRIGH--NVHLELPYKGKPKPSISWLKDGL 27602

Query: 531   PLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPS 590
             PL  S           E +           ++ + +K+    + V   N   +   + P 
Sbjct: 27603 PLKES-----------EFVRFSKTENKITLSIKNAKKEHGGKYTVILDN--AVCRIAVPI 27649

Query: 591   EPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDP---ELLGYYIYSRKVGTSEWQT 647
               I L GPP+    P +    +    SV L+WD  +D    E+  Y I  R+   + W+ 
Sbjct: 27650 TVITL-GPPSKPKGPIRFDEIK--ADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKM 27706

Query: 648   VNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFA 707
             V +  +  T F VP L    EY+F VR+ +  GV +   ++  I  K     P  P    
Sbjct: 27707 VCSS-VARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSSI-IVAKHQFRIPGPPGKPV 27764

Query: 708   LLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEG 767
             + N   + M + W  P   GG ++ G+ +++ +   + W  VN  PI  R  + + L EG
Sbjct: 27765 IYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEG 27824

Query: 768   HFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLY 827
               Y+FR  A N AG+   S PS  F      +  PG P  +   +V   ++ L+W PPL 
Sbjct: 27825 LDYQFRVYAENSAGLSSPSDPSK-FTLAVSPVDPPGTPDYI---DVTRETITLKWNPPLR 27880

Query: 828   MGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAG-LGQ 886
              G   + GY +  + +G+E+W       +S     V+ L PG  Y F++ A N+ G +  
Sbjct: 27881 DGGSKIVGYSIE-KRQGNERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISP 27939

Query: 887   PSMPTDPVLLEDKPGAHEIEVGVDE-EGFIYLAFEA------PEAPDSSEFQWSKDYKGP 939
             PS  +  ++  D+     +E G +  +G I  + E+       +        W KD    
Sbjct: 27940 PSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEI 27999

Query: 940   LDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISA 982
                  ++I D +  + + +++   +  G Y+V   +A     A
Sbjct: 28000 EKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKA 28042



 Score =  135 bits (341), Expect = 2e-31
 Identities = 214/959 (22%), Positives = 379/959 (39%), Gaps = 115/959 (11%)

Query: 169   TTVLLTCT----------VQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIR 218
             T  L+TC           +   P P+VTW   + R+        +  IT      +L ++
Sbjct: 28653 TNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLK----ETDRVSITTTKDRTTLTVK 28708

Query: 219   RCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLK 278
                  DS  Y + ++N  G  +    V+V    G   G              +E +SV  
Sbjct: 28709 DSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTG-------------PIEVSSV-- 28753

Query: 279   PVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKE 338
                    E   LS    +D    E   +  +     ++  + +  + ++  +KV+   K 
Sbjct: 28754 -----SAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKY 28808

Query: 339   DEGLYMVRVPSPFG---PREQSTYVLVRDAEAENPGAPGS-PLNVRCLDVNRDCLILTWA 394
              E  + V   + FG   P E +  +      AE+P  P S P       V+ + + + W 
Sbjct: 28809 MEYSFRVSSENRFGVSKPLESAPII------AEHPFVPPSAPTRPEVYHVSANAMSIRWE 28862

Query: 395   PPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVG 454
              P    G+ I  Y +E+ +  +  W+  ++ P   C   + GLVEG  Y+FR  A++  G
Sbjct: 28863 EPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAG 28922

Query: 455   SSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVT-IPSPPTNVHASEIR 513
              S  S+AS  ++  +   A  + E+           TD    TV+ I S P     S++ 
Sbjct: 28923 VSKASEASRPIMAQNPVDAPGRPEV-----------TDVTRSTVSLIWSAPAYDGGSKV- 28970

Query: 514   EAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVF 573
               Y++         +R P+      S +G G W    + + V    F V  L +  +Y F
Sbjct: 28971 VGYII---------ERKPV------SEVGDGRW-LKCNYTIVSDNFFTVTALSEGDTYEF 29014

Query: 574   RVRAMNQYG-LSDPSEPSEPIALRGPPATLPPPAQVQA-FRDTQTSVSLTWDPVKDPELL 631
             RV A N  G +S  SE + P+  R   A  PP A++ A       ++    D V D  + 
Sbjct: 29015 RVLAKNAAGVISKGSESTGPVTCRDEYA--PPKAELDARLHGDLVTIRAGSDLVLDAAVG 29072

Query: 632   G----YYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVS--EAGVGESS 685
             G      I+++  G  E        +Q T     G R     +FC RS S       +++
Sbjct: 29073 GKPEPKIIWTK--GDKELDLCEKVSLQYT-----GKRATAVIKFCDRSDSGKYTLTVKNA 29125

Query: 686   AATEPIRVKQALATPSAPYG-FALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEEL 744
             + T+ + V   +     P G   +    + +  + W  P+  GG +I  Y +++ ++  L
Sbjct: 29126 SGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRL 29185

Query: 745   DWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQ-PG 803
             +W  V  +  PT    V+ L + + Y FR RA N  G G       +     +T+P  PG
Sbjct: 29186 NWVIVEGE-CPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPG 29244

Query: 804   PPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPG-PISGTHLR 862
              P +V   +     +++QW  P   G   ++ Y V  +E+ S +W  V     +  T L+
Sbjct: 29245 IPEEVGTGK---EHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLK 29301

Query: 863   VSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED---KPGAHEIEVGVD-EEGFIYLA 918
             V+ L  G  Y F+V A+N+AG  +PS  ++ +   +    PG       VD  +  I LA
Sbjct: 29302 VTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLA 29361

Query: 919   FEAP---EAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTD 975
             +  P      D   +      K      RV     +  ++  + +  +    ++ V   +
Sbjct: 29362 WTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVN 29421

Query: 976   ADEDISASHTLTE-EELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPA 1034
                    S ++ E E +E+++    E+ + + K ++     I     +RL + V    P 
Sbjct: 29422 VKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVT-----IRAGASLRLMVSVSGRPPP 29476

Query: 1035  AELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITL 1093
                 +I  +K+     +R I  D  +    +I+  ++  D G YT + ++   K   T+
Sbjct: 29477 ----VITWSKQGIDLASRAI-IDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATV 29530



 Score =  120 bits (301), Expect = 9e-27
 Identities = 179/830 (21%), Positives = 305/830 (36%), Gaps = 90/830 (10%)

Query: 171   VLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTV 230
             + L   V+  P P+VTW K    ID  + R G+  + +    L   I     +DS  Y++
Sbjct: 18624 IRLFAIVRGRPAPKVTWRK--VGID-NVVRKGQVDLVDTMAFLV--IPNSTRDDSGKYSL 18678

Query: 231   RVKNAHGQASSFAKVLVRTYLGKDAGFD-SEIFKRSTFGPSVEFTSVLKPVFAREKEPFS 289
              + N  G+ + F  V V    G  +    S++ K S         S   P    E +  S
Sbjct: 18679 TLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCH------VSWAPP----ENDGGS 18728

Query: 290   LSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPS 349
                 +  +  +A+   W              +    ++ S  V+     +E  + V   +
Sbjct: 18729 QVTHYIVEKREADRKTW------------STVTPEVKKTSFHVTNLVPGNEYYFRVTAVN 18776

Query: 350   PFGPREQSTY---VLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITA 406
              +GP   +     VL  D  +E    P  P  +   ++ ++   L W PP    G  I  
Sbjct: 18777 EYGPGVPTDVPKPVLASDPLSE----PDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDG 18832

Query: 407   YTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVV 466
             Y     + E         +        + GL EG+ Y+FRV A + VG S+P +A     
Sbjct: 18833 YITSYREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAE---- 18888

Query: 467   MGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSP 526
              G ++A  +       +  +ITI                 + A    + +    W++   
Sbjct: 18889 -GVYEAKEQLLPPKILMPEQITIKA----------GKKLRIEAHVYGKPHPTCKWKKG-- 18935

Query: 527   RDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDP 586
                       E  V+ S       ++S   S    + D+ +K S  + + A N  G    
Sbjct: 18936 ----------EDEVVTSSHLAVHKADS---SSILIIKDVTRKDSGYYSLTAENSSGTDTQ 18982

Query: 587   SEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWD-PVKD--PELLGYYIYSRKVGTS 643
                   +   GPP    PP  +        + SL+W  P++D    +  Y +    V   
Sbjct: 18983 KIKVVVMDAPGPPQ---PPFDISDI--DADACSLSWHIPLEDGGSNITNYIVEKCDVSRG 19037

Query: 644   EWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQ-ALATPSA 702
             +W T     +  T   V  L  G+EY F VR+ +  G+ E    T P  V Q     PS 
Sbjct: 19038 DWVTALAS-VTKTSCRVGKLIPGQEYIFRVRAENRFGISEP--LTSPKMVAQFPFGVPSE 19094

Query: 703   PYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVS 762
             P    +    K+ + + W  P   GG  I+GY +++ +   L W   N   + +     +
Sbjct: 19095 PKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVKANDTLVRSTEYPCA 19154

Query: 763   DLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQW 822
              L EG  Y FR  A N AG    S P+     +    P PG P  +   +V  +++ L W
Sbjct: 19155 GLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDP-PGKPEVI---DVTKSTVSLIW 19210

Query: 823   EPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP--ISGTHLRVSDLQPGKSYVFQVQAMN 880
               P + G   + GY V   +   ++W      P  I       + L+    Y F+  A  
Sbjct: 19211 ARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIART 19270

Query: 881   SAGLGQPSMPTDPVLLEDKPGAHEIEVGVDEEGFIYLAFEAPEAPDSSEF-------QWS 933
             +  +  PS P+DPV +  +     I++ V  +  + +        D++ F        W 
Sbjct: 19271 AVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWK 19330

Query: 934   KDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISAS 983
             KD       + +K+  + N   + L     +D G Y++   ++    SA+
Sbjct: 19331 KDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSAT 19380



 Score =  110 bits (274), Expect = 1e-23
 Identities = 170/767 (22%), Positives = 290/767 (37%), Gaps = 128/767 (16%)

Query: 171   VLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTV 230
             + LT  ++  P P   W K    I  R   A     T       L I+     DS TY +
Sbjct: 30154 IRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTE------LVIKEADRGDSGTYDL 30207

Query: 231   RVKNAHGQASSFAKVLVRTYLGKDAG---FDSEIFK--RSTFGPSVEF--TSVLKPVFAR 283
              ++N  G+ + + KV V        G   +D    +  R ++ P  +     +L  +  R
Sbjct: 30208 VLENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILER 30267

Query: 284   EKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
              + P                  W+   S +R +            SL V    +  E  +
Sbjct: 30268 REVP---------------KAAWYTIDSRVRGT------------SLVVKGLKENVEYHF 30300

Query: 344   MVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNV--------RCLDVNRDCLILTWAP 395
              V   + FG        + +  ++E P  P +PLN           LDV +  + L+W+ 
Sbjct: 30301 RVSAENQFG--------ISKPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSR 30352

Query: 396   PSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGS 455
             P D  G+ +T Y IER +  + +W+  ++    T    + GLV    Y+FR+ A + VG 
Sbjct: 30353 PKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGL 30412

Query: 456   SVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREA 515
             S  S ASE VV  D          PFD                  PS P  +    I + 
Sbjct: 30413 SETSPASEPVVCKD----------PFDK-----------------PSQPGELEILSISKD 30445

Query: 516   YVVLAWEEPS-PRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFR 574
              V L WE+P     +  L Y +E    G   W+  S++  ++  +F +  L +   Y FR
Sbjct: 30446 SVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKK-SNKERIKDKQFTIGGLLEATEYEFR 30504

Query: 575   VRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYY 634
             V A N+ GLS P   +  ++++    +   P   +  +D  T +        +   L   
Sbjct: 30505 VFAENETGLSRPRRTA--MSIKTKLTSGEAPGIRKEMKDVTTKLG-------EAAQLSCQ 30555

Query: 635   IYSRKVGTSEWQTVNNKPIQGTRF---------TVPGLRTGKEYEFCVRSVSEAGVGESS 685
             I  R +   +W     + IQ  ++         T+  +   +E E     ++   VGE  
Sbjct: 30556 IVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVE 30615

Query: 686   AATEPIRVKQALATPSAP-----YGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHD 740
              +++ +        P  P     YG        + M IG   P        + +F  Q  
Sbjct: 30616 TSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVP-------AMTWFHGQKL 30668

Query: 741   SEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMP 800
              +  +   +      T +   +   + H  +++ + +N  G  +      + +  +    
Sbjct: 30669 LQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPD---- 30724

Query: 801   QPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQE--EGSEQWKPVTPGPISG 858
             +P  P  + A  +   S V+ W+PP   G   +T Y V   E  EG+E W+ V+   IS 
Sbjct: 30725 KPTGPIVIEA--LLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAE-WQLVS-SAISV 30780

Query: 859   THLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLE---DKPGA 902
             T  R+ +L     Y F+V A N+ G+  P   +  V+++   +KPGA
Sbjct: 30781 TTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGA 30827



 Score = 84.0 bits (206), Expect = 1e-15
 Identities = 85/314 (27%), Positives = 128/314 (40%), Gaps = 31/314 (9%)

Query: 152   RGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITN-NY 210
             + P F   LR+  V   +   L C V   P P V WY+    I   +    KYRI     
Sbjct: 30926 QAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEI---IADGLKYRIQEFKG 30982

Query: 211   GLLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPS 270
             G   L I     +D+  Y VR  N  G  S  A + V           ++I    T    
Sbjct: 30983 GYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEV--------PAKIHLPKTL--- 31031

Query: 271   VEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASL 330
                   +  V A   E  S+   FS        I W +   L+ ++   +++ T    SL
Sbjct: 31032 ----EGMGAVHALRGEVVSIKIPFSGK--PDPVITWQKGQDLIDNNGHYQVIVTRSFTSL 31085

Query: 331   KV-SCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCL 389
                +   ++D G Y+V   + FG  +++  + V D        P  P  V+  DV+RD +
Sbjct: 31086 VFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADV-------PDPPRGVKVSDVSRDSV 31138

Query: 390   ILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRA 449
              LTW  P+   G+ IT Y +E+C   +  W+   +A     R  +  L    SY+FRV A
Sbjct: 31139 NLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQA--RETRYTVINLFGKTSYQFRVIA 31196

Query: 450   ISRVGSSVPSKASE 463
              ++ G S PS+ SE
Sbjct: 31197 ENKFGLSKPSEPSE 31210



 Score = 77.0 bits (188), Expect = 1e-13
 Identities = 101/517 (19%), Positives = 201/517 (38%), Gaps = 59/517 (11%)

Query: 919  FEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADE 978
            FE   +      QW KD +      R+KI+ +    ++++    + D G Y+V+   A  
Sbjct: 3077 FECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVV---AGG 3133

Query: 979  DISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELH 1038
            ++S +    E    +++ +  E++             ++E+   R  +E E      + H
Sbjct: 3134 NVSTAKLFVEGRDVRIRSIKKEVQ-------------VIEK--QRAVVEFEVNEDDVDAH 3178

Query: 1039 LIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDD 1098
               +  EI      +  +  E+ +  + I    + D G YT     G+ ++ +TL +   
Sbjct: 3179 WYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYT--FVAGRNRSSVTLYV--- 3233

Query: 1099 DFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRA 1158
                               + P   + LQ    +  +    C V + + + +  W+ +  
Sbjct: 3234 ----------------NAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQ 3277

Query: 1159 EMPDG-----QYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIF 1213
             +  G      +D +  T LL   E   +D  +Y     +D G   T   L+ +  + + 
Sbjct: 3278 LLSTGFKCKFLHDGQEYTLLLI--EAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVS 3335

Query: 1214 --TELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGT 1271
               E+        TPL+   T EG     + +    + +K +W+ KDK+++     R   
Sbjct: 3336 PDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTD-LKVSWYSKDKKIKPSRFFRMTQ 3394

Query: 1272 TLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLST--DLSGQAFEDAMAEHQRLKTLAII 1329
              D   L I +    D+G YT    A   V Q+S+  +LS +A E  +  H+R++    +
Sbjct: 3395 FEDTYQLEIAEAYPEDEGTYT--FVASNAVGQVSSTANLSLEAPESIL--HERIEQEIEM 3450

Query: 1330 EKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTE 1389
            E   A V++   +   +        TC +   P     W K  + +   D  +  +R ++
Sbjct: 3451 EMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESD--KCSIRSSK 3508

Query: 1390 VTITIEKVNSE--DSGRYGVFVKNKYGSETGQVTISV 1424
               ++E + ++  D G Y     N+YGS +   T++V
Sbjct: 3509 YISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTV 3545



 Score = 75.5 bits (184), Expect = 3e-13
 Identities = 113/488 (23%), Positives = 184/488 (37%), Gaps = 48/488 (9%)

Query: 338   EDEGLYM-VRVPSPFG---PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTW 393
             E+ G Y  V   + FG   P E S+ V+++ +  E PGAPG P       V +D  ++ W
Sbjct: 30790 ENAGYYFRVSAQNTFGISDPLEVSSVVIIK-SPFEKPGAPGKPTITA---VTKDSCVVAW 30845

Query: 394   APPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRV 453
              PP+   G  I  Y +E+ + +  +WI+            ++ L+EG  Y FRV+  +  
Sbjct: 30846 KPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLG 30905

Query: 454   GSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIR 513
             G S  S+ SE +          K+++P        I    F++ +       N++     
Sbjct: 30906 GESEWSEISEPITP--------KSDVP--------IQAPHFKEELR------NLNVRYQS 30943

Query: 514   EAYVVL-AWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYV 572
              A +V      P P  +    Y   K +I  G    I  E      +  +  +    + V
Sbjct: 30944 NATLVCKVTGHPKPIVK---WYRQGKEIIADGLKYRIQ-EFKGGYHQLIIASVTDDDATV 30999

Query: 573   FRVRAMNQYGL--SDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPEL 630
             ++VRA NQ G      S   E  A    P TL     V A R    S+ + +    DP +
Sbjct: 31000 YQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVI 31059

Query: 631   LGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEP 690
                           +Q +  +      F   G+       + V + +  G+ + +   + 
Sbjct: 31060 TWQKGQDLIDNNGHYQVIVTRSFTSLVFP-NGVERKDAGFYVVCAKNRFGIDQKTVELDV 31118

Query: 691   IRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVN 750
               V      P  P G  + +  ++ + + W  P   GG KI  Y +++  +    W  V 
Sbjct: 31119 ADV------PDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVG 31172

Query: 751   QQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRA 810
             Q    TR   V +L     Y+FR  A N  G+ + S PS     KE         YD   
Sbjct: 31173 QAR-ETRY-TVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKE--DKTRAMNYDEEV 31228

Query: 811   SEVRATSL 818
              E R  S+
Sbjct: 31229 DETREVSM 31236



 Score = 72.0 bits (175), Expect = 4e-12
 Identities = 117/572 (20%), Positives = 209/572 (36%), Gaps = 85/572 (14%)

Query: 866  LQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED--------KPGAHEIEVGVDEEGFIYL 917
            LQ  +S++ Q     S  LG  S     +L E         KP + ++ +G       ++
Sbjct: 7176 LQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGTFKCHV 7235

Query: 918  AFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTD-A 976
               AP      +  W+KD +        K+    N + + + + G  D G Y+   ++ A
Sbjct: 7236 TGTAP-----IKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIA 7290

Query: 977  DEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAE 1036
             +D  ++    +E    +KKL     + ++K       D   R E        K+  + E
Sbjct: 7291 GKDSCSAQLGVQEPPRFIKKLEP---SRIVKQ------DEFTRYEC-------KIGGSPE 7334

Query: 1037 LHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLV 1096
            + +++   E     + K        +  + + NLS ED G YT +  +       + +L 
Sbjct: 7335 IKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSL- 7393

Query: 1097 DDDFDKLLRKADAKRRDWKRKQGPYF-ERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFF 1155
                              K K+ P F ++P   +  +   V L C++  T       W+ 
Sbjct: 7394 ------------------KVKEPPIFRKKPHPIETLKGADVHLECELQGTPP-FHVSWYK 7434

Query: 1156 QRAEMPDGQYDPETGTGLLC---IEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAI 1212
             + E+  G+         L    I  +   D G Y+   ++D G D  +  +   A    
Sbjct: 7435 DKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRF 7494

Query: 1213 FTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTT 1272
              +L  I  +    +++Q T EG            E +   WF KDK    G+ +R    
Sbjct: 7495 VKKLSDISTVVGKEVQLQTTIEG-----------AEPISVVWF-KDK----GEIVRES-- 7536

Query: 1273 LDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKN 1332
             D IW+   +   + +        AGK   Q+  D   Q   +  A    L+   I+EK 
Sbjct: 7537 -DNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQ---ECFATLSVLEPATIVEK- 7591

Query: 1333 RAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTI 1392
                    P+   +    T  L C V+G P     W K+ + +T  ++Y++        +
Sbjct: 7592 --------PESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVSGL 7643

Query: 1393 TIEKVNSEDSGRYGVFVKNKYGSETGQVTISV 1424
             I  V   DSG Y   V+N  G ++   ++ V
Sbjct: 7644 KIINVAPSDSGVYSFEVQNPVGKDSCTASLQV 7675



 Score = 72.0 bits (175), Expect = 4e-12
 Identities = 86/389 (22%), Positives = 145/389 (37%), Gaps = 55/389 (14%)

Query: 1042 NNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFD 1101
            + KE+ S    KI+F  +   +++I  N++  D G Y+ ++Q+   K+  T +L   D  
Sbjct: 7622 DGKELTSDNKYKISFFNKVSGLKII--NVAPSDSGVYSFEVQNPVGKDSCTASLQVSD-- 7677

Query: 1102 KLLRKADAKRRDWKRKQGPYFERPL-QWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEM 1160
                          R   P F R L +        V + CKV  +   +   WF +  E+
Sbjct: 7678 --------------RTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPIS-VSWFHEGNEI 7722

Query: 1161 PDGQYDPETGTGLLC---IEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELG 1217
              G+    T T   C   +  L + D G Y  + ++  G D+    LT     +   +  
Sbjct: 7723 SSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPD 7782

Query: 1218 RIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIW 1277
             +  L+ T +      +G   FS            +WF     L  GDR           
Sbjct: 7783 PMDVLTGTNVTFTSIVKGTPPFS-----------VSWFKGSSELVPGDRCNVSLEDSVAE 7831

Query: 1278 LHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVV 1337
            L + D   S  G+YT  +             S +A + +   H  +K         AK V
Sbjct: 7832 LELFDVDTSQSGEYTCIV-------------SNEAGKASCTTHLYIKA-------PAKFV 7871

Query: 1338 RGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKV 1397
            + L D + I + K L L    +G P   ++W KN   VT   R  +        + I   
Sbjct: 7872 KRLNDYS-IEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSS 7930

Query: 1398 NSEDSGRYGVFVKNKYGSETGQVTISVFK 1426
              ED+G+Y  +++N  G ++    I + +
Sbjct: 7931 TVEDAGQYNCYIENASGKDSCSAQILILE 7959



 Score = 71.6 bits (174), Expect = 5e-12
 Identities = 79/340 (23%), Positives = 140/340 (41%), Gaps = 58/340 (17%)

Query: 1132  EDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQ---YDPETGTGLLCIEELSKKDKGIYR 1188
             E   V+  CK+ N  + T+  W+F   ++ + +      E G  +L +++++K D G YR
Sbjct: 31581 EGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYR 31640

Query: 1189  AMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVE 1248
               V +D GED +  +L    +  ++    R      T  KI+   + +R+  +   + + 
Sbjct: 31641 CKVVNDYGEDSSYAELFVKGVREVYDYYCR-----RTMKKIKRRTDTMRLLERPPEFTLP 31695

Query: 1249  -YMKTTWFHKDKRLESGDRIRTGTTL------DEIWL---HILDPKDSDKGKYTLEIAAG 1298
              Y KT +         G+ +R G T+         W      + P D+DK KYT E   G
Sbjct: 31696 LYNKTAYV--------GENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDK-KYTFESDKG 31746

Query: 1299  ---KEVRQLSTD-------LSGQAFEDAMAEHQRLKTL--AIIEKNRAKVVRGLPDVATI 1346
                  +  ++TD       ++   + +   + +   TL     +     + + L   A  
Sbjct: 31747 LYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAEC 31806

Query: 1347  MEDKTLCLTCIVSGDPTPEISWLKNDQPVTF----------LDRYRMEVRGTEVTITIEK 1396
              E +++C    VSG P P + W K+ QP++           LD Y + +R T        
Sbjct: 31807 QEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDT-------- 31858

Query: 1397  VNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELKS 1436
                ED+G Y V   N  GS + Q  + V +   + +E KS
Sbjct: 31859 -LPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQEFKS 31897



 Score = 70.1 bits (170), Expect = 1e-11
 Identities = 107/506 (21%), Positives = 190/506 (37%), Gaps = 84/506 (16%)

Query: 920  EAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADED 979
            E   AP+   FQW K  +   +  +  I      S + +    + D G Y+   ++    
Sbjct: 3478 EIQSAPNV-RFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGS 3536

Query: 980  ISASHTLTEEE------LEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSP 1033
            +S + TLT  E      L + K L+  +      + +     ++E     +W +      
Sbjct: 3537 VSCTATLTVTEAYPPTFLSRPKSLTTFVGKAAKFICTVTGTPVIET----IWQK------ 3586

Query: 1034 AAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITL 1093
                    +   +  SPN +I+    K ++E  + NL+ +D+G Y+ +  +    +    
Sbjct: 3587 --------DGAALSPSPNWRISDAENKHILE--LSNLTIQDRGVYSCKASNKFGADICQA 3636

Query: 1094 TLVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQW 1153
             L+  D    +++ +              +  +  KV  +CQV    KVT T       W
Sbjct: 3637 ELIIIDKPHFIKELEP------------VQSAINKKVHLECQVDEDRKVTVT-------W 3677

Query: 1154 FFQRAEMPDGQ-----YDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDA 1208
                 ++P G+     ++ +  T  + + +L  KD G Y    S++ G       +T   
Sbjct: 3678 SKDGQKLPPGKDYKICFEDKIATLEIPLAKL--KDSGTYVCTASNEAGSSSCSATVT--- 3732

Query: 1209 LDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIR 1268
               +      +  +  + L + G  E  R+  K+K   V  ++ TWF  +K L   + +R
Sbjct: 3733 ---VREPPSFVKKVDPSYLMLPG--ESARLHCKLKGSPV--IQVTWFKNNKELSESNTVR 3785

Query: 1269 TGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAI 1328
                  E  L I D K  D G Y+ E          ST+                    I
Sbjct: 3786 MYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTE--------------------I 3825

Query: 1329 IEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGT 1388
            + K     ++ L + A I+      L C VSG    EISW K+ + +    +YR+  + +
Sbjct: 3826 VIKEPPSFIKTL-EPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKS 3884

Query: 1389 EVTITIEKVNSEDSGRYGVFVKNKYG 1414
             V + I   NS D G Y   V N+ G
Sbjct: 3885 LVCLEIFSFNSADVGEYECVVANEVG 3910



 Score = 67.0 bits (162), Expect = 1e-10
 Identities = 56/211 (26%), Positives = 84/211 (39%), Gaps = 23/211 (10%)

Query: 154  PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLL 213
            P+F   L         +V L C V  +P   V+WYK DT++ P      +YR      + 
Sbjct: 6079 PYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRP----TPEYRTYFTNNVA 6134

Query: 214  SLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEF 273
            +L   +  I DS  YT + +N+ G ASS  K + R              +     PS  F
Sbjct: 6135 TLVFNKVNINDSGEYTCKAENSIGTASS--KTVFR-------------IQERQLPPS--F 6177

Query: 274  TSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVS 333
               LK +      P +L+C  +        + W+RDG LLR     +  + D  A+LK+ 
Sbjct: 6178 ARQLKDIEQTVGLPVTLTCRLNGSA--PIQVCWYRDGVLLRDDENLQTSFVDNVATLKIL 6235

Query: 334  CTYKEDEGLYMVRVPSPFGPREQSTYVLVRD 364
             T     G Y     +P G    S  +  R+
Sbjct: 6236 QTDLSHSGQYSCSASNPLGTASSSARLTARE 6266



 Score = 64.7 bits (156), Expect = 6e-10
 Identities = 89/459 (19%), Positives = 159/459 (34%), Gaps = 88/459 (19%)

Query: 1061  GLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDF----DKLLRKADAKRRDWK- 1115
             G  E+ I NL+E D+G Y  ++      ++  L  +   F    +K+ + ++ K+ D K 
Sbjct: 32772 GTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKT 32831

Query: 1116  ------RKQGPYFERPLQWK-----------VTEDCQVQLTCKVTNTKKETRFQWFFQRA 1158
                   RK  P    P+  K           V+ D   +   K T   + T       +A
Sbjct: 32832 TESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKA 32891

Query: 1159  EMPDGQY--DPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALD------ 1210
                 G+Y    + G   L I +    D G+Y   V +  G   +   LT  A+       
Sbjct: 32892 ITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQK 32951

Query: 1211  --------------AIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNV----EYMKT 1252
                           A+  E     AL +  +K+   +   ++  K +   V    E  K+
Sbjct: 32952 VSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKS 33011

Query: 1253  TWFHKDKRLESGDRIRTGTTLDEIWLHI--------LDPKDSDKGKYTLEIAAGKEVRQL 1304
                  +K +   +  +T    +E+  H         +   +  +      IA   +V+ +
Sbjct: 33012 AATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGATDVKWV 33071

Query: 1305  STDL--------------SGQAFEDAMAEHQRLKTLAIIEKNRAKVVR------------ 1338
                +              S Q      A H+    L  I K +  +V+            
Sbjct: 33072 LNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELS 33131

Query: 1339  ------GLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTI 1392
                     P    I E + +  TC +SG+P+PEI W KN+ P++      +       ++
Sbjct: 33132 DAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSL 33191

Query: 1393  TIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEP 1431
              I   +  DSG+Y +  KN  G  +   ++ V    +EP
Sbjct: 33192 EIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEP 33230



 Score = 64.3 bits (155), Expect = 8e-10
 Identities = 104/508 (20%), Positives = 188/508 (37%), Gaps = 79/508 (15%)

Query: 932  WSKDYKG--PLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTLTEE 989
            WSKD +   P    ++  EDK+   ++ L +  L+D GTY    ++     S S T+T  
Sbjct: 3677 WSKDGQKLPPGKDYKICFEDKIATLEIPLAK--LKDSGTYVCTASNEAGSSSCSATVTVR 3734

Query: 990  ELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSS 1049
            E     K      +P   ++ G +         RL  ++ K SP  ++    NNKE+  S
Sbjct: 3735 EPPSFVKKV----DPSYLMLPGES--------ARLHCKL-KGSPVIQVTWFKNNKELSES 3781

Query: 1050 PNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDD---FDKLLRK 1106
               ++ F   + +++  I ++  ED GSY+ +  +    +  +  +V  +   F K L  
Sbjct: 3782 NTVRMYFVNSEAILD--ITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEP 3839

Query: 1107 ADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQ-Y 1165
            AD                     +       L C+V+ T       WF  + ++   + Y
Sbjct: 3840 AD---------------------IVRGTNALLQCEVSGTGP-FEISWFKDKKQIRSSKKY 3877

Query: 1166 DPETGTGLLCIEELS--KKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALS 1223
               +   L+C+E  S    D G Y  +V+++ G+   +             ++  + AL 
Sbjct: 3878 RLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFVKKVDDLIALG 3937

Query: 1224 ATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDP 1283
               + +Q    G            E +  TW    + +    +I+   +     L I D 
Sbjct: 3938 GQTVTLQAAVRGS-----------EPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDV 3986

Query: 1284 KDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDV 1343
            + S  GKYT  +A  +   Q S                      +I K  AK++     +
Sbjct: 3987 QISFGGKYTC-LAENEAGSQTSVG-------------------ELIVKEPAKIIERAELI 4026

Query: 1344 ATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSG 1403
                 D    L   V+G P  +  W K+ +P+    +YR+  +     +        DSG
Sbjct: 4027 QVTAGDPAT-LEYTVAGTPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSG 4085

Query: 1404 RYGVFVKNKYGSETGQVTISVFKHGDEP 1431
            +Y   + N+ GS + + T +V      P
Sbjct: 4086 QYTFEISNEVGSSSCETTFTVLDRDIAP 4113



 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 59/227 (25%), Positives = 93/227 (40%), Gaps = 28/227 (12%)

Query: 133   RRTEEKVQEAKELRELCYGRGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDT 192
             RRT +K++   +   L   R P F +PL +   +    V    T+   P P VTWYK+  
Sbjct: 31670 RRTMKKIKRRTDTMRLLE-RPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQ 31728

Query: 193   RIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLG 252
             +I P      KY   ++ GL  L I     +D A YTV  +N +G+ S  AK+ V  +  
Sbjct: 31729 KIKPG-DNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLH-- 31785

Query: 253   KDAGFDSEIFKRSTFGPSVEFTSVLKPVFARE------KEPFSLSCLFSEDVLDAESIQW 306
                             P  +  S L+P+F R       +E  S+        +   +++W
Sbjct: 31786 ---------------PPPTD--STLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKW 31828

Query: 307   FRDGSLLRSSRRRKILYTDRQ-ASLKVSCTYKEDEGLYMVRVPSPFG 352
              +DG  L      +I++      +L +  T  ED G Y V   +  G
Sbjct: 31829 EKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAG 31875



 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 61/287 (21%), Positives = 112/287 (39%), Gaps = 38/287 (13%)

Query: 1145  TKKETRFQWFFQRAEMPDGQYDPETGT-GLLCIEELS--KKDKGIYRAMVSDDRGE--DD 1199
             +K     +W+    E+ +      T T G+L +E L     D G YRA+ ++ +GE  D 
Sbjct: 32399 SKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDY 32458

Query: 1200  TILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDK 1259
               LD+TG                  T    Q  +E +      +    E    + F K  
Sbjct: 32459 ATLDVTGG---------------DYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTS 32503

Query: 1260  RLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAE 1319
              +E+   +R      E+   + + ++S                  S ++   A E+   E
Sbjct: 32504 EMEASSSVR------EVKSQMTETRES----------LSSYEHSASAEMKSAALEEKSLE 32547

Query: 1320  HQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLD 1379
              +   T   I+   A  +   P   T+ E ++   +C   G+P P ++WL+  Q ++   
Sbjct: 32548 EK--STTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSA 32605

Query: 1380  RYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFK 1426
             R+++     + T  I  V + D G Y V V+N  G +  + T+++ K
Sbjct: 32606 RHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQK 32652



 Score = 62.4 bits (150), Expect = 3e-09
 Identities = 51/204 (25%), Positives = 82/204 (40%), Gaps = 32/204 (15%)

Query: 167  EHTTVLLTC------TVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRC 220
            E+TT +L        TV  SPP  +TW K+D  +D          I+    + +L+IR  
Sbjct: 5055 ENTTTVLKSSATFQSTVAGSPPISITWLKDDQILD----EDDNVYISFVDSVATLQIRSV 5110

Query: 221  AIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPV 280
                S  YT + KN  G    +A +LV+                       +     K V
Sbjct: 5111 DNGHSGRYTCQAKNESGVERCYAFLLVQE--------------------PAQIVEKAKSV 5150

Query: 281  FAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDE 340
               EK+P +L C+ +        ++W +DG  +  SR   + + +  AS ++    K+D 
Sbjct: 5151 DVTEKDPMTLECVVAGT--PELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDS 5208

Query: 341  GLYMVRVPSPFGPREQSTYVLVRD 364
            G Y  +V + FG      Y+ V D
Sbjct: 5209 GQYTFKVENDFGSSSCDAYLRVLD 5232



 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 105/490 (21%), Positives = 187/490 (38%), Gaps = 82/490 (16%)

Query: 919   FEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADE 978
             FE   + ++++ +W KD       ++  I  K     +++ +  L+D   YS  V  A  
Sbjct: 12393 FECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTART 12452

Query: 979   DISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELH 1038
               S   T+ EEE    K L+              NI++ E   ++L  EV K  P AE+ 
Sbjct: 12453 --SGMLTVLEEEAVFTKNLA--------------NIEVSETDTIKLVCEVSK--PGAEVI 12494

Query: 1039  LIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDD 1098
                 ++EI  +   +I  +  K ++  +IQN   ED G+Y  +L   +   ++ +  +  
Sbjct: 12495 WYKGDEEIIETGRYEILTEGRKRIL--VIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAA 12552

Query: 1099  DFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRA 1158
             +F                       +P   ++ E  + +  C ++  K+    QW     
Sbjct: 12553 EF---------------------ISKPQNLEILEGEKAEFVCSIS--KESFPVQWKRDDK 12589

Query: 1159  EMPDG-QYD--PETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTE 1215
              +  G +YD   +    +L +++ + +D G Y  MV   R            A      E
Sbjct: 12590 TLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARA-----------AAHLTVIE 12638

Query: 1216  LGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDE 1275
               RI      PLK    +E   +    +  N E  K  WF  ++ +    +         
Sbjct: 12639 KLRI----VVPLKDTRVKEQQEVVFNCEV-NTEGAKAKWFRNEEAIFDSSK--------- 12684

Query: 1276  IWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAK 1335
                +I+  KD     YTL I       Q + ++S     +   E+ +     I+E+   +
Sbjct: 12685 ---YIILQKDL---VYTLRIRDAHLDDQANYNVS---LTNHRGENVKSAANLIVEEEDLR 12735

Query: 1336  VVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIE 1395
             +V  L D+ T ME K++   C V+      + W KN + V F +R    V   +  +TI+
Sbjct: 12736 IVEPLKDIET-MEKKSVTFWCKVNR-LNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIK 12793

Query: 1396  KVNSEDSGRY 1405
                  D G Y
Sbjct: 12794 DCGFPDEGEY 12803



 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 4/94 (4%)

Query: 154   PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLL 213
             P F    RS  + E   VL TC +   P P++ W+KN+  I      +    I+ +  + 
Sbjct: 33134 PAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISI----SSNVSISRSRNVY 33189

Query: 214   SLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLV 247
             SLEIR  ++ DS  YT++ KN  GQ S+ A ++V
Sbjct: 33190 SLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV 33223



 Score = 61.2 bits (147), Expect = 7e-09
 Identities = 52/232 (22%), Positives = 98/232 (42%), Gaps = 30/232 (12%)

Query: 1227  LKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIW-LHILDPKD 1285
             LK + ++E  ++   V+   +   + TW+   K+L+     +   + D  + L I +  +
Sbjct: 32724 LKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTE 32783

Query: 1286  SDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAK---------- 1335
             SD+G+Y  EI+      + +    GQAF+     H+++  ++  +K+  K          
Sbjct: 32784 SDQGEYVCEISGEGGTSKTNLQFMGQAFKSI---HEKVSKISETKKSDQKTTESTVTRKT 32840

Query: 1336  -------------VVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYR 1382
                          +V GL D  T+  D         +G+P P   W K+ + +T   +Y+
Sbjct: 32841 EPKAPEPISSKPVIVTGLQDT-TVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYK 32899

Query: 1383  MEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETG--QVTISVFKHGDEPK 1432
             +        + I K ++ DSG Y   VKN  GS +   ++TI   K  +  K
Sbjct: 32900 LSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQK 32951



 Score = 60.8 bits (146), Expect = 9e-09
 Identities = 49/192 (25%), Positives = 76/192 (39%), Gaps = 26/192 (13%)

Query: 173  LTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRV 232
            L C V  +PP ++TW+ ND  I      + K+R++       L +    IEDS  Y    
Sbjct: 4319 LACKVTGTPPIKITWFANDREIK----ESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEA 4374

Query: 233  KNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSC 292
            +N  G     + V+V+                     S  FT   KP+   ++  + +  
Sbjct: 4375 QNEAGSDHCSSIVIVKE--------------------SPYFTKEFKPIEVLKE--YDVML 4412

Query: 293  LFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFG 352
            L          I WF+D ++LRS R+ K    D   SL++      D G Y  RV +  G
Sbjct: 4413 LAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVG 4472

Query: 353  PREQSTYVLVRD 364
                S  V +R+
Sbjct: 4473 SSICSARVTLRE 4484



 Score = 60.8 bits (146), Expect = 9e-09
 Identities = 71/317 (22%), Positives = 114/317 (35%), Gaps = 37/317 (11%)

Query: 177  VQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAH 236
            V  S P  V WYKN+  I P         IT     L L++R+  + D+  YT +V N  
Sbjct: 8273 VAGSQPITVAWYKNNIEIQP----TSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDA 8328

Query: 237  GQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSE 296
            G A   + ++++    K   FD                  L PV   E E   LSC    
Sbjct: 8329 GSALCTSSIVIKEPK-KPPVFDQH----------------LTPVTVSEGEYVQLSCHVQG 8371

Query: 297  DVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQ 356
               +   IQW + G  ++ S R    +    A L++    K D G Y+ +  +  G    
Sbjct: 8372 S--EPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTT 8429

Query: 357  STYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGES 416
             + V ++D  A  P    + ++ R   V+    I      + T    +    I   +   
Sbjct: 8430 KSKVTIKDKPAVAPATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTK 8489

Query: 417  GEWIACHEA-------PGGTCRCPIQGLVEGQSYRFRVRAI-------SRVGSSVPSKAS 462
            G+W   ++         G   +  I+   +  S  +R  A        S V   V  +  
Sbjct: 8490 GKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKK 8549

Query: 463  ELVVMGDHDAARRKTEI 479
            +  + GD  A  +KT I
Sbjct: 8550 QEKIEGDLRAMLKKTPI 8566



 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 79/383 (20%), Positives = 140/383 (36%), Gaps = 62/383 (16%)

Query: 1042 NNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQD--GKAKNQITLTLVDDD 1099
            + + + +S   +I+F  +  + ++   +    D G YT ++ +  G +  + T T++D D
Sbjct: 4053 DGRPLVASKKYRISF--KNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRD 4110

Query: 1100 FDKLLRKADAKRRDWKRKQGPYFERPLQ---WKVTEDCQVQLTCKVTNTKKETRFQWFFQ 1156
                                P+F +PL+     V   C+  L CK+  +    R  WF  
Sbjct: 4111 I------------------APFFTKPLRNVDSVVNGTCR--LDCKIAGSLP-MRVSWFKD 4149

Query: 1157 RAEMPDG---QYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIF 1213
              E+      +     GT  L I  +   D G +    ++  G  D+   L      +  
Sbjct: 4150 GKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFV 4209

Query: 1214 TELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTL 1273
            T+ G    L  + + ++ T +G    +             WF  +K L SG         
Sbjct: 4210 TKPGSKDVLPGSAVCLKSTFQGSTPLT-----------IRWFKGNKELVSGGSCYITKEA 4258

Query: 1274 DEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNR 1333
             E  L +   K SD G YT +++      + S +L                      K  
Sbjct: 4259 LESSLELYLVKTSDSGTYTCKVSNVAGGVECSANL--------------------FVKEP 4298

Query: 1334 AKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTIT 1393
            A  V  L     + +     L C V+G P  +I+W  ND+ +    ++RM    +   + 
Sbjct: 4299 ATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLR 4358

Query: 1394 IEKVNSEDSGRYGVFVKNKYGSE 1416
            +  V  EDSG Y    +N+ GS+
Sbjct: 4359 LTDVGIEDSGEYMCEAQNEAGSD 4381



 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 112/585 (19%), Positives = 196/585 (33%), Gaps = 81/585 (13%)

Query: 861  LRVSDLQPGKSYVFQVQAMNSAGLGQPS---MPTDPVLLEDKPGAHEIEVGVDEEGFIYL 917
            L +S L+   S  +   A N AG  Q S      +P    +KP + ++      +    +
Sbjct: 4732 LEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPNTRVQLKALV 4791

Query: 918  AFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSV-IVTDA 976
               AP        +W KD K         +      + + L      D GTY   +  D 
Sbjct: 4792 GGTAPMT-----IKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDV 4846

Query: 977  DEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAE 1036
                S +    +E  + +KK S     PV+         +L  G+   +      +P   
Sbjct: 4847 GTATSKATLFVKEPPQFIKKPS-----PVL---------VLRNGQSTTFECQITGTPKIR 4892

Query: 1037 LHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLV 1096
            +    +  EI +     I+F    GL    I     E+ G+Y  + ++       ++ L 
Sbjct: 4893 VSWYLDGNEITAIQKHGISFI--DGLATFQISGARVENSGTYVCEARNDAGTASCSIEL- 4949

Query: 1097 DDDFDKLLRKADAKRRDWKRKQGPYFERPLQ-WKVTEDCQVQLTCKVTNTKKETRFQWFF 1155
                              K K+ P F R L+  +V +   V+L C+VT T       W  
Sbjct: 4950 ------------------KVKEPPTFIRELKPVEVVKYSDVELECEVTGTPP-FEVTWLK 4990

Query: 1156 QRAEMPDGQ---YDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAI 1212
               E+   +            L I +    D G Y+ +VS++ G       +      + 
Sbjct: 4991 NNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSF 5050

Query: 1213 FTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTT 1272
              ++     +  +    Q T  G    S            TW   D+ L+  D +     
Sbjct: 5051 IKKIENTTTVLKSSATFQSTVAGSPPIS-----------ITWLKDDQILDEDDNVYISFV 5099

Query: 1273 LDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKN 1332
                 L I    +   G+YT +      V +    L  Q            +   I+EK 
Sbjct: 5100 DSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQ------------EPAQIVEKA 5147

Query: 1333 RAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTI 1392
            ++           + E   + L C+V+G P  ++ WLK+ + +     + M       + 
Sbjct: 5148 KS---------VDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASF 5198

Query: 1393 TIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELKSM 1437
             I+ V  +DSG+Y   V+N +GS +    + V      P   K +
Sbjct: 5199 RIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKL 5243



 Score = 57.8 bits (138), Expect = 7e-08
 Identities = 56/219 (25%), Positives = 93/219 (42%), Gaps = 22/219 (10%)

Query: 152 RGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYG 211
           + P F  PL+S  V E +T      +   P P+V+W+++   I          +I+ + G
Sbjct: 4   QAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPG--VQISFSDG 61

Query: 212 LLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSV 271
              L I      +S  Y+++  N  GQA+S A++LV               K  T  P+ 
Sbjct: 62  RAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLV---------------KAETAPPN- 105

Query: 272 EFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLK 331
            F   L+ +  R+     L    +   +    ++++RDG+ ++SS   +I       SL 
Sbjct: 106 -FVQRLQSMTVRQGSQVRLQVRVTG--IPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLL 162

Query: 332 VSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENP 370
           ++  Y ED G Y V   +  G R  ST  L+   E E P
Sbjct: 163 IAEAYPEDSGTYSVNATNSVG-RATSTAELLVQGEEEVP 200



 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 70/325 (21%), Positives = 121/325 (37%), Gaps = 39/325 (12%)

Query: 1117 KQGPYFE-RPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEM-PDGQYDPET--GTG 1172
            K+ P+F+ +P+   V         C VT  +   R  W     E+ P G Y       T 
Sbjct: 6268 KKSPFFDIKPVSIDVIAGESADFECHVTGAQP-MRITWSKDNKEIRPGGNYTITCVGNTP 6326

Query: 1173 LLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGT 1232
             L I ++ K D G Y    ++D G+D     L+             +  L A+ +  QG 
Sbjct: 6327 HLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKF------VKKLEASKVAKQG- 6379

Query: 1233 EEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYT 1292
             E I++  K+       +K +WF  D  L    +           L I +    D G Y 
Sbjct: 6380 -ESIQLECKIS--GSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYI 6436

Query: 1293 LEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTL 1352
             E   G      ST L+ +A                       V    P     ++   +
Sbjct: 6437 CEAHNGVGDASCSTALTVKA---------------------PPVFTQKPSPVGALKGSDV 6475

Query: 1353 CLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNK 1412
             L C +SG P  E+ W+K+ + V    ++++  +  + ++ I  + + D G Y     N+
Sbjct: 6476 ILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNE 6535

Query: 1413 YGSETGQVTISVFKHGDEPKELKSM 1437
             GS+T   ++   K  + P+ +K +
Sbjct: 6536 VGSDTCSCSV---KFKEPPRFVKKL 6557



 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 50/217 (23%), Positives = 86/217 (39%), Gaps = 25/217 (11%)

Query: 154  PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLL 213
            P+F   L    V    +  L C +  +P   V+WYK DT++ P       Y++     + 
Sbjct: 7961 PYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTT----TYKMHFRNNVA 8016

Query: 214  SLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEF 273
            +L   +  I DS  Y  + +N+ G+ S+   + V+                    PS  F
Sbjct: 8017 TLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQ---------------EQKLPPS--F 8059

Query: 274  TSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVS 333
            +  L+ V      P    C  S    +  S+ W++DG  L+ S   +  + D  A+L + 
Sbjct: 8060 SRQLRDVQETVGLPVVFDCAISGS--EPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIF 8117

Query: 334  CTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENP 370
             T +   G Y     +P G    S  +++   E +NP
Sbjct: 8118 KTDRSLAGQYSCTATNPIGSASSSARLIL--TEGKNP 8152



 Score = 56.2 bits (134), Expect = 2e-07
 Identities = 54/221 (24%), Positives = 88/221 (39%), Gaps = 32/221 (14%)

Query: 147  ELCYGRGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRI 206
            EL     P F   L+   V +++ V L C V  +PP +VTW KN+  I      + KY +
Sbjct: 4948 ELKVKEPPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIR----SSKKYTL 5003

Query: 207  TNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRST 266
            T+   + +L I +C   D+  Y   V N  G  S   +V ++              +  +
Sbjct: 5004 TDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALK--------------EPPS 5049

Query: 267  FGPSVE-FTSVLKPVFAREKEPFSLSCLFSEDVLDAE--SIQWFRDGSLLRSSRRRKILY 323
            F   +E  T+VLK            S  F   V  +   SI W +D  +L       I +
Sbjct: 5050 FIKKIENTTTVLKS-----------SATFQSTVAGSPPISITWLKDDQILDEDDNVYISF 5098

Query: 324  TDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRD 364
             D  A+L++        G Y  +  +  G      ++LV++
Sbjct: 5099 VDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQE 5139



 Score = 56.2 bits (134), Expect = 2e-07
 Identities = 90/499 (18%), Positives = 176/499 (35%), Gaps = 86/499 (17%)

Query: 929  EFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTLTE 988
            E  W KD +     ++ KI  K   + + +      D+G Y      A  ++ +   +  
Sbjct: 5547 EVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHC---KAQNEVGSDTCVCT 5603

Query: 989  EELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFS 1048
             +L++  +   ++ +          + ++      L   +E   P     L    + I  
Sbjct: 5604 VKLKEPPRFVSKLNS----------LTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRE 5653

Query: 1049 SPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQD--GKAKNQITLTLVDDDFDKLLRK 1106
            S N +I F      ++         + G Y  Q+++  G  +N  TL +++     ++ K
Sbjct: 5654 SENIRITFVENVATLQ--FAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAV--IVEK 5709

Query: 1107 ADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQ-- 1164
            A                 P+   V E C ++  CKV  T  E   +W+     +   Q  
Sbjct: 5710 AG----------------PMTVTVGETCTLE--CKVAGTP-ELSVEWYKDGKLLTSSQKH 5750

Query: 1165 ----YDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDD--TILDLTGDALDAIFTELGR 1218
                Y+  +   +L +E   ++D G Y   V ++ G+     ++D++  A+   FT    
Sbjct: 5751 KFSFYNKISSLRILSVE---RQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRR-- 5805

Query: 1219 IGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWL 1278
                    LK  G   G     + K      +   WFH+  ++ SG + +T  + +   L
Sbjct: 5806 --------LKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTL 5857

Query: 1279 HILDPKDSDKGKYT---LEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAK 1335
             +     SD G YT     +A   E R + T     +F                      
Sbjct: 5858 QLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVKE------------------- 5898

Query: 1336 VVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIE 1395
                 P+   ++  K +  T ++ G P  +++W +  + +   DR  +    T   + + 
Sbjct: 5899 -----PEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELF 5953

Query: 1396 KVNSEDSGRYGVFVKNKYG 1414
             ++   SG Y   V N  G
Sbjct: 5954 NIDISQSGEYTCVVSNNAG 5972



 Score = 55.8 bits (133), Expect = 3e-07
 Identities = 55/237 (23%), Positives = 90/237 (37%), Gaps = 48/237 (20%)

Query: 160  LRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRR 219
            L++  V E  +V L C +   P P VTWY+ D +I+  +     ++IT   G+  L IR 
Sbjct: 949  LKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSI----DFQITFQSGIARLMIRE 1004

Query: 220  CAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTS---- 275
               EDS  +T    N  G  S+   + V+          SE F++ T   + +FT+    
Sbjct: 1005 AFAEDSGRFTCSAVNEAGTVSTSCYLAVQV---------SEEFEKETTAVTEKFTTEEKR 1055

Query: 276  -----------------------------VLKPVFAREKEPFSLSCLFSEDVLDAESIQW 306
                                         + KPV  +  E  S+             + W
Sbjct: 1056 FVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYW 1115

Query: 307  FRDGSLLRSSRRRKILYTDR--QASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVL 361
             + G  L +  R K+ Y  +  +  L +S T+ +D G Y + V +  G    S  +L
Sbjct: 1116 KKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLL 1172



 Score = 55.8 bits (133), Expect = 3e-07
 Identities = 53/213 (24%), Positives = 84/213 (39%), Gaps = 20/213 (9%)

Query: 159  PLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIR 218
            PL+     E       C V  +   +V+WY  D +I P  F    +R+T       LEI 
Sbjct: 3350 PLQDTVTSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRF----FRMTQFEDTYQLEIA 3404

Query: 219  RCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLK 278
                ED  TYT    NA GQ SS A + +            E          +E      
Sbjct: 3405 EAYPEDEGTYTFVASNAVGQVSSTANLSLEA---------PESILHERIEQEIEMEMKAA 3455

Query: 279  PVFAREKEPFSLS----CLFSEDVLDAESI--QWFRDGSLLRSSRRRKILYTDRQASLKV 332
            PV  R+ EP  ++      F+ ++  A ++  QWF+ G  +  S +  I  +   +SL++
Sbjct: 3456 PVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEI 3515

Query: 333  SCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDA 365
              T   D G Y  +  + +G    +  + V +A
Sbjct: 3516 LRTQVVDCGEYTCKASNEYGSVSCTATLTVTEA 3548



 Score = 55.8 bits (133), Expect = 3e-07
 Identities = 80/373 (21%), Positives = 140/373 (37%), Gaps = 69/373 (18%)

Query: 1063 VEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGPYF 1122
            V + + NL  ED  +YT ++ +            DD    +L            K+ P F
Sbjct: 5292 VSLEVNNLELEDTANYTCKVSNVAG---------DDACSGILTV----------KEPPSF 5332

Query: 1123 -ERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQ---YDPETGTGLLCIEE 1178
              +P + +   D  V+    +  T    + +WF    E+  G       E  T  L +  
Sbjct: 5333 LVKPGRQQAIPDSTVEFKAILKGTPP-FKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYS 5391

Query: 1179 LSKKDKGIYRAMVSDDRGEDD--TILDLTGDALDAIFTELGRI---GALSATPLKIQGTE 1233
            +     G Y   V++D G D   T+L +T         E  +I   G  S    KI G+ 
Sbjct: 5392 VDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRLECKIAGSP 5451

Query: 1234 EGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTL 1293
            E               ++  WF  +  L + D+ R  T +D +                 
Sbjct: 5452 E---------------IRVVWFRNEHELPASDKYRM-TFIDSV----------------- 5478

Query: 1294 EIAAGKEVRQLSTDLSGQAFEDAM--AEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKT 1351
               A  ++  LST+ SG    +A   A      T  I+++    V    P +   +++  
Sbjct: 5479 ---AVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKE--PPVFSSFPPIVETLKNAE 5533

Query: 1352 LCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKN 1411
            + L C +SG P  E+ W K+ + +    +Y++  +    +I I  V++ D G Y    +N
Sbjct: 5534 VSLECELSGTPPFEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQN 5593

Query: 1412 KYGSETGQVTISV 1424
            + GS+T   T+ +
Sbjct: 5594 EVGSDTCVCTVKL 5606



 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 59/274 (21%), Positives = 105/274 (38%), Gaps = 29/274 (10%)

Query: 173  LTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRV 232
            L  TV  +P  +  WYK+       L  + KYRI+    +  L+     + DS  YT  +
Sbjct: 4036 LEYTVAGTPELKPKWYKDGRP----LVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEI 4091

Query: 233  KNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSC 292
             N  G +S      V          D +I        +  FT  L+ V +       L C
Sbjct: 4092 SNEVGSSSCETTFTV---------LDRDI--------APFFTKPLRNVDSVVNGTCRLDC 4134

Query: 293  LFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFG 352
              +  +     + WF+DG  + +S R +I + +  ASL++      D G +  R  +  G
Sbjct: 4135 KIAGSL--PMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVG 4192

Query: 353  PREQSTYVLVRDAEA--ENPGA----PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITA 406
             ++ S  ++V++  +    PG+    PGS + ++        L + W   +    +  + 
Sbjct: 4193 SKDSSGALIVQEPPSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSC 4252

Query: 407  YTIERCQGESGEWIACHEAPGGTCRCPIQGLVEG 440
            Y  +     S E      +  GT  C +  +  G
Sbjct: 4253 YITKEALESSLELYLVKTSDSGTYTCKVSNVAGG 4286



 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 120/575 (20%), Positives = 197/575 (34%), Gaps = 85/575 (14%)

Query: 861  LRVSDLQPGKSYVFQVQAMNSAGLGQPSMPT----DPVLLEDKPGAHEIEVGVDEEGFIY 916
            L+ S ++P  +  +  Q  N AG+ Q    T    +P  + +KP + ++  G        
Sbjct: 7550 LQFSRVEPANAGKYTCQIKNDAGM-QECFATLSVLEPATIVEKPESIKVTTG----DTCT 7604

Query: 917  LAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIE--DKVNKSKVILKEPGLEDLGTYSVIVT 974
            L       P+ S  +W KD K      + KI   +KV+  K+I   P   D G YS  V 
Sbjct: 7605 LECTVAGTPELST-KWFKDGKELTSDNKYKISFFNKVSGLKIINVAPS--DSGVYSFEVQ 7661

Query: 975  DADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPA 1034
            +     S + +L   +       + +++      +SG ++ +    E +++      SP 
Sbjct: 7662 NPVGKDSCTASLQVSDRTVPPSFTRKLKET--NGLSGSSVVM----ECKVYG-----SPP 7710

Query: 1035 AELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLT 1094
              +       EI  S  RK           + +  L E D G YT    +    ++ +  
Sbjct: 7711 ISVSWFHEGNEI--SSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAP 7768

Query: 1095 LVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWF 1154
            L                    R+   + ++P    V     V  T  V  T   +   WF
Sbjct: 7769 LT------------------VREPPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFS-VSWF 7809

Query: 1155 FQRAEMPDGQ---YDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDA 1211
               +E+  G       E     L + ++     G Y  +VS++ G+      L   A   
Sbjct: 7810 KGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAK 7869

Query: 1212 IFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGT 1271
                L         PL ++GT  G    S            TW      +    R    T
Sbjct: 7870 FVKRLNDYSIEKGKPLILEGTFTGTPPIS-----------VTWKKNGINVTPSQRCNITT 7918

Query: 1272 TLDEIWLHILDPKDSDKGKYT--LEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAII 1329
            T     L I      D G+Y   +E A+GK+        S Q              + I+
Sbjct: 7919 TEKSAILEIPSSTVEDAGQYNCYIENASGKD------SCSAQ--------------ILIL 7958

Query: 1330 EKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTE 1389
            E      V+ L  V   + D    L C ++G P   +SW K D  +     Y+M  R   
Sbjct: 7959 EP--PYFVKQLEPVKVSVGDSA-SLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNV 8015

Query: 1390 VTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISV 1424
             T+   +V+  DSG Y    +N  G  +    ++V
Sbjct: 8016 ATLVFNQVDINDSGEYICKAENSVGEVSASTFLTV 8050



 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 33/111 (29%), Positives = 48/111 (43%), Gaps = 4/111 (3%)

Query: 133   RRTEEKVQEAKELRELCYGRGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDT 192
             ++T E+  E    +       P   + +RSH V           VQ+ P  +V WY N  
Sbjct: 32353 QKTSERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGV 32412

Query: 193   RIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFA 243
              +      + K   TN  G+L+LEI  C  +DS TY     N  G+AS +A
Sbjct: 32413 ELQ----ESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYA 32459



 Score = 55.1 bits (131), Expect = 5e-07
 Identities = 99/499 (19%), Positives = 176/499 (35%), Gaps = 74/499 (14%)

Query: 932  WSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVT-DADEDISASHTLTEEE 990
            WSKD K         I    N   + + + G  D G Y+   T D  +D+ ++    +E 
Sbjct: 6304 WSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEP 6363

Query: 991  LEKLKKLSHEIRNPVIKLISGWNIDILERGE-VRLWLEVEKLSPAAELHLIFNNKEIFSS 1049
             + +KKL                  + ++GE ++L  ++   SP  ++    N+ E+  S
Sbjct: 6364 PKFVKKLEAS--------------KVAKQGESIQLECKISG-SPEIKVSWFRNDSELHES 6408

Query: 1050 PNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLRKADA 1109
                ++F     L+   I   S ED G Y  +  +G      +  L              
Sbjct: 6409 WKYNMSFINSVALLT--INEASAEDSGDYICEAHNGVGDASCSTALTV------------ 6454

Query: 1110 KRRDWKRKQGPYF-ERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQYDPE 1168
                   K  P F ++P      +   V L C+++ T       W   R ++ + +    
Sbjct: 6455 -------KAPPVFTQKPSPVGALKGSDVILQCEISGTPP-FEVVWVKDRKQVRNSKKFKI 6506

Query: 1169 TGTGL---LCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSAT 1225
            T       L I  L   D G Y    +++ G D     +          +L     L   
Sbjct: 6507 TSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLIGD 6566

Query: 1226 PLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKD 1285
             ++++   EG +  S V  +  +  +     ++ R+   D I T        L +  P+ 
Sbjct: 6567 AVELRAIVEGFQPISVV--WLKDRGEVIRESENTRISFIDNIAT--------LQLGSPEA 6616

Query: 1286 SDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVAT 1345
            S+ GKY  +I     +R+ S  L+             L+   IIEK         P+  T
Sbjct: 6617 SNSGKYICQIKNDAGMRECSAVLTV------------LEPARIIEK---------PEPMT 6655

Query: 1346 IMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRY 1405
            +       L C+V+G P     W K+ + ++   ++ +       ++ I      D G Y
Sbjct: 6656 VTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLY 6715

Query: 1406 GVFVKNKYGSETGQVTISV 1424
               VKN  G     V++ V
Sbjct: 6716 SFEVKNSVGKSNCTVSVHV 6734



 Score = 55.1 bits (131), Expect = 5e-07
 Identities = 26/90 (28%), Positives = 48/90 (53%), Gaps = 2/90 (2%)

Query: 1337  VRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTE--VTITI 1394
             +  LP   +I E K L + C  +G+PTPE++W    + +   ++ R  +  T+   T+ I
Sbjct: 33331 IEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLII 33390

Query: 1395  EKVNSEDSGRYGVFVKNKYGSETGQVTISV 1424
               V  +D G Y + + N++GS++  V I +
Sbjct: 33391 MDVQKQDGGLYTLSLGNEFGSDSATVNIHI 33420



 Score = 54.7 bits (130), Expect = 6e-07
 Identities = 38/144 (26%), Positives = 66/144 (45%), Gaps = 17/144 (11%)

Query: 1284  KDSDKGK-YTLEIAAGKEVRQ-LSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLP 1341
             KD  +GK YT  ++A  E  +   ++++  A +D +A    LK              GLP
Sbjct: 19943 KDLTEGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLK--------------GLP 19988

Query: 1342  DVATIM-EDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSE 1400
             D+  +  E+    L   + G P P +SW K + P+    R  +E      T+ +      
Sbjct: 19989 DLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKS 20048

Query: 1401  DSGRYGVFVKNKYGSETGQVTISV 1424
             D+G+Y + +KN  G++ G ++I V
Sbjct: 20049 DAGKYTITLKNVAGTKEGTISIKV 20072



 Score = 54.3 bits (129), Expect = 8e-07
 Identities = 46/186 (24%), Positives = 75/186 (40%), Gaps = 42/186 (22%)

Query: 175  CTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKN 234
            C +  SP  +V WYK++T I      + K+R++    +  LE+   ++EDS  YT    N
Sbjct: 7327 CKIGGSPEIKVLWYKDETEIQ----ESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHN 7382

Query: 235  AHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLF 294
            A G ASS   + V+                              P+F   K+P  +  L 
Sbjct: 7383 AAGSASSSTSLKVKE----------------------------PPIF--RKKPHPIETLK 7412

Query: 295  SEDV-LDAE-------SIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVR 346
              DV L+ E        + W++D   LRS ++ KI+  +   S+ +      D G Y  +
Sbjct: 7413 GADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCK 7472

Query: 347  VPSPFG 352
              +  G
Sbjct: 7473 ATNDVG 7478



 Score = 54.3 bits (129), Expect = 8e-07
 Identities = 45/205 (21%), Positives = 83/205 (40%), Gaps = 26/205 (12%)

Query: 160  LRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRR 219
            L  +++ +   ++L  T   +PP  VTW KN   + P    + +  IT       LEI  
Sbjct: 7874 LNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTP----SQRCNITTTEKSAILEIPS 7929

Query: 220  CAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKP 279
              +ED+  Y   ++NA G+ S  A++L+                         F   L+P
Sbjct: 7930 STVEDAGQYNCYIENASGKDSCSAQILIL--------------------EPPYFVKQLEP 7969

Query: 280  VFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKED 339
            V     +  SL C  +        + W++  + LR +   K+ + +  A+L  +     D
Sbjct: 7970 VKVSVGDSASLQCQLAG--TPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDIND 8027

Query: 340  EGLYMVRVPSPFGPREQSTYVLVRD 364
             G Y+ +  +  G    ST++ V++
Sbjct: 8028 SGEYICKAENSVGEVSASTFLTVQE 8052



 Score = 54.3 bits (129), Expect = 8e-07
 Identities = 51/196 (26%), Positives = 74/196 (37%), Gaps = 39/196 (19%)

Query: 156   FWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSL 215
             F  PL    V E  T +L C V      +V W+KN T I     ++ KY I  +  +  L
Sbjct: 12287 FTKPLEDQTVEEGATAVLECEVSRENA-KVKWFKNGTEI----LKSKKYEIVADGRVRKL 12341

Query: 216   EIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRS----TFGPSV 271
              I  C  ED  TYT                            D++ FK S       P V
Sbjct: 12342 VIHDCTPEDIKTYTC---------------------------DAKDFKTSCNLNVVPPHV 12374

Query: 272   EFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLK 331
             EF   L  +  REKE     C  S +      ++WF+DG+ ++  ++  I+       L 
Sbjct: 12375 EFLRPLTDLQVREKEMARFECELSRE---NAKVKWFKDGAEIKKGKKYDIISKGAVRILV 12431

Query: 332   VSCTYKEDEGLYMVRV 347
             ++    +DE  Y   V
Sbjct: 12432 INKCLLDDEAEYSCEV 12447



 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 52/246 (21%), Positives = 88/246 (35%), Gaps = 34/246 (13%)

Query: 154  PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLL 213
            P F   L++  + E + + +      +P P + W KN   I P  +   K RI    G  
Sbjct: 1556 PMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYP--KIRIEGTKGEA 1613

Query: 214  SLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEF 273
            +L+I     +DSA YT    N  G+ ++  KV V     +       I  R T+      
Sbjct: 1614 ALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIA 1673

Query: 274  TSVLKPVFAR------------EKE--------------------PFSLSCLFSEDVLDA 301
               L+P+  R            +KE                    P    C  +      
Sbjct: 1674 APELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPT 1733

Query: 302  ESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVL 361
              ++W  DG  L ++ R +++      SL     Y  D G+   R  + +G    S  ++
Sbjct: 1734 MVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLI 1793

Query: 362  VRDAEA 367
            V+D ++
Sbjct: 1794 VKDEKS 1799



 Score = 53.5 bits (127), Expect = 1e-06
 Identities = 48/226 (21%), Positives = 85/226 (37%), Gaps = 33/226 (14%)

Query: 175  CTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKN 234
            CTV  +P  +  W K+   + P    +  +RI++      LE+    I+D   Y+ +  N
Sbjct: 3572 CTVTGTPVIETIWQKDGAALSP----SPNWRISDAENKHILELSNLTIQDRGVYSCKASN 3627

Query: 235  AHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLF 294
              G     A++++                         F   L+PV +   +   L C  
Sbjct: 3628 KFGADICQAELIIID--------------------KPHFIKELEPVQSAINKKVHLECQV 3667

Query: 295  SEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPR 354
             ED     ++ W +DG  L   +  KI + D+ A+L++     +D G Y+    +  G  
Sbjct: 3668 DED--RKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSS 3725

Query: 355  EQSTYVLVRD----AEAENPG---APGSPLNVRCLDVNRDCLILTW 393
              S  V VR+     +  +P     PG    + C       + +TW
Sbjct: 3726 SCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTW 3771



 Score = 53.5 bits (127), Expect = 1e-06
 Identities = 54/218 (24%), Positives = 87/218 (39%), Gaps = 40/218 (18%)

Query: 154  PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLL 213
            P+F  PLR+     + T  L C +  S P +V+W+K+   I      + +YRI    G  
Sbjct: 4113 PFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEI----AASDRYRIAFVEGTA 4168

Query: 214  SLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVR---TYLGKDAGFD----SEIFKRST 266
            SLEI R  + D+  +T R  N+ G   S   ++V+   +++ K    D    S +  +ST
Sbjct: 4169 SLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPGSKDVLPGSAVCLKST 4228

Query: 267  FGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDR 326
            F  S   T                             I+WF+    L S     I     
Sbjct: 4229 FQGSTPLT-----------------------------IRWFKGNKELVSGGSCYITKEAL 4259

Query: 327  QASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRD 364
            ++SL++      D G Y  +V +  G  E S  + V++
Sbjct: 4260 ESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKE 4297



 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 42/185 (22%), Positives = 75/185 (40%), Gaps = 22/185 (11%)

Query: 1241 KVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKE 1300
            +VK+   + +   WF   + L  G + +   T     L I+  +  D G+YT E+     
Sbjct: 4599 QVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEV----- 4653

Query: 1301 VRQLSTDLSGQAFEDAMAEHQRLKTL-AIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVS 1359
                  D+   + +       R+  L  II  +  K ++ +  +     D    L CIV+
Sbjct: 4654 ----QNDVGRSSCK------ARINVLDLIIPPSFTKKLKKMDSIKGSFID----LECIVA 4699

Query: 1360 GDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSE--T 1417
            G     I W K+DQ ++  ++Y+         + I ++   DSG Y     NK G    +
Sbjct: 4700 GSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCS 4759

Query: 1418 GQVTI 1422
            G +T+
Sbjct: 4760 GHLTV 4764



 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 71/402 (17%), Positives = 153/402 (38%), Gaps = 61/402 (15%)

Query: 1030 KLSPAAELHLIF--NNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKA 1087
            K++ + E+ +++  N  E+ +S   ++ F     ++++   NLS ED G +  + Q+   
Sbjct: 5446 KIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQM--NNLSTEDSGDFICEAQNPAG 5503

Query: 1088 KNQITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFER-PLQWKVTEDCQVQLTCKVTNTK 1146
                +  ++                    K+ P F   P   +  ++ +V L C+++ T 
Sbjct: 5504 STSCSTKVIV-------------------KEPPVFSSFPPIVETLKNAEVSLECELSGTP 5544

Query: 1147 KETRFQWFFQRAEMPDGQYDPETGTGL---LCIEELSKKDKGIYRAMVSDDRGEDDTILD 1203
                  W+  + ++   +            + I  +   D G Y     ++ G D  +  
Sbjct: 5545 P-FEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCT 5603

Query: 1204 LTGDALDAIFTELGRIGALSATPLKIQGTEEGIR-IFSKVKYYNVEYMKTTWFHKDKRLE 1262
            +         ++L  +  ++  P ++Q + EG + IF       V+++K     K++ + 
Sbjct: 5604 VKLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPIF-------VQWLK----EKEEVIR 5652

Query: 1263 SGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQR 1322
              + IR     +   L     + ++ GKY  +I     +R+             MA    
Sbjct: 5653 ESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRE------------NMATLMV 5700

Query: 1323 LKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYR 1382
            L+   I+EK             T+   +T  L C V+G P   + W K+ + +T   +++
Sbjct: 5701 LEPAVIVEK---------AGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHK 5751

Query: 1383 MEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISV 1424
                    ++ I  V  +D+G Y   V+N  G  +    + V
Sbjct: 5752 FSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDV 5793



 Score = 52.8 bits (125), Expect = 2e-06
 Identities = 31/92 (33%), Positives = 48/92 (52%), Gaps = 4/92 (4%)

Query: 1342  DVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSE- 1400
             D  TI   +   LT   SG P P++SW K++  V  L+  R  ++ T  T+ +EK+ ++ 
Sbjct: 16826 DKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADV--LEDDRTHIKTTPATLALEKIKAKR 16883

Query: 1401  -DSGRYGVFVKNKYGSETGQVTISVFKHGDEP 1431
              DSG+Y V V+N  GS  G   ++V      P
Sbjct: 16884 SDSGKYCVVVENSTGSRKGFCQVNVVDRPGPP 16915



 Score = 52.8 bits (125), Expect = 2e-06
 Identities = 33/106 (31%), Positives = 50/106 (47%), Gaps = 2/106 (1%)

Query: 1329  IEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGT 1388
             IE    ++   L  V  +    TL L   + G P PE+ W K +  +T  DR ++EV  +
Sbjct: 25102 IEPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT--DRAQIEVTSS 25159

Query: 1389  EVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKEL 1434
                + I+ V   DSGRY + ++N  GS+T  V + V      P  L
Sbjct: 25160 FTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNL 25205



 Score = 52.8 bits (125), Expect = 2e-06
 Identities = 26/83 (31%), Positives = 41/83 (49%)

Query: 1342  DVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSED 1401
             D+ TI     L L   V G P P+I W K D+ +   ++  ++  G   T  I+  +  D
Sbjct: 29055 DLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSD 29114

Query: 1402  SGRYGVFVKNKYGSETGQVTISV 1424
             SG+Y + VKN  G++   V + V
Sbjct: 29115 SGKYTLTVKNASGTKAVSVMVKV 29137



 Score = 52.4 bits (124), Expect = 3e-06
 Identities = 48/213 (22%), Positives = 84/213 (39%), Gaps = 23/213 (10%)

Query: 154  PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLL 213
            P+F  PL            L C V  +P  +++WYK  T++  R   A K +  NN  + 
Sbjct: 7020 PYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKL--RSAPAYKMQFKNN--VA 7075

Query: 214  SLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEF 273
            SL I +    D   Y+ +  N+ G  +S A ++++              K   F     F
Sbjct: 7076 SLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKAR------------KLPPF-----F 7118

Query: 274  TSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVS 333
               LK V      P +  C  +    +   + W++DG LL+     +  +    A+L++ 
Sbjct: 7119 ARKLKDVHETLGFPVAFECRINGS--EPLQVSWYKDGVLLKDDANLQTSFVHNVATLQIL 7176

Query: 334  CTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAE 366
             T +   G Y     +P G    S  +++ + E
Sbjct: 7177 QTDQSHIGQYNCSASNPLGTASSSAKLILSEHE 7209



 Score = 52.0 bits (123), Expect = 4e-06
 Identities = 119/563 (21%), Positives = 208/563 (36%), Gaps = 101/563 (17%)

Query: 917  LAFEAPEAPDSSEFQW---SKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIV 973
            +AFE   + D+   +W   S + K P D  R+  E KV+K  ++L+     D G Y+ +V
Sbjct: 2812 VAFEVSVSHDTVPVKWFHKSVEIK-PSDKHRLVSERKVHK--LMLQNISPSDAGEYTAVV 2868

Query: 974  TDAD-------EDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWL 1026
               +       E +  + T+   E+ + K  S E        +S +N+         +WL
Sbjct: 2869 GQLECKAKLFVETLHITKTMKNIEVPETKTASFECE------VSHFNVP-------SMWL 2915

Query: 1027 EVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGK 1086
            +              N  EI  S   KI    +  L ++II N S ED   YT     G 
Sbjct: 2916 K--------------NGVEIEMSEKFKIVVQGK--LHQLIIMNTSTEDSAEYT--FVCGN 2957

Query: 1087 AKNQITLTLVDDDFDKLLRKADAKRRD---------WKRKQGPYFERPLQWKVTEDCQVQ 1137
             +   TLT+       +L+  +A+ +D         ++     + +  ++ K T+ CQ++
Sbjct: 2958 DQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMR 3017

Query: 1138 LTCKVTNTKKETRFQWFFQRAEMPDGQYDPETGTGLLCIE----ELSKKDKGI-----YR 1188
             T K+T++         F  A          T T  L +E    E  K  K I      R
Sbjct: 3018 -TKKLTHSLNIRNVH--FGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKR 3074

Query: 1189 AMVSDDRGEDDTILDLTGDALDAIFTELGRI---------------------------GA 1221
            AM   +  E D  +    D  +   T+  +I                           G 
Sbjct: 3075 AMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGN 3134

Query: 1222 LSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHIL 1281
            +S   L ++G +  IR   K      +      F  ++     D +      D I ++  
Sbjct: 3135 VSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNE-----DDVDAHWYKDGIEINF- 3188

Query: 1282 DPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLP 1341
              +  ++ KY +E    +     +       +      ++   TL +      +V++ L 
Sbjct: 3189 --QVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQ 3246

Query: 1342 DVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSED 1401
             V T+   K      ++SG P P+ISW K +Q ++   + +    G E T+ + +   ED
Sbjct: 3247 PV-TVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPED 3305

Query: 1402 SGRYGVFVKNKYGSETGQVTISV 1424
            +  Y    KN YG  T   ++SV
Sbjct: 3306 AAVYTCEAKNDYGVATTSASLSV 3328



 Score = 52.0 bits (123), Expect = 4e-06
 Identities = 48/197 (24%), Positives = 81/197 (41%), Gaps = 25/197 (12%)

Query: 169  TTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATY 228
            + V L  T Q S P  + W+K +      L   G   IT      SLE+      DS TY
Sbjct: 4221 SAVCLKSTFQGSTPLTIRWFKGNKE----LVSGGSCYITKEALESSLELYLVKTSDSGTY 4276

Query: 229  TVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPF 288
            T +V N  G     A + V+              + +TF   +E + +LK   A +    
Sbjct: 4277 TCKVSNVAGGVECSANLFVK--------------EPATFVEKLEPSQLLKKGDATQ---- 4318

Query: 289  SLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVP 348
             L+C  +        I WF +   ++ S + ++ + +  A L+++    ED G YM    
Sbjct: 4319 -LACKVTGT--PPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQ 4375

Query: 349  SPFGPREQSTYVLVRDA 365
            +  G    S+ V+V+++
Sbjct: 4376 NEAGSDHCSSIVIVKES 4392



 Score = 51.6 bits (122), Expect = 5e-06
 Identities = 104/528 (19%), Positives = 201/528 (38%), Gaps = 96/528 (18%)

Query: 904  EIEVGVDEEGFIYLAFEAPEAPDSSEFQWSKD----YKGPLDPQRVKIEDKVNKSKVILK 959
            E++  V +E      FE   +    + +W KD    ++G  D  R+  + KV+   ++  
Sbjct: 2179 ELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEG--DKYRMHSDRKVHFLSILTI 2236

Query: 960  EPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILER 1019
            +    D   YS ++ + +   + +  + E  + +  K   +I  P  +  SG        
Sbjct: 2237 DTS--DAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVP--ESYSG-------- 2284

Query: 1020 GEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYT 1079
                   E+E +     +   + + ++    N K      +G   + ++++++ED+G Y+
Sbjct: 2285 -------ELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYS 2337

Query: 1080 AQLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLT 1139
              + DGK               K   K   K R     QG   +     KV E   VQL 
Sbjct: 2338 FVI-DGK---------------KTTCKLKMKPRPIAILQGLSDQ-----KVCEGDIVQLE 2376

Query: 1140 CKVTNTKKETRFQWFFQRAEMPDGQYDP-ETGTGLLCIEELSKKDKGIYRAMVSDDRGED 1198
             KV+    E  +    Q  +  D  +   +  + +L IE+++K+D G Y           
Sbjct: 2377 VKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNY----------- 2425

Query: 1199 DTILDLTGDALDAIFTELGRIGALSA---TPLKIQGTEEGIRIFSKVKYYNVEYMKTTWF 1255
                  T  AL    +  GR+   S    TPLK     EG +   + K    +     W+
Sbjct: 2426 ----SFTIPALG--LSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWY 2479

Query: 1256 HKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFED 1315
              D++++  DR++      +  L I     SD+G Y L +                    
Sbjct: 2480 LNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVG------------------- 2520

Query: 1316 AMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPV 1375
                  R++T   +   + K++RGL D+ T  E + +     +S     ++ W   D+ +
Sbjct: 2521 ------RVETNCNLSVEKIKIIRGLRDL-TCTETQNVVFEVELSHSGI-DVLWNFKDKEI 2572

Query: 1376 TFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTIS 1423
                +Y++E  G    +T+  +  +D G+Y  +      S  G++T++
Sbjct: 2573 KPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTS--GKLTVA 2618



 Score = 51.2 bits (121), Expect = 7e-06
 Identities = 51/204 (25%), Positives = 87/204 (42%), Gaps = 23/204 (11%)

Query: 161  RSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRC 220
            +S  V E   + L C V  +P  +V W K+  +I P  + +  +   NN  + S  I+  
Sbjct: 5148 KSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFE--NN--VASFRIQSV 5203

Query: 221  AIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPV 280
              +DS  YT +V+N  G +S  A + V      D        K+ T    V  +S+    
Sbjct: 5204 MKQDSGQYTFKVENDFGSSSCDAYLRVL-----DQNIPPSFTKKLTKMDKVLGSSI---- 5254

Query: 281  FAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDE 340
                     + C  S  +    S QWF+DG  + +S + +++  +R  SL+V+    ED 
Sbjct: 5255 --------HMECKVSGSL--PISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDT 5304

Query: 341  GLYMVRVPSPFGPREQSTYVLVRD 364
              Y  +V +  G    S  + V++
Sbjct: 5305 ANYTCKVSNVAGDDACSGILTVKE 5328



 Score = 50.8 bits (120), Expect = 9e-06
 Identities = 50/196 (25%), Positives = 77/196 (39%), Gaps = 25/196 (12%)

Query: 170  TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT 229
            T  L CTV  +P     W+K+       L    KY+I+    +  L+I   A  DS  Y+
Sbjct: 7602 TCTLECTVAGTPELSTKWFKDGKE----LTSDNKYKISFFNKVSGLKIINVAPSDSGVYS 7657

Query: 230  VRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFS 289
              V+N  G+ S  A + V                  T  PS  FT  LK           
Sbjct: 7658 FEVQNPVGKDSCTASLQVSD---------------RTVPPS--FTRKLKETNGLSGSSVV 7700

Query: 290  LSC-LFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVP 348
            + C ++    +   S+ WF +G+ + S R+ +   TD   +L V+   + D G Y     
Sbjct: 7701 MECKVYGSPPI---SVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIAT 7757

Query: 349  SPFGPREQSTYVLVRD 364
            +  G  E S  + VR+
Sbjct: 7758 NMAGSDECSAPLTVRE 7773



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 113/506 (22%), Positives = 194/506 (38%), Gaps = 78/506 (15%)

Query: 957  ILKEPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIK--LISGW-N 1013
            + KE G+   GT     T  +E     H   E ++ +  ++   +  PV    L+SG  N
Sbjct: 898  VKKEVGVSITGT-----TVREERFEVLHG-REAKVTETARVPAPVEIPVTPPTLVSGLKN 951

Query: 1014 IDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEE 1073
            + ++E   V L   +    P+  +     + +I SS + +I F  + G+  ++I+    E
Sbjct: 952  VTVIEGESVTLECHISGY-PSPTVTWYREDYQIESSIDFQITF--QSGIARLMIREAFAE 1008

Query: 1074 DKGSYTAQL--QDGKAKNQITLTL-VDDDFDK---------------LLRKADAKRRDWK 1115
            D G +T     + G       L + V ++F+K                +   D    D  
Sbjct: 1009 DSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTS 1068

Query: 1116 RKQ---------GPYF-ERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDG-- 1163
              +          PYF  +P+  K+ E   V   C+V    K   + W      +  G  
Sbjct: 1069 LTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVY-WKKSGVPLTTGYR 1127

Query: 1164 ---QYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGR-- 1218
                Y+ +TG   L I      D G Y  +V +  GE      L  +A   +  +  +  
Sbjct: 1128 YKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEM 1187

Query: 1219 -----IGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTL 1273
                 + A    P K+  T  G  ++S+   Y  EY K     + K  +  D +   T +
Sbjct: 1188 LYQTQVTAFVQEP-KVGETAPGF-VYSE---YEKEYEKEQALIRKKMAK--DTVVVRTYV 1240

Query: 1274 DEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNR 1333
            ++   HI     S + +   EI    E R + T L     E+ + E    K    I ++ 
Sbjct: 1241 EDQEFHI----SSFEERLIKEI----EYRIIKTTL-----EELLEEDGEEKMAVDISESE 1287

Query: 1334 AKVVRGLPDVAT---IMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRME-VRGTE 1389
            A V  G         I+E   +   C +SG P P+I+W K+ + +   +RY+M+ ++   
Sbjct: 1288 A-VESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGR 1346

Query: 1390 VTITIEKVNSEDSGRYGVFVKNKYGS 1415
             ++ I  V  ED G Y  F  N  G+
Sbjct: 1347 ASLRIPVVLPEDEGIYTAFASNIKGN 1372



 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 66/298 (22%), Positives = 109/298 (36%), Gaps = 71/298 (23%)

Query: 171  VLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTV 230
            V L  T++ + P  V W+K+   I   +  +    I+ +  + +L+  R    ++  YT 
Sbjct: 7509 VQLQTTIEGAEPISVVWFKDKGEI---VRESDNIWISYSENIATLQFSRVEPANAGKYTC 7565

Query: 231  RVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSL 290
            ++KN  G    FA +                             SVL+P    EK P S+
Sbjct: 7566 QIKNDAGMQECFATL-----------------------------SVLEPATIVEK-PESI 7595

Query: 291  ------SCLFSEDVLDAE--SIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGL 342
                  +C     V      S +WF+DG  L S  + KI + ++ + LK+      D G+
Sbjct: 7596 KVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDSGV 7655

Query: 343  YMVRVPSPFGPREQSTYVLVRDAEA---------ENPGAPGSPLNVRCLDVNRDCLILTW 393
            Y   V +P G    +  + V D            E  G  GS + + C       + ++W
Sbjct: 7656 YSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSW 7715

Query: 394  APPSDTRGNPI-------TAYTIERC--------QGESGEW--IACHEAPGGTCRCPI 434
                   GN I       T  T   C        + +SG++  IA + A    C  P+
Sbjct: 7716 F----HEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPL 7769



 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 92/519 (17%), Positives = 189/519 (36%), Gaps = 100/519 (19%)

Query: 917   LAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTD- 975
             + F      + ++ +W ++ +   D  +  I  K     + +++  L+D   Y+V +T+ 
Sbjct: 12657 VVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNH 12716

Query: 976   -ADEDISASHTLTEEE----LEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEK 1030
               +   SA++ + EEE    +E LK                 +I+ +E+  V  W +V +
Sbjct: 12717 RGENVKSAANLIVEEEDLRIVEPLK-----------------DIETMEKKSVTFWCKVNR 12759

Query: 1031  LSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQ 1090
             L+    L    N +E+          D+ K ++   I++    D+G Y       K+  +
Sbjct: 12760 LN--VTLKWTKNGEEVPFDNRVSYRVDKYKHMLT--IKDCGFPDEGEYIVTAGQDKSVAE 12815

Query: 1091  ITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETR 1150
             + +     +F + L                         VTE      +C+++  K   +
Sbjct: 12816 LLIIEAPTEFVEHLEDQT---------------------VTEFDDAVFSCQLSREKANVK 12854

Query: 1151  FQWFFQRAEMPDGQYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDT-----ILDLT 1205
               W+    E+ +G+            +   +KD  I+R ++ D R +D+      + D  
Sbjct: 12855 --WYRNGREIKEGK------------KYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRK 12900

Query: 1206  GDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGD 1265
               A   +F E   +  +      ++     +   +++   N + ++  W   +  +  GD
Sbjct: 12901 SRA--RLFVEEIPVEIIRPPQDILEAPGADVVFLAEL---NKDKVEVQWLRNNMVVVQGD 12955

Query: 1266  RIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKT 1325
             + +  +      L I D K  D+G+Y   IA  KE R                       
Sbjct: 12956 KHQMMSEGKIHRLQICDIKPRDQGEYRF-IAKDKEAR----------------------- 12991

Query: 1326  LAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEV 1385
              A +E   A  ++       +   K L +       P  E  W K ++P   L    ++ 
Sbjct: 12992 -AKLELAAAPKIKTADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEP---LSTKTIDT 13047

Query: 1386  RGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISV 1424
                + +  I +    D GRY + ++NK+G   G + + V
Sbjct: 13048 TAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKV 13086



 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 52/195 (26%), Positives = 80/195 (41%), Gaps = 36/195 (18%)

Query: 160  LRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRR 219
            ++S  V + +       V   P P+  WYKN  +I+ R  R   Y   +N  +  L IR 
Sbjct: 2084 IQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIE-RSDRIYWYWPEDN--VCELVIRD 2140

Query: 220  CAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKP 279
               EDSA+  V+  N  G+ SS A +LV+                      + FT  L+ 
Sbjct: 2141 VTAEDSASIMVKAINIAGETSSHAFLLVQA------------------KQLITFTQELQD 2182

Query: 280  VFAREKEPF-SLSCLFSEDVLDAESIQWFRDGS--------LLRSSRR---RKILYTDRQ 327
            V A+EK+   +  C  SE  +    ++W++DG          + S R+     IL  D  
Sbjct: 2183 VVAKEKDTMATFECETSEPFV---KVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTS 2239

Query: 328  ASLKVSCTYKEDEGL 342
             +   SC   EDE +
Sbjct: 2240 DAEDYSCVLVEDENV 2254



 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 83/405 (20%), Positives = 153/405 (37%), Gaps = 67/405 (16%)

Query: 1032 SPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQI 1091
            +P   +    + K + SS   K +F  +   + ++  ++  +D G+YT Q+Q+   K+  
Sbjct: 5730 TPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRIL--SVERQDAGTYTFQVQNNVGKSSC 5787

Query: 1092 TLTLVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQ---WKVTEDCQVQLTCKVTNTKKE 1148
            T  +   D                R   P F R L+     +   C ++  CKV  +   
Sbjct: 5788 TAVVDVSD----------------RAVPPSFTRRLKNTGGVLGASCILE--CKVAGSSPI 5829

Query: 1149 TRFQWFFQRAEMPDGQYDPETGTGLLC---IEELSKKDKGIYRAMVSDDRGEDDTILDLT 1205
            +   WF ++ ++  G     T +  +C   +  L   D G Y  + ++  G D+    LT
Sbjct: 5830 S-VAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLT 5888

Query: 1206 GDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGD 1265
                 +   E   +  L    +       G   F           K  WF   + L  GD
Sbjct: 5889 VQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPF-----------KVNWFRGARELVKGD 5937

Query: 1266 R--IRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRL 1323
            R  I    T+ E+ L  +D   S  G+YT  ++            +GQA           
Sbjct: 5938 RCNIYFEDTVAELELFNIDISQS--GEYTCVVSNN----------AGQAS---------- 5975

Query: 1324 KTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRM 1383
             T  +  K  A  ++ L D  ++   K++ L    +G     ++W K+   +T  ++  +
Sbjct: 5976 CTTRLFVKEPAAFLKRLSD-HSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNI 6034

Query: 1384 EVRGTEVTITIEKVNS--EDSGRYGVFVKNKYGSETGQVTISVFK 1426
                TE T  +E +NS   D+G+Y   ++N+ G +     +S  +
Sbjct: 6035 VT--TEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLE 6077



 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 51/231 (22%), Positives = 93/231 (40%), Gaps = 35/231 (15%)

Query: 171  VLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTV 230
            V+L C +  +PP +V W K+  ++      + K++IT+ +   SL I      D   Y  
Sbjct: 6475 VILQCEISGTPPFEVVWVKDRKQVR----NSKKFKITSKHFDTSLHILNLEASDVGEYHC 6530

Query: 231  RVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRST-FGPSVEFTSVLKPVFAREKEPFS 289
            +  N  G  +    V  +    +   F  ++   ST  G +VE  ++++       +P  
Sbjct: 6531 KATNEVGSDTCSCSVKFK----EPPRFVKKLSDTSTLIGDAVELRAIVEGF-----QPI- 6580

Query: 290  LSCLFSEDVLDAESIQWFRD-GSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVP 348
                         S+ W +D G ++R S   +I + D  A+L++      + G Y+ ++ 
Sbjct: 6581 -------------SVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIK 6627

Query: 349  SPFGPREQSTYVLV----RDAEAENP--GAPGSPLNVRCLDVNRDCLILTW 393
            +  G RE S  + V    R  E   P     G+P  + C+      L   W
Sbjct: 6628 NDAGMRECSAVLTVLEPARIIEKPEPMTVTTGNPFALECVVTGTPELSAKW 6678



 Score = 49.3 bits (116), Expect = 3e-05
 Identities = 48/216 (22%), Positives = 92/216 (42%), Gaps = 36/216 (16%)

Query: 154  PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAG-KYRITNNYGL 212
            P+F    +   V +   V+L   V  +PP ++TW+K++T     + R+G KY+      L
Sbjct: 4393 PYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNT-----ILRSGRKYKTFIQDHL 4447

Query: 213  LSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTF-GPSV 271
            +SL+I +    D+  Y  RV N  G +   A+V +R    +   F  +I   S+  G + 
Sbjct: 4448 VSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLR----EPPSFIKKIESTSSLRGGTA 4503

Query: 272  EFTSVLK---PVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQA 328
             F + LK   P+                      ++ W +D   +      ++ + +  A
Sbjct: 4504 AFQATLKGSLPI----------------------TVTWLKDSDEITEDDNIRMTFENNVA 4541

Query: 329  SLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRD 364
            SL +S    + +G Y+ +  +  G +  S  + V++
Sbjct: 4542 SLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKE 4577



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 24/96 (25%), Positives = 45/96 (46%)

Query: 1340  LPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNS 1399
             +  + T+     +CL   V G P P +SW K+   +   +  +M ++    T+ +  VN 
Sbjct: 19301 MKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNR 19360

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
             +DSG Y +  +N  GS++  + + V      P  +K
Sbjct: 19361 KDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVK 19396



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 23/75 (30%), Positives = 38/75 (50%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             +SG P P I+W K+  P+    R  +       T++I++ + +D G+YG+ V N  G +T
Sbjct: 23253 ISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKT 23312

Query: 1418  GQVTISVFKHGDEPK 1432
               + I      D PK
Sbjct: 23313 ASIEIVTLDKPDPPK 23327



 Score = 48.1 bits (113), Expect = 6e-05
 Identities = 70/332 (21%), Positives = 132/332 (39%), Gaps = 40/332 (12%)

Query: 1120 PYFERPLQWKVTEDCQ-VQLTCKVTNTKKETRFQWFFQRAEMPDGQYDPET---GTGLLC 1175
            P    PLQ  VT + Q  +  C+V+ T  + +  W+ +  ++   ++   T    T  L 
Sbjct: 3345 PAIITPLQDTVTSEGQPARFQCRVSGT--DLKVSWYSKDKKIKPSRFFRMTQFEDTYQLE 3402

Query: 1176 IEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGA-----LSATPL--- 1227
            I E   +D+G Y  + S+  G+  +  +L+ +A ++I  E  RI       + A P+   
Sbjct: 3403 IAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHE--RIEQEIEMEMKAAPVIKR 3460

Query: 1228 KIQGTEEGIRIFSKV--KYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKD 1285
            KI+  E  +   +K   +  +   ++  WF   + +   D+    ++     L IL  + 
Sbjct: 3461 KIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQV 3520

Query: 1286 SDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVAT 1345
             D G+YT +  A  E   +S                   TL + E      +   P   T
Sbjct: 3521 VDCGEYTCK--ASNEYGSVSCTA----------------TLTVTEAYPPTFL-SRPKSLT 3561

Query: 1346 IMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRY 1405
                K     C V+G P  E  W K+   ++    +R+     +  + +  +  +D G Y
Sbjct: 3562 TFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVY 3621

Query: 1406 GVFVKNKYGSETGQVTISVFKHGDEPKELKSM 1437
                 NK+G++  Q  + +    D+P  +K +
Sbjct: 3622 SCKASNKFGADICQAELIII---DKPHFIKEL 3650



 Score = 48.1 bits (113), Expect = 6e-05
 Identities = 48/196 (24%), Positives = 80/196 (40%), Gaps = 29/196 (14%)

Query: 171  VLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGK-YRITNNYGLLSLEIRRCAIEDSATYT 229
            V L C V       VTW K+  ++ P     GK Y+I     + +LEI    ++DS TY 
Sbjct: 3661 VHLECQVDEDRKVTVTWSKDGQKLPP-----GKDYKICFEDKIATLEIPLAKLKDSGTYV 3715

Query: 230  VRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFS 289
                N  G +S  A V VR              +  +F   V+ + ++ P      E   
Sbjct: 3716 CTASNEAGSSSCSATVTVR--------------EPPSFVKKVDPSYLMLP-----GESAR 3756

Query: 290  LSC-LFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVP 348
            L C L    V+    + WF++   L  S   ++ + + +A L ++    ED G Y     
Sbjct: 3757 LHCKLKGSPVI---QVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAV 3813

Query: 349  SPFGPREQSTYVLVRD 364
            +  G    ST +++++
Sbjct: 3814 NDVGSDSCSTEIVIKE 3829



 Score = 48.1 bits (113), Expect = 6e-05
 Identities = 44/194 (22%), Positives = 77/194 (39%), Gaps = 25/194 (12%)

Query: 171  VLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTV 230
            V L   V+   P  V W K+   +   +  +   RI+    + +L++      +S  Y  
Sbjct: 6568 VELRAIVEGFQPISVVWLKDRGEV---IRESENTRISFIDNIATLQLGSPEASNSGKYIC 6624

Query: 231  RVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSL 290
            ++KN  G     A + V           + I ++             +P+      PF+L
Sbjct: 6625 QIKNDAGMRECSAVLTVLE--------PARIIEKP------------EPMTVTTGNPFAL 6664

Query: 291  SCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSP 350
             C+ +       S +WF+DG  L +  +  I + ++ ASLK+ C    D+GLY   V + 
Sbjct: 6665 ECVVTGT--PELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNS 6722

Query: 351  FGPREQSTYVLVRD 364
             G    +  V V D
Sbjct: 6723 VGKSNCTVSVHVSD 6736



 Score = 48.1 bits (113), Expect = 6e-05
 Identities = 49/206 (23%), Positives = 82/206 (39%), Gaps = 30/206 (14%)

Query: 160  LRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRR 219
            L   +V   + ++L  T   +PP  V+W K++  I     ++ +  IT       LEI  
Sbjct: 6933 LADFSVETGSPIVLEATYTGTPPISVSWIKDEYLIS----QSERCSITMTEKSTILEILE 6988

Query: 220  CAIEDSATYTVRVKNAHGQ--ASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVL 277
              IED A Y+  ++N  GQ    +   VL   Y                      F   L
Sbjct: 6989 STIEDYAQYSCLIENEAGQDICEALVSVLEPPY----------------------FIEPL 7026

Query: 278  KPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYK 337
            + V A   EP +L C    D      I W+++ + LRS+   K+ + +  ASL ++    
Sbjct: 7027 EHVEAVIGEPATLQC--KVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDH 7084

Query: 338  EDEGLYMVRVPSPFGPREQSTYVLVR 363
             D G Y  +  +  G    S  ++++
Sbjct: 7085 SDVGEYSCKADNSVGAVASSAVLVIK 7110



 Score = 48.1 bits (113), Expect = 6e-05
 Identities = 25/87 (28%), Positives = 43/87 (49%)

Query: 1345  TIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGR 1404
             +I   + L +   V G P P ISW+K+ +P+    R  +E   T   + I++ N +D G+
Sbjct: 24322 SIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGK 24381

Query: 1405  YGVFVKNKYGSETGQVTISVFKHGDEP 1431
             Y V   N  G+ T  +++ V +    P
Sbjct: 24382 YTVTATNSAGTATENLSVIVLEKPGPP 24408



 Score = 48.1 bits (113), Expect = 6e-05
 Identities = 50/180 (27%), Positives = 73/180 (40%), Gaps = 21/180 (11%)

Query: 124   QRRDWKTLRRRTEEKVQEAKELRELCYGRGPWFWIPLRSHAVWEHTTVLLTCTVQASPPP 183
             Q+    T+ R+TE K  E    +       P     L+   V   +           P P
Sbjct: 32829 QKTTESTVTRKTEPKAPEPISSK-------PVIVTGLQDTTVSSDSVAKFAVKATGEPRP 32881

Query: 184   QVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFA 243
                W K+   I     + GKY+++ + G   LEI +    DS  YT  VKN+ G  SS  
Sbjct: 32882 TAIWTKDGKAIT----QGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSC 32937

Query: 244   KVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVLDAES 303
             K+ ++      A  D+E  K ST   S E T   K V    +E  S   L SE++  +E+
Sbjct: 32938 KLTIK------AIKDTEAQKVSTQKTS-EITPQKKAVV---QEEISQKALRSEEIKMSEA 32987



 Score = 47.8 bits (112), Expect = 8e-05
 Identities = 45/211 (21%), Positives = 84/211 (39%), Gaps = 25/211 (11%)

Query: 154  PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLL 213
            P F   L S  V       L  +++ + P  V W K    +   +  +   RIT    + 
Sbjct: 5610 PRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEV---IRESENIRITFVENVA 5666

Query: 214  SLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEF 273
            +L+  +    ++  Y  ++KN  G   + A ++V                     P+V  
Sbjct: 5667 TLQFAKAEPANAGKYICQIKNDGGMRENMATLMV-------------------LEPAV-I 5706

Query: 274  TSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVS 333
                 P+     E  +L C  +       S++W++DG LL SS++ K  + ++ +SL++ 
Sbjct: 5707 VEKAGPMTVTVGETCTLECKVAGT--PELSVEWYKDGKLLTSSQKHKFSFYNKISSLRIL 5764

Query: 334  CTYKEDEGLYMVRVPSPFGPREQSTYVLVRD 364
               ++D G Y  +V +  G    +  V V D
Sbjct: 5765 SVERQDAGTYTFQVQNNVGKSSCTAVVDVSD 5795



 Score = 47.8 bits (112), Expect = 8e-05
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 2/96 (2%)

Query: 1340  LPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNS 1399
             L  +  I    +L L   + G PTPE+ W K D  +   D   ++V  +  ++ ++ VN 
Sbjct: 22948 LRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIR--DAAIIDVTSSFTSLVLDNVNR 23005

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
              DSG+Y + ++N  G+++  VT+ V      P  LK
Sbjct: 23006 YDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLK 23041



 Score = 47.8 bits (112), Expect = 8e-05
 Identities = 40/170 (23%), Positives = 78/170 (45%), Gaps = 16/170 (9%)

Query: 1257  KDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQA-FED 1315
             ++K  +   R+ T  T+      + D K   K  Y+  +AA         ++ G + + +
Sbjct: 29381 QEKDTDQWYRVHTNATIRNTEFTVPDLKMGQK--YSFRVAA--------VNVKGMSEYSE 29430

Query: 1316  AMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPV 1375
             ++AE + ++ + I +   A     L    TI    +L L   VSG P P I+W K  Q +
Sbjct: 29431 SIAEIEPVERIEIPDLELAD---DLKKTVTIRAGASLRLMVSVSGRPPPVITWSK--QGI 29485

Query: 1376  TFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVF 1425
                 R  ++   +   + ++KVN  D+G+Y +  +N+ G ++  V + V+
Sbjct: 29486 DLASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVY 29535



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 23/84 (27%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 1341 PDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEV--RGTEVTITIEKVN 1398
            P V  ++E  ++   C V G+P P + W K+  P+T   RY++    +  E  + I    
Sbjct: 1088 PVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTF 1147

Query: 1399 SEDSGRYGVFVKNKYGSETGQVTI 1422
            ++D+G Y + V+NK+G  +   ++
Sbjct: 1148 ADDAGEYTIVVRNKHGETSASASL 1171



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 48/193 (24%), Positives = 82/193 (42%), Gaps = 25/193 (12%)

Query: 174  TCTVQASPPPQVT--WYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVR 231
            T  V+ S   ++T  W+K+       L    KY+I+    +  L+I     +DS  YT  
Sbjct: 4597 TLQVKFSGTKEITAKWFKDGQE----LTLGSKYKISVTDTVSILKIISTEKKDSGEYTFE 4652

Query: 232  VKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLS 291
            V+N  G++S  A++ V   +                 PS  FT  LK + + +     L 
Sbjct: 4653 VQNDVGRSSCKARINVLDLI---------------IPPS--FTKKLKKMDSIKGSFIDLE 4695

Query: 292  CLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPF 351
            C+ +       SIQWF+D   + +S + K  + D  A L++S     D G Y     +  
Sbjct: 4696 CIVAGS--HPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKA 4753

Query: 352  GPREQSTYVLVRD 364
            G  + S ++ V++
Sbjct: 4754 GHNQCSGHLTVKE 4766



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 43/199 (21%), Positives = 70/199 (35%), Gaps = 40/199 (20%)

Query: 173  LTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRV 232
            L C V  S P  + W+K+D  I      + KY+ + +     LEI +    DS TYT   
Sbjct: 4694 LECIVAGSHPISIQWFKDDQEIS----ASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSA 4749

Query: 233  KN--AHGQASSFAKVLVRTYL-----GKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREK 285
             N   H Q S    V    Y       +D   ++ +  ++  G +   T           
Sbjct: 4750 TNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPNTRVQLKALVGGTAPMT----------- 4798

Query: 286  EPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMV 345
                              I+WF+D   L S   R +   D   SL++      D G Y+ 
Sbjct: 4799 ------------------IKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYIC 4840

Query: 346  RVPSPFGPREQSTYVLVRD 364
            ++ +  G       + V++
Sbjct: 4841 QLSNDVGTATSKATLFVKE 4859



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 62/269 (23%), Positives = 97/269 (36%), Gaps = 42/269 (15%)

Query: 169  TTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATY 228
            ++V++ C V  SPP  V+W+     I        KY+ T      +L +      DS  Y
Sbjct: 7697 SSVVMECKVYGSPPISVSWFHEGNEIS----SGRKYQTTLTDNTCALTVNMLEESDSGDY 7752

Query: 229  TVRVKNAHGQASSFAKVLVR---TYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREK 285
            T    N  G     A + VR   +++ K    D         G +V FTS++K       
Sbjct: 7753 TCIATNMAGSDECSAPLTVREPPSFVQKPDPMD------VLTGTNVTFTSIVKGT----- 7801

Query: 286  EPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMV 345
             PFS+S              WF+  S L    R  +   D  A L++        G Y  
Sbjct: 7802 PPFSVS--------------WFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTC 7847

Query: 346  RVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLI---LTWAPPSDT--R 400
             V +  G    +T++ ++      P      LN   ++  +  ++    T  PP     +
Sbjct: 7848 IVSNEAGKASCTTHLYIK-----APAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWK 7902

Query: 401  GNPITAYTIERCQGESGEWIACHEAPGGT 429
             N I     +RC   + E  A  E P  T
Sbjct: 7903 KNGINVTPSQRCNITTTEKSAILEIPSST 7931



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 111/578 (19%), Positives = 203/578 (35%), Gaps = 90/578 (15%)

Query: 861  LRVSDLQPGKSYVFQVQAMNSAGLGQPSMPT---DPVLLEDKPGAHEIEVGVDEEGFIYL 917
            L V+ L+   S  +   A N AG  + S P    +P     KP   ++  G +     + 
Sbjct: 7739 LTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPDPMDVLTGTN---VTFT 7795

Query: 918  AFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDAD 977
            +      P S  +        P D   V +ED V  +++ L +      G Y+ IV++  
Sbjct: 7796 SIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSV--AELELFDVDTSQSGEYTCIVSN-- 7851

Query: 978  EDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAEL 1037
                        E  K    +H       K +   N   +E+G+  L LE    +    +
Sbjct: 7852 ------------EAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKP-LILE-GTFTGTPPI 7897

Query: 1038 HLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVD 1097
             + +    I  +P+++ N    +    + I + + ED G Y   +++   K+  +  ++ 
Sbjct: 7898 SVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILI 7957

Query: 1098 DDFDKLLRKADAKRRDWKRKQGPYFERPLQ-WKVTEDCQVQLTCKVTNTKKETRFQWFFQ 1156
                                + PYF + L+  KV+      L C++  T  E    W+  
Sbjct: 7958 -------------------LEPPYFVKQLEPVKVSVGDSASLQCQLAGTP-EIGVSWYKG 7997

Query: 1157 RAEM-PDGQYDPE--TGTGLLCIEELSKKDKGIYRAMVSDDRGE--DDTILDLTGDALDA 1211
              ++ P   Y          L   ++   D G Y     +  GE    T L +    L  
Sbjct: 7998 DTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPP 8057

Query: 1212 IFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGT 1271
             F+   R          +Q T  G+ +         E +  +W+   K L+    ++T  
Sbjct: 8058 SFSRQLR---------DVQETV-GLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSF 8107

Query: 1272 TLDEIWLHILDPKDSDKGKYTLEI-----AAGKEVRQLSTDLSGQAFEDAMAEHQRLKTL 1326
              +   L+I     S  G+Y+        +A    R + T+     F D           
Sbjct: 8108 LDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFD----------- 8156

Query: 1327 AIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVR 1386
                      +R  P  A + E       C V+G    ++SW K+ + +    +Y++   
Sbjct: 8157 ----------IRLAPVDAVVGESADF--ECHVTGTQPIKVSWAKDSREIRSGGKYQISYL 8204

Query: 1387 GTEVTITIEKVNSEDSGRYGVFVKNKYGSE--TGQVTI 1422
                 +T+ KV+  DSG+Y  +  N+ G +  T Q+ I
Sbjct: 8205 ENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNI 8242



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 30/96 (31%), Positives = 47/96 (48%), Gaps = 2/96 (2%)

Query: 1340  LPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNS 1399
             L  V TI    TL L   + G P PE+ W ++      LD+  +E   +   + +  VN 
Sbjct: 21866 LRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGES--LDKASIESTSSYTLLIVGNVNR 21923

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
              DSG+Y + V+N  GS++  V + V      P++LK
Sbjct: 21924 FDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLK 21959



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 40/167 (23%), Positives = 72/167 (43%), Gaps = 14/167 (8%)

Query: 177  VQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAH 236
            +   P P+++WYK +  +    F+         Y LL +E      ED+A YT   KN +
Sbjct: 3262 ISGRPQPKISWYKEEQLLSTG-FKCKFLHDGQEYTLLLIE---AFPEDAAVYTCEAKNDY 3317

Query: 237  GQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSE 296
            G A++ A + V   + +    D E+     + P++   + L+     E +P    C  S 
Sbjct: 3318 GVATTSASLSVE--VPEVVSPDQEM---PVYPPAI--ITPLQDTVTSEGQPARFQCRVSG 3370

Query: 297  DVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
              L    + W+     ++ SR  ++   +    L+++  Y EDEG Y
Sbjct: 3371 TDL---KVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTY 3414



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 47/201 (23%), Positives = 72/201 (35%), Gaps = 27/201 (13%)

Query: 1227 LKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDS 1286
            L     E G  I  +  Y     +  TW      + + ++    TT     L IL+    
Sbjct: 5992 LSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKR 6051

Query: 1287 DKGKYTLEIA--AGKEV-RQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDV 1343
            D G+Y+ EI   AG++V   L + L    F                       V  L  +
Sbjct: 6052 DAGQYSCEIENEAGRDVCGALVSTLEPPYF-----------------------VTELEPL 6088

Query: 1344 ATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSG 1403
               + D ++ L C V+G P   +SW K D  +     YR        T+   KVN  DSG
Sbjct: 6089 EAAVGD-SVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSG 6147

Query: 1404 RYGVFVKNKYGSETGQVTISV 1424
             Y    +N  G+ + +    +
Sbjct: 6148 EYTCKAENSIGTASSKTVFRI 6168



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 51/212 (24%), Positives = 82/212 (38%), Gaps = 25/212 (11%)

Query: 152  RGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYG 211
            + P+F I   S  V    +    C V  + P ++TW K++  I P     G Y IT    
Sbjct: 6269 KSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRP----GGNYTITCVGN 6324

Query: 212  LLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSV 271
               L I +    DS  YT +  N  G+    A++ V+              +   F   +
Sbjct: 6325 TPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVK--------------EPPKFVKKL 6370

Query: 272  EFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLK 331
            E + V     A++ E   L C  S        + WFR+ S L  S +  + + +  A L 
Sbjct: 6371 EASKV-----AKQGESIQLECKISGS--PEIKVSWFRNDSELHESWKYNMSFINSVALLT 6423

Query: 332  VSCTYKEDEGLYMVRVPSPFGPREQSTYVLVR 363
            ++    ED G Y+    +  G    ST + V+
Sbjct: 6424 INEASAEDSGDYICEAHNGVGDASCSTALTVK 6455



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 49/227 (21%), Positives = 93/227 (40%), Gaps = 26/227 (11%)

Query: 1219  IGALSATPLKIQGTEEG-IRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIW 1277
             IG +S   +   G E G ++   K++ Y+ +  + TW+   ++LE+ ++           
Sbjct: 31567 IGPVSGQIMHAVGEEGGHVKYVCKIENYD-QSTQVTWYFGVRQLENSEKYEITYEDGVAI 31625

Query: 1278  LHILDPKDSDKGKYTLEIAAGKEVRQLSTDLS-GQAFEDAMAE-------------HQRL 1323
             L++ D    D G Y  ++     V     D S  + F   + E              +R 
Sbjct: 31626 LYVKDITKLDDGTYRCKV-----VNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRT 31680

Query: 1324  KTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLD---R 1380
              T+ ++E+     +      A + E+    +T  V   P P ++W K+ Q +   D   +
Sbjct: 31681 DTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVH--PEPHVTWYKSGQKIKPGDNDKK 31738

Query: 1381  YRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKH 1427
             Y  E       +TI  V ++D   Y V  +NKYG ++ +  ++V  H
Sbjct: 31739 YTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLH 31785



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 47/188 (25%), Positives = 78/188 (41%), Gaps = 31/188 (16%)

Query: 171  VLLTCTVQASPPPQVTWYKNDTRIDPRLFRAG-KYRITNNYGLLSLEIRRCAIEDSATYT 229
            V L C +Q +PP  V+WYK     D R  R+G KY+I +   L S+ I      D   Y 
Sbjct: 7416 VHLECELQGTPPFHVSWYK-----DKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQ 7470

Query: 230  VRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRST-FGPSVEFTSVLKPVFAREKEPF 288
             +  N  G  +    + ++        F  ++   ST  G  V+  + ++       EP 
Sbjct: 7471 CKATNDVGSDTCVGSIALKA----PPRFVKKLSDISTVVGKEVQLQTTIEGA-----EPI 7521

Query: 289  SLSCLFSEDVLDAESIQWFRD-GSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRV 347
                          S+ WF+D G ++R S    I Y++  A+L+ S     + G Y  ++
Sbjct: 7522 --------------SVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQI 7567

Query: 348  PSPFGPRE 355
             +  G +E
Sbjct: 7568 KNDAGMQE 7575



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 2/85 (2%)

Query: 1351  TLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVK 1410
             TL L+ I+ G P P+++W K D+      + R++V      + I     ED G Y + V+
Sbjct: 17235 TLRLSAIIKGVPFPKVTWKKEDRDAP--TKARIDVTPVGSKLEIRNAAHEDGGIYSLTVE 17292

Query: 1411  NKYGSETGQVTISVFKHGDEPKELK 1435
             N  GS+T  V + V      P++L+
Sbjct: 17293 NPAGSKTVSVKVLVLDKPGPPRDLE 17317



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 34/149 (22%), Positives = 68/149 (45%), Gaps = 7/149 (4%)

Query: 1282 DPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFE------DAMAEHQRLKTLAIIEKNRAK 1335
            D  D+ K +  +E+     V    T +  + FE        + E  R+     I      
Sbjct: 885  DTPDTYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPT 944

Query: 1336 VVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIE 1395
            +V GL +V T++E +++ L C +SG P+P ++W + D  +     +++  +     + I 
Sbjct: 945  LVSGLKNV-TVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIR 1003

Query: 1396 KVNSEDSGRYGVFVKNKYGSETGQVTISV 1424
            +  +EDSGR+     N+ G+ +    ++V
Sbjct: 1004 EAFAEDSGRFTCSAVNEAGTVSTSCYLAV 1032



 Score = 45.4 bits (106), Expect = 4e-04
 Identities = 108/578 (18%), Positives = 198/578 (34%), Gaps = 90/578 (15%)

Query: 874  FQVQAMNSAGLGQPS---MPTDPVLLEDKPGAHEIEVGVDEEGFIYLAFEAPEAPDSSEF 930
            F  +A NS G    S   +  +P     KPG+ ++       G         +       
Sbjct: 4183 FTCRATNSVGSKDSSGALIVQEPPSFVTKPGSKDVL-----PGSAVCLKSTFQGSTPLTI 4237

Query: 931  QWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTLTEEE 990
            +W K  K  +      I  +  +S + L      D GTY+  V++    +  S  L  +E
Sbjct: 4238 RWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKE 4297

Query: 991  ----LEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEI 1046
                +EKL+                    +L++G+          +P  ++    N++EI
Sbjct: 4298 PATFVEKLEPSQ-----------------LLKKGDATQLACKVTGTPPIKITWFANDREI 4340

Query: 1047 FSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLRK 1106
              S   +++F     ++   + ++  ED G Y  + Q+    +  +  ++          
Sbjct: 4341 KESSKHRMSFVESTAVLR--LTDVGIEDSGEYMCEAQNEAGSDHCSSIVIV--------- 4389

Query: 1107 ADAKRRDWKRKQGPYFERPLQ-WKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQ- 1164
                      K+ PYF +  +  +V ++  V L  +V  T       WF     +  G+ 
Sbjct: 4390 ----------KESPYFTKEFKPIEVLKEYDVMLLAEVAGTPP-FEITWFKDNTILRSGRK 4438

Query: 1165 YDPETGTGLLCIEELS--KKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGAL 1222
            Y       L+ ++ L     D G Y+  V+++ G       +T     +   ++    +L
Sbjct: 4439 YKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSL 4498

Query: 1223 SATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILD 1282
                   Q T +G    +            TW      +   D IR     +   L++  
Sbjct: 4499 RGGTAAFQATLKGSLPIT-----------VTWLKDSDEITEDDNIRMTFENNVASLYLSG 4547

Query: 1283 PKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPD 1342
             +    GKY  +      +++ S  LS             +K  A I +    +     D
Sbjct: 4548 IEVKHDGKYVCQAKNDAGIQRCSALLS-------------VKEPATITEEAVSIDVTQGD 4594

Query: 1343 VATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDS 1402
             AT+            SG       W K+ Q +T   +Y++ V  T   + I     +DS
Sbjct: 4595 PATLQVK--------FSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDS 4646

Query: 1403 GRYGVFVKNKYGSETGQVTISVFKHGDEP---KELKSM 1437
            G Y   V+N  G  + +  I+V      P   K+LK M
Sbjct: 4647 GEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKM 4684



 Score = 45.4 bits (106), Expect = 4e-04
 Identities = 53/280 (18%), Positives = 93/280 (33%), Gaps = 39/280 (13%)

Query: 1150 RFQWFFQRAEMPDGQ---YDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTG 1206
            + +WF    E+  G+      E     L + E+   + G Y  +V++D G       L  
Sbjct: 6864 KVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFV 6923

Query: 1207 DALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDR 1266
                     L      + +P+ ++ T           Y     +  +W   +  +   +R
Sbjct: 6924 KEPATFVKRLADFSVETGSPIVLEAT-----------YTGTPPISVSWIKDEYLISQSER 6972

Query: 1267 IRTGTTLDEIWLHILDPKDSDKGKYT--LEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLK 1324
                 T     L IL+    D  +Y+  +E  AG+++ +    +    +     EH    
Sbjct: 6973 CSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVE-- 7030

Query: 1325 TLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRME 1384
                               A I E  TL   C V G P   ISW K    +     Y+M+
Sbjct: 7031 -------------------AVIGEPATL--QCKVDGTPEIRISWYKEHTKLRSAPAYKMQ 7069

Query: 1385 VRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISV 1424
             +    ++ I KV+  D G Y     N  G+      + +
Sbjct: 7070 FKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVI 7109



 Score = 45.4 bits (106), Expect = 4e-04
 Identities = 41/194 (21%), Positives = 74/194 (38%), Gaps = 26/194 (13%)

Query: 169  TTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATY 228
            T V  T  V+ +PP  V+W+K  + + P      +  ++    +  LE+       S  Y
Sbjct: 7790 TNVTFTSIVKGTPPFSVSWFKGSSELVP----GDRCNVSLEDSVAELELFDVDTSQSGEY 7845

Query: 229  TVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPF 288
            T  V N  G+AS    + ++                       +F   L      + +P 
Sbjct: 7846 TCIVSNEAGKASCTTHLYIKA--------------------PAKFVKRLNDYSIEKGKPL 7885

Query: 289  SLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVP 348
             L   F+       S+ W ++G  +  S+R  I  T++ A L++  +  ED G Y   + 
Sbjct: 7886 ILEGTFTGT--PPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIE 7943

Query: 349  SPFGPREQSTYVLV 362
            +  G    S  +L+
Sbjct: 7944 NASGKDSCSAQILI 7957



 Score = 45.4 bits (106), Expect = 4e-04
 Identities = 55/268 (20%), Positives = 92/268 (34%), Gaps = 19/268 (7%)

Query: 1168 ETGTGLLCIEELSKKDKGIYRAMVSDDRGED--DTILDLTGDALDAIFTELGRIGALSAT 1225
            +  T +L + +    D G+Y   VS+D G     + + +       +F +         T
Sbjct: 8301 KNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKKPPVFDQ-------HLT 8353

Query: 1226 PLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKD 1285
            P+ +    EG  +         E ++  W    + ++  DR           L + D   
Sbjct: 8354 PVTVS---EGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAK 8410

Query: 1286 SDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVAT 1345
            +D G Y   +     V    T  S    +D  A     K  A+    R   V   P    
Sbjct: 8411 ADSGDY---VCKASNVAGSDTTKSKVTIKDKPAVAPATKKAAV--DGRLFFVSE-PQSIR 8464

Query: 1346 IMEDKTLCLTCIVSGDPTPEISWLKND-QPVTFLDRYRMEVRGTEVTITIEKVNSEDSGR 1404
            ++E  T      V GDP P + W K   + +    R  +  +G E  + I      DSG 
Sbjct: 8465 VVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGL 8524

Query: 1405 YGVFVKNKYGSETGQVTISVFKHGDEPK 1432
            Y     N++G     V + V +   + K
Sbjct: 8525 YRCVAFNEHGEIESNVNLQVDERKKQEK 8552



 Score = 45.1 bits (105), Expect = 5e-04
 Identities = 46/183 (25%), Positives = 68/183 (37%), Gaps = 31/183 (16%)

Query: 165   VWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIED 224
             V E  T+ L C V + P  +V WYK D  I       G+Y I        L I+   +ED
Sbjct: 12474 VSETDTIKLVCEV-SKPGAEVIWYKGDEEI----IETGRYEILTEGRKRILVIQNAHLED 12528

Query: 225   SATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFARE 284
             +  Y  R+ ++          L   ++ K      EI +    G   EF      V +  
Sbjct: 12529 AGNYNCRLPSSRTDGKVKVHELAAEFISKPQNL--EILE----GEKAEF------VCSIS 12576

Query: 285   KEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYM 344
             KE F               +QW RD   L S  +  ++   ++  L V     +D G Y+
Sbjct: 12577 KESFP--------------VQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYV 12622

Query: 345   VRV 347
             V V
Sbjct: 12623 VMV 12625



 Score = 44.7 bits (104), Expect = 7e-04
 Identities = 33/149 (22%), Positives = 67/149 (44%), Gaps = 7/149 (4%)

Query: 1279  HILDPKDSDKGKYTL-EIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVV 1337
             H ++ +   K +YT+ ++ AG+E +   + ++G    D+      +K +  +      + 
Sbjct: 28301 HKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDID 28360

Query: 1338  RGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEV--TITIE 1395
                     +    ++ L     G PTP   W K D  ++     R ++  T+   T+T+E
Sbjct: 28361 ANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSL----RADIHTTDSFSTLTVE 28416

Query: 1396  KVNSEDSGRYGVFVKNKYGSETGQVTISV 1424
               N  D+G+Y + V+N  GS++   T+ V
Sbjct: 28417 NCNRNDAGKYTLTVENNSGSKSITFTVKV 28445



 Score = 44.3 bits (103), Expect = 9e-04
 Identities = 48/237 (20%), Positives = 85/237 (35%), Gaps = 51/237 (21%)

Query: 161   RSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRC 220
             RS  V+E  +   +C     P P VTW +    +      + ++++T      + EI   
Sbjct: 32568 RSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLST----SARHQVTTTKYKSTFEISSV 32623

Query: 221   AIEDSATYTVRVKNAHG-QASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLK- 278
                D   Y+V V+N+ G Q + F   + +  + + A       K     P V+    +K 
Sbjct: 32624 QASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPE--PRVKSPEAVKS 32681

Query: 279   -------------------------------PVFA-----------REKEPFSLSCLFSE 296
                                            PV A             KE   L+C+   
Sbjct: 32682 PKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVVES 32741

Query: 297   DVLDAESIQWFRDGSLLRSSRRRKILYT-DRQASLKVSCTYKEDEGLYMVRVPSPFG 352
              VL A+ + W++DG  L+ +   +  Y+ D    LK++   + D+G Y+  +    G
Sbjct: 32742 SVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGG 32798



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 87/491 (17%), Positives = 169/491 (34%), Gaps = 73/491 (14%)

Query: 932  WSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDA-DEDISASHTLTEEE 990
            W KD          +I D  NK  + L    ++D G YS   ++    DI  +  +  ++
Sbjct: 3584 WQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDK 3643

Query: 991  LEKLKKLSHEIRNPVIKLIS-GWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSS 1049
               +K+L   +++ + K +     +D   +  V    + +KL P  +             
Sbjct: 3644 PHFIKEL-EPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDY------------ 3690

Query: 1050 PNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLRKADA 1109
               KI F+ +   +E+ +  L  +D G+Y     +    +  + T+   +    ++K D 
Sbjct: 3691 ---KICFEDKIATLEIPLAKL--KDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDP 3745

Query: 1110 KRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDG---QYD 1166
                       Y   P +         +L CK+  +    +  WF    E+ +    +  
Sbjct: 3746 S----------YLMLPGE-------SARLHCKLKGS-PVIQVTWFKNNKELSESNTVRMY 3787

Query: 1167 PETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATP 1226
                  +L I ++  +D G Y     +D G D    ++      +    L     +  T 
Sbjct: 3788 FVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTN 3847

Query: 1227 LKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDS 1286
              +Q    G   F           + +WF   K++ S  + R  +    + L I     +
Sbjct: 3848 ALLQCEVSGTGPF-----------EISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSA 3896

Query: 1287 DKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATI 1346
            D G+Y  E     EV +             MA H   +    ++K          D    
Sbjct: 3897 DVGEY--ECVVANEVGKCG----------CMATHLLKEPPTFVKK---------VDDLIA 3935

Query: 1347 MEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYG 1406
            +  +T+ L   V G     ++W+K  + +    + +M        + I  V     G+Y 
Sbjct: 3936 LGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYT 3995

Query: 1407 VFVKNKYGSET 1417
               +N+ GS+T
Sbjct: 3996 CLAENEAGSQT 4006



 Score = 43.5 bits (101), Expect = 0.001
 Identities = 45/185 (24%), Positives = 74/185 (40%), Gaps = 19/185 (10%)

Query: 1251 KTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKD-SDKGKYTLEIAAGKEVRQLSTDLS 1309
            +T WFH  +++ +    +     D     I+ P   SD G++T+          +S  L+
Sbjct: 1487 ETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILT 1546

Query: 1310 GQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWL 1369
             +A      EHQ         KN             I E   L +    +G+P P+I WL
Sbjct: 1547 VEA-----VEHQVKPMFVEKLKN-----------VNIKEGSRLEMKVRATGNPNPDIVWL 1590

Query: 1370 KNDQPVTFLDRYRMEVRGT--EVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKH 1427
            KN   +      ++ + GT  E  + I+   S+DS  Y     NK G +T +  ++V   
Sbjct: 1591 KNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVE 1650

Query: 1428 GDEPK 1432
              EP+
Sbjct: 1651 FAEPE 1655



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 72/389 (18%), Positives = 139/389 (35%), Gaps = 55/389 (14%)

Query: 1042 NNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFD 1101
            + +E+ +     I F  +   +++    +S  DKG Y+ ++++   K+  T+++   D  
Sbjct: 6681 DGRELSADSKHHITFINKVASLKIPCAEMS--DKGLYSFEVKNSVGKSNCTVSVHVSD-- 6736

Query: 1102 KLLRKADAKRRDWKRKQGPYFERPLQ-WKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEM 1160
                          R   P F R L+         V L C+V+ +   +   WF    E+
Sbjct: 6737 --------------RIVPPSFIRKLKDVNAILGASVVLECRVSGSAPIS-VGWFQDGNEI 6781

Query: 1161 PDGQYDPETGTGLLCIEELS---KKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELG 1217
              G     + +  +C   LS     D GIY  + ++  G D+    LT     +      
Sbjct: 6782 VSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPD 6841

Query: 1218 RIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIW 1277
             +  L    L       G   F           K  WF   + L  G+            
Sbjct: 6842 SVEVLPGMSLTFTSVIRGTPPF-----------KVKWFKGSRELVPGESCNISLEDFVTE 6890

Query: 1278 LHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVV 1337
            L + + +  + G Y+           L T+ +G A            T  +  K  A  V
Sbjct: 6891 LELFEVQPLESGDYSC----------LVTNDAGSAS----------CTTHLFVKEPATFV 6930

Query: 1338 RGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKV 1397
            + L D + +     + L    +G P   +SW+K++  ++  +R  + +      + I + 
Sbjct: 6931 KRLADFS-VETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILES 6989

Query: 1398 NSEDSGRYGVFVKNKYGSETGQVTISVFK 1426
              ED  +Y   ++N+ G +  +  +SV +
Sbjct: 6990 TIEDYAQYSCLIENEAGQDICEALVSVLE 7018



 Score = 42.7 bits (99), Expect = 0.002
 Identities = 45/192 (23%), Positives = 75/192 (39%), Gaps = 23/192 (11%)

Query: 173  LTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRV 232
            L C V  +P     W+K+   +        K+ IT    + SL+I    + D   Y+  V
Sbjct: 6664 LECVVTGTPELSAKWFKDGRELSAD----SKHHITFINKVASLKIPCAEMSDKGLYSFEV 6719

Query: 233  KNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSC 292
            KN+ G+++    V V   +                 PS  F   LK V A       L C
Sbjct: 6720 KNSVGKSNCTVSVHVSDRI---------------VPPS--FIRKLKDVNAILGASVVLEC 6762

Query: 293  LFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFG 352
              S       S+ WF+DG+ + S  + +  +++   +L +S     D G+Y     +  G
Sbjct: 6763 RVSGSA--PISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAG 6820

Query: 353  PREQSTYVLVRD 364
              E S  + V++
Sbjct: 6821 SDECSAVLTVQE 6832



 Score = 42.7 bits (99), Expect = 0.002
 Identities = 69/301 (22%), Positives = 125/301 (41%), Gaps = 49/301 (16%)

Query: 1120  PYFERPLQWKVT-EDCQVQLTCKVTNTKKETRFQWFFQRAEM-PDGQYDPETG--TGLLC 1175
             PYF   L  K   E  ++ L C+V+   K+   +WF    E+ P  +Y  +      +L 
Sbjct: 11663 PYFTVKLHDKTAVEKDEITLKCEVS---KDVPVKWFKDGEEIVPSPKYSIKADGLRRILK 11719

Query: 1176  IEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEG 1235
             I++   KDKG Y      D G D T  ++T                + A  +K++    G
Sbjct: 11720 IKKADLKDKGEYVC----DCGTDKTKANVT----------------VEARLIKVEKPLYG 11759

Query: 1236  IRIF-SKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLE 1294
             + +F  +  ++ +E  +    H   +L+ G  +      + I          + GK  + 
Sbjct: 11760 VEVFVGETAHFEIELSEPD-VHGQWKLK-GQPLTASPDCEII----------EDGKKHIL 11807

Query: 1295  IAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCL 1354
             I    ++  ++ ++S QA     A + ++K L +I       +  L DV    +D+    
Sbjct: 11808 ILHNCQLG-MTGEVSFQAANAKSAANLKVKELPLI------FITPLSDVKVFEKDEAK-F 11859

Query: 1355  TCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYG 1414
              C VS +P     WLK  Q +T  DR+ +   GT+ ++ I+    ED  +Y    ++K+ 
Sbjct: 11860 ECEVSREPKT-FRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHT 11918

Query: 1415  S 1415
             S
Sbjct: 11919 S 11919



 Score = 42.7 bits (99), Expect = 0.002
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 2/75 (2%)

Query: 1360  GDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQ 1419
             G PTPEI+W + +    F D+ ++E       ++I+  +  D+G+Y + ++N  GS++  
Sbjct: 24050 GRPTPEITWSREEGE--FTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAF 24107

Query: 1420  VTISVFKHGDEPKEL 1434
             VT+ V      P+ L
Sbjct: 24108 VTVKVLDTPGPPQNL 24122



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 45/180 (25%), Positives = 72/180 (40%), Gaps = 12/180 (6%)

Query: 165  VWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIED 224
            V E   V L+C VQ S P ++ W K    I P    + +   +   G   LE+R  A  D
Sbjct: 8357 VSEGEYVQLSCHVQGSEPIRIQWLKAGREIKP----SDRCSFSFASGTAVLELRDVAKAD 8412

Query: 225  SATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFARE 284
            S  Y  +  N  G  ++ +KV +     KD    +   K++     + F S  + +   E
Sbjct: 8413 SGDYVCKASNVAGSDTTKSKVTI-----KDKPAVAPATKKAAVDGRLFFVSEPQSIRVVE 8467

Query: 285  KEPFSLSCLFSEDVLDAESIQWFR-DGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
            K   +       D +   +++W +     L    R  I     +A L++  T K D GLY
Sbjct: 8468 KTTATFIAKVGGDPI--PNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLY 8525



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 1/80 (1%)

Query: 1346  IMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRY 1405
             IM  KTL +  +V+G P P   W K +  +   DR  ++  GT+  + I+    +D GRY
Sbjct: 15116 IMAGKTLRIPAVVTGRPVPTKVWTKEEGELD-KDRVVIDNVGTKSELIIKDALRKDHGRY 15174

Query: 1406  GVFVKNKYGSETGQVTISVF 1425
              +   N  GS+     + VF
Sbjct: 15175 VITATNSCGSKFAAARVEVF 15194



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 8/104 (7%)

Query: 1337  VRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKND----QPVTFLDRYRMEVRGTEVT- 1391
             VRG  D   +   + + +   V+G P P+I W KN+    +P   L   + EV  +E   
Sbjct: 15403 VRG--DTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKT 15460

Query: 1392  -ITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKEL 1434
              ++I K   ED G Y V   N+ GS    V + V+     P+ L
Sbjct: 15461 ELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNL 15504



 Score = 42.0 bits (97), Expect = 0.004
 Identities = 49/205 (23%), Positives = 74/205 (36%), Gaps = 42/205 (20%)

Query: 170  TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT 229
            TV L   V+ S P  VTW K    I       GK +++ + G+  L I    I     YT
Sbjct: 3940 TVTLQAAVRGSEPISVTWMKGQEVIR----EDGKIKMSFSNGVAVLIIPDVQISFGGKYT 3995

Query: 230  VRVKNAHGQASSF--------AKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVF 281
               +N  G  +S         AK++ R  L +    D      +T   +V  T  LKP  
Sbjct: 3996 CLAENEAGSQTSVGELIVKEPAKIIERAELIQVTAGDP-----ATLEYTVAGTPELKP-- 4048

Query: 282  AREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEG 341
                                   +W++DG  L +S++ +I + +  A LK       D G
Sbjct: 4049 -----------------------KWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSG 4085

Query: 342  LYMVRVPSPFGPREQSTYVLVRDAE 366
             Y   + +  G     T   V D +
Sbjct: 4086 QYTFEISNEVGSSSCETTFTVLDRD 4110



 Score = 42.0 bits (97), Expect = 0.004
 Identities = 44/183 (24%), Positives = 66/183 (36%), Gaps = 26/183 (14%)

Query: 170  TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT 229
            T     T++ S P  VTW K+   I          R+T    + SL +    ++    Y 
Sbjct: 4502 TAAFQATLKGSLPITVTWLKDSDEIT----EDDNIRMTFENNVASLYLSGIEVKHDGKYV 4557

Query: 230  VRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFS 289
             + KN                   DAG        S   P+   T     +   + +P +
Sbjct: 4558 CQAKN-------------------DAGIQRCSALLSVKEPAT-ITEEAVSIDVTQGDPAT 4597

Query: 290  LSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPS 349
            L   FS       + +WF+DG  L    + KI  TD  + LK+  T K+D G Y   V +
Sbjct: 4598 LQVKFSGT--KEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQN 4655

Query: 350  PFG 352
              G
Sbjct: 4656 DVG 4658



 Score = 42.0 bits (97), Expect = 0.004
 Identities = 62/301 (20%), Positives = 110/301 (36%), Gaps = 52/301 (17%)

Query: 154  PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLL 213
            P+F    +S  V  +T V L   V  + P  + W+K++  +     R+    +  +    
Sbjct: 4768 PYFVEKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARS----VWKDDTST 4823

Query: 214  SLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEF 273
            SLE+      DS TY  ++ N  G A+S A + V+                       +F
Sbjct: 4824 SLELFAAKATDSGTYICQLSNDVGTATSKATLFVK--------------------EPPQF 4863

Query: 274  TSVLKPVFA-REKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKV 332
                 PV   R  +  +  C  +        + W+ DG+ + + ++  I + D  A+ ++
Sbjct: 4864 IKKPSPVLVLRNGQSTTFECQITG--TPKIRVSWYLDGNEITAIQKHGISFIDGLATFQI 4921

Query: 333  SCTYKEDEGLYMVRVPSPFGPREQSTYVLVR--------------------DAEAENPGA 372
            S    E+ G Y+    +  G    S  + V+                    + E E  G 
Sbjct: 4922 SGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVELECEVTGT 4981

Query: 373  PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQ-GESGEWIACHEAPGGTCR 431
            P  P  V  L  NR+  I +    + T    +    I +C   ++GE+       GG+C 
Sbjct: 4982 P--PFEVTWLKNNRE--IRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCS 5037

Query: 432  C 432
            C
Sbjct: 5038 C 5038



 Score = 42.0 bits (97), Expect = 0.004
 Identities = 23/93 (24%), Positives = 40/93 (43%)

Query: 1340  LPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNS 1399
             +P+  TI   K L +   V G P P   W K +  V       +    +   + I+ V  
Sbjct: 18904 MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTR 18963

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPK 1432
             +DSG Y +  +N  G++T ++ + V      P+
Sbjct: 18964 KDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQ 18996



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 38/160 (23%), Positives = 63/160 (39%), Gaps = 27/160 (16%)

Query: 1246 NVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLS 1305
            N   +K +W+   ++LE  D+       D   L + + +  D+G Y L    G  +    
Sbjct: 8682 NYPEIKLSWYKGTEKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRL--VCGPHIASAK 8739

Query: 1306 TDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPE 1365
              +   A+E                       R L DV T+ E +T  +TC  S  P  +
Sbjct: 8740 LTVIEPAWE-----------------------RHLQDV-TLKEGQTCTMTCQFSV-PNVK 8774

Query: 1366 ISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRY 1405
              W +N + +    R++ EV      +TI  V +ED G+Y
Sbjct: 8775 SEWFRNGRILKPQGRHKTEVEHKVHKLTIADVRAEDQGQY 8814



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 32/189 (16%)

Query: 156   FWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSL 215
             F  PL    V E  T    C + +     V W+KND +    L  +    I++      L
Sbjct: 11576 FMSPLEDQTVKEGETATFVCEL-SHEKMHVVWFKNDAK----LHTSRTVLISSEGKTHKL 11630

Query: 216   EIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTS 275
             E++   ++D +    +VK    + SS A++ V          +++ +          FT 
Sbjct: 11631 EMKEVTLDDISQIKAQVK----ELSSTAQLKV---------LEADPY----------FTV 11667

Query: 276   VLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCT 335
              L    A EK+  +L C  S+DV     ++WF+DG  +  S +  I     +  LK+   
Sbjct: 11668 KLHDKTAVEKDEITLKCEVSKDV----PVKWFKDGEEIVPSPKYSIKADGLRRILKIKKA 11723

Query: 336   YKEDEGLYM 344
               +D+G Y+
Sbjct: 11724 DLKDKGEYV 11732



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 23/91 (25%), Positives = 42/91 (46%)

Query: 1346  IMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRY 1405
             ++E + L +       P P +SW K+ + V   DR  M+       + + K    D+G Y
Sbjct: 14398 VIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIY 14457

Query: 1406  GVFVKNKYGSETGQVTISVFKHGDEPKELKS 1436
              + ++NK GS T  + + V       K++K+
Sbjct: 14458 TITLENKLGSATASINVKVIGLPGPCKDIKA 14488



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 20/67 (29%), Positives = 35/67 (52%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             +SG P P+++W   +  +   DR  +       T+T++     DSGRY + ++N  G +T
Sbjct: 28671 ISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKT 28730

Query: 1418  GQVTISV 1424
               VT+ V
Sbjct: 28731 FSVTVVV 28737



 Score = 41.2 bits (95), Expect = 0.007
 Identities = 94/487 (19%), Positives = 174/487 (35%), Gaps = 91/487 (18%)

Query: 925  PDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASH 984
            PD +  +W  + +      RV+   K  K ++++      D G Y +IV   + + + S 
Sbjct: 2471 PDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLS- 2529

Query: 985  TLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNK 1044
                  +EK            IK+I G   D+       +  EVE      ++   F +K
Sbjct: 2530 ------VEK------------IKIIRGLR-DLTCTETQNVVFEVELSHSGIDVLWNFKDK 2570

Query: 1045 EIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLL 1104
            EI   P+ K   +    + ++ + N+ ++D+G YT    +     ++T+           
Sbjct: 2571 EI--KPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVA---------- 2618

Query: 1105 RKADAKRRDWKRKQGPYFERPL-QWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDG 1163
                          G    +PL    V E  +    C+V N   +++ +W      + DG
Sbjct: 2619 --------------GGAISKPLTDQTVAESQEAVFECEVANP--DSKGEW------LRDG 2656

Query: 1164 QYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALS 1223
            ++ P T    +  E    K + I  A   DD GE  T    T      +  E  +I    
Sbjct: 2657 KHLPLTNN--IRSESDGHKRRLIIAATKLDDIGEY-TYKVATSKTSAKLKVEAVKI---K 2710

Query: 1224 ATPLKIQGTEEGIRIFS-KVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILD 1282
             T   +  TE    +F+ ++ + NV+ ++  W      LES ++           L I +
Sbjct: 2711 KTLKNLTVTETQDAVFTVELTHPNVKGVQ--WIKNGVVLESNEKYAISVKGTIYSLRIKN 2768

Query: 1283 PKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPD 1342
                D+  Y   +                          RL   A +     K+++   D
Sbjct: 2769 CAIVDESVYGFRLG-------------------------RLGASARLHVETVKIIKKPKD 2803

Query: 1343 VATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDS 1402
            V T +E+ T+     VS D  P + W      +   D++R+        + ++ ++  D+
Sbjct: 2804 V-TALENATVAFEVSVSHDTVP-VKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDA 2861

Query: 1403 GRYGVFV 1409
            G Y   V
Sbjct: 2862 GEYTAVV 2868



 Score = 41.2 bits (95), Expect = 0.007
 Identities = 42/198 (21%), Positives = 76/198 (38%), Gaps = 29/198 (14%)

Query: 167  EHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAG-KYRITNNYGLLSLEIRRCAIEDS 225
            ++  V L C +  +PP +V WYK     D R  R+  KY+I +     S+ I      D 
Sbjct: 5530 KNAEVSLECELSGTPPFEVVWYK-----DKRQLRSSKKYKIASKNFHTSIHILNVDTSDI 5584

Query: 226  ATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREK 285
              Y  + +N  G  +    V ++                        F S L  +     
Sbjct: 5585 GEYHCKAQNEVGSDTCVCTVKLK--------------------EPPRFVSKLNSLTVVAG 5624

Query: 286  EPFSLSCLFSEDVLDAESIQWFRD-GSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYM 344
            EP  L    S +      +QW ++   ++R S   +I + +  A+L+ +     + G Y+
Sbjct: 5625 EPAELQA--SIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYI 5682

Query: 345  VRVPSPFGPREQSTYVLV 362
             ++ +  G RE    ++V
Sbjct: 5683 CQIKNDGGMRENMATLMV 5700



 Score = 41.2 bits (95), Expect = 0.007
 Identities = 20/77 (25%), Positives = 37/77 (48%)

Query: 1359  SGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETG 1418
             +G P P  +W   D+ +   DR +M+       + I      D G Y + ++N+  + +G
Sbjct: 13419 TGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISG 13478

Query: 1419  QVTISVFKHGDEPKELK 1435
             ++ ++V      PKELK
Sbjct: 13479 EIDVNVIARPSAPKELK 13495



 Score = 40.4 bits (93), Expect = 0.012
 Identities = 39/180 (21%), Positives = 67/180 (37%), Gaps = 26/180 (14%)

Query: 173  LTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRV 232
            L C ++ SP  QVTW+KN+  +        +    N+  +  L+I    +EDS +Y+   
Sbjct: 3757 LHCKLKGSPVIQVTWFKNNKELSES--NTVRMYFVNSEAI--LDITDVKVEDSGSYSCEA 3812

Query: 233  KNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSC 292
             N  G  S   +++++              K       V  T+ L         PF +S 
Sbjct: 3813 VNDVGSDSCSTEIVIKE--------PPSFIKTLEPADIVRGTNALLQCEVSGTGPFEIS- 3863

Query: 293  LFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFG 352
                         WF+D   +RSS++ ++        L++      D G Y   V +  G
Sbjct: 3864 -------------WFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVG 3910



 Score = 40.4 bits (93), Expect = 0.012
 Identities = 45/208 (21%), Positives = 88/208 (42%), Gaps = 30/208 (14%)

Query: 159  PLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRI--DPRLFRAGKYRITNNYGLLSLE 216
            P R  A+ + +TV     ++ +PP ++ W+K+D  +   P+ F  G    T+   L S++
Sbjct: 5336 PGRQQAIPD-STVEFKAILKGTPPFKIKWFKDDVELVSGPKCF-IGLEGSTSFLNLYSVD 5393

Query: 217  IRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSV 276
              +     +  YT  V N  G  S    +LV               +   F   +E + +
Sbjct: 5394 ASK-----TGQYTCHVTNDVGSDSCTTMLLVT--------------EPPKFVKKLEASKI 5434

Query: 277  LKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTY 336
            +K   A +          S ++     + WFR+   L +S + ++ + D  A ++++   
Sbjct: 5435 VK---AGDSSRLECKIAGSPEI----RVVWFRNEHELPASDKYRMTFIDSVAVIQMNNLS 5487

Query: 337  KEDEGLYMVRVPSPFGPREQSTYVLVRD 364
             ED G ++    +P G    ST V+V++
Sbjct: 5488 TEDSGDFICEAQNPAGSTSCSTKVIVKE 5515



 Score = 40.4 bits (93), Expect = 0.012
 Identities = 47/197 (23%), Positives = 70/197 (35%), Gaps = 28/197 (14%)

Query: 172  LLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVR 231
            +L C V  S P  V W+   T+I        KY+ T +  + +L++      D   YT  
Sbjct: 5818 ILECKVAGSSPISVAWFHEKTKI----VSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCV 5873

Query: 232  VKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTF-GPSVEFTSVLKPVFAREKEPFSL 290
              N  G     A + V+    +   F  E        G +V FTSV+     R   PF  
Sbjct: 5874 AANVAGSDECRAVLTVQ----EPPSFVKEPEPLEVLPGKNVTFTSVI-----RGTPPF-- 5922

Query: 291  SCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSP 350
                         + WFR    L    R  I + D  A L++        G Y   V + 
Sbjct: 5923 ------------KVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNN 5970

Query: 351  FGPREQSTYVLVRDAEA 367
             G    +T + V++  A
Sbjct: 5971 AGQASCTTRLFVKEPAA 5987



 Score = 40.4 bits (93), Expect = 0.012
 Identities = 41/183 (22%), Positives = 69/183 (37%), Gaps = 28/183 (15%)

Query: 171  VLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTV 230
            V  T  ++ +PP +V W++        L +  +  I     +  LE+    I  S  YT 
Sbjct: 5910 VTFTSVIRGTPPFKVNWFRGARE----LVKGDRCNIYFEDTVAELELFNIDISQSGEYTC 5965

Query: 231  RVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSL 290
             V N  GQAS   ++ V+                       E  + LK +     EP   
Sbjct: 5966 VVSNNAGQASCTTRLFVK-----------------------EPAAFLKRLSDHSVEPGKS 6002

Query: 291  SCLFSEDVLDAE-SIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPS 349
              L S        S+ W +DG  + +S +  I+ T++   L++  + K D G Y   + +
Sbjct: 6003 IILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIEN 6062

Query: 350  PFG 352
              G
Sbjct: 6063 EAG 6065



 Score = 40.4 bits (93), Expect = 0.012
 Identities = 43/207 (20%), Positives = 77/207 (37%), Gaps = 26/207 (12%)

Query: 160  LRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRR 219
            L  H+V    +++L  T   + P  VTW K+   I      + K  I        LEI  
Sbjct: 5992 LSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITT----SEKCNIVTTEKTCILEILN 6047

Query: 220  CAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKP 279
                D+  Y+  ++N  G+    A V                   ST  P   F + L+P
Sbjct: 6048 STKRDAGQYSCEIENEAGRDVCGALV-------------------STLEPPY-FVTELEP 6087

Query: 280  VFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKED 339
            + A   +  SL C  +       ++ W++  + LR +   +  +T+  A+L  +     D
Sbjct: 6088 LEAAVGDSVSLQCQVAGT--PEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNIND 6145

Query: 340  EGLYMVRVPSPFGPREQSTYVLVRDAE 366
             G Y  +  +  G     T   +++ +
Sbjct: 6146 SGEYTCKAENSIGTASSKTVFRIQERQ 6172



 Score = 40.4 bits (93), Expect = 0.012
 Identities = 44/191 (23%), Positives = 78/191 (40%), Gaps = 27/191 (14%)

Query: 175  CTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKN 234
            C V  + P ++TW K++  I P     G Y++T              +E++AT TV +K 
Sbjct: 7233 CHVTGTAPIKITWAKDNREIRP----GGNYKMT-------------LVENTATLTV-LKV 7274

Query: 235  AHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFS-LSCL 293
              G A  +       Y    AG DS   +     P   F   L+P    +++ F+   C 
Sbjct: 7275 GKGDAGQYT-----CYASNIAGKDSCSAQLGVQEPP-RFIKKLEPSRIVKQDEFTRYECK 7328

Query: 294  FSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGP 353
                      + W++D + ++ S + ++ + D  A L++     ED G Y     +  G 
Sbjct: 7329 IGGS--PEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGS 7386

Query: 354  REQSTYVLVRD 364
               ST + V++
Sbjct: 7387 ASSSTSLKVKE 7397



 Score = 40.4 bits (93), Expect = 0.012
 Identities = 52/240 (21%), Positives = 99/240 (41%), Gaps = 44/240 (18%)

Query: 116  LQTHRLLRQRRDWKTLRRRTEE---KVQEAKELRELCY-------GRGPWFWIP-LRSHA 164
            LQ   LL+Q ++ +T R   EE     ++ KE  EL            P   I  + +  
Sbjct: 8607 LQAFELLKQSQEEETHRLEIEEIERSERDEKEFEELVSFIQQRLSQTEPVTLIKDIENQT 8666

Query: 165  VWEHTTVLLTCTVQASPPP-QVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIE 223
            V +    +    ++ + P  +++WYK   +++P    + K+ I+ +    +L ++ C ++
Sbjct: 8667 VLKDNDAVFEIDIKINYPEIKLSWYKGTEKLEP----SDKFEISIDGDRHTLRVKNCQLK 8722

Query: 224  DSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAR 283
            D   Y +      G   + AK+ V                     P+ E    L+ V  +
Sbjct: 8723 DQGNYRL----VCGPHIASAKLTV-------------------IEPAWE--RHLQDVTLK 8757

Query: 284  EKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
            E +  +++C FS   + +E   WFR+G +L+   R K     +   L ++    ED+G Y
Sbjct: 8758 EGQTCTMTCQFSVPNVKSE---WFRNGRILKPQGRHKTEVEHKVHKLTIADVRAEDQGQY 8814



 Score = 40.0 bits (92), Expect = 0.016
 Identities = 26/100 (26%), Positives = 46/100 (46%), Gaps = 2/100 (2%)

Query: 1330 EKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTE 1389
            EK +  +V   P+   ++E +T    C V+G P P+++W  N Q +    R+R+   G  
Sbjct: 1837 EKQKPDIVL-YPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIH 1895

Query: 1390 VTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGD 1429
              + I    S D+G   V  +N  G    +V + + +  D
Sbjct: 1896 Y-LDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQRED 1934



 Score = 40.0 bits (92), Expect = 0.016
 Identities = 36/161 (22%), Positives = 68/161 (42%), Gaps = 22/161 (13%)

Query: 1252  TTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQ 1311
             TTW      +    + R      +  LHI+D + SD G+YT  +  G + +  +  L   
Sbjct: 11149 TTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKL--- 11205

Query: 1312  AFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKN 1371
                             ++E+   + V+ L +  T+++ + L L+C ++ +   ++ W K+
Sbjct: 11206 ----------------VVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKE--RDVVWRKD 11247

Query: 1372  DQPVTFL-DRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKN 1411
              + V     R    V G    +TI   +  D+G Y V V+N
Sbjct: 11248 GKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVEN 11288



 Score = 40.0 bits (92), Expect = 0.016
 Identities = 97/527 (18%), Positives = 193/527 (36%), Gaps = 94/527 (17%)

Query: 920   EAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADED 979
             E   + ++++ +W K+    L  ++ +I       K+++ +   ED+ TY+    D    
Sbjct: 12305 ECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKT- 12363

Query: 980   ISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHL 1039
              S +  +    +E L+ L+              ++ + E+   R   E+ + +  A++  
Sbjct: 12364 -SCNLNVVPPHVEFLRPLT--------------DLQVREKEMARFECELSREN--AKVKW 12406

Query: 1040  IFNNKEIFSSPNRKINFDREKGLVEVIIQNLSE-EDKGSYTAQLQDGKAKNQITLTLVDD 1098
               +  EI       I     KG V +++ N    +D+  Y+ +++  +    +T+   + 
Sbjct: 12407 FKDGAEIKKGKKYDII---SKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEEA 12463

Query: 1099  DFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRA 1158
              F K L   +                     V+E   ++L C+V+    E    W+    
Sbjct: 12464 VFTKNLANIE---------------------VSETDTIKLVCEVSKPGAEVI--WYKGDE 12500

Query: 1159  EMPD-GQYD--PETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTE 1215
             E+ + G+Y+   E    +L I+    +D G Y   +   R +    +            E
Sbjct: 12501 EIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVH-----------E 12549

Query: 1216  LGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDE 1275
             L          L+I   E+   + S  K    E     W   DK LESGD+        +
Sbjct: 12550 LAAEFISKPQNLEILEGEKAEFVCSISK----ESFPVQWKRDDKTLESGDKYDVIADGKK 12605

Query: 1276  IWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAK 1335
               L + D    D G Y + + A +    L+                      +IEK R  
Sbjct: 12606 RVLVVKDATLQDMGTYVVMVGAARAAAHLT----------------------VIEKLR-- 12641

Query: 1336  VVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIE 1395
             +V  L D   + E + +   C V+ +   +  W +N++ +    +Y +  +    T+ I 
Sbjct: 12642 IVVPLKDTR-VKEQQEVVFNCEVNTEGA-KAKWFRNEEAIFDSSKYIILQKDLVYTLRIR 12699

Query: 1396  KVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGD----EP-KELKSM 1437
               + +D   Y V + N  G         + +  D    EP K++++M
Sbjct: 12700 DAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETM 12746



 Score = 39.7 bits (91), Expect = 0.021
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 2/81 (2%)

Query: 1346 IMEDKTLCLTCIVSGDPTPEISWLKNDQPV--TFLDRYRMEVRGTEVTITIEKVNSEDSG 1403
            ++E  T      +SG P PE+SW ++ Q +  + L   ++        +TI  V   +SG
Sbjct: 17   VLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSG 76

Query: 1404 RYGVFVKNKYGSETGQVTISV 1424
            RY +   N  G  T    + V
Sbjct: 77   RYSLKATNGSGQATSTAELLV 97



 Score = 39.7 bits (91), Expect = 0.021
 Identities = 80/412 (19%), Positives = 157/412 (38%), Gaps = 69/412 (16%)

Query: 1001  IRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREK 1060
             ++ P ++         +E G   + LE E     A++    N  EI  S   +I  D   
Sbjct: 12280 VKEPPVEFTKPLEDQTVEEGATAV-LECEVSRENAKVKWFKNGTEILKSKKYEIVADGR- 12337

Query: 1061  GLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGP 1120
              + +++I + + ED  +YT   +D K    + +     +F + L     + ++  R    
Sbjct: 12338 -VRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMAR---- 12392

Query: 1121  YFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQ-YD--PETGTGLLCIE 1177
              FE          C++        +++  + +WF   AE+  G+ YD   +    +L I 
Sbjct: 12393 -FE----------CEL--------SRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVIN 12433

Query: 1178  ELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIR 1237
             +    D+  Y   V   R    T   LT    +A+FT+       +   +++  T+  I+
Sbjct: 12434 KCLLDDEAEYSCEVRTAR----TSGMLTVLEEEAVFTK-------NLANIEVSETDT-IK 12481

Query: 1238  IFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAA 1297
             +  +V     E +   W+  D+ +    R    T   +  L I +    D G Y   + +
Sbjct: 12482 LVCEVSKPGAEVI---WYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPS 12538

Query: 1298  GKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCI 1357
              +      TD   +  E A     + + L I+E  +A+ V                  C 
Sbjct: 12539 SR------TDGKVKVHELAAEFISKPQNLEILEGEKAEFV------------------CS 12574

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFV 1409
             +S +  P + W ++D+ +   D+Y +   G +  + ++    +D G Y V V
Sbjct: 12575 ISKESFP-VQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMV 12625



 Score = 39.7 bits (91), Expect = 0.021
 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 1/86 (1%)

Query: 1340  LPDVATIMEDKTLCLTCI-VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVN 1398
             + D  TI    T+ L  I + G P P+ SW K  + +   D  ++    T   +TI+   
Sbjct: 20384 IKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYAT 20443

Query: 1399  SEDSGRYGVFVKNKYGSETGQVTISV 1424
              +D+G Y +   N +G++   V ++V
Sbjct: 20444 RKDAGEYTITATNPFGTKVEHVKVTV 20469



 Score = 39.7 bits (91), Expect = 0.021
 Identities = 21/67 (31%), Positives = 29/67 (43%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             V G P P ++W K DQ +    R   E   T   + I +    DSG Y +  +N  G   
Sbjct: 21089 VLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEVG 21148

Query: 1418  GQVTISV 1424
               +TI V
Sbjct: 21149 DVITIQV 21155



 Score = 39.7 bits (91), Expect = 0.021
 Identities = 20/73 (27%), Positives = 33/73 (45%)

Query: 1360  GDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQ 1419
             G P P ISWLK+  P+   +  R      ++T++I+    E  G+Y V + N        
Sbjct: 27589 GKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVP 27648

Query: 1420  VTISVFKHGDEPK 1432
             +T+       +PK
Sbjct: 27649 ITVITLGPPSKPK 27661



 Score = 39.3 bits (90), Expect = 0.028
 Identities = 62/309 (20%), Positives = 114/309 (36%), Gaps = 40/309 (12%)

Query: 1117 KQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDG---QYDPETGTGL 1173
            KQ   F + LQ  V ++     T +   ++   + +W+    E+ +G   +   +     
Sbjct: 2171 KQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHF 2230

Query: 1174 LCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTE 1233
            L I  +   D   Y  ++ +D     T   +   A+     EL  I      P    G  
Sbjct: 2231 LSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDI----EVPESYSGEL 2286

Query: 1234 EGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTL 1293
            E I         + E ++  W+H D  L+S  +    +      L + D    D+G+Y+ 
Sbjct: 2287 ECI--------VSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSF 2338

Query: 1294 EIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLC 1353
             I   K   +L                 + + +AI++        GL D   + E   + 
Sbjct: 2339 VIDGKKTTCKLK---------------MKPRPIAILQ--------GLSD-QKVCEGDIVQ 2374

Query: 1354 LTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKY 1413
            L   VS +    + W+K+ Q V   DR  + +      + IE +  ED+G Y   +    
Sbjct: 2375 LEVKVSLESVEGV-WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALG 2433

Query: 1414 GSETGQVTI 1422
             S +G+V++
Sbjct: 2434 LSTSGRVSV 2442



 Score = 39.3 bits (90), Expect = 0.028
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTE--VTITIEKVNSEDSGRYGVFVKNKYGS 1415
             + G P P I W+K DQ ++  +  R+E++ T+   +++++     DSG Y +  KN  G 
Sbjct: 22567 IYGKPIPTIQWIKGDQELS--NTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGE 22624

Query: 1416  ETGQVTISVFKHGDEPK 1432
              +  V + V      P+
Sbjct: 22625 RSVTVNVKVLDRPGPPE 22641



 Score = 39.3 bits (90), Expect = 0.028
 Identities = 21/76 (27%), Positives = 36/76 (47%)

Query: 1360  GDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQ 1419
             G P   ++W K+ Q +    R  +    T  +++I++ + ED G Y + V N  GS T  
Sbjct: 25420 GRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVP 25479

Query: 1420  VTISVFKHGDEPKELK 1435
             +TI V      P  ++
Sbjct: 25480 ITIIVLDRPGPPGPIR 25495



 Score = 38.9 bits (89), Expect = 0.036
 Identities = 76/393 (19%), Positives = 144/393 (36%), Gaps = 35/393 (8%)

Query: 1036 ELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTL 1095
            +L + + +K+    P+R     + +   ++ I     ED+G+YT    +   +   T  L
Sbjct: 3372 DLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANL 3431

Query: 1096 VDDDFDKLLRKADAKRRDWKRKQGPYFERPLQ-WKVTEDCQVQLTCKVTNTKKETRFQWF 1154
              +  + +L +   +  + + K  P  +R ++  +V      + TC++ +     RFQWF
Sbjct: 3432 SLEAPESILHERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPN-VRFQWF 3490

Query: 1155 FQRAEMPDGQYDPETGTGLLCIEELSKK---DKGIYRAMVSDDRGEDDTILDLTGDALDA 1211
                E+ +        +  +   E+ +    D G Y    S++ G       LT      
Sbjct: 3491 KAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLT------ 3544

Query: 1212 IFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGT 1271
              TE      LS          +  +    V       ++T W      L      R   
Sbjct: 3545 -VTEAYPPTFLSRPKSLTTFVGKAAKFICTVT--GTPVIETIWQKDGAALSPSPNWRISD 3601

Query: 1272 TLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEK 1331
              ++  L + +    D+G Y+      K   +   D+         AE      L II+K
Sbjct: 3602 AENKHILELSNLTIQDRGVYSC-----KASNKFGADI-------CQAE------LIIIDK 3643

Query: 1332 NRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVT 1391
                 ++ L  V + + +K + L C V  D    ++W K+ Q +     Y++       T
Sbjct: 3644 PH--FIKELEPVQSAI-NKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIAT 3700

Query: 1392 ITIEKVNSEDSGRYGVFVKNKYGSETGQVTISV 1424
            + I     +DSG Y     N+ GS +   T++V
Sbjct: 3701 LEIPLAKLKDSGTYVCTASNEAGSSSCSATVTV 3733



 Score = 38.9 bits (89), Expect = 0.036
 Identities = 68/400 (17%), Positives = 142/400 (35%), Gaps = 57/400 (14%)

Query: 1042 NNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFD 1101
            +N+EI    N K+        + V+   + + D G YT    +   K+  +  L   +  
Sbjct: 7248 DNREIRPGGNYKMTLVENTATLTVL--KVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPP 7305

Query: 1102 KLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMP 1161
            + ++K +  R                  V +D   +  CK+  +  E +  W+    E+ 
Sbjct: 7306 RFIKKLEPSRI-----------------VKQDEFTRYECKIGGSP-EIKVLWYKDETEIQ 7347

Query: 1162 DG---QYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGR 1218
            +    +        +L +  LS +D G Y     +            G A  +   ++  
Sbjct: 7348 ESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHN----------AAGSASSSTSLKVKE 7397

Query: 1219 IGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWL 1278
                   P  I+ T +G  +  + +         +W+   + L SG + +  +      +
Sbjct: 7398 PPIFRKKPHPIE-TLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSI 7456

Query: 1279 HILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVR 1338
            HIL+   +D G+Y       K    + +D                   +I  K   + V+
Sbjct: 7457 HILNVDAADIGEYQC-----KATNDVGSDTC---------------VGSIALKAPPRFVK 7496

Query: 1339 GLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVN 1398
             L D++T++  +    T I   +P   + +    + V   D   +       T+   +V 
Sbjct: 7497 KLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVE 7556

Query: 1399 SEDSGRYGVFVKNKYGSETGQVTISVFKHG---DEPKELK 1435
              ++G+Y   +KN  G +    T+SV +     ++P+ +K
Sbjct: 7557 PANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPESIK 7596



 Score = 38.9 bits (89), Expect = 0.036
 Identities = 18/74 (24%), Positives = 36/74 (48%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             +SG P P+++  ++  P+    R+  E+    +TI +++  + D+GRY +   N  G+  
Sbjct: 26500 ISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTK 26559

Query: 1418  GQVTISVFKHGDEP 1431
               + I V      P
Sbjct: 26560 AFINIVVLDRPGPP 26573



 Score = 38.9 bits (89), Expect = 0.036
 Identities = 46/199 (23%), Positives = 79/199 (39%), Gaps = 36/199 (18%)

Query: 184   QVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFA 243
             QVTWY    +++     + KY IT   G+  L ++     D  TY  +V N +G+ SS+A
Sbjct: 31599 QVTWYFGVRQLE----NSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYA 31654

Query: 244   KVLVRTYLGKDAGFD------SEIFKRST-----FGPSVEFTSVL--KPVFAREKEPFSL 290
             ++ V+   G    +D       +  KR T          EFT  L  K  +  E   F +
Sbjct: 31655 ELFVK---GVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGV 31711

Query: 291   SCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSP 350
             +      V     + W++ G  ++     K              T++ D+GLY + + S 
Sbjct: 31712 TI----TVHPEPHVTWYKSGQKIKPGDNDK------------KYTFESDKGLYQLTINSV 31755

Query: 351   FGPREQSTYVLVRDAEAEN 369
                 +    V+ R+   E+
Sbjct: 31756 TTDDDAEYTVVARNKYGED 31774



 Score = 38.5 bits (88), Expect = 0.047
 Identities = 24/105 (22%), Positives = 39/105 (37%), Gaps = 8/105 (7%)

Query: 1339  GLPDVATIMEDKTLCLTCIVSGDPTPEISW--------LKNDQPVTFLDRYRMEVRGTEV 1390
             G  D         + +  ++ G PTP+ SW           D      +  ++E      
Sbjct: 15815 GAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSS 15874

Query: 1391  TITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
              I I +     +G+Y +  KNK G +T    + V      PK+LK
Sbjct: 15875 VIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLK 15919



 Score = 38.5 bits (88), Expect = 0.047
 Identities = 22/76 (28%), Positives = 40/76 (52%), Gaps = 4/76 (5%)

Query: 1351  TLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGT--EVTITIEKVNSEDSGRYGVF 1408
             T+ L   V G P P+I+W K +  V   DR  ++++ T  +  +  E VN  D+G+Y + 
Sbjct: 19710 TMRLYVPVKGRPPPKITWSKPN--VNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILT 19767

Query: 1409  VKNKYGSETGQVTISV 1424
             ++N  G +   + + V
Sbjct: 19768 LENSCGKKEYTIVVKV 19783



 Score = 38.5 bits (88), Expect = 0.047
 Identities = 18/61 (29%), Positives = 29/61 (47%)

Query: 1354  LTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKY 1413
             L+C + G P P+I W +  + +    +Y+M   G   T+T+     ED G Y     N+ 
Sbjct: 30552 LSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEV 30611

Query: 1414  G 1414
             G
Sbjct: 30612 G 30612



 Score = 38.1 bits (87), Expect = 0.061
 Identities = 25/90 (27%), Positives = 40/90 (44%), Gaps = 5/90 (5%)

Query: 158   IPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEI 217
             +PL+   V E   V+  C V      +  W++N+  I    F + KY I     + +L I
Sbjct: 12644 VPLKDTRVKEQQEVVFNCEVNTEGA-KAKWFRNEEAI----FDSSKYIILQKDLVYTLRI 12698

Query: 218   RRCAIEDSATYTVRVKNAHGQASSFAKVLV 247
             R   ++D A Y V + N  G+    A  L+
Sbjct: 12699 RDAHLDDQANYNVSLTNHRGENVKSAANLI 12728



 Score = 38.1 bits (87), Expect = 0.061
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 4/92 (4%)

Query: 1342  DVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTE--VTITIEKVNS 1399
             DV  +   + L +   ++G P P ISW K+   +   +R R E+  T+    +T++    
Sbjct: 25797 DVIVVKAGEVLKINADIAGRPLPVISWAKDG--IEIEERARTEIISTDNHTLLTVKDCIR 25854

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEP 1431
              D+G+Y + +KN  G+ +  V   V      P
Sbjct: 25855 RDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPP 25886



 Score = 37.7 bits (86), Expect = 0.080
 Identities = 50/220 (22%), Positives = 79/220 (35%), Gaps = 34/220 (15%)

Query: 171  VLLTCTVQASPPPQVTWYKNDT--RIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATY 228
            V LTC +  S P QV WY++    R D  L    +    +N  + +L+I +  +  S  Y
Sbjct: 6192 VTLTCRLNGSAPIQVCWYRDGVLLRDDENL----QTSFVDN--VATLKILQTDLSHSGQY 6245

Query: 229  TVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPF 288
            +    N  G ASS A++  R              K+S F    +   V   V A E   F
Sbjct: 6246 SCSASNPLGTASSSARLTAREP------------KKSPF---FDIKPVSIDVIAGESADF 6290

Query: 289  SLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVP 348
                  ++ +     I W +D   +R      I        L++    K D G Y  +  
Sbjct: 6291 ECHVTGAQPM----RITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQAT 6346

Query: 349  SPFGPREQSTYVLVRD-------AEAENPGAPGSPLNVRC 381
            +  G    S  + V++        EA      G  + + C
Sbjct: 6347 NDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQLEC 6386



 Score = 37.7 bits (86), Expect = 0.080
 Identities = 22/93 (23%), Positives = 45/93 (48%), Gaps = 3/93 (3%)

Query: 1342  DVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGT--EVTITIEKVNS 1399
             DV  +   +T  L   + G P P++ W K+ + +      RME++ T  + T+ ++    
Sbjct: 24715 DVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELE-ETAARMEIKSTIQKTTLVVKDCIR 24773

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPK 1432
              D G+Y + + N  G+++  +T+ V      P+
Sbjct: 24774 TDGGQYILKLSNVGGTKSIPITVKVLDRPGPPE 24806



 Score = 37.7 bits (86), Expect = 0.080
 Identities = 23/93 (24%), Positives = 39/93 (41%), Gaps = 2/93 (2%)

Query: 284   EKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
             E E    SC    D     ++ W R G +L +S R ++  T  +++ ++S     DEG Y
Sbjct: 32574 EGESARFSC--DTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNY 32631

Query: 344   MVRVPSPFGPREQSTYVLVRDAEAENPGAPGSP 376
              V V +  G +E    + ++ A          P
Sbjct: 32632 SVVVENSEGKQEAEFTLTIQKARVTEKAVTSPP 32664



 Score = 37.4 bits (85), Expect = 0.10
 Identities = 27/97 (27%), Positives = 42/97 (43%), Gaps = 4/97 (4%)

Query: 1335  KVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITI 1394
             K++ GL    T+     + L   V+G P P+I+W K D  +    R  +E    + T+TI
Sbjct: 13695 KLLAGL----TVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTI 13750

Query: 1395  EKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEP 1431
                   D+G Y +   N  G  T  V ++V      P
Sbjct: 13751 VDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPP 13787



 Score = 37.4 bits (85), Expect = 0.10
 Identities = 17/67 (25%), Positives = 37/67 (55%), Gaps = 2/67 (2%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             + G P PE++W K++  +   +R  +E   +   + I + N  D+G++ + ++N  G ++
Sbjct: 20800 IKGRPAPEVTWTKDN--INLKNRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKS 20857

Query: 1418  GQVTISV 1424
             G V + V
Sbjct: 20858 GFVNVRV 20864



 Score = 37.4 bits (85), Expect = 0.10
 Identities = 20/79 (25%), Positives = 36/79 (45%), Gaps = 2/79 (2%)

Query: 1354  LTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKY 1413
             LT  + G P P   W K  Q ++   R  +    T   + I++ +  DSG Y + ++NK 
Sbjct: 30156 LTIPIKGKPFPICKWTKEGQDIS--KRAMIATSETHTELVIKEADRGDSGTYDLVLENKC 30213

Query: 1414  GSETGQVTISVFKHGDEPK 1432
             G +   + + V    + P+
Sbjct: 30214 GKKAVYIKVRVIGSPNSPE 30232



 Score = 37.0 bits (84), Expect = 0.14
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 4/93 (4%)

Query: 1342  DVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTE--VTITIEKVNS 1399
             D   +   +T  L   V G P P I WL+ D+ +   +  R E++ T+    + ++    
Sbjct: 23633 DTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIE--ESARCEIKNTDFKALLIVKDAIR 23690

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPK 1432
              D G+Y +   N  GS++  V + V      P+
Sbjct: 23691 IDGGQYILRASNVAGSKSFPVNVKVLDRPGPPE 23723



 Score = 37.0 bits (84), Expect = 0.14
 Identities = 21/83 (25%), Positives = 36/83 (43%), Gaps = 2/83 (2%)

Query: 167   EHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSA 226
             E   + + C     P P+VTW     +I  +    G++ I N   L +L I     +D  
Sbjct: 33342 EGKVLTVACAFTGEPTPEVTWSCGGRKIHSQ--EQGRFHIENTDDLTTLIIMDVQKQDGG 33399

Query: 227   TYTVRVKNAHGQASSFAKVLVRT 249
              YT+ + N  G  S+   + +R+
Sbjct: 33400 LYTLSLGNEFGSDSATVNIHIRS 33422



 Score = 36.6 bits (83), Expect = 0.18
 Identities = 47/218 (21%), Positives = 87/218 (39%), Gaps = 30/218 (13%)

Query: 1220 GALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLH 1279
            GA+S  PL  Q   E      + +  N +  K  W    K L   + IR+ +   +  L 
Sbjct: 2620 GAISK-PLTDQTVAESQEAVFECEVANPD-SKGEWLRDGKHLPLTNNIRSESDGHKRRLI 2677

Query: 1280 ILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRG 1339
            I   K  D G+YT ++A  K   +L  +        A+   + LK L             
Sbjct: 2678 IAATKLDDIGEYTYKVATSKTSAKLKVE--------AVKIKKTLKNL------------- 2716

Query: 1340 LPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNS 1399
                 T+ E +    T  ++      + W+KN   +   ++Y + V+GT  ++ I+    
Sbjct: 2717 -----TVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAI 2771

Query: 1400 EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELKSM 1437
             D   YG F   + G+ + ++ +   K   +PK++ ++
Sbjct: 2772 VDESVYG-FRLGRLGA-SARLHVETVKIIKKPKDVTAL 2807



 Score = 36.6 bits (83), Expect = 0.18
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 1359  SGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEK-VNSEDSGRYGVFVKNKYGSET 1417
             SG P P I+W K    +     Y++ V  +  ++     V  +D+G Y V  KN++G + 
Sbjct: 31052 SGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQ 31111

Query: 1418  GQVTISVFKHGDEPKELK 1435
               V + V    D P+ +K
Sbjct: 31112 KTVELDVADVPDPPRGVK 31129



 Score = 36.2 bits (82), Expect = 0.23
 Identities = 61/331 (18%), Positives = 136/331 (41%), Gaps = 49/331 (14%)

Query: 882  AGLGQPSMP---TDPVLLEDKPGAHEI---EVGVDEEGFIYLAFEAPEAPDSSEFQWSKD 935
            AG G+P+ P   T PV+ +   G   +   +VG + +  +Y  ++    P ++ +++   
Sbjct: 1074 AGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVY--WKKSGVPLTTGYRYKVS 1131

Query: 936  YKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTLTEE-ELEKL 994
            Y             +  + K+++     +D G Y+++V +   + SAS +L EE + E L
Sbjct: 1132 YN-----------KQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELL 1180

Query: 995  KKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKI 1054
             K   E               +L + +V  +++  K+   A   +    ++ +      I
Sbjct: 1181 MKSQQE---------------MLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALI 1225

Query: 1055 NFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLRKADAKR--- 1111
               R+K   + ++     ED+  + +  ++   K +I   ++    ++LL +   ++   
Sbjct: 1226 ---RKKMAKDTVVVRTYVEDQEFHISSFEERLIK-EIEYRIIKTTLEELLEEDGEEKMAV 1281

Query: 1112 --RDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDG---QYD 1166
               + +  +  +  R   +++ E   V   CK++      +  W+     +  G   Q D
Sbjct: 1282 DISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPL-PKIAWYKDGKRIKHGERYQMD 1340

Query: 1167 -PETGTGLLCIEELSKKDKGIYRAMVSDDRG 1196
              + G   L I  +  +D+GIY A  S+ +G
Sbjct: 1341 FLQDGRASLRIPVVLPEDEGIYTAFASNIKG 1371



 Score = 36.2 bits (82), Expect = 0.23
 Identities = 27/102 (26%), Positives = 43/102 (42%), Gaps = 4/102 (3%)

Query: 147  ELCYGRGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRI 206
            E+     P F   L    +   T  LL C V  + P +++W+K+  +I      + KYR+
Sbjct: 3824 EIVIKEPPSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIR----SSKKYRL 3879

Query: 207  TNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVR 248
             +   L+ LEI      D   Y   V N  G+    A  L++
Sbjct: 3880 FSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLLK 3921



 Score = 36.2 bits (82), Expect = 0.23
 Identities = 22/87 (25%), Positives = 36/87 (41%)

Query: 1345  TIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGR 1404
             T++  + L +     G PTP ++W K++ P+    R   E       +TI+    ED G 
Sbjct: 22158 TVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGH 22217

Query: 1405  YGVFVKNKYGSETGQVTISVFKHGDEP 1431
             Y V + N  G     + + V      P
Sbjct: 22218 YVVKLTNSAGEAIETLNVIVLDKPGPP 22244



 Score = 35.8 bits (81), Expect = 0.31
 Identities = 19/81 (23%), Positives = 36/81 (44%), Gaps = 2/81 (2%)

Query: 1354  LTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKY 1413
             +T    G P P + W K D  +    R  ++   +  ++TIE  N  DSG+Y + ++N  
Sbjct: 26206 MTVPFRGRPVPNVLWSKPDTDLR--TRAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVL 26263

Query: 1414  GSETGQVTISVFKHGDEPKEL 1434
              + +  + + V      P  +
Sbjct: 26264 SAASLTLVVKVLDTPGPPTNI 26284



 Score = 35.8 bits (81), Expect = 0.31
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 2/63 (3%)

Query: 1251  KTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKY--TLEIAAGKEVRQLSTDL 1308
             K TW  ++ RL+  DR+   TT D   L + D    D G+Y  TLE  AG +   ++  +
Sbjct: 28678 KVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVV 28737

Query: 1309  SGQ 1311
              G+
Sbjct: 28738 IGR 28740



 Score = 35.4 bits (80), Expect = 0.40
 Identities = 40/173 (23%), Positives = 64/173 (36%), Gaps = 23/173 (13%)

Query: 171  VLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTV 230
            V+  C +  S P  V+WYK+   +      +   + +      +L I +     +  Y+ 
Sbjct: 8074 VVFDCAISGSEPISVSWYKDGKPLKD----SPNVQTSFLDNTATLNIFKTDRSLAGQYSC 8129

Query: 231  RVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSL 290
               N  G ASS A++++    GK+  F               F   L PV A   E    
Sbjct: 8130 TATNPIGSASSSARLILTE--GKNPPF---------------FDIRLAPVDAVVGESADF 8172

Query: 291  SCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
             C  +        + W +D   +RS  + +I Y +  A L V    K D G Y
Sbjct: 8173 ECHVTGT--QPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQY 8223



 Score = 35.0 bits (79), Expect = 0.52
 Identities = 20/65 (30%), Positives = 30/65 (46%)

Query: 1360 GDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQ 1419
            GDPT  + WL + +P+   +R RM       ++      S DSG       NKYG++   
Sbjct: 1730 GDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTS 1789

Query: 1420 VTISV 1424
             T+ V
Sbjct: 1790 ATLIV 1794



 Score = 35.0 bits (79), Expect = 0.52
 Identities = 19/43 (44%), Positives = 25/43 (58%)

Query: 1253  TWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEI 1295
             TW   DK LE+GDR++  T      L I   + SDKG YTL++
Sbjct: 13427 TWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKL 13469



 Score = 34.7 bits (78), Expect = 0.68
 Identities = 36/166 (21%), Positives = 64/166 (38%), Gaps = 25/166 (15%)

Query: 1245 YNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQL 1304
            ++V  +K+ WF   + L+   R +T        L I D +  D+G+YT +     E  + 
Sbjct: 8768 FSVPNVKSEWFRNGRILKPQGRHKTEVEHKVHKLTIADVRAEDQGQYTCKY----EDLET 8823

Query: 1305 STDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTP 1364
            S +L                    IE    +  + + ++  + E ++    C VS D   
Sbjct: 8824 SAELR-------------------IEAEPIQFTKRIQNI-VVSEHQSATFECEVSFDDA- 8862

Query: 1365 EISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVK 1410
             ++W K    +T   +Y     G    +TI  V  +D G Y V  +
Sbjct: 8863 IVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIAR 8908



 Score = 34.7 bits (78), Expect = 0.68
 Identities = 32/148 (21%), Positives = 70/148 (47%), Gaps = 13/148 (8%)

Query: 955   KVILKEPGLEDLGTYSVI----VTDADEDISASHTLTEEELEKLK-----KLSHEIRNPV 1005
             K+++++PG    G   ++    + DAD+  + ++T+T E    L+     K+   IR+ +
Sbjct: 11249 KIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWL 11308

Query: 1006  IKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEV 1065
             +K I   ++    +G      ++ K +P  +    ++  EI + PN K    R+   + +
Sbjct: 11309 VKPIRDQHVK--PKGTAIFACDIAKDTPNIKWFKGYD--EIPAEPNDKTEILRDGNHLYL 11364

Query: 1066  IIQNLSEEDKGSYTAQLQDGKAKNQITL 1093
              I+N   ED   Y  +++  +   ++TL
Sbjct: 11365 KIKNAMPEDIAEYAVEIEGKRYPAKLTL 11392



 Score = 34.3 bits (77), Expect = 0.89
 Identities = 24/89 (26%), Positives = 37/89 (41%), Gaps = 5/89 (5%)

Query: 160  LRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRIT-NNYGLLSLEIR 218
            ++++ + E   V   C +   P P++ WYK+  RI        +Y++     G  SL I 
Sbjct: 1297 IKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIK----HGERYQMDFLQDGRASLRIP 1352

Query: 219  RCAIEDSATYTVRVKNAHGQASSFAKVLV 247
                ED   YT    N  G A    K+ V
Sbjct: 1353 VVLPEDEGIYTAFASNIKGNAICSGKLYV 1381



 Score = 34.3 bits (77), Expect = 0.89
 Identities = 35/184 (19%), Positives = 76/184 (41%), Gaps = 15/184 (8%)

Query: 1228  KIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSD 1287
             +++G +   R+F  V    +++M      +D+ ++ G+       L    +H++  K+  
Sbjct: 11557 EVEGKKTSARLF--VTGIRLKFMSPL---EDQTVKEGETATFVCELSHEKMHVVWFKNDA 11611

Query: 1288  KGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIM 1347
             K   +  +    E +    ++     +D      ++K L+     + KV+   P     +
Sbjct: 11612 KLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELS--STAQLKVLEADPYFTVKL 11669

Query: 1348  EDKT------LCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSED 1401
              DKT      + L C VS D    + W K+ + +    +Y ++  G    + I+K + +D
Sbjct: 11670 HDKTAVEKDEITLKCEVSKDVP--VKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKD 11727

Query: 1402  SGRY 1405
              G Y
Sbjct: 11728 KGEY 11731



 Score = 33.9 bits (76), Expect = 1.2
 Identities = 32/114 (28%), Positives = 50/114 (43%), Gaps = 7/114 (6%)

Query: 1299  KEVRQLSTDLSGQAFEDAM-----AEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLC 1353
             K+  + S  +   AFED       AE +      IIE  R K +  L DV T  E ++  
Sbjct: 11889 KDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDV-TAKEKESAV 11947

Query: 1354  LTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGV 1407
              T  +S D    + W KNDQ +       M+  G   +IT + ++ +D+ +  V
Sbjct: 11948 FTVELSHDNI-RVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRV 12000



 Score = 33.9 bits (76), Expect = 1.2
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 4/74 (5%)

Query: 1354  LTCIVSGDPTPEISWLKNDQPVTFLD--RYRM-EVRGTEVTITIEKVNSEDSGRYGVFVK 1410
             L C V+G P P + W +  + +   D  +YR+ E +G    + I  V  +D+  Y V   
Sbjct: 30947 LVCKVTGHPKPIVKWYRQGKEI-IADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRAT 31005

Query: 1411  NKYGSETGQVTISV 1424
             N+ GS +G  ++ V
Sbjct: 31006 NQGGSVSGTASLEV 31019



 Score = 33.5 bits (75), Expect = 1.5
 Identities = 21/86 (24%), Positives = 38/86 (44%), Gaps = 2/86 (2%)

Query: 1345 TIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGR 1404
            T+ +   + L   V+G PTP + + ++   +     +++   G   ++ I +   EDSG 
Sbjct: 114  TVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGT 173

Query: 1405 YGVFVKNKYGSETGQVTISVFKHGDE 1430
            Y V   N  G  T   T  +   G+E
Sbjct: 174  YSVNATNSVGRATS--TAELLVQGEE 197



 Score = 33.5 bits (75), Expect = 1.5
 Identities = 26/81 (32%), Positives = 31/81 (38%), Gaps = 3/81 (3%)

Query: 161  RSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRC 220
            +S  V E TT      V   P P V W K   R   +L + G+  I        LEIR  
Sbjct: 8461 QSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWR---QLNQGGRVFIHQKGDEAKLEIRDT 8517

Query: 221  AIEDSATYTVRVKNAHGQASS 241
               DS  Y     N HG+  S
Sbjct: 8518 TKTDSGLYRCVAFNEHGEIES 8538



 Score = 33.5 bits (75), Expect = 1.5
 Identities = 18/74 (24%), Positives = 34/74 (45%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             +SG P P I W K+D+ +       +E      +I I+  +  +SG Y + ++N  GS +
Sbjct: 26896 ISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSAS 26955

Query: 1418  GQVTISVFKHGDEP 1431
               + + +      P
Sbjct: 26956 ATIRVQILDKPGPP 26969



 Score = 33.1 bits (74), Expect = 2.0
 Identities = 51/224 (22%), Positives = 88/224 (39%), Gaps = 42/224 (18%)

Query: 304  IQWFRDGSLLRSSRRRKILYT-DRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLV 362
            I W++DG  ++   R ++ +  D +ASL++     EDEG+Y     +  G    S  + V
Sbjct: 1322 IAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYV 1381

Query: 363  RDAEAENPGAP-GSPLNVRCLD------------VNRDCLILTWAPPSDTRGNPITAYTI 409
                   P AP G+P  +  L+            V+R  + ++ A  S  R +P      
Sbjct: 1382 ------EPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPA 1435

Query: 410  ERCQGESGEWIACHEAPGGTCRCPIQGL-------VEGQSYRFRVRAISRVGSSVPSKAS 462
                G   E     E+       P+  L       +EGQ+ RF ++    VG  +P    
Sbjct: 1436 RMSPGRRLE--ETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKV---VGRPMPE--- 1487

Query: 463  ELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTN 506
                   HD      +I  D  +K+ I  D  +  + +P+ P++
Sbjct: 1488 ---TFWFHDG----QQIVNDYTHKVVIKEDGTQSLIIVPATPSD 1524



 Score = 33.1 bits (74), Expect = 2.0
 Identities = 37/166 (22%), Positives = 69/166 (41%), Gaps = 29/166 (17%)

Query: 179  ASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT-VRVKNAHG 237
            + P  +V WYK+   +        KYR+ ++  +  L I      D+  Y+ V V++ + 
Sbjct: 2199 SEPFVKVKWYKDGMEVH----EGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENV 2254

Query: 238  QASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSED 297
            + +  AK++V                    G  VEF   L+ +   E     L C+ S +
Sbjct: 2255 KTT--AKLIVE-------------------GAVVEFVKELQDIEVPESYSGELECIVSPE 2293

Query: 298  VLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
             ++ +   W+ +   L+S+ +  I     + +L V    KED+G Y
Sbjct: 2294 NIEGK---WYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEY 2336



 Score = 32.7 bits (73), Expect = 2.6
 Identities = 41/187 (21%), Positives = 69/187 (36%), Gaps = 34/187 (18%)

Query: 170  TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT 229
            ++  T  ++ +PP +V W+K    + P         I+    +  LE+      +S  Y+
Sbjct: 6850 SLTFTSVIRGTPPFKVKWFKGSRELVP----GESCNISLEDFVTELELFEVQPLESGDYS 6905

Query: 230  VRVKNAHGQASSFAKVLVR---TYLGKDAGFDSEIFKRSTFGPSV-EFTSVLKPVFAREK 285
              V N  G AS    + V+   T++ + A F  E     T  P V E T    P      
Sbjct: 6906 CLVTNDAGSASCTTHLFVKEPATFVKRLADFSVE-----TGSPIVLEATYTGTPPI---- 6956

Query: 286  EPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMV 345
                             S+ W +D  L+  S R  I  T++   L++  +  ED   Y  
Sbjct: 6957 -----------------SVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSC 6999

Query: 346  RVPSPFG 352
             + +  G
Sbjct: 7000 LIENEAG 7006



 Score = 32.3 bits (72), Expect = 3.4
 Identities = 38/177 (21%), Positives = 64/177 (36%), Gaps = 33/177 (18%)

Query: 167  EHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSA 226
            E+ TV    +V     P V W+     I P    + K+R+ +   +  L ++  +  D+ 
Sbjct: 2808 ENATVAFEVSVSHDTVP-VKWFHKSVEIKP----SDKHRLVSERKVHKLMLQNISPSDAG 2862

Query: 227  TYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKE 286
             YT  V    GQ    AK+ V T                     +  T  +K +   E +
Sbjct: 2863 EYTAVV----GQLECKAKLFVET---------------------LHITKTMKNIEVPETK 2897

Query: 287  PFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
              S  C  S   + +    W ++G  +  S + KI+   +   L +  T  ED   Y
Sbjct: 2898 TASFECEVSHFNVPS---MWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEY 2951



 Score = 32.3 bits (72), Expect = 3.4
 Identities = 28/120 (23%), Positives = 52/120 (43%), Gaps = 13/120 (10%)

Query: 227  TYTVRVKNAH-GQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREK 285
            T+++ ++N H G A+ +      T++   A   + ++  +     +EF   +K +   EK
Sbjct: 3022 THSLNIRNVHFGDAADY------TFVAGKATSTATLYVEARH---IEFRKHIKDIKVLEK 3072

Query: 286  EPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMV 345
            +     C  SE  +   ++QW +D   L+ + R KI        L +  T   D G Y V
Sbjct: 3073 KRAMFECEVSEPDI---TVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTV 3129



 Score = 32.3 bits (72), Expect = 3.4
 Identities = 15/63 (23%), Positives = 28/63 (44%)

Query: 1354 LTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKY 1413
            + C VSG       W K+ + ++   +YR+      V++ +  +  ED+  Y   V N  
Sbjct: 5256 MECKVSGSLPISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVA 5315

Query: 1414 GSE 1416
            G +
Sbjct: 5316 GDD 5318



 Score = 32.3 bits (72), Expect = 3.4
 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 2/67 (2%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYG--S 1415
             ++G P P  SW      +   +R  +E       +TI +    D+G Y + +KN  G  S
Sbjct: 29762 IAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTS 29821

Query: 1416  ETGQVTI 1422
             ET +V I
Sbjct: 29822 ETIKVII 29828



 Score = 32.0 bits (71), Expect = 4.4
 Identities = 17/76 (22%), Positives = 30/76 (39%), Gaps = 1/76 (1%)

Query: 1356 CIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGS 1415
            C +SG     +SW K+ +P+      +        T+ I K +   +G+Y     N  GS
Sbjct: 8078 CAISGSEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGS 8137

Query: 1416 ETGQVTISVFKHGDEP 1431
             +    + +   G  P
Sbjct: 8138 ASSSARL-ILTEGKNP 8152



 Score = 32.0 bits (71), Expect = 4.4
 Identities = 29/166 (17%), Positives = 56/166 (33%), Gaps = 17/166 (10%)

Query: 1250 MKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLS 1309
            +K +W    + + SG + +     +   L +L     D G+YT                 
Sbjct: 8182 IKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAV------------- 8228

Query: 1310 GQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWL 1369
             +  +D+      +K   I         + L +     E  +  L   V+G     ++W 
Sbjct: 8229 NEVGKDSCTAQLNIKERLI----PPSFTKRLSETVEETEGNSFKLEGRVAGSQPITVAWY 8284

Query: 1370 KNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGS 1415
            KN+  +       +  +   + + + K    D+G Y   V N  GS
Sbjct: 8285 KNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGS 8330



 Score = 32.0 bits (71), Expect = 4.4
 Identities = 20/99 (20%), Positives = 39/99 (39%), Gaps = 7/99 (7%)

Query: 1340  LPDVATIMEDKTLCLTCIVSGDPTPEISWLK-------NDQPVTFLDRYRMEVRGTEVTI 1392
             L +   + E   + +   + G P P ++W K       N +PV +       V     T+
Sbjct: 16122 LKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTL 16181

Query: 1393  TIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEP 1431
              I +    D+G Y +   N  G+ + ++ ++V      P
Sbjct: 16182 VIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPP 16220



 Score = 31.6 bits (70), Expect = 5.8
 Identities = 22/73 (30%), Positives = 28/73 (38%), Gaps = 5/73 (6%)

Query: 165  VWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIED 224
            V E  T    C V   P P+V WY N      +L R  K       G+  L+I  C   D
Sbjct: 1852 VLEGETARFRCRVTGYPQPKVNWYLNG-----QLIRKSKRFRVRYDGIHYLDIVDCKSYD 1906

Query: 225  SATYTVRVKNAHG 237
            +    V  +N  G
Sbjct: 1907 TGEVKVTAENPEG 1919



 Score = 31.2 bits (69), Expect = 7.5
 Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 2/92 (2%)

Query: 275  SVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSC 334
            S LK V   E E  +L C  S     + ++ W+R+   + SS   +I +    A L +  
Sbjct: 947  SGLKNVTVIEGESVTLECHISG--YPSPTVTWYREDYQIESSIDFQITFQSGIARLMIRE 1004

Query: 335  TYKEDEGLYMVRVPSPFGPREQSTYVLVRDAE 366
             + ED G +     +  G    S Y+ V+ +E
Sbjct: 1005 AFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSE 1036



 Score = 31.2 bits (69), Expect = 7.5
 Identities = 16/67 (23%), Positives = 28/67 (41%), Gaps = 2/67 (2%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             VSG P P ++W  N++  T      +E      ++ I+       G Y +  KN+ G   
Sbjct: 16548 VSGKPPPTVTWNMNER--TLPQEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERK 16605

Query: 1418  GQVTISV 1424
               + + V
Sbjct: 16606 KTIIVDV 16612



 Score = 31.2 bits (69), Expect = 7.5
 Identities = 23/115 (20%), Positives = 48/115 (41%), Gaps = 1/115 (0%)

Query: 1321  QRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDR 1380
             + +K   I+E     +   +  +  +     + L  IV G P P+++W K       + +
Sbjct: 18593 EAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGID-NVVRK 18651

Query: 1381  YRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
              ++++  T   + I     +DSG+Y + + N  G +   V + V        +LK
Sbjct: 18652 GQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLK 18706



 Score = 31.2 bits (69), Expect = 7.5
 Identities = 34/168 (20%), Positives = 66/168 (39%), Gaps = 31/168 (18%)

Query: 1253  TWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQA 1312
             +W    + L+   R+    T     LHI +    D GKYT+           +T+ +G A
Sbjct: 24344 SWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTV----------TATNSAGTA 24393

Query: 1313  FEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTP-----EIS 1367
              E+         ++ ++EK         P V  +  D+      ++S +P       +IS
Sbjct: 24394 TENL--------SVIVLEKPG-------PPVGPVRFDEVSADFVVISWEPPAYTGGCQIS 24438

Query: 1368  -WLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYG 1414
              ++   +  T    + +       TI I K+ +    ++ +F +N+YG
Sbjct: 24439 NYIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYG 24486



 Score = 30.8 bits (68), Expect = 9.8
 Identities = 15/38 (39%), Positives = 18/38 (47%)

Query: 159  PLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDP 196
            PL+   V E T  +L C V       V WY ND +I P
Sbjct: 2450 PLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKP 2487



 Score = 30.8 bits (68), Expect = 9.8
 Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 1051  NRKINFDREKGLVEVIIQNLSEEDKGSYTA----QLQDGKAKNQITLTLVDDDFDKLLR 1105
             ++K  F+ +KGL ++ I +++ +D   YT     +  +   K ++T+TL     D  LR
Sbjct: 31736 DKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLR 31794



 Score = 30.8 bits (68), Expect = 9.8
 Identities = 30/123 (24%), Positives = 55/123 (44%), Gaps = 6/123 (4%)

Query: 977   DEDISASHTLTEEELEKLK---KLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSP 1033
             DE I    + T+E + K +    LS E+ +    +    + +I E   V    E+    P
Sbjct: 33103 DEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISG-EP 33161

Query: 1034  AAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITL 1093
             + E+    NN  I  S N  ++  R + +  + I+N S  D G YT + ++ + +   T 
Sbjct: 33162 SPEIEWFKNNLPISISSN--VSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATA 33219

Query: 1094  TLV 1096
             +L+
Sbjct: 33220 SLM 33222


>gi|110349717 titin isoform novex-2 [Homo sapiens]
          Length = 27118

 Score =  274 bits (701), Expect = 4e-73
 Identities = 215/831 (25%), Positives = 361/831 (43%), Gaps = 81/831 (9%)

Query: 169  TTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATY 228
            T + L  TV   P P++TW    T+ D  L +  +  I N     ++ I      D+ TY
Sbjct: 7401 TKIELPATVTGKPEPKITW----TKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTY 7456

Query: 229  TVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPF 288
             +   N  G+A++  +V V    G  A FD               T V            
Sbjct: 7457 IIEAVNVCGRATAVVEVNVLDKPGPPAAFD--------------ITDVTNE--------- 7493

Query: 289  SLSCLFS----EDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYM 344
              SCL +     D   ++   +  +     S    K+  T +  + K +      E ++ 
Sbjct: 7494 --SCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFR 7551

Query: 345  VRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPI 404
            V   + +G  E      +      +P  PG P  +   D+ +D + LTW  P D  G+PI
Sbjct: 7552 VAAENMYGVGEPVQASPITAKYQFDP--PGPPTRLEPSDITKDAVTLTWCEPDDDGGSPI 7609

Query: 405  TAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASEL 464
            T Y +ER   ++ +W+ C++ P       ++GL   + YRFRV A +  G   PSK++E 
Sbjct: 7610 TGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEP 7669

Query: 465  VVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEP 524
            +++                           +D +  P PP      ++ +  V L W +P
Sbjct: 7670 ILI---------------------------KDPIDPPWPPGKPTVKDVGKTSVRLNWTKP 7702

Query: 525  SPRDRAPL-TYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGL 583
                 A + +Y +E    G+  W  ++   P  + +  +  L + + Y FRVRA+N+ G 
Sbjct: 7703 EHDGGAKIESYVIEMLKTGTDEWVRVAEGVP--TTQHLLPGLMEGQEYSFRVRAVNKAGE 7760

Query: 584  SDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWD-PVKD--PELLGYYIYSRKV 640
            S+PSEPS+P+  R       PP  ++    T+ +  L W  P KD    +  Y +  R V
Sbjct: 7761 SEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDV 7820

Query: 641  GTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATP 700
                WQTV+   ++ T+ TV  L  G  Y F V + +  G  + +   + +  K    TP
Sbjct: 7821 RRKGWQTVDTT-VKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTP 7879

Query: 701  SAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCK 760
              PY  A+++  K  + + W+PPK  GG  I  Y +++ +     W    +   P    +
Sbjct: 7880 GPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFR 7939

Query: 761  VSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVL 820
            V+D+ EG   +F+ RA N AGVG  S P+ +   ++ T P P PP D+  ++     + +
Sbjct: 7940 VTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSP-PSPPLDLHVTDAGRKHIAI 7998

Query: 821  QWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSD-LQPGKSYVFQVQAM 879
             W+PP   G  P+ GYHV     G+E+W  V   PI     +V + + P K YV +V+A+
Sbjct: 7999 AWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAV 8058

Query: 880  NSAGLGQPSMPTDPVLLED---KP----GAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQW 932
            N+ G+ +PS  ++ V+ +D   KP      H+I V   E+  I + F A   P  S   W
Sbjct: 8059 NAIGVSEPSEISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVS---W 8115

Query: 933  SKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISAS 983
             KD K      R+ +++    + + + +    D G Y++ + +     +AS
Sbjct: 8116 HKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATAS 8166



 Score =  227 bits (579), Expect = 5e-59
 Identities = 173/602 (28%), Positives = 259/602 (43%), Gaps = 86/602 (14%)

Query: 373  PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRC 432
            P  P NV+  D   + + LTW PP +  G+ I  Y +ERC   S +W+AC E P    + 
Sbjct: 7283 PDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGE-PVAETKM 7341

Query: 433  PIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARR----------------- 475
             + GL EG+ Y +RV+A++R G+S PS+ +E +   D   A                   
Sbjct: 7342 EVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGT 7401

Query: 476  KTEIPFDLGNK-------------------ITISTDAFEDTVTI---------------- 500
            K E+P  +  K                   ITI     + TVTI                
Sbjct: 7402 KIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAV 7461

Query: 501  -----------------PSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIG 542
                             P PP     +++     +L W  P     + +T Y +E+    
Sbjct: 7462 NVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATD 7521

Query: 543  SGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALR---GPP 599
            S  W  +S  S V+   F    L   K Y+FRV A N YG+ +P + S PI  +    PP
Sbjct: 7522 SEVWHKLS--STVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQAS-PITAKYQFDPP 7578

Query: 600  ATLPPPAQVQAFRDTQTSVSLTW-DPVKD--PELLGYYIYSRKVGTSEWQTVNNKPIQGT 656
                PP +++    T+ +V+LTW +P  D    + GY++      T +W   N  P++ T
Sbjct: 7579 G---PPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDT 7635

Query: 657  RFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEM 716
             + V GL   K+Y F V + + AG G+ S +TEPI +K  +  P  P    + + GK  +
Sbjct: 7636 TYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSV 7695

Query: 717  VIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARA 776
             + W  P+  GG KI  Y ++   +   +W  V  + +PT    +  L EG  Y FR RA
Sbjct: 7696 RLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRV-AEGVPTTQHLLPGLMEGQEYSFRVRA 7754

Query: 777  ANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGY 836
             N AG  E S PS    C+E   P P PP  +    +   +  L+W  P   G  P+T Y
Sbjct: 7755 VNKAGESEPSEPSDPVLCREKLYP-PSPPRWLEVINITKNTADLKWTVPEKDGGSPITNY 7813

Query: 837  HVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLL 896
             V  ++   + W+ V    +  T   V+ L  G  YVF+V A N+ G    +   D VL 
Sbjct: 7814 IVEKRDVRRKGWQTVDT-TVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLA 7872

Query: 897  ED 898
            +D
Sbjct: 7873 KD 7874



 Score =  221 bits (564), Expect = 3e-57
 Identities = 228/925 (24%), Positives = 366/925 (39%), Gaps = 96/925 (10%)

Query: 194   IDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVK--NAHGQASSFAKVLVRTYL 251
             ++ RL    K+    N  LLS +     +++  TY  RV   N  GQ             
Sbjct: 10448 LESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQ------------- 10494

Query: 252   GKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGS 311
             GK +     I  +    P          +  R  E F+L+  +S        + WF+D +
Sbjct: 10495 GKPSFCTKPITCKDELAPPTLHLDFRDKLTIRVGEAFALTGRYSGK--PKPKVSWFKDEA 10552

Query: 312   LLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPG 371
              +    R  I  T    +L+     + D G Y V V +  G R+    V V D     PG
Sbjct: 10553 DVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVD----RPG 10608

Query: 372   APGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCR 431
              P  P++    +V +D ++++W PP D  G+ IT Y IE+ +     W+    A   T  
Sbjct: 10609 PPVGPVSFD--EVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKT-T 10665

Query: 432   CPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITIST 491
             C +  L+EG+ Y FR+ A +  G S P  +  +                           
Sbjct: 10666 CKVSKLLEGKDYIFRIHAENLYGISDPLVSDSMKA------------------------- 10700

Query: 492   DAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISS 551
                +D   +P  P     +E+ +   ++ W +P    +    Y LEK    S  W  ++ 
Sbjct: 10701 ---KDRFRVPDAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKRETMSKRWARVTK 10757

Query: 552   ESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAF 611
             +      +F V DL +   Y FRV A N+ G+ DPS PS+P+  + P A   PP   +A 
Sbjct: 10758 DPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAI 10817

Query: 612   RDTQTSVSLTWDPVK---DPELLGYYIYSRKVGTSEWQTVNNKP--IQGTRFTVPGLRTG 666
               T  SV LTW P +     ++LGY +  +KVG  EW+  N+ P     T++ V GLR G
Sbjct: 10818 DTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDG 10877

Query: 667   KEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRR 726
             + Y+F V +V+ AG  + +   EP+ VK  L  P         N  + + +       + 
Sbjct: 10878 QTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPEL---ILDANMAREQHI-------KV 10927

Query: 727   GGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELS 786
             G    L   +      ++ W     +  PT+  ++     G   E R  A    G+  L+
Sbjct: 10928 GDTLRLSAIIKGVPFPKVTWKK-EDRDAPTK-ARIDVTPVGSKLEIRNAAHEDGGIYSLT 10985

Query: 787   ----APSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQE 842
                 A S     K   + +PGPP D+  SE+R  S  L W+ PL  G   +T Y V  ++
Sbjct: 10986 VENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRD 11045

Query: 843   EGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLG------QPSMPTDPVLL 896
               S QW P++      +H     L  G  Y+F+V A N  G G      +P    DP+  
Sbjct: 11046 VASAQWSPLSATSKKKSHF-AKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHP 11104

Query: 897   EDKP-GAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQ-WSKDYKGPLDPQRVKIEDKVNKS 954
                P   H ++V   E   + L +  P+    S    +  +Y+       +K +   N  
Sbjct: 11105 PGPPKDLHHVDVDKTE---VSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKTVTNLE 11161

Query: 955   KVILKEPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNI 1014
              V+    GL+   TY   V  A+  +      T   +E  +KL        +KLI G   
Sbjct: 11162 CVV---TGLQQGKTYRFRV-KAENIVGLGLPDTTIPIECQEKLVPPSVELDVKLIEGL-- 11215

Query: 1015  DILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEED 1074
              +++ G    +  + +  P        +  EI +  +  +  D    +  + I+N    D
Sbjct: 11216 -VVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSV--LTIKNCLRRD 11272

Query: 1075  KGSY--TAQLQDGKAKNQITLTLVD 1097
              G Y  T     G     + LT++D
Sbjct: 11273 TGEYQITVSNAAGSKTVAVHLTVLD 11297



 Score =  213 bits (542), Expect = 1e-54
 Identities = 170/663 (25%), Positives = 296/663 (44%), Gaps = 72/663 (10%)

Query: 338   EDEGLYMVRVPSPFG---PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWA 394
             E +  + VR  + FG   P E       RD        P  P+ ++   + ++ + L+W 
Sbjct: 9673  EQQYFFRVRAENRFGIGPPVETIQRTTARDPIYP----PDPPIKLKIGLITKNTVHLSWK 9728

Query: 395   PPSDTRGNPITAYTIERCQGE-----SGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRA 449
             PP +  G+P+T Y +E    +        W  C++      +  ++ LVEG  Y FRV+A
Sbjct: 9729  PPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKA 9788

Query: 450   ISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHA 509
             ++  G S PS       +G  D  R       DL   + +     E+   +     N+ A
Sbjct: 9789  VNAAGVSKPS-----ATVGPCDCQRPDMPPSIDLKEFMEV-----EEGTNV-----NIVA 9833

Query: 510   SEIREAYVVLAWEEPSPR---DRAPLTYSLE-KSVIGSGTWEAISSESPVRSPRFAVLDL 565
                   +  L W +  P+   ++ P+ Y      ++   T   +  +S            
Sbjct: 9834  KIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQS------------ 9881

Query: 566   EKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPV 625
              +  + ++ + A+N  G +        +   GPP     P + ++    Q  ++L+W P 
Sbjct: 9882  RRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVG---PIKFESVSADQ--MTLSWFPP 9936

Query: 626   KDP---ELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVG 682
             KD    ++  Y I  R+     W  V+++P + T +T+P L  G EY F + + ++ G+G
Sbjct: 9937  KDDGGSKITNYVIEKREANRKTWVHVSSEPKECT-YTIPKLLEGHEYVFRIMAQNKYGIG 9995

Query: 683   ESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSE 742
             E    +EP   +   + P AP    + +  +N M + W+ P+  GG  + GY+L+  D+ 
Sbjct: 9996  EP-LDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTT 10054

Query: 743   ELDWHAVNQQPIPTRVC----KVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWT 798
                W  VN+ PI         KV+ L EG  Y+FR  A N AGVG  S PS     ++  
Sbjct: 10055 SKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPI 10114

Query: 799   MPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISG 858
              P PGPP+  + ++   +S  L+W PPL  G   VTGY V ++EEG E+W+      + G
Sbjct: 10115 AP-PGPPFP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRG 10172

Query: 859   THLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEVGVDEEGFI--- 915
             T L V+ L+ G  Y F+V+A+N AG+G+P   TD + ++D+  + ++++       I   
Sbjct: 10173 TKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVH 10232

Query: 916   ------YLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTY 969
                    +A+ + + P +    W+ + +    PQ   IE     S +++K       G Y
Sbjct: 10233 AGGVIRIIAYVSGKPPPT--VTWNMNER--TLPQEATIETTAISSSMVIKNCQRSHQGVY 10288

Query: 970   SVI 972
             S++
Sbjct: 10289 SLL 10291



 Score =  206 bits (524), Expect = 1e-52
 Identities = 222/873 (25%), Positives = 358/873 (41%), Gaps = 94/873 (10%)

Query: 139  VQEAKELRELCYGRGPWF--WIPLRSH--AVWEHTTVLLTCTVQASPPPQVTWYKNDTRI 194
            V E  E+ E    + P     I L +H   V E   + +    +A P P V+W+K+   +
Sbjct: 8063 VSEPSEISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEV 8122

Query: 195  DPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKD 254
                  + +  + N++    LE+ +    D+  YT+ ++N  G A++   V V    G  
Sbjct: 8123 KA----SDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPC 8178

Query: 255  AGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLR 314
                +    +S                         SC  + +  + +         L R
Sbjct: 8179 KDIKASDITKS-------------------------SCKLTWEPPEFDGGTPILHYVLER 8213

Query: 315  SSRRRKILYTDRQASLKVSCTYKE--DEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGA 372
                R+          K+S T K+    G Y  RV +           L     A++P  
Sbjct: 8214 REAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQ 8273

Query: 373  PGSP-LNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCR 431
            P  P ++V   +   + + +TW PP    G+ I  Y IE+       W  C+E       
Sbjct: 8274 PPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILT 8333

Query: 432  CPIQGLVEGQSYRFRVRAISRVGSSVPSKASE-----------LVVMGDHDAARRKTEIP 480
               +GL EG+ Y+FRVRA +  G S PS+A+             V++      +R  EI 
Sbjct: 8334 YTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIA 8393

Query: 481  FDL---GNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLE 537
             D    G+     T   ++ V +P       A  +R     +  EEP      PLT  L 
Sbjct: 8394 LDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFV---LPLTQRLS 8450

Query: 538  KSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRG 597
                  G       ES +R     V D  +    ++ ++  N +G++        +   G
Sbjct: 8451 IDNSKKG-------ESQLR-----VRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPG 8498

Query: 598  PPATLPPPAQVQAFRDTQ-TSVSLTWDPVKDP---ELLGYYIYSRKVGT--SEWQTVNNK 651
            PP           F D + TSV   W+P  D    E++ Y +  +      SEW  V + 
Sbjct: 8499 PPINF-------VFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTST 8551

Query: 652  PIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNC 711
             ++  +++V  L  GKEY F VR+ +  G G     ++P+  K     P AP    + + 
Sbjct: 8552 -LRHCKYSVTKLIEGKEYLFRVRAENRFGPGPP-CVSKPLVAKDPFGPPDAPDKPIVEDV 8609

Query: 712  GKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYE 771
              N M++ W  PK  G   ILGY+L++ +     W  VN+  +      V  L EG  Y 
Sbjct: 8610 TSNSMLVKWNEPKDNGS-PILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYV 8668

Query: 772  FRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAG 831
            FR  A N AG G+ S PS      +   P PGPP   R ++  +T++ L+WEPP + G G
Sbjct: 8669 FRVCAENAAGPGKFSPPSDPKTAHDPISP-PGPPIP-RVTDTSSTTIELEWEPPAFNGGG 8726

Query: 832  PVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPT 891
             + GY V  Q  G+ +W   T   I      V +++ G  Y  +V A+N+AG G P   T
Sbjct: 8727 EIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPG-ET 8785

Query: 892  DPVLLED--KPGAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQ------WSKDYKGPLDPQ 943
             PV + +  +P A E++V V + G   +A +    P     +      W+K+ +G LD  
Sbjct: 8786 QPVTVAEPQEPPAVELDVSV-KGGIQIMAGKTLRIPAVVTGRPVPTKVWTKE-EGELDKD 8843

Query: 944  RVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDA 976
            RV I++   KS++I+K+   +D G Y +  T++
Sbjct: 8844 RVVIDNVGTKSELIIKDALRKDHGRYVITATNS 8876



 Score =  201 bits (512), Expect = 3e-51
 Identities = 209/819 (25%), Positives = 323/819 (39%), Gaps = 106/819 (12%)

Query: 179  ASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQ 238
            A P  +  W+K +  +  +        I       S  I      D   Y + ++N HG+
Sbjct: 6720 AYPKAEAEWFKENEPLSTKT-------IDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGK 6772

Query: 239  ASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDV 298
            A  F  + V                       ++    ++ +   E     +S  + E +
Sbjct: 6773 AEGFINLKV-----------------------IDVPGPVRNLEVTETFDGEVSLAWEEPL 6809

Query: 299  LDAES--IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGL-YMVRVPSPFGPRE 355
             D  S  I +  +   ++  R+  +L TDR  S + + T  +  G+ Y+ RV +      
Sbjct: 6810 TDGGSKIIGYVVERRDIK--RKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSA------ 6861

Query: 356  QSTYVLVRDAEAENP-------GAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYT 408
            ++        E +NP         PG PLNV   DVNR  + LTW PP    G  IT Y 
Sbjct: 6862 RNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYV 6921

Query: 409  IERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMG 468
            IE     S  W              +  +VEGQ Y FRVRA +R+G   PS A+  V + 
Sbjct: 6922 IELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVA 6981

Query: 469  DHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRD 528
            D                            +  PSPP N+ +S+  ++ V L WE P    
Sbjct: 6982 D---------------------------PIERPSPPVNLTSSDQTQSSVQLKWEPPLKDG 7014

Query: 529  RAP-LTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPS 587
             +P L Y +E+   G   W   + +  V    + V  LEK   Y++RV A N+ G+SDPS
Sbjct: 7015 GSPILGYIIERCEEGKDNWIRCNMKL-VPELTYKVTGLEKGNKYLYRVSAENKAGVSDPS 7073

Query: 588  EPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQT 647
            E   P  L    A + P   + AF+D    +      V +P  +          T+ W  
Sbjct: 7074 EILGP--LTADDAFVEPTMDLSAFKDGLEVI------VPNPITILVPSTGYPRPTATWCF 7125

Query: 648  VNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVK-----QALATPSA 702
             +     G R  +  L    E        S+ G+           +        +A PSA
Sbjct: 7126 GDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSA 7185

Query: 703  PYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVS 762
            P      +  K+ + + W+PP   GG  + GY +++ +     W  V    +      V 
Sbjct: 7186 PKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV-MDFVTDLEFTVP 7244

Query: 763  DLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQ--PGPPYDVRASEVRATSLVL 820
            DL +G  Y F+  A N  G GE   P+ + E    + P   P PP +V+  +  A S+ L
Sbjct: 7245 DLVQGKEYLFKVCARNKCGPGE---PAYVDEPVNMSTPATVPDPPENVKWRDRTANSIFL 7301

Query: 821  QWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPG-PISGTHLRVSDLQPGKSYVFQVQAM 879
             W+PP   G   + GY V     GS++W  V  G P++ T + V+ L+ GK Y ++V+A+
Sbjct: 7302 TWDPPKNDGGSRIKGYIVERCPRGSDKW--VACGEPVAETKMEVTGLEEGKWYAYRVKAL 7359

Query: 880  NSAGLGQPSMPTDPVLLEDKPGAHEIEVGVD-EEGFIYLAFEAPEAP------DSSEFQW 932
            N  G  +PS PT+ +   D   A EI + V    G    A    E P         +  W
Sbjct: 7360 NRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITW 7419

Query: 933  SKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSV 971
            +K        +R+ IE+   KS V + +    D GTY +
Sbjct: 7420 TKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYII 7458



 Score =  199 bits (506), Expect = 2e-50
 Identities = 177/674 (26%), Positives = 281/674 (41%), Gaps = 59/674 (8%)

Query: 376   PLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQ 435
             P NVR  D++++ + L+W  P+   G+ IT Y +ER     G W           +  I 
Sbjct: 20466 PRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIIS 20525

Query: 436   GLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFE 495
             GL +   Y FRV A + VGS   S  SE+V                     IT       
Sbjct: 20526 GLTQNSQYEFRVFARNAVGSI--SNPSEVV-------------------GPITCIDSYGG 20564

Query: 496   DTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPV 555
               + +P   T V       +  + A     P   AP T    K      T   +  E+  
Sbjct: 20565 PVIDLPLEYTEVVKYRAGTSVKLRAGISGKP---AP-TIEWYKDDKELQTNALVCVENTT 20620

Query: 556   RSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQ 615
                   + D ++  S  + ++  N  G +  +   + +   GPP        ++    T 
Sbjct: 20621 DLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPG-----GPIEFKTVTA 20675

Query: 616   TSVSLTWDPVKDP---ELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFC 672
               ++L W P  D    ++  Y +  R+     W  V+   ++    T   +  G EY F 
Sbjct: 20676 EKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEH-LEECIITTTKIIKGNEYIFR 20734

Query: 673   VRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKIL 732
             VR+V++ G+GE    ++ +  K A  TP  P    +    KN M + W  P   GG  I 
Sbjct: 20735 VRAVNKYGIGEP-LESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDIS 20793

Query: 733   GYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLF 792
             GYFL++ D + L W  V ++ I     KV+ L E   Y++R  A N AG G  S PS  +
Sbjct: 20794 GYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFY 20853

Query: 793   ECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPV- 851
             +  +   P PGPP  +R ++   +S+ L W  P+Y G   VTGY V  ++   E+W  V 
Sbjct: 20854 KAADPIDP-PGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVS 20912

Query: 852   TPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEVGV-- 909
             T G +  T   VS+L+PG +Y F+V A+N AG G+P    +PV  +D   A EI++ V  
Sbjct: 20913 TKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVAL 20972

Query: 910   --------DEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEP 961
                      E+  + + F+    P  +   W KD K      R  IE+  + S + + + 
Sbjct: 20973 RTSVIAKAGEDVQVLIPFKGRPPPTVT---WRKDEKNLGSDARYSIENTDSSSLLTIPQV 21029

Query: 962   GLEDLGTYSVIVTDA-----DEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDI 1016
                D G Y + + +         +S     T    +KL ++ H  R  V  L   W+  +
Sbjct: 21030 TRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKL-QVKHVSRGTVTLL---WDPPL 21085

Query: 1017  LERGEVRLWLEVEK 1030
             ++ G   +   +EK
Sbjct: 21086 IDGGSPIINYVIEK 21099



 Score =  193 bits (491), Expect = 9e-49
 Identities = 171/677 (25%), Positives = 283/677 (41%), Gaps = 77/677 (11%)

Query: 238   QASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSED 297
             +A S + ++++    KD+G+ S   + S+   + +   V+       + PF +S + +  
Sbjct: 12644 KADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDA-- 12701

Query: 298   VLDAESIQW---FRDGS-------LLRSSRRRKILYTDRQASLKVSCTYKE----DEGLY 343
               DA S+ W     DG        + +    R    T   +  K SC   +     E ++
Sbjct: 12702 --DACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIF 12759

Query: 344   MVRVPSPFGPREQSTYVLVRDAEAENP-GAPGSPLNVRCLDVNRDCLILTWAPPSDTRGN 402
              VR  + FG  E  T   +    A+ P G P  P N R   VN+DC+ + W  P    G+
Sbjct: 12760 RVRAENRFGISEPLTSPKM---VAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGS 12816

Query: 403   PITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKAS 462
             PI  Y IER +  S  W+  ++    +   P  GLVEG  Y FR+ A+++ GSS PSK +
Sbjct: 12817 PIIGYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPT 12876

Query: 463   ELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWE 522
             E V             +P D                    PP      ++ ++ V L W 
Sbjct: 12877 EYVT----------ARMPVD--------------------PPGKPEVIDVTKSTVSLIWA 12906

Query: 523   EPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPR--FAVLDLEKKKSYVFRVRAMN 579
              P     + +  Y +E   +    W   ++ +P + P+  +    LE+K  Y FR  A  
Sbjct: 12907 RPKHDGGSKIIGYFVEACKLPGDKWVRCNT-APHQIPQEEYTATGLEEKAQYQFRAIART 12965

Query: 580   QYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRK 639
                +S PSEPS+P+ +      +PP   +     +  +V    +   D  + G     + 
Sbjct: 12966 AVNISPPSEPSDPVTILA--ENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFG-----KP 13018

Query: 640   VGTSEWQTVNN--KPIQGTRFTVPGLRTGKEYEFCVRSVSEAG----VGESSAATEPIRV 693
             + T  W+      KP +G +  +   R     E    +  ++G      E+S+ ++   +
Sbjct: 13019 MPTVSWKKDGTLLKPAEGIKMAMQ--RNLCTLELFSVNRKDSGDYTITAENSSGSKSATI 13076

Query: 694   K-QALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQ 752
             K + L  P  P    +     +  ++ W+PP   GG +I  Y +D+ ++   +W  V+  
Sbjct: 13077 KLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVS-A 13135

Query: 753   PIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMP-QPGPPYDVRAS 811
              +P   C V  L EGH Y+FR  A N  GVG+            +  P +  PP     S
Sbjct: 13136 TVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDPPV---IS 13192

Query: 812   EVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKS 871
              +    + + W+PP   G  P+TGY +  +E  +  W  V   PI    L+ + LQ G  
Sbjct: 13193 NITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTE 13252

Query: 872   YVFQVQAMNSAGLGQPS 888
             Y F+V A+N AG G+PS
Sbjct: 13253 YEFRVTAINKAGPGKPS 13269



 Score =  192 bits (487), Expect = 3e-48
 Identities = 216/903 (23%), Positives = 365/903 (40%), Gaps = 121/903 (13%)

Query: 154   PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLL 213
             P   +P  ++++     + +   V   P P ++W K+    +P L +  +  +       
Sbjct: 18007 PSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDG---EP-LKQTTRVNVEETATST 18062

Query: 214   SLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAG---FDSEIFKRSTFGPS 270
              L I+    +D   YTV   N+ G A+    V+V    G   G   FD           S
Sbjct: 18063 VLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEV---------S 18113

Query: 271   VEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASL 330
              +F      V + E   ++  C  S  +++       RD +   ++    +  T  + ++
Sbjct: 18114 ADFV-----VISWEPPAYTGGCQISNYIVEK------RDTT---TTTWHMVSATVARTTI 18159

Query: 331   KVSCTYKEDEGLYMVRVPSPFGPRE--QSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDC 388
             K++      E  + +   + +G      S  V+V+    E PG PG+P       +++D 
Sbjct: 18160 KITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKE-PGPPGTPF---VTSISKDQ 18215

Query: 389   LILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVR 448
             +++ W  P +  G  I  Y +E+ +  S  W+  ++ P    +    GL EG  Y F+V 
Sbjct: 18216 MLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVS 18275

Query: 449   AISRVGSSVPSKASELVVMGD---------------HDAARRKTEIPFDLGNKIT---IS 490
             A + VG   PSK SE  V  D               ++   +  +  +D G+KIT   + 
Sbjct: 18276 AENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVE 18335

Query: 491   TDAFEDTVTIPSPPTNVHASEI---------REAYVVLA------WEEPSP-------RD 528
                  D   + +  TNV  +E          R  + V+A      + EPS        RD
Sbjct: 18336 KKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARD 18395

Query: 529   R-------------------APLTYSLEKSVIGSG----TWEAISSESPVRSPRFAVLDL 565
                                 A  T+ LE  + G       W     E    + R  +   
Sbjct: 18396 EIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKST 18455

Query: 566   EKKKSYVFRVRAMNQYG-----LSDPS-EPSEPIALRGPPATLPPPAQVQAFRDTQTSVS 619
              +K + V +       G     LS+     S PI ++      PP   ++    T     
Sbjct: 18456 IQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCY 18515

Query: 620   LTWDP-VKD--PELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSV 676
             L W+P ++D    +  Y I  R+     W  V+ + +Q   + V  L  G EY F V +V
Sbjct: 18516 LAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTE-VQALNYKVTKLLPGNEYIFRVMAV 18574

Query: 677   SEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFL 736
             ++ G+GE    + P+        P  P    +    K+ MV+ W  P   GG +I GY L
Sbjct: 18575 NKYGIGEP-LESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYIL 18633

Query: 737   DQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKE 796
             ++ D E + W   N++ +     +V+ L EGH YEFR  A N AGVGE S PS  +   +
Sbjct: 18634 EKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACD 18693

Query: 797   WTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP- 855
                P PGPP + + ++   +S+ L W  P+Y G  PV GY V  +E  +++W   TP   
Sbjct: 18694 ALYP-PGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTG 18752

Query: 856   ISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEVGVDEEGFI 915
             + G    V+ L+    Y F++ A+NS G+G+P+     V+ +++    EIE+  D    +
Sbjct: 18753 LQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVV 18812

Query: 916   YL-------AFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGT 968
              L        F   +     E +W K  +G L   R +IE   + + +++      D G 
Sbjct: 18813 VLRASATLRLFVTIKGRPEPEVKWEK-AEGIL-TDRAQIEVTSSFTMLVIDNVTRFDSGR 18870

Query: 969   YSV 971
             Y++
Sbjct: 18871 YNL 18873



 Score =  191 bits (486), Expect = 3e-48
 Identities = 201/819 (24%), Positives = 336/819 (41%), Gaps = 89/819 (10%)

Query: 170   TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT 229
             T+ L+  ++  P P+VTW K D R  P      K RI        LEIR  A ED   Y+
Sbjct: 10930 TLRLSAIIKGVPFPKVTWKKED-RDAPT-----KARIDVTPVGSKLEIRNAAHEDGGIYS 10983

Query: 230   VRVKNAHGQASSFAKVLVRTYLGKDAGFD-SEIFKRSTFGPSVEFTSVLKPVFAREKEPF 288
             + V+N  G  +   KVLV    G     + SEI K S +                 KEP 
Sbjct: 10984 LTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCY--------------LTWKEPL 11029

Query: 289   ----SLSCLFSEDVLDAESIQWFR-DGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
                 S+   +  +  D  S QW     +  + S   K L    Q   +V+   +   G +
Sbjct: 11030 DDGGSVITNYVVERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPF 11089

Query: 344   MVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNP 403
              V  P P           ++  +  +P  PG P ++  +DV++  + L W  P    G+P
Sbjct: 11090 -VETPKP-----------IKALDPLHP--PGPPKDLHHVDVDKTEVSLVWNKPDRDGGSP 11135

Query: 404   ITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASE 463
             IT Y +E  +  + +WI           C + GL +G++YRFRV+A + VG  +P     
Sbjct: 11136 ITGYLVEYQEEGTQDWIKFKTVTN--LECVVTGLQQGKTYRFRVKAENIVGLGLPD---- 11189

Query: 464   LVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEE 523
                          T IP +   K+     + E  V +         + +R   ++     
Sbjct: 11190 -------------TTIPIECQEKLV--PPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPV 11234

Query: 524   PSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGL 583
             P+ +      ++ + S I   T E  + E+   S    + +  ++ +  +++   N  G 
Sbjct: 11235 PTAK------WTTDGSEIK--TDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGS 11286

Query: 584   SDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDP---ELLGYYIYSRKV 640
                +     + + GPP        +     T   ++++W P KD     ++ Y +  +  
Sbjct: 11287 KTVAVHLTVLDVPGPPT-----GPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDT 11341

Query: 641   GTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATP 700
                 W  V++   + T+  +P L+ G EY F VR+ ++ GVG    +T P   K   + P
Sbjct: 11342 RKDTWGVVSSGSSK-TKLKIPHLQKGCEYVFRVRAENKIGVGPPLDST-PTVAKHKFSPP 11399

Query: 701   SAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCK 760
             S P    + +  +N   + W  PK  GG  I GY++++ +     W  VN+ PI     +
Sbjct: 11400 SPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREVTG-KWVRVNKTPIADLKFR 11458

Query: 761   VSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVL 820
             V+ L+EG+ YEFR  A N AG+ + S  S   +      P PGPP + +  +    +  L
Sbjct: 11459 VTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKP-PGPPINPKLKDKSRETADL 11517

Query: 821   QWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP-ISGTHLRVSDLQPGKSYVFQVQAM 879
              W  PL  G  P+ GY V  Q+ G+ QW  +     I     RV  L  G  Y F+++A 
Sbjct: 11518 VWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAA 11577

Query: 880   NSAGLGQPSMPTDPVLLEDKPGAHEIEVGVD-------EEGFIYLAFEAPEAPDSSEFQW 932
             N  G G+P    + V+ +D     E+E+ V          G         +     +  W
Sbjct: 11578 NIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITW 11637

Query: 933   SKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSV 971
             +K+ K  +  +RV +   + + ++ +KE    D G Y +
Sbjct: 11638 TKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYII 11676



 Score =  189 bits (480), Expect = 2e-47
 Identities = 164/614 (26%), Positives = 260/614 (42%), Gaps = 54/614 (8%)

Query: 373   PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRC 432
             PG P     +++ R+ + L W  P    G+ +T Y +E+    S  W+  +      C  
Sbjct: 13972 PGKP---EVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAF 14028

Query: 433   PIQGLVEGQSYRFRVRAISRVGS-SVPSKASELVVMGDHDAARRKTEIPFDLGNKITIST 491
              +  LVEG  Y FR+RA +  G+ S PS+++E ++  D      + E P       TI  
Sbjct: 14029 TVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKD------EYEAP-------TIVL 14075

Query: 492   D-AFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAIS 550
             D   +D +TI +  T V       A  +L   +P P+       S  K+       +   
Sbjct: 14076 DPTIKDGLTIKAGDTIV-----LNAISILG--KPLPKS------SWSKAGKDIRPSDITQ 14122

Query: 551   SESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQA 610
               S   S    +    +K +  + + A N +G          + + GPP        V+ 
Sbjct: 14123 ITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPPGP------VEI 14176

Query: 611   FRDTQTSVSLTWDPVKDP---ELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGK 667
                +    +LTW P  +     +  Y +  R+     W TV ++ IQ  R     L  G 
Sbjct: 14177 SNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLW-TVVSEDIQSCRHVATKLIQGN 14235

Query: 668   EYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRG 727
             EY F V +V+  G GE    +EP+++      P  P    + N  KN   + WK P   G
Sbjct: 14236 EYIFRVSAVNHYGKGEP-VQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDG 14294

Query: 728   GGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSA 787
             G +I GY +++ + + L W    + P+    CKV+ L EG  YEFR  A N AG+G  S 
Sbjct: 14295 GSEITGYHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSE 14354

Query: 788   PSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQ 847
              S     K+   P PGPP +   ++    S  L W  P Y G   +TGY V  Q+ G E 
Sbjct: 14355 ASDSVLMKDAAYP-PGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEA 14413

Query: 848   W-KPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIE 906
             W K  T   +  T   V DLQ  + Y F++ A+N AG+G+P++  D  ++E +  A + E
Sbjct: 14414 WIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVE-REMAPDFE 14472

Query: 907   VGVD-------EEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILK 959
             +  +         G     F   +   + E  W+KD        R  IE+  + + +I+ 
Sbjct: 14473 LDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINL--KNRANIENTESFTLLIIP 14530

Query: 960   EPGLEDLGTYSVIV 973
             E    D G + + +
Sbjct: 14531 ECNRYDTGKFVMTI 14544



 Score =  189 bits (479), Expect = 2e-47
 Identities = 201/842 (23%), Positives = 336/842 (39%), Gaps = 108/842 (12%)

Query: 170   TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT 229
             T +L   ++  P P V W K+   ++     A +  I +     +L ++ C   D   Y 
Sbjct: 18419 TFVLEADIRGKPIPDVVWSKDGKELEET---AARMEIKSTIQKTTLVVKDCIRTDGGQYI 18475

Query: 230   VRVKNAHGQASSFAKVLVRTYLG------KDAGFDSEIFKRSTFGPSVEFTSVLKPVFAR 283
             +++ N  G  S    V V    G      K  G  +E    +   P  +  + +      
Sbjct: 18476 LKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIE 18535

Query: 284   EKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQA-SLKVSCTYKEDEGL 342
             ++E   LS              W +             + T+ QA + KV+     +E +
Sbjct: 18536 KRETSRLS--------------WTQ-------------VSTEVQALNYKVTKLLPGNEYI 18568

Query: 343   YMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGN 402
             + V   + +G  E      V       P  PG P       + +D +++TWA P D  G 
Sbjct: 18569 FRVMAVNKYGIGEPLESGPVTACNPYKP--PGPPSTPEVSAITKDSMVVTWARPVDDGGT 18626

Query: 403   PITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKAS 462
              I  Y +E+   E   W  C++      R  + GL EG SY FRV A +  G   PS+ S
Sbjct: 18627 EIEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPS 18686

Query: 463   ELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWE 522
                    + A                       D +  P PP+N   ++   + V LAW 
Sbjct: 18687 VF-----YRAC----------------------DALYPPGPPSNPKVTDTSRSSVSLAWS 18719

Query: 523   EPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQY 581
             +P     AP+  Y +E     +  W   +  + ++  +F V  L++   Y FR+ A+N  
Sbjct: 18720 KPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSE 18779

Query: 582   GLSDPSE-PSEPIALRG--PP-----ATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGY 633
             G+ +P+  P   +A     PP     A L     ++A    +  V++   P  +PE+   
Sbjct: 18780 GVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFVTIKGRP--EPEV--- 18834

Query: 634   YIYSRKVGTSEWQTVNNKPIQGTR-FTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIR 692
                  K   +E    +   I+ T  FT+  +     ++    +++      S  A   +R
Sbjct: 18835 -----KWEKAEGILTDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVR 18889

Query: 693   VKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQ 752
             V   L +PSAP    +    K+ + + W+PP   GG KI  Y +++ ++    +  +   
Sbjct: 18890 V---LDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNN 18946

Query: 753   PIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASE 812
                T   ++ +L EG  Y FR  A+N  G+G    P+   E  + + P P PP  V   +
Sbjct: 18947 CTKT-TFRIENLQEGCSYYFRVLASNEYGIG---LPAETTEPVKVSEP-PLPPGRVTLVD 19001

Query: 813   VRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSY 872
             V   +  ++WE P   G   +TGY V  Q +GSE+W   T   +      +S L  G+ Y
Sbjct: 19002 VTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCT--QVKTLEATISGLTAGEEY 19059

Query: 873   VFQVQAMNSAGLGQPSMPTDPVLLED---KPGA----HEIEVGVDEEGFIYLAFEA-PEA 924
             VF+V A+N  G   P     PV+  D   KP      H   V   E+  I + F+  P+A
Sbjct: 19060 VFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKIDVPFKGRPQA 19119

Query: 925   PDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASH 984
                    W KD +   +  RV +      + + +KE   ED+GTY + V+++   I+   
Sbjct: 19120 ----TVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPI 19175

Query: 985   TL 986
             T+
Sbjct: 19176 TI 19177



 Score =  186 bits (471), Expect = 2e-46
 Identities = 162/628 (25%), Positives = 268/628 (42%), Gaps = 63/628 (10%)

Query: 373   PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRC 432
             PG P+    L++ R  + L WA P  T G  IT+Y +E+    +G W+  + +       
Sbjct: 15055 PGKPVP---LNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEF 15111

Query: 433   PIQGLVEGQSYRFRVRAISRVGS-SVPSKASELVVMGDH-DAARRKTEIPFDLGNKITIS 490
              + GL E  +Y FRV A +  G+ S PS+ S+ +   D  +A + K ++ F     I  +
Sbjct: 15112 TVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFK-DTVILKA 15170

Query: 491   TDAF--EDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEA 548
              +AF  E  V+   PPT             + W +         T  LE  +    T   
Sbjct: 15171 GEAFRLEADVSGRPPPT-------------MEWSKDGKELEG--TAKLEIKIADFST-NL 15214

Query: 549   ISSESPVRSPRFAVLDLEKKKSY---VFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPP 605
             ++ +S  R      L       +   +F V+ +++ G                    PP 
Sbjct: 15215 VNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPG--------------------PPE 15254

Query: 606   AQVQAFRDTQTSVSLTWDPVKDP---ELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPG 662
               +     T     L+W P  D    ++  Y +  R+     W  V ++ +Q T+  V  
Sbjct: 15255 GPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASE-VQVTKLKVTK 15313

Query: 663   LRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKP 722
             L  G EY F V +V++ GVGE    +EP+        P  P    +    K+ MV+ W  
Sbjct: 15314 LLKGNEYIFRVMAVNKYGVGEP-LESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGH 15372

Query: 723   PKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGV 782
             P   GG +I+ Y +++ D     W   N++ +     KVS L EGH YEFR  A N AG+
Sbjct: 15373 PDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGI 15432

Query: 783   GELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQE 842
                S  S  ++  + T+ +PGPP + R  +   +S+ + W  P+Y G   +TGY V    
Sbjct: 15433 SAPSPTSPFYKACD-TVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIAL 15491

Query: 843   EGSEQWKPVT-PGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPG 901
                ++W+ VT P  +  T   ++ L   + Y  ++ AMNS GLG+P++       ED+  
Sbjct: 15492 PEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRML 15551

Query: 902   AHEIEVGVDEEGFIYL-------AFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKS 954
               EIE+  D    + +        F   +   + E +W++D+   LD  +  IE   + +
Sbjct: 15552 PPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLD--KASIESTSSYT 15609

Query: 955   KVILKEPGLEDLGTYSVIVTDADEDISA 982
              +I+      D G Y + V ++    SA
Sbjct: 15610 LLIVGNVNRFDSGKYILTVENSSGSKSA 15637



 Score =  184 bits (466), Expect = 7e-46
 Identities = 263/1176 (22%), Positives = 454/1176 (38%), Gaps = 191/1176 (16%)

Query: 318   RRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPL 377
             + +I  T   + L++     ED G+Y + V +P G +  S  VLV D        PG P 
Sbjct: 10957 KARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDK-------PGPPR 11009

Query: 378   NVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGL 437
             ++   ++ +D   LTW  P D  G+ IT Y +ER    S +W               + L
Sbjct: 11010 DLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHFA-KHL 11068

Query: 438   VEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDT 497
              EG  Y FRV A ++ G                         PF    K   + D     
Sbjct: 11069 NEGNQYLFRVAAENQYGRG-----------------------PFVETPKPIKALDPLHP- 11104

Query: 498   VTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVR 556
                P PP ++H  ++ +  V L W +P     +P+T Y +E    G+  W    +   V 
Sbjct: 11105 ---PGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKT---VT 11158

Query: 557   SPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQT 616
             +    V  L++ K+Y FRV+A N  GL  P + + PI  +     L PP+     +  + 
Sbjct: 11159 NLECVVTGLQQGKTYRFRVKAENIVGLGLP-DTTIPIECQ---EKLVPPSVELDVKLIEG 11214

Query: 617   SVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVP--GLRTGKEYEFCVR 674
              V      V+ P +    I    V T++W T  ++      +TV      +    + C+R
Sbjct: 11215 LVVKAGTTVRFPAI----IRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLR 11270

Query: 675   -SVSEAGVGESSAA-TEPIRVK-QALATPSAPYG-FALLNCGKNEMVIGWKPPKRRGGGK 730
                 E  +  S+AA ++ + V    L  P  P G   +L+     M I W+PPK  GG  
Sbjct: 11271 RDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSP 11330

Query: 731   ILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGE-LSAPS 789
             ++ Y +++ D+ +  W  V+     T++ K+  L +G  Y FR RA N  GVG  L +  
Sbjct: 11331 VINYIVEKQDTRKDTWGVVSSGSSKTKL-KIPHLQKGCEYVFRVRAENKIGVGPPLDSTP 11389

Query: 790   SLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWK 849
             ++ + K      P PP     +++   +  + W  P   G  P+TGY++  + E + +W 
Sbjct: 11390 TVAKHK---FSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYME-RREVTGKWV 11445

Query: 850   PVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLL--EDKPGAHEIEV 907
              V   PI+    RV+ L  G +Y F+V A N AGL +PS  +DP+      KP    I  
Sbjct: 11446 RVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKPPGPPINP 11505

Query: 908   GVDEEGFIYLAFEAPEAPDSSEFQWSK---DYKGPLDPQRVKIE-------DKVNKSKVI 957
              + ++           + ++++  W+K   D   P+    V+ +       +++NK ++I
Sbjct: 11506 KLKDK-----------SRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELI 11554

Query: 958   ----LKEPGLEDLGTYSVIVTDAD-----------EDISASHTLTEEELEKLKKLSHEIR 1002
                  + PGL +   Y   +  A+           E + A   L   E+E    L    R
Sbjct: 11555 RQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVE----LDVTCR 11610

Query: 1003  NPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGL 1062
             + VI +  G  I IL R + R         P  ++      K +     ++++  ++   
Sbjct: 11611 D-VITVRVGQTIRILARVKGR---------PEPDITWTKEGKVLVRE--KRVDLIQDLPR 11658

Query: 1063  VEVIIQNLSEEDKGSY--TAQLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGP 1120
             VE+ I+     D G Y  +A+   G A+    + ++D                   + GP
Sbjct: 11659 VELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLD-------------------RPGP 11699

Query: 1121  YFERPLQWKVTEDCQVQLTCKVTNTKKE-TRFQWFFQRAEMPDGQYDPETGTGLLCIEEL 1179
                  +     E+C +     + N   E T F   +++             T  L    L
Sbjct: 11700 CQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIKANL 11759

Query: 1180  SKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIF 1239
                ++  +R    +  G   TI   T                L+  P+   G  E + I 
Sbjct: 11760 LANNEYYFRVCAENKVGVGPTIETKTP--------------ILAINPIDRPGEPENLHIA 11805

Query: 1240  SKVKYYNVEYMKTTW-------------FHKDKRLESGD---RIRTGTTLDEIWLHILDP 1283
              K K +   Y+K  W             +H ++RL+  D   R+  G+  +         
Sbjct: 11806 DKGKTF--VYLK--WRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKET-------- 11853

Query: 1284  KDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLP-- 1341
                    Y ++     ++ +       +  E    + + +    +++++  K V  L   
Sbjct: 11854 ------HYMVDRCVENQIYEFRVQTKNEGGESDWVKTEEV----VVKEDLQKPVLDLKLS 11903

Query: 1342  DVATIMEDKTLCLTCIVSGDPTPEISWLKNDQ--PVTFLDRYRMEVRGTEVTITIEKVNS 1399
              V T+    T+ L   V G P PE++W K+     +T   R +++ R      ++ K   
Sbjct: 11904 GVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKR 11963

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
              D G+Y V   N  GS     T++V       + LK
Sbjct: 11964 SDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLK 11999



 Score =  182 bits (463), Expect = 2e-45
 Identities = 207/847 (24%), Positives = 333/847 (39%), Gaps = 107/847 (12%)

Query: 170   TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT 229
             T  L   V   P P + W + D  I+     + +  I N      L ++     D   Y 
Sbjct: 17337 TFRLEADVHGKPLPTIEWLRGDKEIE----ESARCEIKNTDFKALLIVKDAIRIDGGQYI 17392

Query: 230   VRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFS 289
             +R  N  G  S    V V    G   G              V+ T V       EK   +
Sbjct: 17393 LRASNVAGSKSFPVNVKVLDRPGPPEG-------------PVQVTGVTS-----EKCSLT 17434

Query: 290   LSCLFSEDVLD-AESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVP 348
              S    +   D +  +   R+ S L  +     + T+   SLKV+   + +E ++ +   
Sbjct: 17435 WSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTN---SLKVTKLLEGNEYVFRIMAV 17491

Query: 349   SPFGPRE--QSTYVLVRDAEAENPGA-PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPIT 405
             + +G  E  +S  VL++     NP   PG P ++   ++ +D + + W  P    G+ I 
Sbjct: 17492 NKYGVGEPLESAPVLMK-----NPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEII 17546

Query: 406   AYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELV 465
              Y +E+       WI C++      R  + GL E   Y FRV A +  G   PS A    
Sbjct: 17547 GYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPA---- 17602

Query: 466   VMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPS 525
                                   T+   A  D V  P PPTN H  +  +  + LAW +P 
Sbjct: 17603 ----------------------TVYYKAC-DPVFKPGPPTNAHIVDTTKNSITLAWGKPI 17639

Query: 526   PRDRAP-LTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLS 584
                 +  L Y +E        W+ ++ ++ +R  RF +  L + + Y  RV A+N+ GL 
Sbjct: 17640 YDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLG 17699

Query: 585   D----PSEPSEPIALRGPPATLPPPAQ----VQAFRDTQTSVSLTWDPVKDPELLGYYIY 636
             +    P        L  P   L    +    V+A    +  +     P   PE+     +
Sbjct: 17700 EATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPT--PEIT----W 17753

Query: 637   SRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQA 696
             SR+ G    +    K +  T+ ++         ++ ++  + +G   S +A   ++V   
Sbjct: 17754 SREEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSG---SKSAFVTVKV--- 17807

Query: 697   LATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPT 756
             L TP  P   A+    K+   + W+PP   GG K+  Y +D+ +S    +  V+ +   T
Sbjct: 17808 LDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKT 17867

Query: 757   RVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRAT 816
                KV +L EG  Y FR  A N  GVG    P    +  +   P P PP  V  ++V  T
Sbjct: 17868 SF-KVENLTEGAIYYFRVMAENEFGVG---VPVETVDAVKAAEP-PSPPGKVTLTDVSQT 17922

Query: 817   SLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQV 876
             S  L WE P + G   V GY V  Q +G+E+W  V    +   +  V+ L  G+ Y F+V
Sbjct: 17923 SASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKV--CNAVVTGLSSGQEYQFRV 17980

Query: 877   QAMNSAGLGQPSMPTDPVLLEDKP---------GAHEIEVGVDEEGFIYLAFEAPE-APD 926
             +A N  G   P +   PV+ +D             + I+ G D      L  E P     
Sbjct: 17981 KAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGED------LKIEIPVIGRP 18034

Query: 927   SSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTL 986
                  W KD +      RV +E+    + + +KE   +D G Y+V  T++    +A+  L
Sbjct: 18035 RPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAG--TATENL 18092

Query: 987   TEEELEK 993
             +   LEK
Sbjct: 18093 SVIVLEK 18099



 Score =  182 bits (461), Expect = 3e-45
 Identities = 197/775 (25%), Positives = 320/775 (41%), Gaps = 86/775 (11%)

Query: 249   TYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFARE--KEPFSLSCLFSEDVL-DAESIQ 305
             T L     +   IF  + +G S    S   P+ A+   KEP      F+  +  D+  IQ
Sbjct: 17080 TKLKTGTEYQFRIFAENRYGQSFALES--DPIVAQYPYKEPGPPGTPFATAISKDSMVIQ 17137

Query: 306   WFRD---------GSLLRSSRRRKILYTDRQASLKVSCTYKE---DEGL-YMVRVPSP-- 350
             W            G  L    R  IL+T    ++     +K    +EG+ Y  RV +   
Sbjct: 17138 WHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENI 17197

Query: 351   --FGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYT 408
                G   +++   V     + PG P  P+ V+     R+ + L W  P    G+ IT Y 
Sbjct: 17198 VGVGKASKNSECYVARDPCDPPGTP-EPIMVK-----RNEITLQWTKPVYDGGSMITGYI 17251

Query: 409   IERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGS-SVPSKASELVVM 467
             +E+     G W+          +  + GL E Q Y FRV A +  G+ S PS ++  +  
Sbjct: 17252 VEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPI-- 17309

Query: 468   GDHDAARRKTEIPFDLGNKITISTD-AFEDTVTIPSPPT-NVHASEIREAYVVLAWEEPS 525
                  A+ + E+P        IS D  F DT+ + +  T  + A    +    + W    
Sbjct: 17310 ----TAKDEVELP-------RISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRG- 17357

Query: 526   PRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSD 585
                        +K +  S   E  +++         V D  +     + +RA N  G   
Sbjct: 17358 -----------DKEIEESARCEIKNTDF---KALLIVKDAIRIDGGQYILRASNVAG--- 17400

Query: 586   PSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWD-PVKD--PELLGYYIYSRKVGT 642
                 S P+ ++      PP   VQ    T    SLTW  P++D   ++  Y +  R+   
Sbjct: 17401 --SKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSR 17458

Query: 643   SEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSA 702
               W  V ++ +  +   V  L  G EY F + +V++ GVGE    + P+ +K     P  
Sbjct: 17459 LAWTVVASEVVTNS-LKVTKLLEGNEYVFRIMAVNKYGVGE-PLESAPVLMKNPFVLPGP 17516

Query: 703   PYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVS 762
             P    + N  K+ M + W  P   GG +I+GY +++ D   + W   N++ I     +V+
Sbjct: 17517 PKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVT 17576

Query: 763   DLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQW 822
              L E H YEFR  A N AGVGE S P++++      + +PGPP +    +    S+ L W
Sbjct: 17577 GLTEDHEYEFRVSAENAAGVGEPS-PATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAW 17635

Query: 823   EPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP-ISGTHLRVSDLQPGKSYVFQVQAMNS 881
               P+Y G   + GY V   +   E+W+ VTP   +  T   +S L   + Y  +V A+N 
Sbjct: 17636 GKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNK 17695

Query: 882   AGLGQPSMPTDPVLLEDKPGAHEIE----------VGVDEEGFIYLAFEAPEAPDSSEFQ 931
              GLG+ +     V  EDK  A E++          V       I++ F+    P   E  
Sbjct: 17696 VGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTP---EIT 17752

Query: 932   WSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTL 986
             WS++     D  +V+IE  VN +++ +      D G Y + + ++    SA  T+
Sbjct: 17753 WSREEGEFTD--KVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTV 17805



 Score =  181 bits (459), Expect = 4e-45
 Identities = 191/817 (23%), Positives = 328/817 (40%), Gaps = 91/817 (11%)

Query: 169   TTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATY 228
             T VL   ++   P P+ +W K    I P    +   +IT+      L I+    +D+  Y
Sbjct: 14090 TIVLNAISILGKPLPKSSWSKAGKDIRP----SDITQITSTPTSSMLTIKYATRKDAGEY 14145

Query: 229   TVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPF 288
             T+   N  G      KV V    G               GP VE ++V     + EK   
Sbjct: 14146 TITATNPFGTKVEHVKVTVLDVPGPP-------------GP-VEISNV-----SAEKATL 14186

Query: 289   SLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTY------KEDEGL 342
             + +    +     +S        +L      ++L+T     ++ SC +      + +E +
Sbjct: 14187 TWTPPLEDGGSPIKSY-------ILEKRETSRLLWTVVSEDIQ-SCRHVATKLIQGNEYI 14238

Query: 343   YMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGN 402
             + V   + +G  E      V+  +   P  PG P      +V ++   ++W  P D  G+
Sbjct: 14239 FRVSAVNHYGKGEPVQSEPVKMVDRFGP--PGPPEKPEVSNVTKNTATVSWKRPVDDGGS 14296

Query: 403   PITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKAS 462
              IT Y +ER + +S  W+   + P    RC + GL EG +Y FRV A +R G   PS+AS
Sbjct: 14297 EITGYHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEAS 14356

Query: 463   ELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWE 522
             + V+M                           +D    P PP+N H ++  +    LAW 
Sbjct: 14357 DSVLM---------------------------KDAAYPPGPPSNPHVTDTTKKSASLAWG 14389

Query: 523   EPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQY 581
             +P       +T Y +E   +G   W   ++ + +R  +F V DL+ K+ Y FR+ A+N  
Sbjct: 14390 KPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDA 14449

Query: 582   GLSDPSE-PSEPIALRGPPATLPPPAQVQAFRDTQTSVSL-TWDPVKDPELLGYYIYSRK 639
             G+ +P+  P   I  R         A+++     +  +S+  + P+K             
Sbjct: 14450 GVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDN 14509

Query: 640   VGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALAT 699
             +       + N     T   +P        +F +   + AG     +    +RV   L T
Sbjct: 14510 INLKNRANIENTE-SFTLLIIPECNRYDTGKFVMTIENPAG---KKSGFVNVRV---LDT 14562

Query: 700   PSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVC 759
             P         +  K+ + + W  P   GG +I  Y +++ ++    +     +       
Sbjct: 14563 PGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTK-CHKCTY 14621

Query: 760   KVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLV 819
             KV+ L EG  Y FR  A N  G+GE +  +   +  E     P PP  +   ++  +++ 
Sbjct: 14622 KVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASE----APSPPDSLNIMDITKSTVS 14677

Query: 820   LQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAM 879
             L W  P + G   +TGY +  Q +GS+QW  +T   + G    V +L  G+ Y FQV A+
Sbjct: 14678 LAWPKPKHDGGSKITGYVIEAQRKGSDQWTHIT--TVKGLECVVRNLTEGEEYTFQVMAV 14735

Query: 880   NSAGLGQPSMPTDPVLLEDKPGAHEIEV-GVDEEGFIYLAFE--APEAP----DSSEFQW 932
             NSAG   P   + PV+++++    E+++ G+ ++  I  A +    E P          W
Sbjct: 14736 NSAGRSAP-RESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTW 14794

Query: 933   SKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTY 969
              K  +     QRV  E     + + + E    D G Y
Sbjct: 14795 KKGDQILKQTQRVNFETTATSTILNINECVRSDSGPY 14831



 Score =  181 bits (458), Expect = 6e-45
 Identities = 156/580 (26%), Positives = 239/580 (41%), Gaps = 71/580 (12%)

Query: 341   GLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTR 400
             G Y +   +  G +  +  V V D        PG P +++  D+ R    L+W  P D  
Sbjct: 9582  GKYSITAKNKAGQKTANCRVKVMDV-------PGPPKDLKVSDITRGSCRLSWKMPDDDG 9634

Query: 401   GNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSK 460
             G+ I  Y IE+   +   W   +   G T    +  L+  Q Y FRVRA +R G   P +
Sbjct: 9635  GDRIKGYVIEKRTIDGKAWTKVNPDCGST-TFVVPDLLSEQQYFFRVRAENRFGIGPPVE 9693

Query: 461   ASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLA 520
                                        TI      D +  P PP  +    I +  V L+
Sbjct: 9694  ---------------------------TIQRTTARDPIYPPDPPIKLKIGLITKNTVHLS 9726

Query: 521   WEEPSPRDRAPLTYSLEKSVIGSGT------WEAISSESPVRSPRFAVLDLEKKKSYVFR 574
             W+ P     +P+T+ + + +    T      W   +    V   +F V DL +   Y FR
Sbjct: 9727  WKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRD-VEELQFTVEDLVEGGEYEFR 9785

Query: 575   VRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRD----TQTSVSLTWDPVKDPEL 630
             V+A+N  G+S PS    P   + P   +PP   ++ F +    T  ++      V  P L
Sbjct: 9786  VKAVNAAGVSKPSATVGPCDCQRP--DMPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPTL 9843

Query: 631   LGYYIYSRKVGTSE---WQTVNNKPIQGTRFT--VPGLRTGKEYEFCVRSVSEAGVGESS 685
               +    +K    E   + T  NK +     T  +P  R      + + +V+  G     
Sbjct: 9844  TWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLG----- 9898

Query: 686   AATEPIRVKQALATPSAPYG-FALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEEL 744
              A++ +R+   L  P  P G     +   ++M + W PPK  GG KI  Y +++ ++   
Sbjct: 9899  TASKEMRL-NVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEKREANRK 9957

Query: 745   DWHAVNQQPIPTRVC--KVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQP 802
              W  V+ +P   + C   +  L EGH Y FR  A N  G+GE     S  E        P
Sbjct: 9958  TWVHVSSEP---KECTYTIPKLLEGHEYVFRIMAQNKYGIGE--PLDSEPETARNLFSVP 10012

Query: 803   GPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPIS----G 858
             G P     S V   S+ + WE P Y G  PVTGY +  ++  S++WK V   PI     G
Sbjct: 10013 GAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLG 10072

Query: 859   THLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED 898
                +V+ L  G  Y F+V A+N+AG+G  S+P+DP    D
Sbjct: 10073 VSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARD 10112



 Score =  181 bits (458), Expect = 6e-45
 Identities = 157/619 (25%), Positives = 252/619 (40%), Gaps = 78/619 (12%)

Query: 304   IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVR 363
             I W +    LR      I  TD    L+     K D G Y++ + +  G +E +  V V 
Sbjct: 13420 ITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVL 13479

Query: 364   DAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACH 423
             D        PG P+NV   ++++D   +TW PP    G+PI  Y +++   E   W    
Sbjct: 13480 DT-------PGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTVT 13532

Query: 424   EAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDL 483
                  T    +  L EG+SY FRV A +  G   P +                       
Sbjct: 13533 TECSKTS-FRVANLEEGKSYFFRVFAENEYGIGDPGE----------------------- 13568

Query: 484   GNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGS 543
                   + DA + + T P P  ++    + ++   + W++P     + +   +   +   
Sbjct: 13569 ------TRDAVKASQT-PGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTEE 13621

Query: 544   GTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSE---------PSEPIA 594
               W+ +       S +++  DL + K Y FRV A N+ G   PSE          +  + 
Sbjct: 13622 NKWQRVMKSL---SLQYSAKDLTEGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLD 13678

Query: 595   LRGPPATLPPPAQVQAFR-----DTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVN 649
             L+G P       +   FR       + + S++W   +DP           + T    +V 
Sbjct: 13679 LKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDP-----------LATDTRVSVE 13727

Query: 650   NKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALL 709
             +  +  T   V   +     ++ +   + AG  E + +   I+V      P+ P  F  +
Sbjct: 13728 SSAVN-TTLIVYDCQKSDAGKYTITLKNVAGTKEGTIS---IKVVGKPGIPTGPIKFDEV 13783

Query: 710   NCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHF 769
                   M + W PPK  GG +I  Y L++ DS    W       +     +V+ LHEG  
Sbjct: 13784 TA--EAMTLKWAPPKDDGGSEITNYILEKRDSVNNKW-VTCASAVQKTTFRVTRLHEGME 13840

Query: 770   YEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMG 829
             Y FR  A N  GVGE      +     + +P   PP ++   +VR  S+ L W  P   G
Sbjct: 13841 YTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNI--VDVRHDSVSLTWTDPKKTG 13898

Query: 830   AGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSM 889
               P+TGYH+ F+E  S  WK     PI     +V+ L  G  Y F+V A+N AG+G+PS+
Sbjct: 13899 GSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSL 13958

Query: 890   PTDPVLL---EDKPGAHEI 905
             P++PV+     D PG  E+
Sbjct: 13959 PSEPVVALDPIDPPGKPEV 13977



 Score =  181 bits (458), Expect = 6e-45
 Identities = 201/832 (24%), Positives = 324/832 (38%), Gaps = 115/832 (13%)

Query: 173   LTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRV 232
             L   V   PPP + W K+   ++       K  I       +L  +     DS  YT+  
Sbjct: 15176 LEADVSGRPPPTMEWSKDGKELEG----TAKLEIKIADFSTNLVNKDSTRRDSGAYTLTA 15231

Query: 233   KNAHGQASSFAKVLVRTYLGKDAG------FDSEIFKRSTFGPSVEFTSVLKPVFAREKE 286
              N  G A     V V    G   G        SE    S F P  +  + +     +++E
Sbjct: 15232 TNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRE 15291

Query: 287   PFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVR 346
                L+              W    S ++ ++            LKV+   K +E ++ V 
Sbjct: 15292 TSRLA--------------WTNVASEVQVTK------------LKVTKLLKGNEYIFRVM 15325

Query: 347   VPSPFGPRE--QSTYVLVRDAEAENP-GAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNP 403
               + +G  E  +S  VL     A NP G P  P N     + +D +++ W  P    G+ 
Sbjct: 15326 AVNKYGVGEPLESEPVL-----AVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSE 15380

Query: 404   ITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASE 463
             I  Y +ER       WI C++      R  + GL EG  Y FR+ A +  G S PS  S 
Sbjct: 15381 IINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTS- 15439

Query: 464   LVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEE 523
                             PF              DTV  P PP N    +   + + +AW +
Sbjct: 15440 ----------------PFYKAC----------DTVFKPGPPGNPRVLDTSRSSISIAWNK 15473

Query: 524   PSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYG 582
             P     + +T Y +E ++     W+ ++  + +++  + +  L + + Y  R+ AMN  G
Sbjct: 15474 PIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEG 15533

Query: 583   LSDPS-EPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLT-------WDPVKD---PELL 631
             L +P+  P  P   +     LPP  ++ A  D +  V++        + P+K    PE+ 
Sbjct: 15534 LGEPALVPGTP---KAEDRMLPPEIELDA--DLRKVVTIRACCTLRLFVPIKGRPAPEVK 15588

Query: 632   GYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPI 691
                 ++R  G S  +         T   V  +      ++ +   + +G   S +A   +
Sbjct: 15589 ----WARDHGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSG---SKSAFVNV 15641

Query: 692   RVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQ 751
             RV   L TP  P    +    K  + + W PP   GG KI  Y +++ +S    +  V  
Sbjct: 15642 RV---LDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVAT 15698

Query: 752   QPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRAS 811
                 T   KV  L EG  Y FR  A N  G+G  +  +   +  E    +P PP  +   
Sbjct: 15699 NCHKTS-WKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASE----RPLPPGKITLM 15753

Query: 812   EVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKS 871
             +V   S+ L WE P + G   + GY V  Q +GS++W   T   +  T   ++ L  G+ 
Sbjct: 15754 DVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKW--ATCATVKVTEATITGLIQGEE 15811

Query: 872   YVFQVQAMNSAGLGQPSMPTDPVLLEDK--PGAHEI-----EVGVDEEGFIYLAFEAPEA 924
             Y F+V A N  G+  P   + PV+ +D   P A ++      V   E+  + + F     
Sbjct: 15812 YSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPT 15871

Query: 925   PDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDA 976
             P      W KD        RV  E   N S + +K+   ED+G Y V +T++
Sbjct: 15872 P---AVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNS 15920



 Score =  179 bits (454), Expect = 2e-44
 Identities = 155/612 (25%), Positives = 260/612 (42%), Gaps = 65/612 (10%)

Query: 303   SIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLV 362
             ++ W +DG+LL+ +   K+       +L++    ++D G Y +   +  G +  +  + V
Sbjct: 13021 TVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKV 13080

Query: 363   RDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIAC 422
              D        PG P +V+   +  D  +L+W PP +  G+ IT Y +++ +     W A 
Sbjct: 13081 LDK-------PGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNW-AQ 13132

Query: 423   HEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFD 482
               A      C ++ L+EG  Y+FR+ A ++ G   P      +    +D   R       
Sbjct: 13133 VSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRC------ 13186

Query: 483   LGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVI 541
                                 PP     S I + ++ ++W+ P+    +P+T Y LEK   
Sbjct: 13187 -------------------DPPV---ISNITKDHMTVSWKPPADDGGSPITGYLLEKRET 13224

Query: 542   GSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPAT 601
              +  W  ++ + P+         L++   Y FRV A+N+ G   PS+ S+    R P   
Sbjct: 13225 QAVNWTKVNRK-PIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYP 13283

Query: 602   LPPPAQVQAFRDTQTSVSLTW-DPVKD--PELLGYYIYSRKVGTSEWQTVN-NKPIQGTR 657
               PPA  + +  T++SVSL+W  P  D    ++GY +  ++  +  W   N  + +Q TR
Sbjct: 13284 PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTR 13343

Query: 658   FTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMV 717
             F V GL    +Y+F V +V++ G  + S   +    K  L  P       L    +  ++
Sbjct: 13344 FEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADL----RKTLI 13399

Query: 718   IGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEF-RARA 776
             +      R G    L   +      ++ W   N   +  R     D+    F  F R   
Sbjct: 13400 L------RAGVTMRLYVPVKGRPPPKITWSKPN---VNLRDRIGLDIKSTDFDTFLRCEN 13450

Query: 777   ANWAGVGE--LSAPSSLFECKEWT-----MPQPGPPYDVRASEVRATSLVLQWEPPLYMG 829
              N    G+  L+  +S  + KE+T     +  PGPP +V   E+   S  + WEPP+  G
Sbjct: 13451 VNKYDAGKYILTLENSCGK-KEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDG 13509

Query: 830   AGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSM 889
               P+  Y V  ++   + W  VT    S T  RV++L+ GKSY F+V A N  G+G P  
Sbjct: 13510 GSPIINYVVQKRDAERKSWSTVTT-ECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGE 13568

Query: 890   PTDPVLLEDKPG 901
               D V     PG
Sbjct: 13569 TRDAVKASQTPG 13580



 Score =  179 bits (454), Expect = 2e-44
 Identities = 197/755 (26%), Positives = 292/755 (38%), Gaps = 105/755 (13%)

Query: 167   EHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSA 226
             E++   L   ++  P P V+W K +   DP L    +  + ++    +L +  C   D+ 
Sbjct: 13691 ENSNFRLKIPIKGKPAPSVSWKKGE---DP-LATDTRVSVESSAVNTTLIVYDCQKSDAG 13746

Query: 227   TYTVRVKNAHGQASSFAKVLVRTYLGKDAG---FDSEIFKRSTFGPSVEFTSVLKPVFAR 283
              YT+ +KN  G       + V    G   G   FD    +  T          LK    +
Sbjct: 13747 KYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMT----------LKWAPPK 13796

Query: 284   EKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKI-LYTDRQASLKVSCTYKEDEGL 342
             +     ++    E   D+ + +W    S ++ +  R   L+   + + +VS   K   G 
Sbjct: 13797 DDGGSEITNYILEK-RDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGE 13855

Query: 343   YMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGN 402
              +   P            +V     + P AP  P     +DV  D + LTW  P  T G+
Sbjct: 13856 GLKSEP------------IVARHPFDVPDAPPPP---NIVDVRHDSVSLTWTDPKKTGGS 13900

Query: 403   PITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKAS 462
             PIT Y +E  +  S  W   ++ P       + GL EG  Y FRV AI+  G   PS  S
Sbjct: 13901 PITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPS 13960

Query: 463   ELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWE 522
             E VV  D          P D                    PP       I    V L W 
Sbjct: 13961 EPVVALD----------PID--------------------PPGKPEVINITRNSVTLIWT 13990

Query: 523   EPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQY 581
             EP       LT Y +EK  + S +W   +  + V    F V DL +   Y FR+RA N  
Sbjct: 13991 EPKYDGGHKLTGYIVEKRDLPSKSWMKANHVN-VPECAFTVTDLVEGGKYEFRIRAKNTA 14049

Query: 582   G-LSDPSEPSEPIALR----GPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIY 636
             G +S PSE +E I  +     P   L P       +D      LT        L    I 
Sbjct: 14050 GAISAPSESTETIICKDEYEAPTIVLDP-----TIKD-----GLTIKAGDTIVLNAISIL 14099

Query: 637   SRKVGTSEWQTVNN--KPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESS-AATEPIRV 693
              + +  S W       +P   T+ T     T       ++  +    GE +  AT P   
Sbjct: 14100 GKPLPKSSWSKAGKDIRPSDITQIT----STPTSSMLTIKYATRKDAGEYTITATNPFGT 14155

Query: 694   K------QALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWH 747
             K        L  P  P    + N    +  + W PP   GG  I  Y L++ ++  L W 
Sbjct: 14156 KVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWT 14215

Query: 748   AVNQQPIPTRVCK--VSDLHEGHFYEFRARAANWAGVGE--LSAPSSLFECKEWTMPQPG 803
              V++     + C+   + L +G+ Y FR  A N  G GE   S P  + +        PG
Sbjct: 14216 VVSED---IQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQSEPVKMVD----RFGPPG 14268

Query: 804   PPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRV 863
             PP     S V   +  + W+ P+  G   +TGYHV  +E+ S +W      P+S    +V
Sbjct: 14269 PPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDLRCKV 14328

Query: 864   SDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED 898
             + LQ G +Y F+V A N AG+G PS  +D VL++D
Sbjct: 14329 TGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKD 14363



 Score =  179 bits (453), Expect = 2e-44
 Identities = 150/611 (24%), Positives = 255/611 (41%), Gaps = 62/611 (10%)

Query: 304   IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVR 363
             I W +DG  +    R +I+ TD    L V    + D G Y++ + +  G R     V V 
Sbjct: 19516 ISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRS----VAVN 19571

Query: 364   DAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACH 423
                 + PG P  PL +  L   +    L+W  P +  G  I  Y +E+ +     W  C 
Sbjct: 19572 CKVLDKPGPPAGPLEINGLTAEK--CSLSWGRPQEDGGADIDYYIVEKRETSHLAWTIC- 19628

Query: 424   EAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDL 483
             E       C +  L++G  Y FRV  +++ G   P ++  +  +                
Sbjct: 19629 EGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLESVAIKAL---------------- 19672

Query: 484   GNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIG 542
                         D  T+PSPPT++  + + +  + L W  P     + ++ Y +E+    
Sbjct: 19673 ------------DPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSEISGYIIERREKN 19720

Query: 543   SGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATL 602
             S  W  + ++ PV   R     L +   Y +RV A N  GLS PSE S  I    P    
Sbjct: 19721 SLRWVRV-NKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLP 19779

Query: 603   PPPAQVQAFRDTQTSVSLTW-DPVKD--PELLGYYIYSRKVGTSEWQTVNNKPIQGTRFT 659
              PP++ +     +T++++ W  P+ D    + GY +  +K   ++W+T + + ++GT +T
Sbjct: 19780 SPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKT-SIQSLRGTEYT 19838

Query: 660   VPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATP-----SAPYGFALLNCGKN 714
             + GL TG EY F V+SV++ G  + S +++P   K+    P     S      ++  G +
Sbjct: 19839 ISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGAS 19898

Query: 715   -EMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFR 773
               M + ++       G+ +   L      +L   A            + + +     ++ 
Sbjct: 19899 FTMTVPFR-------GRPVPNVLWSKPDTDLRTRAYVDTTDSRTSLTIENANRNDSGKYT 19951

Query: 774   ARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPV 833
                 N      LSA S     K   +  PGPP ++   +V   S VL W+ P   G  PV
Sbjct: 19952 LTIQN-----VLSAASLTLVVK--VLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPV 20004

Query: 834   TGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDP 893
               YH+  +E   + W  VT    +    +V++LQ G  Y F+V   N  G+G P+   + 
Sbjct: 20005 KNYHIEKREASKKAWVSVT-NNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEG 20063

Query: 894   VLLEDKPGAHE 904
             V + +KP   E
Sbjct: 20064 VKITEKPSPPE 20074



 Score =  179 bits (453), Expect = 2e-44
 Identities = 190/806 (23%), Positives = 301/806 (37%), Gaps = 147/806 (18%)

Query: 171   VLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTV 230
             V L   +   PPP  +W+   ++    L  + +  +  +  +  L IR   I D+  YT+
Sbjct: 23451 VELVIPIAGRPPPAASWFFAGSK----LRESERVTVETHTKVAKLTIRETTIRDTGEYTL 23506

Query: 231   RVKNAHGQASSFAKVLVRTYLGKDAG------FDSEIFKRSTFGPSVEFTSVLKPVFARE 284
              +KN  G  S   KV++    G   G       D+     S   P ++  + L      +
Sbjct: 23507 ELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPELDGGAPLSGYVVEQ 23566

Query: 285   KEPFSLSCLFSEDVLDAESIQWFR-DGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
             +              DA    W     S+ RS+ +   L    +   +V+ T +   G Y
Sbjct: 23567 R--------------DAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFGIGSY 23612

Query: 344   MVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNP 403
             +           QS  +  R +       PG P  ++  DV+RD + LTW PP D  G+ 
Sbjct: 23613 L-----------QSEVIECRSSIR----IPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQ 23657

Query: 404   ITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASE 463
             +T Y +ER +  +  W+  ++ P    R    GL EG  Y  RV AI+  GS  PS+ S+
Sbjct: 23658 VTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSK 23717

Query: 464   LVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEE 523
              +V                             D +  P  P N   ++     V LAW  
Sbjct: 23718 PIVA---------------------------MDPIAPPGKPQNPRVTDTTRTSVSLAWSV 23750

Query: 524   PSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYG 582
             P     + +T Y +E   +    W   ++ +P +   + +  L +   Y FRV A N  G
Sbjct: 23751 PEDEGGSKVTGYLIEMQKVDQHEWTKCNT-TPTKIREYTLTHLPQGAEYRFRVLACNAGG 23809

Query: 583   LSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGT 642
                P EP+E       P T                       VK  E+L Y  Y      
Sbjct: 23810 ---PGEPAEV------PGT-----------------------VKVTEMLEYPDYELDERY 23837

Query: 643   SEWQTVNNKPIQGTRFTVPGLRTGKEYEFCV-----RSVSEAGVGESSAATEPIRVKQAL 697
              E   V    +   R T+P    GK +  C      + +S+  +  +S     + +K+A 
Sbjct: 23838 QEGIFVRQGGV--IRLTIP--IKGKPFPICKWTKEGQDISKRAMIATSETHTELVIKEAD 23893

Query: 698   ATPSAPYGFALLN-CGKNEMVI---------------------------GWKPPKRRGGG 729
                S  Y   L N CGK  + I                            W+PP   GG 
Sbjct: 23894 RGDSGTYDLVLENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGA 23953

Query: 730   KILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPS 789
              ILGY L++ +  +  W+ ++ +   T +  V  L E   Y FR  A N  G+ +     
Sbjct: 23954 DILGYILERREVPKAAWYTIDSRVRGTSLV-VKGLKENVEYHFRVSAENQFGISKPLKSE 24012

Query: 790   SLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWK 849
                  K    P   P       +V  +S+ L W  P   G   VTGY++  +E  +++W 
Sbjct: 24013 EPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWV 24072

Query: 850   PVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED------KPGAH 903
                   I+ T   V+ L P   Y F++ A N  GL + S  ++PV+ +D      +PG  
Sbjct: 24073 RHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPG-- 24130

Query: 904   EIEVGVDEEGFIYLAFEAPEAPDSSE 929
             E+E+    +  + L +E PE     E
Sbjct: 24131 ELEILSISKDSVTLQWEKPECDGGKE 24156



 Score =  177 bits (450), Expect = 5e-44
 Identities = 215/843 (25%), Positives = 344/843 (40%), Gaps = 113/843 (13%)

Query: 170  TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRIT-NNYGLLS-LEIRRCAIEDSAT 227
            T+ +   V   P P   W K +  +D       K R+  +N G  S L I+    +D   
Sbjct: 8816 TLRIPAVVTGRPVPTKVWTKEEGELD-------KDRVVIDNVGTKSELIIKDALRKDHGR 8868

Query: 228  YTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEP 287
            Y +   N+ G   + A+V V         FD         GP ++    LKPV    K  
Sbjct: 8869 YVITATNSCGSKFAAARVEV---------FDVP-------GPVLD----LKPVVTNRK-- 8906

Query: 288  FSLSCLFS----EDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
                CL +    ED   +E   +  +    +    R+ + T+R +   ++   +  E  +
Sbjct: 8907 ---MCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETER-SKCDITGLLEGQEYKF 8962

Query: 344  MVRVPSPFG--PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRG 401
             V   + FG  P  +   +L  D      G P SP  +   +  +  + L W  P    G
Sbjct: 8963 RVIAKNKFGCGPPVEIGPILAVDPL----GPPTSPERLTYTERTKSTITLDWKEPRSNGG 9018

Query: 402  NPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKA 461
            +PI  Y IE+ + +  ++   ++    T    ++ L E Q Y FRV+A++ +G S PS  
Sbjct: 9019 SPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLP 9078

Query: 462  SELVVMGDHDAARRKTEIPFDLGNKITISTDAFE----DTVTIPSPPTNVHASEIREAYV 517
              +V+  D        E+P  +  ++++  D  +    + V IP+  T +   +I  +  
Sbjct: 9079 LNVVIQDD--------EVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKN 9130

Query: 518  VLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRA 577
                E+P+  D   +T   ++ V  S     +S    VR         E K +Y   V A
Sbjct: 9131 ETVIEKPT--DALQIT---KEEVSRSEAKTELSIPKAVR---------EDKGTYT--VTA 9174

Query: 578  MNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQT-SVSLTWDPVKD---PELLGY 633
             N+ G    +   E      PP  L       A  D +  S  LTWD   D    E+  Y
Sbjct: 9175 SNRLGSVFRNVHVEVYDRPSPPRNL-------AVTDIKAESCYLTWDAPLDNGGSEITHY 9227

Query: 634  YIYSRKVG--TSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPI 691
             I  R      +EW+ V N  ++  R+ +  L    +YEF VR+V++ G+ +    ++ +
Sbjct: 9228 VIDKRDASRKKAEWEEVTNTAVE-KRYGIWKLIPNGQYEFRVRAVNKYGISD-ECKSDKV 9285

Query: 692  RVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQ 751
             ++     P  P    +L   K  M++ W PP   GG  I GY+L++ +     W  V++
Sbjct: 9286 VIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSR 9345

Query: 752  QPIPTRV------CKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPP 805
             PI T+V        V  L EG  Y+FRA A N AG+G  S PS      +   P PGPP
Sbjct: 9346 API-TKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFP-PGPP 9403

Query: 806  YDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP--ISGTHLRV 863
                  +   +S+ L W+PP   G  P+ GY V  QEEG+  WK V      I+     V
Sbjct: 9404 SCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCECVV 9463

Query: 864  SDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEVGVDEEGF--------- 914
             +L+  + Y F+V+A+N AG  +PS  T  +   D     E+ + +  +           
Sbjct: 9464 PNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQI 9523

Query: 915  -IYLAFEAPEAPDSSEFQWSKDYKGPLD-----PQRVKIEDKVNKSKVILKEPGLEDLGT 968
             I    +    P SS     K  K   D     P+  ++E   N S +I+ E      G 
Sbjct: 9524 RIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHTGK 9583

Query: 969  YSV 971
            YS+
Sbjct: 9584 YSI 9586



 Score =  177 bits (450), Expect = 5e-44
 Identities = 197/851 (23%), Positives = 347/851 (40%), Gaps = 100/851 (11%)

Query: 150   YGRGPWFWIPLRSHAVWEH---TTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRI 206
             YG GP   +PL    V ++   T+V L   +   P P + WYK+D  +           +
Sbjct: 20562 YG-GPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVC----V 20616

Query: 207   TNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRST 266
              N   L S+ I+     +S  Y ++++NA G AS+  +V +    G   G     FK  T
Sbjct: 20617 ENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPIE--FKTVT 20674

Query: 267   FGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDR 326
                + + T + +P      +  +    +  +  +   + W    S++       I+ T +
Sbjct: 20675 ---AEKITLLWRPP---ADDGGAKITHYIVEKRETSRVVW----SMVSEHLEECIITTTK 20724

Query: 327   QASLKVSCTYKEDEGLYMVRVPSPFGPRE--QSTYVLVRDAEAENPGAPGSPLNVRCLDV 384
                       K +E ++ VR  + +G  E  +S  V+ ++A    PG PG P       +
Sbjct: 20725 --------IIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAFV-TPGPPGIP---EVTKI 20772

Query: 385   NRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYR 444
              ++ + + W+ P    G+ I+ Y +E+   +S  W    +      R  + GL E   Y+
Sbjct: 20773 TKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQ 20832

Query: 445   FRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPP 504
             +RV A++  G    S+ SE      + AA                      D +  P PP
Sbjct: 20833 YRVCAVNAAGQGPFSEPSEF-----YKAA----------------------DPIDPPGPP 20865

Query: 505   TNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVL 563
               +  ++  ++ + L W +P     + +T Y +E        W  +S++  VR+  + V 
Sbjct: 20866 AKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVS 20925

Query: 564   DLEKKKSYVFRVRAMNQYGLSDPSEPSEPI----ALRGPPATLPPPAQ----VQAFRDTQ 615
             +L+   +Y FRV A+N  G  +P E +EP+     L  P   L    +     +A  D Q
Sbjct: 20926 NLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQ 20985

Query: 616   TSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRS 675
               +     P   P  + +    + +G+    ++ N     +  T+P +      ++ +  
Sbjct: 20986 VLIPFKGRP---PPTVTWRKDEKNLGSDARYSIENTD-SSSLLTIPQVTRNDTGKYIL-- 21039

Query: 676   VSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYF 735
               E GVGE  ++T  ++V   L TP+A     + +  +  + + W PP   GG  I+ Y 
Sbjct: 21040 TIENGVGEPKSSTVSVKV---LDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYV 21096

Query: 736   LDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECK 795
             +++ D+ +  W  V+ +   T   K+ DL E   + FR  A N  G+GE    +   +  
Sbjct: 21097 IEKRDATKRTWSVVSHKCSSTSF-KLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAA 21155

Query: 796   EWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP 855
             E     P P  D+   +   TS++L W  P + G   +T Y V  + +G + W     G 
Sbjct: 21156 E----VPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHA--GI 21209

Query: 856   ISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQP----------SMPTDPVLLEDKPGAHEI 905
                  + VS L+      F+V A N  GL  P           + T  V L D PGA ++
Sbjct: 21210 SKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPGA-QV 21268

Query: 906   EVGVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLED 965
              V +     + L ++    P  S   W KD     + + V+     NK  + +K    E 
Sbjct: 21269 TVRIGHNVHLELPYKGKPKPSIS---WLKDGLPLKESEFVRFSKTENKITLSIKNAKKEH 21325

Query: 966   LGTYSVIVTDA 976
              G Y+VI+ +A
Sbjct: 21326 GGKYTVILDNA 21336



 Score =  177 bits (450), Expect = 5e-44
 Identities = 161/611 (26%), Positives = 259/611 (42%), Gaps = 76/611 (12%)

Query: 304   IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVR 363
             I W + G  L S  R  I  T+  + L V    + D G Y +   +  G +  +  V V 
Sbjct: 23173 ITWSKQGIDLAS--RAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVY 23230

Query: 364   DAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACH 423
             D        PG   +V+  +V+RD + +TW  P+   G P+  Y +E+ +       A  
Sbjct: 23231 DT-------PGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREA------AMR 23277

Query: 424   EAPGGTCRCP-----IQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTE 478
                  T +C      I GLVEG  Y FRV   +  G   P + S+ V++ +         
Sbjct: 23278 AFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSE--------- 23328

Query: 479   IPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLE 537
                                  +P  P  +   ++ ++ V LAWE+P     + LT Y LE
Sbjct: 23329 ---------------------VPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLE 23367

Query: 538   KSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIA--- 594
                 G+  W  + +  P       V  L + + Y+FR+RA N+ G+S+P E    +    
Sbjct: 23368 ACKAGTERWMKVVTLKPT-VLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQD 23426

Query: 595   LRGPP----ATLPPPA-QVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTV- 648
             LR  P    +T+P     V A R  +  + +   P   P    ++    K+  SE  TV 
Sbjct: 23427 LRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRP---PPAASWFFAGSKLRESERVTVE 23483

Query: 649   NNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYG-FA 707
              +  +         +R   EY   +++V       +   +E I+V   L  P  P G   
Sbjct: 23484 THTKVAKLTIRETTIRDTGEYTLELKNV-------TGTTSETIKV-IILDKPGPPTGPIK 23535

Query: 708   LLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEG 767
             +       + I W+PP+  GG  + GY ++Q D+    W  V++  +     K + L EG
Sbjct: 23536 IDEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSES-VTRSTFKFTRLTEG 23594

Query: 768   HFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLY 827
             + Y FR  A N  G+G     S + EC+  ++  PGPP  ++  +V    + L W PP  
Sbjct: 23595 NEYVFRVAATNRFGIGSY-LQSEVIECRS-SIRIPGPPETLQIFDVSRDGMTLTWYPPED 23652

Query: 828   MGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQP 887
              G   VTGY V  +E  +++W  V   P++ T  R + L  G  Y  +V A+N+ G G+P
Sbjct: 23653 DGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKP 23712

Query: 888   SMPTDPVLLED 898
             S P+ P++  D
Sbjct: 23713 SRPSKPIVAMD 23723



 Score =  175 bits (443), Expect = 3e-43
 Identities = 264/1228 (21%), Positives = 457/1228 (37%), Gaps = 184/1228 (14%)

Query: 301   AESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYV 360
             A +I+W++D   L+++    +  T   AS+ +    + + G Y +++ +  G    +  V
Sbjct: 20596 APTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRV 20655

Query: 361   LVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWI 420
              + D     PG PG P+  + +   +  + L W PP+D  G  IT Y +E+ +     W 
Sbjct: 20656 QILD----KPGPPGGPIEFKTVTAEK--ITLLWRPPADDGGAKITHYIVEKRETSRVVWS 20709

Query: 421   ACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIP 480
                E     C      +++G  Y FRVRA+++ G   P ++  +V               
Sbjct: 20710 MVSEHLE-ECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVA-------------- 20754

Query: 481   FDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKS 539
                           ++    P PP     ++I +  + + W  P     + ++ Y LEK 
Sbjct: 20755 --------------KNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKR 20800

Query: 540   VIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPP 599
                S  W  +  E+ +R  R  V  L +   Y +RV A+N  G    SEPSE      P 
Sbjct: 20801 DKKSLGWFKVLKET-IRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPI 20859

Query: 600   ATLPPPAQVQAFRDTQTSVSLTWD-PVKD--PELLGYYIYSRKVGTSEWQTVNNK-PIQG 655
                 PPA+++    T++S++L W  PV D    + GY +  R+    EW TV+ K  ++ 
Sbjct: 20860 DPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRT 20919

Query: 656   TRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFAL-----LN 710
             T + V  L+ G  Y F V +V+ AG GE     EP++ K  L  P      AL       
Sbjct: 20920 TEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAK 20979

Query: 711   CGKNEMVI----GWKPPKR--RGGGKILG----YFLDQHDSEELDWHAVNQQPIPTRVCK 760
              G++  V+    G  PP    R   K LG    Y ++  DS  L                
Sbjct: 20980 AGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSL--------------LT 21025

Query: 761   VSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVL 820
             +  +      ++     N  GVGE    SS    K   +  P     ++   V   ++ L
Sbjct: 21026 IPQVTRNDTGKYILTIEN--GVGE--PKSSTVSVK--VLDTPAACQKLQVKHVSRGTVTL 21079

Query: 821   QWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMN 880
              W+PPL  G  P+  Y +  ++     W  V+    S T  ++ DL     + F+V A N
Sbjct: 21080 LWDPPLIDGGSPIINYVIEKRDATKRTWSVVSH-KCSSTSFKLIDLSEKTPFFFRVLAEN 21138

Query: 881   SAGLGQPSMPTDPVLLEDKPGA-HEIEVGVDEEGFIYLAFEAPEAPDSS---EFQWSKDY 936
               G+G+P   T+PV   + P    ++ +    +  + L++  P+    S   E+   +  
Sbjct: 21139 EIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKG 21198

Query: 937   KGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKK 996
             KG        I          LKE  + +   ++       + ++    +T +EL     
Sbjct: 21199 KGEQTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIG-PITVKEL----- 21252

Query: 997   LSHEIRNPVIKL--ISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKI 1054
                 I  P + L  I G  + +     V L L   K  P   +  + +   +  S    +
Sbjct: 21253 ----IITPEVDLSDIPGAQVTVRIGHNVHLELPY-KGKPKPSISWLKDGLPLKES--EFV 21305

Query: 1055  NFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDD----------FDKLL 1104
              F + +  + + I+N  +E  G YT  L +   +  + +T++             FD++ 
Sbjct: 21306 RFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKGPIRFDEI- 21364

Query: 1105  RKADAKRRDW-----------------KRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKK 1147
              KAD+    W                 KR+          WK+      + T KV N  K
Sbjct: 21365 -KADSVILSWDVPEDNGGGEITCYSIEKRETSQ-----TNWKMVCSSVARTTFKVPNLVK 21418

Query: 1148  ETRFQWFFQRAEMPDGQYDPETGTGLLCIEEL---SKKDKGIYRAMVSD----------- 1193
             +  +Q F  RAE   G   P   + ++   +        K +   + SD           
Sbjct: 21419 DAEYQ-FRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVY 21477

Query: 1194  DRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTT 1253
             D G + T   +     ++I  +      +S    +  G  EG+    +V   N   + + 
Sbjct: 21478 DGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGLSSP 21537

Query: 1254  WFHKDKRLESGDRIRTGT---------TLDEIWLHILDPKDSDKGKYTLEIAAGKE--VR 1302
                    L        GT         T+   W   L    S    Y++E   G E  VR
Sbjct: 21538 SDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVGYSIEKRQGNERWVR 21597

Query: 1303  QLSTDLS-----------GQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIME--- 1348
                TD+S           G  +E  +     + T++   ++   ++    +V  I+E   
Sbjct: 21598 CNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGP 21657

Query: 1349  ----------DKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGT--EVTITIEK 1396
                        ++L +  +V G P P ++W K+   V    R  ME+       ++ +  
Sbjct: 21658 EYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDG--VEIEKRMNMEITDVLGSTSLFVRD 21715

Query: 1397  VNSEDSGRYGVFVKNKYGSETGQVTISV 1424
                +  G Y V  KN  GS   ++ + V
Sbjct: 21716 ATRDHRGVYTVEAKNASGSAKAEIKVKV 21743



 Score =  174 bits (442), Expect = 4e-43
 Identities = 161/669 (24%), Positives = 276/669 (41%), Gaps = 89/669 (13%)

Query: 305   QWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRD 364
             +W  DGS +++     +   +  + L +    + D G Y + V +  G +  + ++ V D
Sbjct: 11238 KWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLD 11297

Query: 365   AEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHE 424
                  PG P  P+N+  LDV  + + ++W PP D  G+P+  Y +E+       W     
Sbjct: 11298 V----PGPPTGPINI--LDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSS 11351

Query: 425   APGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLG 484
                 T +  I  L +G  Y FRVRA +++G   P                        L 
Sbjct: 11352 GSSKT-KLKIPHLQKGCEYVFRVRAENKIGVGPP------------------------LD 11386

Query: 485   NKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGS 543
             +  T++   F      PSPP     ++I E    ++W  P     +P+T Y +E+  + +
Sbjct: 11387 STPTVAKHKFSP----PSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREV-T 11441

Query: 544   GTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLP 603
             G W  + +++P+   +F V  L +  +Y FRV A N  GLS PS  S+PI    P     
Sbjct: 11442 GKWVRV-NKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKPPG 11500

Query: 604   PPAQVQAFRDTQTSVSLTW-DPVKD--PELLGYYIYSRKVGTSEWQTVN-NKPIQGTRFT 659
             PP   +    ++ +  L W  P+ D    +LGY +  +K GT++W  +N ++ I+   F 
Sbjct: 11501 PPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFR 11560

Query: 660   VPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNC-------- 711
             VPGL  G EY F +++ +  G GE     E +  K  L  P         +         
Sbjct: 11561 VPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQT 11620

Query: 712   --------GKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSD 763
                     G+ E  I W        GK+L         + +D      Q +P    ++ +
Sbjct: 11621 IRILARVKGRPEPDITWTKE-----GKVL------VREKRVDL----IQDLPRVELQIKE 11665

Query: 764   LHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWE 823
                    ++   A N +G  + SA  ++ +       +PGP  +++ + V   +  + WE
Sbjct: 11666 AVRADHGKYIISAKNSSGHAQGSAIVNVLD-------RPGPCQNLKVTNVTKENCTISWE 11718

Query: 824   PPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAG 883
              PL  G   +T + V +++   + W  V         L  ++L     Y F+V A N  G
Sbjct: 11719 NPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTK--RLIKANLLANNEYYFRVCAENKVG 11776

Query: 884   LGQPSMPTDPVLL---EDKPGAHE-IEVGVDEEGFIYLAFEAPEAPDSS---EFQWSKDY 936
             +G       P+L     D+PG  E + +    + F+YL +  P+    S    +   +  
Sbjct: 11777 VGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRL 11836

Query: 937   KGPLDPQRV 945
             KG  D +RV
Sbjct: 11837 KGSDDWERV 11845



 Score =  174 bits (442), Expect = 4e-43
 Identities = 147/610 (24%), Positives = 257/610 (42%), Gaps = 64/610 (10%)

Query: 305   QWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRD 364
             +W +    + +S    +   D  + L +    ++D G Y +   +  G   Q   V+V D
Sbjct: 12626 KWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMD 12685

Query: 365   AEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHE 424
             A    PG P  P ++   D++ D   L+W  P +  G+ IT Y +E+C    G+W+    
Sbjct: 12686 A----PGPPQPPFDIS--DIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALA 12739

Query: 425   APGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLG 484
             +   T  C +  L+ GQ Y FRVRA +R G S P  + ++V            + PF   
Sbjct: 12740 SVTKT-SCRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMV-----------AQFPFG-- 12785

Query: 485   NKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGS 543
                            +PS P N   +++ +  + +AW+ P     +P+  Y +E+    S
Sbjct: 12786 ---------------VPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNS 12830

Query: 544   GTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLP 603
               W   ++++ VRS  +    L +   Y FR+ A+N+ G S PS+P+E +  R P   + 
Sbjct: 12831 LLW-VKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMP---VD 12886

Query: 604   PPAQVQAFRDTQTSVSLTWDPVK---DPELLGYYIYSRKVGTSEWQTVNNKP--IQGTRF 658
             PP + +    T+++VSL W   K     +++GY++ + K+   +W   N  P  I    +
Sbjct: 12887 PPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEY 12946

Query: 659   TVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVI 718
             T  GL    +Y+F   + +   +   S  ++P+ +      P      A+    K+ + +
Sbjct: 12947 TATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAM----KSLLTV 13002

Query: 719   GWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEF----RA 774
                   + G    L   +       + W        P    K++        E     R 
Sbjct: 13003 ------KAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRK 13056

Query: 775   RAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVT 834
              + ++    E S+ S     K   + +PGPP  V+ +++ +   +L WEPPL  G   +T
Sbjct: 13057 DSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEIT 13116

Query: 835   GYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPV 894
              Y V  +E     W  V+   +  T   V  L  G  Y F++ A N  G+G P   T+P 
Sbjct: 13117 NYIVDKRETSRPNWAQVS-ATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVF-TEPA 13174

Query: 895   LLE---DKPG 901
             + +   D PG
Sbjct: 13175 IAKNPYDPPG 13184



 Score =  174 bits (442), Expect = 4e-43
 Identities = 140/540 (25%), Positives = 234/540 (43%), Gaps = 43/540 (7%)

Query: 373   PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRC 432
             PG+P     +DV R+ + L W PP    G+ I  Y+IE+ QG    W+ C+      C+ 
Sbjct: 21553 PGTP---DYIDVTRETITLKWNPPLRDGGSKIVGYSIEKRQGNE-RWVRCNFTDVSECQY 21608

Query: 433   PIQGLVEGQSYRFRVRAISRVGS-SVPSKASELVVMGDHDAARRKTEIPFDLGNKITIST 491
              + GL  G  Y FR+ A + VG+ S PS++S +++  D +        P      +    
Sbjct: 21609 TVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVP------PI-----VEFGP 21657

Query: 492   DAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISS 551
             + F+  +        + A         + W +        +   +   V+GS +      
Sbjct: 21658 EYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEIT-DVLGSTS------ 21710

Query: 552   ESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAF 611
                       V D  +    V+ V A N  G    ++    + ++  P  +  P  ++  
Sbjct: 21711 --------LFVRDATRDHRGVYTVEAKNASG---SAKAEIKVKVQDTPGKVVGP--IRFT 21757

Query: 612   RDTQTSVSLTWD-PVKD--PELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKE 668
               T   ++L WD P+ D    +  Y I  R+     W  + +K  +   +T   L  G E
Sbjct: 21758 NITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDK-CEAQSYTAIKLINGNE 21816

Query: 669   YEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGG 728
             Y+F V +V++ GVG     ++P+  +     P AP      N   N + + W  P+  GG
Sbjct: 21817 YQFRVSAVNKFGVGRP-LDSDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGG 21875

Query: 729   GKILGYFLDQHDSEELDW-HAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSA 787
              +I  Y L++ + +   W   ++++PI     KV+ L EG+ YEF   A N AGVG  S 
Sbjct: 21876 SEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASG 21935

Query: 788   PSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQ 847
              S L +C+E   P PGPP  V+ ++   T++ L+W  P++ G   + GY +   +     
Sbjct: 21936 ISRLIKCREPVNP-PGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGD 21994

Query: 848   WKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEV 907
             W  V       T   V+DLQ G+ Y F+V A+N AG G     T  +   D+  A E+++
Sbjct: 21995 WHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDI 22054



 Score =  174 bits (440), Expect = 7e-43
 Identities = 169/657 (25%), Positives = 270/657 (41%), Gaps = 90/657 (13%)

Query: 295   SEDVLDAE-------SIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRV 347
             S+ VLDA         I W +    L    +  + YT ++A+  +    + D G Y + V
Sbjct: 22758 SDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTV 22817

Query: 348   PSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAY 407
              +  G +  S  V V D       +PG    +    V ++   L W+ P +  G  IT Y
Sbjct: 22818 KNASGTKAVSVMVKVLD-------SPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHY 22870

Query: 408   TIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVM 467
              +ER +     W+   E    T    +  L++   Y FRVRA+++ G  VP ++  +V  
Sbjct: 22871 IVERRETSRLNWVIV-EGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVA- 22928

Query: 468   GDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEP-SP 526
                                         ++ TIPSPP         + ++++ W +P S 
Sbjct: 22929 ---------------------------RNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESD 22961

Query: 527   RDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDP 586
                    Y ++K    S  W  ++ +  V   R  V  L +   Y FRV A+N  G S+P
Sbjct: 22962 GGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEP 23021

Query: 587   SEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTW-DPVKD--PELLGYYIYSRKVGTS 643
             SE S  I+ R P  T  PP+  +    T+ S+SL W  P+ D   +++GY +  ++  T 
Sbjct: 23022 SEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTD 23081

Query: 644   EWQTVN-NKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATP-- 700
             +W  V+ N  I+ T FTVP L+ G++Y F V +V+  G+ E S +   I   + +  P  
Sbjct: 23082 QWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPDL 23141

Query: 701   --------------SAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDW 746
                            A     +   G+   VI W    ++G        +D  +S  L  
Sbjct: 23142 ELADDLKKTVTIRAGASLRLMVSVSGRPPPVITW---SKQGIDLASRAIIDTTESYSL-- 23196

Query: 747   HAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPY 806
                        V KV+    G   ++   A N +G    +    +++        PGP  
Sbjct: 23197 ---------LIVDKVNRYDAG---KYTIEAENQSGKKSATVLVKVYD-------TPGPCP 23237

Query: 807   DVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDL 866
              V+  EV   S+ + WE P   G  PV  Y V  +E     +K VT    S T  R+S L
Sbjct: 23238 SVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREAAMRAFKTVTT-KCSKTLYRISGL 23296

Query: 867   QPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKP-GAHEIEVGVDEEGFIYLAFEAP 922
               G  Y F+V   N  G+G+P   +D VL+ + P    ++EV    +  + LA+E P
Sbjct: 23297 VEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKP 23353



 Score =  173 bits (439), Expect = 9e-43
 Identities = 167/665 (25%), Positives = 277/665 (41%), Gaps = 93/665 (13%)

Query: 299  LDAESIQWFRDGSLLRSSR------RRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFG 352
            L    I+W ++ +++          + ++  ++ +  L +    +ED+G Y V   +  G
Sbjct: 9120 LPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLG 9179

Query: 353  PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIER- 411
               ++ +V V D        P  P N+   D+  +   LTW  P D  G+ IT Y I++ 
Sbjct: 9180 SVFRNVHVEVYDR-------PSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKR 9232

Query: 412  -CQGESGEWIACHEAPGGTC---RCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVM 467
                +  EW    E    T    R  I  L+    Y FRVRA+++ G S   K+ ++V+ 
Sbjct: 9233 DASRKKAEW----EEVTNTAVEKRYGIWKLIPNGQYEFRVRAVNKYGISDECKSDKVVI- 9287

Query: 468  GDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPR 527
                                       +D   +P PP         +  ++++W  P   
Sbjct: 9288 ---------------------------QDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDN 9320

Query: 528  DRAPLT-YSLEKSVIGSGTWEAIS----SESPVRSPRFAVLDLEKKKSYVFRVRAMNQYG 582
              +P+T Y LEK   GS  W  +S    ++  ++   F V  L +   Y FR  A+N  G
Sbjct: 9321 GGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAG 9380

Query: 583  LSDPSEPSEPIALRGPPATLPPPAQVQAFRD-TQTSVSLTWDP-VKD--PELLGYYIYSR 638
            +  PSEPS+P  + G P   P P      +D T++S+SL W P  KD    + GY +  +
Sbjct: 9381 IGPPSEPSDP-EVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQ 9439

Query: 639  KVGTSEWQTVN--NKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQA 696
            + GT++W+ VN  +K I      VP L+  ++Y F V++V+EAG  E S  T  I     
Sbjct: 9440 EEGTTDWKRVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDI 9499

Query: 697  LATPSAPYGFALLNCG--------KNEMVIGWKPPKRRG---GGKILGYFLDQ-HDSEEL 744
               P         +C         +   VI  +P  +      GK      D  HD  E 
Sbjct: 9500 QEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPE- 9558

Query: 745  DWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGP 804
               A  +    + V  + +    H  ++   A N AG            C+   M  PGP
Sbjct: 9559 --DAQLETAENSSVIIIPECKRSHTGKYSITAKNKAG-------QKTANCRVKVMDVPGP 9609

Query: 805  PYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVS 864
            P D++ S++   S  L W+ P   G   + GY +  +    + W  V P   S T + V 
Sbjct: 9610 PKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFV-VP 9668

Query: 865  DLQPGKSYVFQVQAMNSAGLGQP------SMPTDPVLLEDKPGAHEIEVGVDEEGFIYLA 918
            DL   + Y F+V+A N  G+G P      +   DP+   D P   ++++G+  +  ++L+
Sbjct: 9669 DLLSEQQYFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPP--IKLKIGLITKNTVHLS 9726

Query: 919  FEAPE 923
            ++ P+
Sbjct: 9727 WKPPK 9731



 Score =  173 bits (439), Expect = 9e-43
 Identities = 182/737 (24%), Positives = 287/737 (38%), Gaps = 93/737 (12%)

Query: 177   VQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAH 236
             VQ  P P+VTW+K+   I+ R+       IT+  G  SL +R    +    YTV  KNA 
Sbjct: 21677 VQGRPVPRVTWFKDGVEIEKRM----NMEITDVLGSTSLFVRDATRDHRGVYTVEAKNAS 21732

Query: 237   GQASSFAKVLVRTYLGKDAG---FDSEIFKRSTFGPSVEFTSVLKPV---FAREKEPFSL 290
             G A +  KV V+   GK  G   F +   ++ T            P+      ++E   L
Sbjct: 21733 GSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRL 21792

Query: 291   SCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSP 350
             +    ED  +A+S    +             L    +   +VS   K   G         
Sbjct: 21793 AWALIEDKCEAQSYTAIK-------------LINGNEYQFRVSAVNKFGVG--------- 21830

Query: 351   FGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIE 410
                R   +  +V   +   P APG P      ++  + + LTWA P    G+ I  Y +E
Sbjct: 21831 ---RPLDSDPVVAQIQYTVPDAPGIP---EPSNITGNSITLTWARPESDGGSEIQQYILE 21884

Query: 411   RCQGESGEWI-ACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGD 469
             R + +S  W+    + P    R  + GL EG  Y F V A +  G    S  S L+    
Sbjct: 21885 RREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLI---- 21940

Query: 470   HDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEP-SPRD 528
                                       + V  P PPT V  ++  +  V L W +P     
Sbjct: 21941 -----------------------KCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGG 21977

Query: 529   RAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSE 588
                + Y +E      G W  +++E+ V++ R+ V DL+  + Y FRV A+N  G  D  E
Sbjct: 21978 MEIIGYIIEMCKADLGDWHKVNAEACVKT-RYTVTDLQAGEEYKFRVSAINGAGKGDSCE 22036

Query: 589   PSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEW-QT 647
              +  I  +       P   + A    QT V      ++    L      R   T+ W + 
Sbjct: 22037 VTGTI--KAVDRLTAPELDIDA-NFKQTHVVRAGASIR----LFIAYQGRPTPTAVWSKP 22089

Query: 648   VNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAG-----VGESSAATEPIRVKQALATPSA 702
              +N  ++    T     T    E C R  ++AG     V  +S +       + L TP  
Sbjct: 22090 DSNLSLRADIHTTDSFST-LTVENCNR--NDAGKYTLTVENNSGSKSITFTVKVLDTPGP 22146

Query: 703   PYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVS 762
             P      +  +    + W  P   GG +I  Y +++ ++    W  ++++    ++ KV+
Sbjct: 22147 PGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISEK-CTRQIFKVN 22205

Query: 763   DLHEGHFYEFRARAANWAGVGE-LSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQ 821
             DL EG  Y FR  A N  GVGE    P  +   +     QP PP  +   +   +S VL 
Sbjct: 22206 DLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATE-----QPAPPRRLDVVDTSKSSAVLA 22260

Query: 822   WEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNS 881
             W  P + G   +TGY +  +++GS+ W  V  G        V  L     Y F+V+A N 
Sbjct: 22261 WLKPDHDGGSRITGYLLEMRQKGSDFW--VEAGHTKQLTFTVERLVEKTEYEFRVKAKND 22318

Query: 882   AGLGQPSMPTDPVLLED 898
             AG  +P      V++++
Sbjct: 22319 AGYSEPREAFSSVIIKE 22335



 Score =  172 bits (437), Expect = 2e-42
 Identities = 153/644 (23%), Positives = 258/644 (40%), Gaps = 86/644 (13%)

Query: 373   PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRC 432
             PG P N R  D  R  + L W+ P D  G+ +T Y IE  + +  EW  C+  P      
Sbjct: 23728 PGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREY 23787

Query: 433   PIQGLVEGQSYRFRVRAISRVGSSVPS------KASELVVMGDHDAARRKTEIPF-DLGN 485
              +  L +G  YRFRV A +  G   P+      K +E++   D++   R  E  F   G 
Sbjct: 23788 TLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQGG 23847

Query: 486   KITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAW----EEPSPRDRAPLTYSLEKSVI 541
              I +       T+ I   P           + +  W    ++ S R     + +  + VI
Sbjct: 23848 VIRL-------TIPIKGKP-----------FPICKWTKEGQDISKRAMIATSETHTELVI 23889

Query: 542   ------GSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIAL 595
                    SGT++ +                  KK+   +VR      +  P+ P  P+  
Sbjct: 23890 KEADRGDSGTYDLVLENKC------------GKKAVYIKVRV-----IGSPNSPEGPLE- 23931

Query: 596   RGPPATLPPPAQVQAFRDTQT-SVSLTWDPVKDP---ELLGYYIYSRKVGTSEWQTVNNK 651
                            + D Q  SV ++W P  D    ++LGY +  R+V  + W T++++
Sbjct: 23932 ---------------YDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSR 23976

Query: 652   PIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFA-LLN 710
              ++GT   V GL+   EY F V + ++ G+ +   + EP+  K  L  P  P     +L+
Sbjct: 23977 -VRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVLD 24035

Query: 711   CGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFY 770
               K+ + + W  PK  GG ++ GY++++ ++    W   N+  I T +  V+ L     Y
Sbjct: 24036 VTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEY 24095

Query: 771   EFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGA 830
             +FR  A N  G+ E S  S    CK+    +P  P ++    +   S+ LQWE P   G 
Sbjct: 24096 QFRIIAQNDVGLSETSPASEPVVCKD-PFDKPSQPGELEILSISKDSVTLQWEKPECDGG 24154

Query: 831   GPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMP 890
               + GY V +++ G   WK      I      +  L     Y F+V A N  GL +P   
Sbjct: 24155 KEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRT 24214

Query: 891   TDPVLLE----DKPGAH----EIEVGVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDP 942
                +  +    + PG      ++   + E   +         PD    +W +  K  +  
Sbjct: 24215 AMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPD---IKWYRFGKELIQS 24271

Query: 943   QRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTL 986
             ++ K+        + +     ED G Y+ I T+   ++  S  L
Sbjct: 24272 RKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKL 24315



 Score =  172 bits (436), Expect = 2e-42
 Identities = 159/611 (26%), Positives = 255/611 (41%), Gaps = 65/611 (10%)

Query: 304   IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTY--KEDEGLYMVRVPSPFGPREQSTYVL 361
             + W +D      +R  ++    R  S K S T   + D G Y+V   +  G       V 
Sbjct: 11928 VAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVN 11987

Query: 362   VRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIA 421
             V D        PG   N++ +DV+ D   + W PP D  G  I  Y +E+C+ +   W +
Sbjct: 11988 VLDK-------PGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVW-S 12039

Query: 422   CHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPF 481
              + A   T    +  L+EG  Y FRVRA +++G+  P+++  ++    +D   R      
Sbjct: 12040 TYSATVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYDKPGR------ 12093

Query: 482   DLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSV 540
                                P PP     +++ +  + + W  P       +T Y LEK  
Sbjct: 12094 -------------------PDPP---EVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKE 12131

Query: 541   IGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPA 600
               S  W  ++ +S +   R  V +L     Y FRV+A N+ G+ +PS PS P+  + P  
Sbjct: 12132 KHSTRWVPVN-KSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIE 12190

Query: 601   TLPPPAQVQAFRDTQTSVSLTWD-PVKD--PELLGYYIYSR-KVGTSE----WQTVNNKP 652
                PP   +    T+ S++L W  PV D    ++GY +  R K+  +     W+  N   
Sbjct: 12191 PPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAA 12250

Query: 653   -IQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNC 711
              +    FTV  L   +EYEF V + ++ G+G  +   E I+ K+ L  P        L+ 
Sbjct: 12251 QLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEID-----LDA 12305

Query: 712   GKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYE 771
                ++VI      R G    L   +    + ++ W  V    +  R  +V  +    F  
Sbjct: 12306 SMRKLVI-----VRAGCPIRLFAIVRGRPAPKVTWRKVGIDNV-VRKGQVDLVDTMAFLV 12359

Query: 772   FRARAANWAGVGELSAPSSLFECKEW----TMPQPGPPYDVRASEVRATSLVLQWEPPLY 827
                   + +G   L+  +   E   +     +  PGP  D++ S+V  TS  + W PP  
Sbjct: 12360 IPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPEN 12419

Query: 828   MGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQP 887
              G   VT Y V  +E   + W  VTP  +  T   V++L PG  Y F+V A+N  G G P
Sbjct: 12420 DGGSQVTHYIVEKREADRKTWSTVTP-EVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVP 12478

Query: 888   SMPTDPVLLED 898
             +    PVL  D
Sbjct: 12479 TDVPKPVLASD 12489



 Score =  172 bits (435), Expect = 3e-42
 Identities = 157/594 (26%), Positives = 245/594 (41%), Gaps = 57/594 (9%)

Query: 310   GSLLRSSRRRKILYTDRQASLKVSCTYKED---EGL------YMVRVPSPFGPREQSTYV 360
             G L+    R  +L+     +L  S  Y      EGL      Y +       P + + YV
Sbjct: 12820 GYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYV 12879

Query: 361   LVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWI 420
               R    + PG P        +DV +  + L WA P    G+ I  Y +E C+    +W+
Sbjct: 12880 TAR-MPVDPPGKP------EVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWV 12932

Query: 421   ACHEAPGGTCR--CPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTE 478
              C+ AP    +      GL E   Y+FR  A + V  S PS+ S+ V           T 
Sbjct: 12933 RCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPV-----------TI 12981

Query: 479   IPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEK 538
             +  ++  +I +S  A +  +T+ +  TNV             + +P P      T S +K
Sbjct: 12982 LAENVPPRIDLSV-AMKSLLTVKAG-TNVCLD-------ATVFGKPMP------TVSWKK 13026

Query: 539   SVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGP 598
                     E I            +  + +K S  + + A N  G    +   + +   GP
Sbjct: 13027 DGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGP 13086

Query: 599   PATLPPPAQVQAFRDTQTSVSLTWDPVKDP---ELLGYYIYSRKVGTSEWQTVNNKPIQG 655
             PA+      V+  +       L+W+P  +    E+  Y +  R+     W  V+   +  
Sbjct: 13087 PAS------VKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVS-ATVPI 13139

Query: 656   TRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNE 715
             T  +V  L  G EY+F + + ++ GVG+    TEP   K     P       + N  K+ 
Sbjct: 13140 TSCSVEKLIEGHEYQFRICAENKYGVGDP-VFTEPAIAKNPYDPPGRCDPPVISNITKDH 13198

Query: 716   MVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRAR 775
             M + WKPP   GG  I GY L++ +++ ++W  VN++PI  R  K + L EG  YEFR  
Sbjct: 13199 MTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVT 13258

Query: 776   AANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTG 835
             A N AG G+ S  S     ++   P PGPP   +  +   +S+ L W  P Y G  P+ G
Sbjct: 13259 AINKAGPGKPSDASKAAYARDPQYP-PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIG 13317

Query: 836   YHVSFQEEGSEQW-KPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPS 888
             Y V  +   S+ W +   P  +  T   V+ L     Y F+V A+N  G   PS
Sbjct: 13318 YLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPS 13371



 Score =  171 bits (432), Expect = 6e-42
 Identities = 194/832 (23%), Positives = 310/832 (37%), Gaps = 116/832 (13%)

Query: 169   TTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATY 228
             T V L  TV   P P V+W K+ T + P    A   ++     L +LE+     +DS  Y
Sbjct: 13006 TNVCLDATVFGKPMPTVSWKKDGTLLKP----AEGIKMAMQRNLCTLELFSVNRKDSGDY 13061

Query: 229   TVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPF 288
             T+  +N+ G  S+  K+ V    G  A              SV+   +         EP 
Sbjct: 13062 TITAENSSGSKSATIKLKVLDKPGPPA--------------SVKINKMYSDRAMLSWEP- 13106

Query: 289   SLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVP 348
                     +   +E   +  D          ++  T    S  V    +  E  + +   
Sbjct: 13107 ------PLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAE 13160

Query: 349   SPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCL-DVNRDCLILTWAPPSDTRGNPITAY 407
             + +G  +    V    A A+NP  P    +   + ++ +D + ++W PP+D  G+PIT Y
Sbjct: 13161 NKYGVGDP---VFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGY 13217

Query: 408   TIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVM 467
              +E+ + ++  W   +  P         GL EG  Y FRV AI++ G   PS AS+    
Sbjct: 13218 LLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKA--- 13274

Query: 468   GDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPR 527
                 A  R  + P                    P PP      +   + V L+W +P+  
Sbjct: 13275 ----AYARDPQYP--------------------PGPPAFPKVYDTTRSSVSLSWGKPAYD 13310

Query: 528   DRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDP 586
               +P+  Y +E     S  W   +    ++  RF V  L +   Y FRV A+N+ G SDP
Sbjct: 13311 GGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLMEDTQYQFRVYAVNKIGYSDP 13370

Query: 587   SEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQ 646
             S+  +      P   L PP                 +   D +L    I    V    + 
Sbjct: 13371 SDVPDK---HYPKDILIPP-----------------EGELDADLRKTLILRAGVTMRLYV 13410

Query: 647   TVNNKPIQGTRFTVPGLRTGKEYEFCVRSVS-------------EAG-----VGESSAAT 688
              V  +P     ++ P +         ++S               +AG     +  S    
Sbjct: 13411 PVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKK 13470

Query: 689   EPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHA 748
             E   V + L TP  P    +    K+   + W+PP   GG  I+ Y + + D+E   W  
Sbjct: 13471 EYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWST 13530

Query: 749   VNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDV 808
             V  +   T   +V++L EG  Y FR  A N  G+G+        +  +     PGP  D+
Sbjct: 13531 VTTECSKTSF-RVANLEEGKSYFFRVFAENEYGIGDPGETRDAVKASQ----TPGPVVDL 13585

Query: 809   RASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQP 868
             +   V  +S  + W+ P   G   + GY V F  E   +W+ V             DL  
Sbjct: 13586 KVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTE-ENKWQRVMKS--LSLQYSAKDLTE 13642

Query: 869   GKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEV-GVDEEGFIYLAFEAP----- 922
             GK Y F+V A N  G G PS  T  V+  D   A ++++ G+ +    YLA E       
Sbjct: 13643 GKEYTFRVSAENENGEGTPSEIT--VVARDDVVAPDLDLKGLPD--LCYLAKENSNFRLK 13698

Query: 923   ---EAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSV 971
                +   +    W K         RV +E     + +I+ +    D G Y++
Sbjct: 13699 IPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTI 13750



 Score =  171 bits (432), Expect = 6e-42
 Identities = 199/832 (23%), Positives = 332/832 (39%), Gaps = 126/832 (15%)

Query: 177   VQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAH 236
             ++  P P+VTW K++  +  R        I N      L I  C   D+  + + ++N  
Sbjct: 14495 IKGRPAPEVTWTKDNINLKNRA------NIENTESFTLLIIPECNRYDTGKFVMTIENPA 14548

Query: 237   GQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSE 296
             G+ S F  V V                  T GP +     L+P               ++
Sbjct: 14549 GKKSGFVNVRVL----------------DTPGPVLN----LRP---------------TD 14573

Query: 297   DVLDAESIQWFRDGSLLRS-SRRRKILYTDRQASLKV---------SCTYKE---DEGL- 342
                D+ ++ W  D  L+   SR    +   R+A+ K           CTYK     EG  
Sbjct: 14574 ITKDSVTLHW--DLPLIDGGSRITNYIVEKREATRKSYSTATTKCHKCTYKVTGLSEGCE 14631

Query: 343   YMVRVPSPFGPREQSTYVLVRDAEAENP----GAPGSPLNVRCLDVNRDCLILTWAPPSD 398
             Y  RV +      ++ Y +    E   P     AP  P ++  +D+ +  + L W  P  
Sbjct: 14632 YFFRVMA------ENEYGIGEPTETTEPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKH 14685

Query: 399   TRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVP 458
               G+ IT Y IE  +  S +W       G    C ++ L EG+ Y F+V A++  G S P
Sbjct: 14686 DGGSKITGYVIEAQRKGSDQWTHITTVKG--LECVVRNLTEGEEYTFQVMAVNSAGRSAP 14743

Query: 459   SKASELVVMGDHDAARRKTEIP-FDLGN---KITISTDAFEDTVTIPSPPTNVHASEIRE 514
              ++  ++V       + +T +P  DL     K+ I+       V IP             
Sbjct: 14744 RESRPVIV-------KEQTMLPELDLRGIYQKLVIAKAGDNIKVEIP------------- 14783

Query: 515   AYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFR 574
                VL   +P+      +T+     ++     + ++ E+   S    + +  +  S  + 
Sbjct: 14784 ---VLGRPKPT------VTWKKGDQILKQT--QRVNFETTATSTILNINECVRSDSGPYP 14832

Query: 575   VRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDP---ELL 631
             + A N  G     E  + I ++      PP   ++    +   V+ +WDP ++     + 
Sbjct: 14833 LTARNIVG-----EVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPIS 14887

Query: 632   GYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPI 691
              Y +  R+  ++ W  +    I+ T +    L TG EY+F V++ +  GVG    +   I
Sbjct: 14888 NYVVEMRQTDSTTWVELATTVIR-TTYKATRLTTGLEYQFRVKAQNRYGVGPGITSA-CI 14945

Query: 692   RVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQ 751
                     P  P    +    K+ M I W  P   GG  ILGY +++ +   + W  V++
Sbjct: 14946 VANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSK 15005

Query: 752   QPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRAS 811
               +P  + K S L +G  YEFR  A N AG  + S PS      +   P PG P  +  +
Sbjct: 15006 ALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDP-PGKPVPLNIT 15064

Query: 812   EVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKS 871
                 T   L+W  P Y G   +T Y V  ++  + +W       I      VS L    +
Sbjct: 15065 RHTVT---LKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAA 15121

Query: 872   YVFQVQAMNSAG-LGQPSMPTDPVLLEDKPGAHEIEVGVD-EEGFIYLAFEA--PEAPDS 927
             Y F+V A N+AG +  PS P+D +   D   A +I+V V  ++  I  A EA   EA  S
Sbjct: 15122 YEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVS 15181

Query: 928   SE----FQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTD 975
                    +WSKD K      +++I+     + ++ K+    D G Y++  T+
Sbjct: 15182 GRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATN 15233



 Score =  170 bits (431), Expect = 8e-42
 Identities = 188/740 (25%), Positives = 291/740 (39%), Gaps = 96/740 (12%)

Query: 170   TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT 229
             T+ +   V+  P P +TW    T+    L R  +  +  +   + L+I+     D   Y 
Sbjct: 11620 TIRILARVKGRPEPDITW----TKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYI 11675

Query: 230   VRVKNA--HGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGP--SVEFTSVLKPVFAREK 285
             +  KN+  H Q S+   VL R                   GP  +++ T+V K       
Sbjct: 11676 ISAKNSSGHAQGSAIVNVLDRP------------------GPCQNLKVTNVTKE------ 11711

Query: 286   EPFSLSCLFS-EDVLD--AESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGL 342
                  +C  S E+ LD     I  F       + +   I+ +D    L  +     +E  
Sbjct: 11712 -----NCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIKANLLANNEYY 11766

Query: 343   YMVRVPSPFGPR---EQSTYVLVRDAEAENP-GAPGSPLNVRCLDVNRDCLILTWAPPSD 398
             + V   +  G     E  T +L     A NP   PG P N+   D  +  + L W  P  
Sbjct: 11767 FRVCAENKVGVGPTIETKTPIL-----AINPIDRPGEPENLHIADKGKTFVYLKWRRPDY 11821

Query: 399   TRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVP 458
               G+P  +Y +ER    S +W   H+         +   VE Q Y FRV+  +  G S  
Sbjct: 11822 DGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDW 11881

Query: 459   SKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVV 518
              K  E+VV  D     +K  +   L   +T+      DT+ +        A    + +  
Sbjct: 11882 VKTEEVVVKED----LQKPVLDLKLSGVLTVKAG---DTIRL-------EAGVRGKPFPE 11927

Query: 519   LAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAM 578
             +AW +   +D   LT S             +  ++   S +F++   ++     + V A 
Sbjct: 11928 VAWTKD--KDATDLTRS-----------PRVKIDTRADSSKFSLTKAKRSDGGKYVVTAT 11974

Query: 579   NQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDP---ELLGYYI 635
             N  G          +   GP   L     V + R T     + WDP +D    E+  Y +
Sbjct: 11975 NTAGSFVAYATVNVLDKPGPVRNLKI-VDVSSDRCT-----VCWDPPEDDGGCEIQNYIL 12028

Query: 636   YSRKVGTSEWQTVNNKPIQ-GTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVK 694
                +     W T +   +  GT  TV  L  G EY F VR+ ++ G G  + + +P+  K
Sbjct: 12029 EKCETKRMVWSTYSATVLTPGT--TVTRLIEGNEYIFRVRAENKIGTGPPTES-KPVIAK 12085

Query: 695   QALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPI 754
                  P  P    +    K EM + W PP+  GG  I GYFL++ +     W  VN+  I
Sbjct: 12086 TKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAI 12145

Query: 755   PTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVR 814
             P R  KV +L   H Y+FR +A N  G+GE S PS     K+   P PGPP + R  +  
Sbjct: 12146 PERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEP-PGPPTNFRVVDTT 12204

Query: 815   ATSLVLQWEPPLYMGAGPVTGYHVSFQEE-----GSEQWKPV-TPGPISGTHLRVSDLQP 868
               S+ L W  P+Y G  P+ GY V  + +       E WK       +      V+ L  
Sbjct: 12205 KHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDE 12264

Query: 869   GKSYVFQVQAMNSAGLGQPS 888
              + Y F+V A N  G+G+P+
Sbjct: 12265 NQEYEFRVCAQNQVGIGRPA 12284



 Score =  170 bits (430), Expect = 1e-41
 Identities = 149/565 (26%), Positives = 249/565 (44%), Gaps = 50/565 (8%)

Query: 353   PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERC 412
             P + S   + RD   + PG P        + V R+ + L W  P+   G+ IT Y +E+ 
Sbjct: 16121 PSKVSECYVARDP-CDPPGRP------EAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKK 16173

Query: 413   QGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGS-SVPSKASELVVMGDHD 471
             +   G W+             + GLVE   Y FRV A +  G  S PS+++  +      
Sbjct: 16174 ELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAIT----- 16228

Query: 472   AARRKTEIPFDLGNKITISTDA-FEDTVTIPSPPT-NVHASEIREAYVVLAWEEPSPRDR 529
              AR + + P        IS D  ++DT+ + +  +  V A    +    + W +      
Sbjct: 16229 -ARDEVDPP-------RISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGD--QE 16278

Query: 530   APLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEP 589
                T  LE       T  ++     V S  +    L+ K     R   +N   L  P  P
Sbjct: 16279 LSNTARLEIKSTDFATSLSVKDAVRVDSGNYI---LKAKNVAGERSVTVNVKVLDRPGPP 16335

Query: 590   SEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDP-VKD--PELLGYYIYSRKVGTSEWQ 646
               P+ + G                T    +L W P ++D   +++ Y +  R+     W 
Sbjct: 16336 EGPVVISGV---------------TAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVW- 16379

Query: 647   TVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGF 706
             TV +  +Q     V  L  G EY F + +V++ GVGE    +EP+  K     P AP   
Sbjct: 16380 TVVDANVQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEP-LESEPVVAKNPFVVPDAPKAP 16438

Query: 707   ALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHE 766
              +    K+ M++ W+ P   GG +ILGY L++ D E + W   +++ I     +V+ L E
Sbjct: 16439 EVTTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIE 16498

Query: 767   GHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPL 826
              H YEFR  A N AG+ E S PS+  +  +  + +PGPP + +  ++  +S+ L W  P+
Sbjct: 16499 NHDYEFRVSAENAAGLSEPSPPSAYQKACD-PIYKPGPPNNPKVIDITRSSVFLSWSKPI 16557

Query: 827   YMGAGPVTGYHVSFQEEGSEQWKPVTPGP-ISGTHLRVSDLQPGKSYVFQVQAMNSAGLG 885
             Y G   + GY V   +    +W   TP   I+ T++ V  L     Y F++ A+N AG+G
Sbjct: 16558 YDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVG 16617

Query: 886   QPSMPTDPVLLEDKPGAHEIEVGVD 910
             + +    P+++E+K  A +I++ ++
Sbjct: 16618 EHADVPGPIIVEEKLEAPDIDLDLE 16642



 Score =  169 bits (427), Expect = 2e-41
 Identities = 153/602 (25%), Positives = 252/602 (41%), Gaps = 55/602 (9%)

Query: 307   FRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGL-YMVRVPSP----FGPREQSTYVL 361
             +++ S +  S+  KIL  D Q  +KVS     DEGL Y  RV +      G   +S   +
Sbjct: 19320 YKERSSILWSKANKILIADTQ--MKVSGL---DEGLMYEYRVYAENIAGIGKCSKSCEPV 19374

Query: 362   VRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIA 421
                   + PG P         ++ R  + L W+ P    G  IT Y +ER +   G W+ 
Sbjct: 19375 PARDPCDPPGQP------EVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLK 19428

Query: 422   CHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGS-SVPSKASELVVMGDHDAARRKTEIP 480
             C+          +  L E Q Y FRV A +   S S PS+++  +++ D           
Sbjct: 19429 CNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKD----------- 19477

Query: 481   FDLGNKITISTDAFEDTVTIPSPPT-NVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKS 539
              D+     +    F D + + +     ++A        V++W     +D   +       
Sbjct: 19478 -DVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWA----KDGIEIEERARTE 19532

Query: 540   VIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPP 599
             +I +     ++ +  +R      + L  K     R  A+N   L  P  P+ P+ + G  
Sbjct: 19533 IISTDNHTLLTVKDCIRRDTGQYV-LTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGL- 19590

Query: 600   ATLPPPAQVQAFRDTQTSVSLTWD-PVKDPEL-LGYYIYSRKVGTSEWQTVNNKPIQGTR 657
                           T    SL+W  P +D    + YYI  ++  +    T+    +Q T 
Sbjct: 19591 --------------TAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQMTS 19636

Query: 658   FTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMV 717
               V  L  G EY F V  V++ GVGE   +   I+       PS P    + +  K  M 
Sbjct: 19637 CKVTKLLKGNEYIFRVTGVNKYGVGEPLESVA-IKALDPFTVPSPPTSLEITSVTKESMT 19695

Query: 718   IGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAA 777
             + W  P+  GG +I GY +++ +   L W  VN++P+     K + L EG  YE+R  A 
Sbjct: 19696 LCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAE 19755

Query: 778   NWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYH 837
             N AG+   S  S L   ++     P PP   +  +   T++ + W  PL+ G  P+TGY 
Sbjct: 19756 NAAGLSLPSETSPLIRAEDPVF-LPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYT 19814

Query: 838   VSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLE 897
             V +++     WK  +   + GT   +S L  G  YVF+V+++N  G   PS  +DP + +
Sbjct: 19815 VEYKKSDDTDWK-TSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAK 19873

Query: 898   DK 899
             ++
Sbjct: 19874 ER 19875



 Score =  169 bits (427), Expect = 2e-41
 Identities = 198/866 (22%), Positives = 338/866 (39%), Gaps = 151/866 (17%)

Query: 173   LTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRV 232
             +T   +  P P V W K DT +  R +      +       SL I      DS  YT+ +
Sbjct: 19901 MTVPFRGRPVPNVLWSKPDTDLRTRAY------VDTTDSRTSLTIENANRNDSGKYTLTI 19954

Query: 233   KNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSC 292
             +N    AS    V V                  T GP    T          ++    S 
Sbjct: 19955 QNVLSAASLTLVVKVL----------------DTPGPPTNITV---------QDVTKESA 19989

Query: 293   LFSEDVLDAESIQWFRDGSLLR--SSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVP-- 348
             + S DV + +     ++  + +  +S++  +  T+    L    T  ++  +Y  RV   
Sbjct: 19990 VLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGE 20049

Query: 349   SPFG---PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPIT 405
             + FG   P E    V + +        P  P  +    +++D + LTW  P    G+ I 
Sbjct: 20050 NEFGVGIPAETKEGVKITEK-------PSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIV 20102

Query: 406   AYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELV 465
              Y +E  +     W+ C  A   +    + GL E   Y FRV A ++ G S P +    V
Sbjct: 20103 HYVVEALEKGQKNWVKC--AVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPV 20160

Query: 466   VMGDH-------------------DAARRKTEIPFDLGN---KITISTDAFEDTVTIPSP 503
             ++ +                      +  K +IP   G    K+T+S D       +P  
Sbjct: 20161 LIKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPIS-GKPLPKVTLSRDG------VPLK 20213

Query: 504   PTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIG-SGTWEAISSESPVRSPRFAV 562
              T    +EI                   LT +L++SV   +G +E  ++ S   +  F  
Sbjct: 20214 ATMRFNTEITAEN---------------LTINLKESVTADAGRYEITAANSSGTTKAF-- 20256

Query: 563   LDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTW 622
                            +N   L  P  P+ P+ +                  T+ SV+L W
Sbjct: 20257 ---------------INIVVLDRPGPPTGPVVISDI---------------TEESVTLKW 20286

Query: 623   DPVK---DPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEA 679
             +P K     ++  Y +  R+  T+ W  V+   +  T   V  L TG+EY+F +++ +  
Sbjct: 20287 EPPKYDGGSQVTNYILLKRETSTAVWTEVS-ATVARTMMKVMKLTTGEEYQFRIKAENRF 20345

Query: 680   GVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQH 739
             G+ +   +   + VK    TP  P    + N  +  + +GW  P   GG  ++GY L+  
Sbjct: 20346 GISDHIDSA-CVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMK 20404

Query: 740   DSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPS----SLFECK 795
             D   + W   N+  I T   KV+ +  G  YEFR  A N AGVG+ S PS    ++  C+
Sbjct: 20405 DRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACE 20464

Query: 796   EWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP 855
                     PP +VR +++   S+ L W+ P + G   +TGY V  ++    +W   +   
Sbjct: 20465 --------PPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTN 20516

Query: 856   ISGTHLRVSDLQPGKSYVFQVQAMNSAG-LGQPSMPTDPVLLEDKPGAHEIEVGVD-EEG 913
             ++ T   +S L     Y F+V A N+ G +  PS    P+   D  G   I++ ++  E 
Sbjct: 20517 VTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEV 20576

Query: 914   FIYLAFEAPE------APDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLG 967
               Y A  + +         +   +W KD K       V +E+  + + +++K+    + G
Sbjct: 20577 VKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSG 20636

Query: 968   TYSVIVTDADEDISASHTLTEEELEK 993
              Y + + +A    SAS T+  + L+K
Sbjct: 20637 CYELKLRNAMG--SASATIRVQILDK 20660



 Score =  167 bits (424), Expect = 5e-41
 Identities = 199/830 (23%), Positives = 319/830 (38%), Gaps = 105/830 (12%)

Query: 173   LTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRV 232
             LT      P P+V+W+K++  +        +  I      L+LE  +    DS  Y V V
Sbjct: 10533 LTGRYSGKPKPKVSWFKDEADV----LEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVV 10588

Query: 233   KNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSC 292
             +N+ G    F +V V    G   G              V F  V K       +P     
Sbjct: 10589 ENSTGSRKGFCQVNVVDRPGPPVG-------------PVSFDEVTKDYMVISWKP----- 10630

Query: 293   LFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFG 352
                 D   ++   +  +   +       +     + + KVS   +  + ++ +   + +G
Sbjct: 10631 --PLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDYIFRIHAENLYG 10688

Query: 353   PREQSTYVLVRDAEAEN-----PGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAY 407
               +     LV D+         P AP  P+     +V +D  ++TW  P D  G PIT Y
Sbjct: 10689 ISDP----LVSDSMKAKDRFRVPDAPDQPI---VTEVTKDSALVTWNKPHD-GGKPITNY 10740

Query: 408   TIERCQGESGEWIACHEAP-GGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVV 466
              +E+ +  S  W    + P     +  +  L+EG  Y FRV A + +G   PS  S+ V 
Sbjct: 10741 ILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVF 10800

Query: 467   MGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSP 526
                                         +D +  PSPP N  A +     V L W+ P  
Sbjct: 10801 A---------------------------KDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRH 10833

Query: 527   RDRAP-LTYSLEKSVIGSGTWEAISSESPVRSP--RFAVLDLEKKKSYVFRVRAMNQYGL 583
                +  L Y +E   +G   W   ++ +P   P  ++ V  L   ++Y FRV A+N  G 
Sbjct: 10834 DGGSKILGYIVEYQKVGDEEWRR-ANHTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGE 10892

Query: 584   SDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTS 643
             SDP+   EP+ ++      PP   + A    +  +      V D   L   I        
Sbjct: 10893 SDPAHVPEPVLVK--DRLEPPELILDANMAREQHIK-----VGDTLRLSAIIKGVPFPKV 10945

Query: 644   EWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGV----GESSAATEPIRVK-QALA 698
              W+  +       R  V  +  G + E    +  + G+     E+ A ++ + VK   L 
Sbjct: 10946 TWKKEDRDAPTKARIDVTPV--GSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLD 11003

Query: 699   TPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRV 758
              P  P    +    K+   + WK P   GG  I  Y +++ D     W      P+    
Sbjct: 11004 KPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQW-----SPLSATS 11058

Query: 759   CKVS----DLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVR 814
              K S     L+EG+ Y FR  A N  G G         +  +   P PGPP D+   +V 
Sbjct: 11059 KKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHP-PGPPKDLHHVDVD 11117

Query: 815   ATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVF 874
              T + L W  P   G  P+TGY V +QEEG++ W  +    ++     V+ LQ GK+Y F
Sbjct: 11118 KTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDW--IKFKTVTNLECVVTGLQQGKTYRF 11175

Query: 875   QVQAMNSAGLGQPSMPTDPVLLEDK--PGAHEIEVGVDEEGFIYLAFEAPEAP------D 926
             +V+A N  GLG P   T P+  ++K  P + E++V +  EG +  A      P       
Sbjct: 11176 RVKAENIVGLGLPD-TTIPIECQEKLVPPSVELDVKL-IEGLVVKAGTTVRFPAIIRGVP 11233

Query: 927   SSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDA 976
                 +W+ D       +   +E     S + +K     D G Y + V++A
Sbjct: 11234 VPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNA 11283



 Score =  167 bits (422), Expect = 9e-41
 Identities = 182/748 (24%), Positives = 309/748 (41%), Gaps = 108/748 (14%)

Query: 170   TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT 229
             T+ L  T++  P P+V W K +  +  R     +  +T+++ +L ++       DS  Y 
Sbjct: 18819 TLRLFVTIKGRPEPEVKWEKAEGILTDR----AQIEVTSSFTMLVID--NVTRFDSGRYN 18872

Query: 230   VRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFS 289
             + ++N  G  ++F  V V          DS         PS      ++ V   +K+  +
Sbjct: 18873 LTLENNSGSKTAFVNVRV---------LDS---------PSAPVNLTIREV---KKDSVT 18911

Query: 290   LSCLFSEDVLDA---------ESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDE 340
             LS  +   ++D          E  +  R      ++   K  +  R  +L+  C+Y    
Sbjct: 18912 LS--WEPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKTTF--RIENLQEGCSY---- 18963

Query: 341   GLYMVRVPSPFG---PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPS 397
               + V   + +G   P E +  V V    +E P  PG    V  +DV R+   + W  P 
Sbjct: 18964 -YFRVLASNEYGIGLPAETTEPVKV----SEPPLPPG---RVTLVDVTRNTATIKWEKPE 19015

Query: 398   DTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSV 457
                G+ IT Y +E     S +W  C +    T    I GL  G+ Y FRV A++  G S 
Sbjct: 19016 SDGGSKITGYVVEMQTKGSEKWSTCTQVK--TLEATISGLTAGEEYVFRVAAVNEKGRSD 19073

Query: 458   PSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYV 517
             P +    V+  D +                       + +V +P    NV A E  +  V
Sbjct: 19074 PRQLGVPVIARDIE----------------------IKPSVELPFHTFNVKAREQLKIDV 19111

Query: 518   VLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRA 577
                      R +A + +  +   +   T   +SS   V S   ++ +  K+    + +  
Sbjct: 19112 PF-----KGRPQATVNWRKDGQTLKETTRVNVSSSKTVTS--LSIKEASKEDVGTYELCV 19164

Query: 578   MNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLG----- 632
              N  G    + P   I L  P     PP  ++    +  S++++W+P   PE  G     
Sbjct: 19165 SNSAG--SITVPITIIVLDRPG----PPGPIRIDEVSCDSITISWNP---PEYDGGCQIS 19215

Query: 633   YYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIR 692
              YI  +K  TS    + ++ +  T   +  L TG EY+F  R  +E   G+SS +     
Sbjct: 19216 NYIVEKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQF--RVCAENRYGKSSYSESSAV 19273

Query: 693   VKQALATPSAPYGFA-LLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQ 751
             V +   +P  P G   +++  K+ M++ W+ P   GG +++GY L+  +   + W   N+
Sbjct: 19274 VAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANK 19333

Query: 752   QPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRAS 811
               I     KVS L EG  YE+R  A N AG+G+ S        ++   P PG P     +
Sbjct: 19334 ILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDP-PGQP---EVT 19389

Query: 812   EVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKS 871
              +   S+ L+W  P Y G   +TGY V  +E    +W       I  T+  V++L   + 
Sbjct: 19390 NITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQR 19449

Query: 872   YVFQVQAMNSA-GLGQPSMPTDPVLLED 898
             Y F+V A N+A  + +PS  T P++++D
Sbjct: 19450 YEFRVFARNAADSVSEPSESTGPIIVKD 19477



 Score =  166 bits (421), Expect = 1e-40
 Identities = 157/618 (25%), Positives = 255/618 (41%), Gaps = 79/618 (12%)

Query: 304   IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVR 363
             ++W +   +L    R +I  T     L +    + D G Y + + +  G +     V V 
Sbjct: 18834 VKWEKAEGILTD--RAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVL 18891

Query: 364   DAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIA-C 422
             D+       P +P+N+   +V +D + L+W PP    G  IT Y +E+ +     +    
Sbjct: 18892 DS-------PSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATIT 18944

Query: 423   HEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFD 482
             +     T R  I+ L EG SY FRV A +  G  +P++ +E V + +             
Sbjct: 18945 NNCTKTTFR--IENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEP------------ 18990

Query: 483   LGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVI 541
                               P PP  V   ++      + WE+P     + +T Y +E    
Sbjct: 18991 ------------------PLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTK 19032

Query: 542   GSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRG---- 597
             GS  W   S+ + V++    +  L   + YVFRV A+N+ G SDP +   P+  R     
Sbjct: 19033 GSEKW---STCTQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIK 19089

Query: 598   PPATLP-PPAQVQAFRDTQTSVSLTWDPV------KDPELLGYYIYSRKVGTSEWQTVNN 650
             P   LP     V+A    +  V     P       KD + L     + +V  S  +TV +
Sbjct: 19090 PSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLK---ETTRVNVSSSKTVTS 19146

Query: 651   KPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLN 710
               I+       G      YE CV +        + + T PI +   L  P  P    +  
Sbjct: 19147 LSIKEASKEDVG-----TYELCVSN-------SAGSITVPITI-IVLDRPGPPGPIRIDE 19193

Query: 711   CGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFY 770
                + + I W PP+  GG +I  Y +++ ++    WH V+Q    T + K+  L  G  Y
Sbjct: 19194 VSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSI-KIVRLTTGSEY 19252

Query: 771   EFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGA 830
             +FR  A N  G    S  S++    E+    PGPP   +      +++++ W+ P+  G 
Sbjct: 19253 QFRVCAENRYGKSSYSESSAV--VAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGG 19310

Query: 831   GPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMP 890
               V GYH+ ++E  S  W       I+ T ++VS L  G  Y ++V A N AG+G+ S  
Sbjct: 19311 SRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKS 19370

Query: 891   TDPVLLE---DKPGAHEI 905
              +PV      D PG  E+
Sbjct: 19371 CEPVPARDPCDPPGQPEV 19388



 Score =  165 bits (417), Expect = 3e-40
 Identities = 191/836 (22%), Positives = 318/836 (38%), Gaps = 117/836 (13%)

Query: 177   VQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAH 236
             +   P P + W K D  +        +  I +     SL ++     DS  Y ++ KN  
Sbjct: 16262 IYGKPIPTIQWIKGDQELS----NTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVA 16317

Query: 237   GQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSE 296
             G+ S    V V    G   G            P V      +      K P         
Sbjct: 16318 GERSVTVNVKVLDRPGPPEG------------PVVISGVTAEKCTLAWKPPLQDG---GS 16362

Query: 297   DVLDAESIQWFRDGSLLRSSRRRKILYTDRQA-----SLKVSCTYKEDEGLYMVRVPSPF 351
             D+++           ++      ++++T   A     S KV+   + +E  + +   + +
Sbjct: 16363 DIINY----------IVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEYTFRIMAVNKY 16412

Query: 352   G---PREQSTYVLVRDAEAENPGA-PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAY 407
             G   P E    V      A+NP   P +P       V +D +I+ W  P+   G+ I  Y
Sbjct: 16413 GVGEPLESEPVV------AKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGY 16466

Query: 408   TIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVM 467
              +E+   E   W  CH+   G  R  + GL+E   Y FRV A +  G S PS  S     
Sbjct: 16467 VLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPS----- 16521

Query: 468   GDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPR 527
                  A +K                   D +  P PP N    +I  + V L+W +P   
Sbjct: 16522 -----AYQKAC-----------------DPIYKPGPPNNPKVIDITRSSVFLSWSKPIYD 16559

Query: 528   DRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDP 586
                 +  Y +EK  +  G W   +  + +      V  L +K  Y FR+ A+N+ G+ + 
Sbjct: 16560 GGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEH 16619

Query: 587   SEPSEPIA----LRGPPATLPPPAQVQAFRDTQTSVSLT-WDPVKD---PELLGYYIYSR 638
             ++   PI     L  P   L    +++   + +   SL  + P+K    PE+        
Sbjct: 16620 ADVPGPIIVEEKLEAPDIDLD--LELRKIINIRAGGSLRLFVPIKGRPTPEV-------- 16669

Query: 639   KVGTSEWQTVNNKPIQGTR-FTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQAL 697
             K G  + +  +   I  T  FT   L     Y+    +++      + +A   +RV   L
Sbjct: 16670 KWGKVDGEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRV---L 16726

Query: 698   ATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTR 757
              TPS P    +    K+ + I W+PP   GG KI  Y +++ ++    + AV        
Sbjct: 16727 DTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTN-CHKN 16785

Query: 758   VCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATS 817
               K+  L EG  Y FR  A N  G+G  +  +   +  E     P PP  +   +V   S
Sbjct: 16786 SWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAE----VPQPPGKITVDDVTRNS 16841

Query: 818   LVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQ 877
             + L W  P + G   +  Y V  Q + SE+W       +      +++L  G+ Y+F+V 
Sbjct: 16842 VSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSEC--ARVKSLQAVITNLTQGEEYLFRVV 16899

Query: 878   AMNSAGLGQPSMPTDPVLLED-------KP--GAHEIEVGVDEEGFIYLAFEAP-EAPDS 927
             A+N  G   P     P++ +D       KP   ++ ++VG D      L  E P      
Sbjct: 16900 AVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQD------LKIEVPISGRPK 16953

Query: 928   SEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISAS 983
                 W+KD        R+ + D ++ + + +KE   +D G Y + V +     +AS
Sbjct: 16954 PTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTAS 17009



 Score =  163 bits (413), Expect = 1e-39
 Identities = 152/616 (24%), Positives = 238/616 (38%), Gaps = 78/616 (12%)

Query: 304   IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVR 363
             + WF+DG  +      +I       SL V    ++  G+Y V   +  G  +    V V+
Sbjct: 21685 VTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQ 21744

Query: 364   DAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACH 423
             D     PG    P  +R  ++  + + L W  P +    PIT Y IE+ +     W    
Sbjct: 21745 DT----PGKVVGP--IRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIE 21798

Query: 424   EAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDL 483
             +         I+ L+ G  Y+FRV A+++ G   P  +  +V    +             
Sbjct: 21799 DKCEAQSYTAIK-LINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQY------------- 21844

Query: 484   GNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIG 542
                            T+P  P     S I    + L W  P     + +  Y LE+    
Sbjct: 21845 ---------------TVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKK 21889

Query: 543   SGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATL 602
             S  W  + S+ P+   RF V  L +   Y F V A N  G+   S  S  I  R P    
Sbjct: 21890 STRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPP 21949

Query: 603   PPPAQVQAFRDTQTSVSLTWD-PVKDP--ELLGYYIYSRKVGTSEWQTVNNKPIQGTRFT 659
              PP  V+    ++T+VSL W  PV D   E++GY I   K    +W  VN +    TR+T
Sbjct: 21950 GPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYT 22009

Query: 660   VPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIG 719
             V  L+ G+EY+F V +++ AG G+S   T  I+    L  P         N  +  +V  
Sbjct: 22010 VTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDID---ANFKQTHVV-- 22064

Query: 720   WKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKV--------SDLHEGHFYE 771
                   R G  I  +             A   +P PT V           +D+H    + 
Sbjct: 22065 ------RAGASIRLFI------------AYQGRPTPTAVWSKPDSNLSLRADIHTTDSFS 22106

Query: 772   F-------RARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEP 824
                     R  A  +    E ++ S         +  PGPP  +   +V   S  L W+ 
Sbjct: 22107 TLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDA 22166

Query: 825   PLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGL 884
             PL  G   +  Y V  +E     W+ ++    +    +V+DL  G  Y F+V A+N  G+
Sbjct: 22167 PLLDGGARIHHYVVEKREASRRSWQVISE-KCTRQIFKVNDLAEGVPYYFRVSAVNEYGV 22225

Query: 885   GQPSMPTDPVLLEDKP 900
             G+P    +P++  ++P
Sbjct: 22226 GEPYEMPEPIVATEQP 22241



 Score =  162 bits (409), Expect = 3e-39
 Identities = 184/743 (24%), Positives = 294/743 (39%), Gaps = 109/743 (14%)

Query: 177   VQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLE-IRRCAIEDSATYTVRVKNA 235
             ++  P P+V W K    +D  +  A    +T+++  L L+ + R    DS  YT+ ++N+
Sbjct: 16661 IKGRPTPEVKWGK----VDGEIRDAAIIDVTSSFTSLVLDNVNRY---DSGKYTLTLENS 16713

Query: 236   HGQASSFAKVLVRTYLGKDAGFD-SEIFKRSTF----GPSVEFTSVLKPVFAREKEPFSL 290
              G  S+F  V V            +EI K S       P ++  S +K     ++E    
Sbjct: 16714 SGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRK 16773

Query: 291   SCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSP 350
             S  ++  V +     W  D                    L+  C+Y      + V   + 
Sbjct: 16774 S--YAAVVTNCHKNSWKID-------------------QLQEGCSY-----YFRVTAENE 16807

Query: 351   FG---PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAY 407
             +G   P + +  + V    AE P  PG    +   DV R+ + L+W  P    G+ I  Y
Sbjct: 16808 YGIGLPAQTADPIKV----AEVPQPPGK---ITVDDVTRNSVSLSWTKPEHDGGSKIIQY 16860

Query: 408   TIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSS------VPSKA 461
              +E     S +W  C      + +  I  L +G+ Y FRV A++  G S      VP  A
Sbjct: 16861 IVEMQAKHSEKWSECARVK--SLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVA 16918

Query: 462   SELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAW 521
              +LV+  D   A     +      KI +           P P               + W
Sbjct: 16919 KDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGR------PKP--------------TITW 16958

Query: 522   EEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQY 581
                  +D  PL  +   +V  S     +S           + +  K     + +   N  
Sbjct: 16959 T----KDGLPLKQTTRINVTDSLDLTTLS-----------IKETHKDDGGQYGITVANVV 17003

Query: 582   GLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDP---VKDPELLGYYIYSR 638
             G    S   E + L  P    PP   V+    +  S++L+W+P       ++  Y +  R
Sbjct: 17004 GQKTAS--IEIVTLDKPD---PPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKR 17058

Query: 639   KVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAA-TEPIRVKQAL 697
                T+ W  V+   +  T   V  L+TG EY+F  R  +E   G+S A  ++PI  +   
Sbjct: 17059 DTTTTVWDVVS-ATVARTTLKVTKLKTGTEYQF--RIFAENRYGQSFALESDPIVAQYPY 17115

Query: 698   ATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTR 757
               P  P         K+ MVI W  P   GG  ++GY L++ +   + W  VN+  I   
Sbjct: 17116 KEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDT 17175

Query: 758   VCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATS 817
               K  +L EG  YEFR  A N  GVG+ S  S  +  ++   P PG P  +    V+   
Sbjct: 17176 QFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDP-PGTPEPIM---VKRNE 17231

Query: 818   LVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQ 877
             + LQW  P+Y G   +TGY V  ++    +W   +   +  T   VS L   + Y F+V 
Sbjct: 17232 ITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVI 17291

Query: 878   AMNSAG-LGQPSMPTDPVLLEDK 899
             A N+AG + +PS  T P+  +D+
Sbjct: 17292 AKNAAGAISKPSDSTGPITAKDE 17314



 Score =  162 bits (409), Expect = 3e-39
 Identities = 170/699 (24%), Positives = 266/699 (38%), Gaps = 134/699 (19%)

Query: 173   LTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRV 232
             L  +V   PPP +TW K    +  R         T +Y LL ++  +    D+  YT+  
Sbjct: 23161 LMVSVSGRPPPVITWSKQGIDLASRAI----IDTTESYSLLIVD--KVNRYDAGKYTIEA 23214

Query: 233   KNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSC 292
             +N  G+ S  A VLV+ Y               T GP          V  +E    S++ 
Sbjct: 23215 ENQSGKKS--ATVLVKVY--------------DTPGPCPS-------VKVKEVSRDSVTI 23251

Query: 293   LFSEDVLDAESIQWFRDGSLLRS---SRRRKILYTDRQASLKVSCTYKEDEGL-----YM 344
              +    +D         G+ + +    +R   +   +  + K S T     GL     Y 
Sbjct: 23252 TWEIPTIDG--------GAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYY 23303

Query: 345   VRV--PSPFG---PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDT 399
              RV   + +G   P E S  VLV +        P  P  +  +DV +  + L W  P   
Sbjct: 23304 FRVLPENIYGIGEPCETSDAVLVSEV-------PLVPAKLEVVDVTKSTVTLAWEKPLYD 23356

Query: 400   RGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPS 459
              G+ +T Y +E C+  +  W+             +  L EG+ Y FR+RA +  G S P 
Sbjct: 23357 GGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPR 23416

Query: 460   KASELVVMGD-----------------HDAARRKTEIPFDLGN----------------- 485
             +    V + D                 H  A R  E+   +                   
Sbjct: 23417 ETVTAVTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRE 23476

Query: 486   -------------KITISTDAFEDT--------------------VTIPSP--PTN-VHA 509
                          K+TI      DT                    + +  P  PT  +  
Sbjct: 23477 SERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKI 23536

Query: 510   SEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKK 568
              EI    + ++WE P     APL+ Y +E+       W  + SES  RS  F    L + 
Sbjct: 23537 DEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPV-SESVTRS-TFKFTRLTEG 23594

Query: 569   KSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKD- 627
               YVFRV A N++G+    + SE I  R       PP  +Q F  ++  ++LTW P +D 
Sbjct: 23595 NEYVFRVAATNRFGIGSYLQ-SEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDD 23653

Query: 628   --PELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESS 685
                ++ GY +  ++V    W  VN  P+  TR+   GL  G EYE  V +++  G G+ S
Sbjct: 23654 GGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPS 23713

Query: 686   AATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELD 745
               ++PI     +A P  P    + +  +  + + W  P+  GG K+ GY ++    ++ +
Sbjct: 23714 RPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHE 23773

Query: 746   WHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGE 784
             W   N  P   R   ++ L +G  Y FR  A N  G GE
Sbjct: 23774 WTKCNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGE 23812



 Score =  161 bits (407), Expect = 5e-39
 Identities = 189/778 (24%), Positives = 304/778 (39%), Gaps = 109/778 (14%)

Query: 181   PPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQAS 240
             P P VTW+K++  +  +  R       NN     L I+    ED   Y V++ N+ G+A 
Sbjct: 15870 PTPAVTWHKDNVPLK-QTTRVNAESTENNS---LLTIKDACREDVGHYVVKLTNSAGEAI 15925

Query: 241   SFAKVLVRTYLGKDAG------FDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLF 294
                 V+V    G   G        ++    S   P  +  S +      ++         
Sbjct: 15926 ETLNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKR--------- 15976

Query: 295   SEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPR 354
                  D  +  W     ++ ++  R    T +   LK  C Y+     + +   + +G  
Sbjct: 15977 -----DTSTTTW----QIVSATVART---TIKACRLKTGCEYQ-----FRIAAENRYG-- 16017

Query: 355   EQSTYVLVRDAEAENP----GAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIE 410
              +STY+      A+ P    G PG+P+       +RD + + W  P    G+ +  Y +E
Sbjct: 16018 -KSTYLNSEPTVAQYPFKVPGPPGTPVVTLS---SRDSMEVQWNEPISDGGSRVIGYHLE 16073

Query: 411   RCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDH 470
             R +  S  W+  ++ P    +    GL EG  Y FRV A + VG   PSK SE  V  D 
Sbjct: 16074 RKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARD- 16132

Query: 471   DAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRA 530
                      P D                    PP    A  +    V L W++P+    +
Sbjct: 16133 ---------PCD--------------------PPGRPEAIIVTRNSVTLQWKKPTYDGGS 16163

Query: 531   PLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGL-SDPSE 588
              +T Y +EK  +  G W   +S + +    F V  L +   Y FRV A N  G+ S+PSE
Sbjct: 16164 KITGYIVEKKELPEGRWMK-ASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSE 16222

Query: 589   PSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEW--- 645
              +  I  R     + PP      +   T V    +  K    +   IY + + T +W   
Sbjct: 16223 STGAITARD---EVDPPRISMDPKYKDTIVVHAGESFK----VDADIYGKPIPTIQWIKG 16275

Query: 646   -QTVNNK---PIQGTRF-TVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATP 700
              Q ++N     I+ T F T   ++     +     +    V    + T  ++V      P
Sbjct: 16276 DQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPP 16335

Query: 701   SAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCK 760
               P   + +   K    + WKPP + GG  I+ Y +++ ++  L W  V+   + T  CK
Sbjct: 16336 EGPVVISGVTAEK--CTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDAN-VQTLSCK 16392

Query: 761   VSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVL 820
             V+ L EG+ Y FR  A N  GVGE      +     + +P    P     + V   S+++
Sbjct: 16393 VTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPD--APKAPEVTTVTKDSMIV 16450

Query: 821   QWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMN 880
              WE P   G   + GY +  +++   +W       I    LRV+ L     Y F+V A N
Sbjct: 16451 VWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAEN 16510

Query: 881   SAGLGQPSMPT------DPVLLEDKPGAHEIEVGVD-EEGFIYLAFEAPEAPDSSEFQ 931
             +AGL +PS P+      DP+    KPG       +D     ++L++  P      E Q
Sbjct: 16511 AAGLSEPSPPSAYQKACDPIY---KPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQ 16565



 Score =  158 bits (399), Expect = 4e-38
 Identities = 183/779 (23%), Positives = 309/779 (39%), Gaps = 91/779 (11%)

Query: 327  QASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNR 386
            ++ L+V  + + D GLYM++V +  G  +    V V D        PG P+N    D+ +
Sbjct: 8458 ESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDT-------PGPPINFVFEDIRK 8510

Query: 387  DCLILTWAPPSDTRGNPITAYTIERCQGES--GEWIACHEAPGGTCRCPIQGLVEGQSYR 444
              ++  W PP D  G+ I  YT+E+        EWI         C+  +  L+EG+ Y 
Sbjct: 8511 TSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRH-CKYSVTKLIEGKEYL 8569

Query: 445  FRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPP 504
            FRVRA +R G   P  +  LV                             +D    P  P
Sbjct: 8570 FRVRAENRFGPGPPCVSKPLVA----------------------------KDPFGPPDAP 8601

Query: 505  TNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLD 564
                  ++    +++ W EP       L Y LEK  + S  W  ++ +S + + +  V  
Sbjct: 8602 DKPIVEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVN-KSLLNALKANVDG 8660

Query: 565  LEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQ-TSVSLTWD 623
            L +  +YVFRV A N  G    S PS+P     P +  PP   +    DT  T++ L W+
Sbjct: 8661 LLEGLTYVFRVCAENAAGPGKFSPPSDPKTAHDPIS--PPGPPIPRVTDTSSTTIELEWE 8718

Query: 624  PVK---DPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAG 680
            P       E++GY++  + VGT+EW     K I+  ++TV  +R G +Y+  V +V+ AG
Sbjct: 8719 PPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAG 8778

Query: 681  VGESSAATEPIRVKQALATPSAPYGFAL-----LNCGKN---EMVIGWKPPKRRGGGKIL 732
             G     T+P+ V +    P+     ++     +  GK      V+  +P   +   K  
Sbjct: 8779 EGPPGE-TQPVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEE 8837

Query: 733  GYFLDQHDSEELDWHAVNQQPIPTRV-CKVSDLHEGHFYEFRARAANWAGVGELSAPSSL 791
            G         ELD   V    + T+    + D        +   A N  G    +A   +
Sbjct: 8838 G---------ELDKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEV 8888

Query: 792  FECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPV 851
            F+        PGP  D++         +L W  P   G   +TG+ +  ++     W+  
Sbjct: 8889 FDV-------PGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQ- 8940

Query: 852  TPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGA----HEIEV 907
             P     +   ++ L  G+ Y F+V A N  G G P +   P+L  D  G       +  
Sbjct: 8941 -PIETERSKCDITGLLEGQEYKFRVIAKNKFGCGPP-VEIGPILAVDPLGPPTSPERLTY 8998

Query: 908  GVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLD-PQRVKIEDKVNKSKVILKEPGLEDL 966
                +  I L ++ P +   S  Q     K   D P   ++  ++  +   L E  L++ 
Sbjct: 8999 TERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVE-NLDEH 9057

Query: 967  GTYSVIVTDADE------DISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERG 1020
              Y   V   +E       +  +  + ++E+    KL   +R   IK+ +G  + I    
Sbjct: 9058 QMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHI--PA 9115

Query: 1021 EVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYT 1079
            +V   L + K+  +    +I    +       +++  R +   E+ I     EDKG+YT
Sbjct: 9116 DVT-GLPMPKIEWSKNETVIEKPTDALQITKEEVS--RSEAKTELSIPKAVREDKGTYT 9171



 Score =  157 bits (398), Expect = 5e-38
 Identities = 167/617 (27%), Positives = 247/617 (40%), Gaps = 70/617 (11%)

Query: 300   DAESIQW---FRDGSL------LRSSRRRKILYTDRQASLKVSCTYKED---EGL-YMVR 346
             +A SI+W   + DG        +    R  IL+        + C YK     EGL Y  R
Sbjct: 22550 NAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFR 22609

Query: 347   VPSPFGPREQSTYVLVRDAEAENP-GAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPIT 405
               +             R   A+NP  APG P      DV R  + L W+ P+   G+ + 
Sbjct: 22610 TYALNAAGVSKASEASRPIMAQNPVDAPGRP---EVTDVTRSTVSLIWSAPAYDGGSKVV 22666

Query: 406   AYTIER---CQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKAS 462
              Y IER    +   G W+ C+          +  L EG +Y FRV A +  G  V SK S
Sbjct: 22667 GYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAG--VISKGS 22724

Query: 463   ELV--VMGDHDAARRKTEIPFDL-GNKITI--STDAFEDTVTIPSPPTNVHASEIREAYV 517
             E    V    + A  K E+   L G+ +TI   +D   D      P   +          
Sbjct: 22725 ESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKI---------- 22774

Query: 518   VLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRA 577
                W +                       E +S +   +     +   ++  S  + +  
Sbjct: 22775 --IWTKGDKE---------------LDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTV 22817

Query: 578   MNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWD-PVKD--PELLGYY 634
              N  G    S   + +   GP   L         R TQ   +L W  P +D   E+  Y 
Sbjct: 22818 KNASGTKAVSVMVKVLDSPGPCGKLT------VSRVTQEKCTLAWSLPQEDGGAEITHYI 22871

Query: 635   IYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVK 694
             +  R+     W  V  +      + V  L    EY F VR+V++ G G     +EPI  +
Sbjct: 22872 VERRETSRLNWVIVEGE-CPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVP-VESEPIVAR 22929

Query: 695   QALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPI 754
              +   PS P     +  GK  ++I W  P+  GG +I  Y +D+ + + L W  VN+  +
Sbjct: 22930 NSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYV 22989

Query: 755   --PTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASE 812
                TR+ KV+ L EG  Y+FR  A N AG  E S  S+   C+E +   PGPP   R  +
Sbjct: 22990 VYDTRL-KVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYT-PGPPSAPRVVD 23047

Query: 813   VRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPV-TPGPISGTHLRVSDLQPGKS 871
                 S+ L W  P+Y G   + GY +  QE+ ++QW  V T   I  T   V DL+ G+ 
Sbjct: 23048 TTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQK 23107

Query: 872   YVFQVQAMNSAGLGQPS 888
             Y F+V A+N  G+ + S
Sbjct: 23108 YSFRVAAVNVKGMSEYS 23124



 Score =  156 bits (395), Expect = 1e-37
 Identities = 147/576 (25%), Positives = 232/576 (40%), Gaps = 75/576 (13%)

Query: 337   KEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPP 396
             + D G Y++++ +  G +     V V D        PG P N+   +V +D   L W PP
Sbjct: 17782 RNDAGKYILKLENSSGSKSAFVTVKVLDT-------PGPPQNLAVKEVRKDSAFLVWEPP 17834

Query: 397   SDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSS 456
                 G  +  Y I++ +     +         T    ++ L EG  Y FRV A +  G  
Sbjct: 17835 IIDGGAKVKNYVIDKRESTRKAYANVSSKCSKT-SFKVENLTEGAIYYFRVMAENEFGVG 17893

Query: 457   VPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAY 516
             VP +  + V   +                               PSPP  V  +++ +  
Sbjct: 17894 VPVETVDAVKAAEP------------------------------PSPPGKVTLTDVSQTS 17923

Query: 517   VVLAWEEPS-PRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRV 575
               L WE+P        L Y +E    G+  W +I +ES V +    V  L   + Y FRV
Sbjct: 17924 ASLMWEKPEHDGGSRVLGYVVEMQPKGTEKW-SIVAESKVCNA--VVTGLSSGQEYQFRV 17980

Query: 576   RAMNQYGLSDPSEPSEPIALRG----PPATLP-PPAQVQAFRDTQTSVSLTWDP------ 624
             +A N+ G SDP     P+  +     P   LP     +QA  D +  + +   P      
Sbjct: 17981 KAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISW 18040

Query: 625   VKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGES 684
             VKD E L              QT      +    TV  ++ G + +F   +V+      +
Sbjct: 18041 VKDGEPLK-------------QTTRVNVEETATSTVLHIKEGNKDDFGKYTVT--ATNSA 18085

Query: 685   SAATEPIRVKQALATPSAPYGFALLN-CGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEE 743
               ATE + V   L  P  P G    +    + +VI W+PP   GG +I  Y +++ D+  
Sbjct: 18086 GTATENLSV-IVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTT 18144

Query: 744   LDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAP-SSLFECKEWTMPQP 802
               WH V+     T + K++ L  G  Y+FR  A N  G    SAP  S     ++   +P
Sbjct: 18145 TTWHMVSATVARTTI-KITKLKTGTEYQFRIFAENRYG---KSAPLDSKAVIVQYPFKEP 18200

Query: 803   GPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLR 862
             GPP     + +    +++QW  P+  G   + GYH+  +E+ S  W  +   PI  T  +
Sbjct: 18201 GPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFK 18260

Query: 863   VSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED 898
              + L  G  Y F+V A N  G+G+PS  ++  +  D
Sbjct: 18261 TTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARD 18296



 Score =  155 bits (393), Expect = 2e-37
 Identities = 190/829 (22%), Positives = 307/829 (37%), Gaps = 96/829 (11%)

Query: 169   TTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRI-TNNYGLLSLEIRRCAIEDSAT 227
             TTV     ++  P P   W  + + I         Y + T+N+  + L I+ C   D+  
Sbjct: 11221 TTVRFPAIIRGVPVPTAKWTTDGSEIKTD----EHYTVETDNFSSV-LTIKNCLRRDTGE 11275

Query: 228   YTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEP 287
             Y + V NA G  +    + V    G   G                      P+   +  P
Sbjct: 11276 YQITVSNAAGSKTVAVHLTVLDVPGPPTG----------------------PINILDVTP 11313

Query: 288   FSLSCLFSEDVLDAES--IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMV 345
               ++  +     D  S  I +  +    R      +     +  LK+    K  E ++ V
Sbjct: 11314 EHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRV 11373

Query: 346   RVPSPFG--PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNP 403
             R  +  G  P   ST  + +  +   P  PG P+     D+  +   ++W  P    G+P
Sbjct: 11374 RAENKIGVGPPLDSTPTVAKH-KFSPPSPPGKPV---VTDITENAATVSWTLPKSDGGSP 11429

Query: 404   ITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASE 463
             IT Y +ER +  +G+W+  ++ P    +  + GL EG +Y FRV A +  G S PS +S+
Sbjct: 11430 ITGYYMERRE-VTGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSD 11488

Query: 464   LVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEE 523
              +      A R                       +  P PP N    +       L W +
Sbjct: 11489 PI-----KACR----------------------PIKPPGPPINPKLKDKSRETADLVWTK 11521

Query: 524   PSPRDRAP-LTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYG 582
             P     +P L Y +E    G+  W  I+ +  +R   F V  L +   Y FR++A N  G
Sbjct: 11522 PLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVG 11581

Query: 583   LSDPSEPSEPIALRGPPATLPPPAQVQAF-RDTQT-----SVSLTWDPVKDPELLGYYIY 636
               +P E +E +  +      PP  ++    RD  T     ++ +       PE    +  
Sbjct: 11582 EGEPRELAESVIAKD--ILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTK 11639

Query: 637   SRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQA 696
               KV   E +    + +      +         ++ + + + +G  + SA      +   
Sbjct: 11640 EGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSA------IVNV 11693

Query: 697   LATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPT 756
             L  P       + N  K    I W+ P   GG +I  + ++     +  W  V    +  
Sbjct: 11694 LDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASD-VTK 11752

Query: 757   RVCKVSDLHEGHFYEFRARAANWAGVG---ELSAPSSLFECKEWTMPQPGPPYDVRASEV 813
             R+ K + L    +Y FR  A N  GVG   E   P          + +PG P ++  ++ 
Sbjct: 11753 RLIKANLLANNEYY-FRVCAENKVGVGPTIETKTPILAIN----PIDRPGEPENLHIADK 11807

Query: 814   RATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYV 873
               T + L+W  P Y G  P   YHV  + +GS+ W+ V  G I  TH  V      + Y 
Sbjct: 11808 GKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYE 11867

Query: 874   FQVQAMNSAGLGQPSMPTDPVLLED--KPGAHEIEVGV--DEEGFIYLAFEAPEAPDSSE 929
             F+VQ  N  G        + V+ ED  KP       GV   + G               E
Sbjct: 11868 FRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPE 11927

Query: 930   FQWSKDYKGPLD---PQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTD 975
               W+KD K   D     RVKI+ + + SK  L +    D G Y V  T+
Sbjct: 11928 VAWTKD-KDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATN 11975



 Score =  155 bits (393), Expect = 2e-37
 Identities = 194/833 (23%), Positives = 328/833 (39%), Gaps = 89/833 (10%)

Query: 161   RSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRC 220
             ++H V    ++ L    Q  P P   W K D+ +  R         T+++  L++E   C
Sbjct: 22060 QTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLR----ADIHTTDSFSTLTVE--NC 22113

Query: 221   AIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPV 280
                D+  YT+ V+N  G  S    V V                  T GP         P+
Sbjct: 22114 NRNDAGKYTLTVENNSGSKSITFTVKV----------------LDTPGPP-------GPI 22150

Query: 281   FAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDR--QASLKVSCTYKE 338
               ++    S + ++   +LD  +           +SRR   + +++  +   KV+   + 
Sbjct: 22151 TFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISEKCTRQIFKVNDLAEG 22210

Query: 339   DEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSD 398
                 + V   + +G  E   Y +     A    AP   L+V  +D ++   +L W  P  
Sbjct: 22211 VPYYFRVSAVNEYGVGE--PYEMPEPIVATEQPAPPRRLDV--VDTSKSSAVLAWLKPDH 22266

Query: 399   TRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVP 458
               G+ IT Y +E  Q  S  W+        T    ++ LVE   Y FRV+A +  G S P
Sbjct: 22267 DGGSRITGYLLEMRQKGSDFWVEAGHTKQLT--FTVERLVEKTEYEFRVKAKNDAGYSEP 22324

Query: 459   SKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVV 518
              +A   V++ +       T     + N++         T+ +P                 
Sbjct: 22325 REAFSSVIIKEPQI--EPTADLTGITNQLITCKAGSPFTIDVPI---------------- 22366

Query: 519   LAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAM 578
                   S R    +T+ LE+  +     + +S  +        V D  +  S  + +   
Sbjct: 22367 ------SGRPAPKVTWKLEEMRLKE--TDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLE 22418

Query: 579   NQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKD---PELLGYYI 635
             N  G+      S  + + G P  +  P +V +   +  S  L+W   KD    E+  Y +
Sbjct: 22419 NTAGV---KTFSVTVVVIGRPGPVTGPIEVSSV--SAESCVLSWGEPKDGGGTEITNYIV 22473

Query: 636   YSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQ 695
               R+ GT+ WQ VN+  ++ T+  V  L    EY F V S +  GV +    + PI  + 
Sbjct: 22474 EKRESGTTAWQLVNSS-VKRTQIKVTHLTKYMEYSFRVSSENRFGVSK-PLESAPIIAEH 22531

Query: 696   ALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIP 755
                 PSAP    + +   N M I W+ P   GG KI+GY++++ +   + W   N+ P  
Sbjct: 22532 PFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCL 22591

Query: 756   TRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRA 815
                 KV+ L EG  Y+FR  A N AGV + S  S     +   +  PG P     ++V  
Sbjct: 22592 ECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQN-PVDAPGRP---EVTDVTR 22647

Query: 816   TSLVLQWEPPLYMGAGPVTGYHVS---FQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSY 872
             +++ L W  P Y G   V GY +      E G  +W       +S     V+ L  G +Y
Sbjct: 22648 STVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTY 22707

Query: 873   VFQVQAMNSAG-LGQPSMPTDPVLLEDK--PGAHEIEVGVDEE------GFIYLAFEAPE 923
              F+V A N+AG + + S  T PV   D+  P   E++  +  +      G   +   A  
Sbjct: 22708 EFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVG 22767

Query: 924   APDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDA 976
                  +  W+K  K     ++V ++    ++  ++K     D G Y++ V +A
Sbjct: 22768 GKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNA 22820



 Score =  153 bits (387), Expect = 1e-36
 Identities = 148/599 (24%), Positives = 246/599 (41%), Gaps = 80/599 (13%)

Query: 324   TDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLD 383
             T    SL +    + D G Y + + +  G +  S +V VR  +  +P     P+N++  +
Sbjct: 16687 TSSFTSLVLDNVNRYDSGKYTLTLENSSGTK--SAFVTVRVLDTPSP-----PVNLKVTE 16739

Query: 384   VNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIA----CHEAPGGTCRCPIQGLVE 439
             + +D + +TW PP    G+ I  Y +E+ +     + A    CH+         I  L E
Sbjct: 16740 ITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKN-----SWKIDQLQE 16794

Query: 440   GQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVT 499
             G SY FRV A +  G  +P++ ++ + + +                              
Sbjct: 16795 GCSYYFRVTAENEYGIGLPAQTADPIKVAE------------------------------ 16824

Query: 500   IPSPPTNVHASEIREAYVVLAWEEPSPRDRAP-LTYSLEKSVIGSGTWEAISSESPVRSP 558
             +P PP  +   ++    V L+W +P     +  + Y +E     S  W   S  + V+S 
Sbjct: 16825 VPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKW---SECARVKSL 16881

Query: 559   RFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRG---PPATLP--PPAQVQAFRD 613
             +  + +L + + Y+FRV A+N+ G SDP   + PI  +     P   P      VQ  +D
Sbjct: 16882 QAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQD 16941

Query: 614   TQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLR-----TGKE 668
              +  V ++  P          I   K G    QT           T   ++      G +
Sbjct: 16942 LKIEVPISGRPKPT-------ITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQ 16994

Query: 669   YEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGG 728
             Y   V +V    VG+ +A+ E + + +    P  P  F   +     + + W PP   GG
Sbjct: 16995 YGITVANV----VGQKTASIEIVTLDKP-DPPKGPVKFD--DVSAESITLSWNPPLYTGG 17047

Query: 729   GKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAP 788
              +I  Y + + D+    W  V+     T + KV+ L  G  Y+FR  A N    G+  A 
Sbjct: 17048 CQITNYIVQKRDTTTTVWDVVSATVARTTL-KVTKLKTGTEYQFRIFAEN--RYGQSFAL 17104

Query: 789   SSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQW 848
              S     ++   +PGPP    A+ +   S+V+QW  P+  G  PV GYH+  +E  S  W
Sbjct: 17105 ESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILW 17164

Query: 849   KPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLE---DKPGAHE 904
               V    I  T  +  +L+ G  Y F+V A N  G+G+ S  ++  +     D PG  E
Sbjct: 17165 TKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPE 17223



 Score =  152 bits (385), Expect = 2e-36
 Identities = 157/622 (25%), Positives = 251/622 (40%), Gaps = 76/622 (12%)

Query: 290  LSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPS 349
            L+ +   D       +WF++   L +   + I  T  Q S ++    K D+G Y + + +
Sbjct: 6712 LTMVVPYDAYPKAEAEWFKENEPLST---KTIDTTAEQTSFRILEAKKGDKGRYKIVLQN 6768

Query: 350  PFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTI 409
              G  E    + V D        PG   N+   +     + L W  P    G+ I  Y +
Sbjct: 6769 KHGKAEGFINLKVIDV-------PGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVV 6821

Query: 410  ERCQGESGEWIACHEAPGGTCRCPIQGLVEGQ-SYRFRVRAISRVGSSVPSKASELVVMG 468
            ER   +   W+   +    +C   + GL +G   Y FRV A +RVG+  P +    V   
Sbjct: 6822 ERRDIKRKTWVLATDR-AESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPV--- 6877

Query: 469  DHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRD 528
                AR K ++P                      PP NV  +++    V L WE P    
Sbjct: 6878 ---EARSKYDVP---------------------GPPLNVTITDVNRFGVSLTWEPPEYDG 6913

Query: 529  RAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFA--VLDLEKKKSYVFRVRAMNQYGLSD 585
             A +T Y +E     S  W+   +   VR+   +  V D+ + + Y FRVRA N+ G+  
Sbjct: 6914 GAEITNYVIELRDKTSIRWDTAMT---VRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGK 6970

Query: 586  PSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDP-VKD--PELLGYYIYSRKVGT 642
            PS  +  + +  P     PP  + +   TQ+SV L W+P +KD    +LGY I   + G 
Sbjct: 6971 PSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGK 7030

Query: 643  SEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPS- 701
              W   N K +    + V GL  G +Y + V + ++AGV + S    P+    A   P+ 
Sbjct: 7031 DNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTM 7090

Query: 702  --APYGFALLNCGKNEMVI-----GWKPPKRRG--GGKILGYFLDQHDSEELDWHAVNQQ 752
              + +   L     N + I     G+  P      G K+L    D+   + L  +A    
Sbjct: 7091 DLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETG-DRVKMKTLSAYA---- 7145

Query: 753  PIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASE 812
                 V   S+  +   Y  +         GE+             + +P  P +++  +
Sbjct: 7146 ---ELVISPSERSDKGIYTLKLENRVKTISGEIDVN---------VIARPSAPKELKFGD 7193

Query: 813  VRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSY 872
            +   S+ L WEPP   G  P+TGY V  +E   + W  V    ++     V DL  GK Y
Sbjct: 7194 ITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDF-VTDLEFTVPDLVQGKEY 7252

Query: 873  VFQVQAMNSAGLGQPSMPTDPV 894
            +F+V A N  G G+P+   +PV
Sbjct: 7253 LFKVCARNKCGPGEPAYVDEPV 7274



 Score =  151 bits (381), Expect = 5e-36
 Identities = 151/610 (24%), Positives = 237/610 (38%), Gaps = 73/610 (11%)

Query: 301   AESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYV 360
             A  ++W RD     S  +  I  T     L V    + D G Y++ V +  G +     V
Sbjct: 15584 APEVKWARDHG--ESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNV 15641

Query: 361   LVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWI 420
              V D        PG P +++  +V +  + LTW PP    G+ I  Y +E+ +     + 
Sbjct: 15642 RVLDT-------PGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYS 15694

Query: 421   A----CHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRK 476
                  CH+         +  L EG SY FRV A +  G  +P++ +E V   +       
Sbjct: 15695 TVATNCHKT-----SWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASER------ 15743

Query: 477   TEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAP-LTYS 535
                                     P PP  +   ++    V L+WE+P     +  L Y 
Sbjct: 15744 ------------------------PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYI 15779

Query: 536   LEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIAL 595
             +E    GS  W   ++   V+     +  L + + Y FRV A N+ G+SDP + S P+  
Sbjct: 15780 VEMQTKGSDKWATCAT---VKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIA 15836

Query: 596   RGPPATLPPPAQVQAFRDTQTSVSLTWDPVK-DPELLGYYIYSRKVGTSEWQTVNNKPIQ 654
             +     + PPA    F    T   L  + +K D   +G     R      W   N    Q
Sbjct: 15837 KD---LVIPPAFKLLF---NTFTVLAGEDLKVDVPFIG-----RPTPAVTWHKDNVPLKQ 15885

Query: 655   GTRFTVPGLRTGKEY---EFCVRSVSEAGVGESSAATEPIRVKQ--ALATPSAPYGFALL 709
              TR               + C   V    V  +++A E I       L  P  P G   +
Sbjct: 15886 TTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKM 15945

Query: 710   N-CGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGH 768
             +    + + + W PPK  GG  I  Y +++ D+    W  V+     T + K   L  G 
Sbjct: 15946 DEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTI-KACRLKTGC 16004

Query: 769   FYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYM 828
              Y+FR  A N    G+ +  +S     ++    PGPP     +     S+ +QW  P+  
Sbjct: 16005 EYQFRIAAEN--RYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPISD 16062

Query: 829   GAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPS 888
             G   V GYH+  +E  S  W  +   PI  T  + + L+ G  Y F+V A N  G+G+PS
Sbjct: 16063 GGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPS 16122

Query: 889   MPTDPVLLED 898
               ++  +  D
Sbjct: 16123 KVSECYVARD 16132



 Score =  148 bits (374), Expect = 3e-35
 Identities = 138/607 (22%), Positives = 241/607 (39%), Gaps = 76/607 (12%)

Query: 317   RRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSP 376
             R+ ++   D  A L +  + ++D G Y + + +P G  E++ +V VR  +      PG  
Sbjct: 12345 RKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAG--EKAVFVNVRVLDT-----PGPV 12397

Query: 377   LNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQG 436
              +++  DV +    ++WAPP +  G+ +T Y +E+ + +   W         T    +  
Sbjct: 12398 SDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVKKTS-FHVTN 12456

Query: 437   LVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFED 496
             LV G  Y FRV A++  G  VP                  T++P     K  +++D   +
Sbjct: 12457 LVPGNEYYFRVTAVNEYGPGVP------------------TDVP-----KPVLASDPLSE 12493

Query: 497   TVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVR 556
                 P PP  +  +E+ +    LAW  P     A +   +          +  +  S V+
Sbjct: 12494 ----PDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYSVVK 12549

Query: 557   SPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIA----LRGPPATLPPPAQVQAFR 612
                  V  L++ K Y FRV A N  G+S P E          L  P   +P    ++A +
Sbjct: 12550 DLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQITIKAGK 12609

Query: 613   DTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFC 672
               +                  ++Y +   T +W+   ++ +  +   V   +        
Sbjct: 12610 KLRIEA---------------HVYGKPHPTCKWKKGEDEVVTSSHLAVH--KADSSSILI 12652

Query: 673   VRSVSEAGVG------ESSAATEPIRVK----QALATPSAPYGFALLNCGKNEMVIGWKP 722
             ++ V+    G      E+S+ T+  ++K     A   P  P+  + ++   +   + W  
Sbjct: 12653 IKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDA--DACSLSWHI 12710

Query: 723   PKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGV 782
             P   GG  I  Y +++ D    DW         T  C+V  L  G  Y FR RA N  G+
Sbjct: 12711 PLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTS-CRVGKLIPGQEYIFRVRAENRFGI 12769

Query: 783   GE-LSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQ 841
              E L++P  +    ++    P  P + R ++V    + + W+ P   G  P+ GY +  +
Sbjct: 12770 SEPLTSPKMV---AQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERK 12826

Query: 842   EEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLE---D 898
             E  S  W       +  T    + L  G  Y F++ A+N AG   PS PT+ V      D
Sbjct: 12827 ERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVD 12886

Query: 899   KPGAHEI 905
              PG  E+
Sbjct: 12887 PPGKPEV 12893



 Score =  147 bits (371), Expect = 7e-35
 Identities = 168/753 (22%), Positives = 287/753 (38%), Gaps = 116/753 (15%)

Query: 159  PLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRI--DPRL-FRAGKYRITNNYGLLSL 215
            PL+     E  +V   C V       + W KN   +  D R+ +R  KY+         L
Sbjct: 6434 PLKDIETMEKKSVTFWCKVNRLNVT-LKWTKNGEEVPFDNRVSYRVDKYKHM-------L 6485

Query: 216  EIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTS 275
             I+ C   D   Y V      GQ  S A++L+                        EF  
Sbjct: 6486 TIKDCGFPDEGEYIVTA----GQDKSVAELLI-------------------IEAPTEFVE 6522

Query: 276  VLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCT 335
             L+     E +    SC  S +     +++W+R+G  ++  ++ K         L +   
Sbjct: 6523 HLEDQTVTEFDDAVFSCQLSRE---KANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDC 6579

Query: 336  YKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDV------NRDCL 389
              +DE  Y   V      R+    + V +   E    P   L     DV      N+D +
Sbjct: 6580 RLDDECEYACGVED----RKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKV 6635

Query: 390  ILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRA 449
             + W      R N +        QG+  + ++                 EG+ +R ++  
Sbjct: 6636 EVQWL-----RNNMVVV------QGDKHQMMS-----------------EGKIHRLQICD 6667

Query: 450  ISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHA 509
            I       P    E   +     AR K E    L     I T   +  V +  P T V  
Sbjct: 6668 IK------PRDQGEYRFIAKDKEARAKLE----LAAAPKIKTADQDLVVDVGKPLTMVVP 6717

Query: 510  SEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKK 569
             +   AY            +A   +  E   + + T +  + ++      F +L+ +K  
Sbjct: 6718 YD---AY-----------PKAEAEWFKENEPLSTKTIDTTAEQTS-----FRILEAKKGD 6758

Query: 570  SYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWD-PVKD- 627
               +++   N++G ++     + I + GP   L      +        VSL W+ P+ D 
Sbjct: 6759 KGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNL------EVTETFDGEVSLAWEEPLTDG 6812

Query: 628  -PELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGK-EYEFCVRSVSEAGVGESS 685
              +++GY +  R +    W    ++  +   FTV GL+ G  EY F V + +  G GE  
Sbjct: 6813 GSKIIGYVVERRDIKRKTWVLATDRA-ESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPV 6871

Query: 686  AATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELD 745
                P+  +     P  P    + +  +  + + W+PP+  GG +I  Y ++  D   + 
Sbjct: 6872 ETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIR 6931

Query: 746  WHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPP 805
            W              V+D+ EG  Y FR RA N  GVG+ SA +   +  +  + +P PP
Sbjct: 6932 WDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVAD-PIERPSPP 6990

Query: 806  YDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSD 865
             ++ +S+   +S+ L+WEPPL  G  P+ GY +   EEG + W       +     +V+ 
Sbjct: 6991 VNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTG 7050

Query: 866  LQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED 898
            L+ G  Y+++V A N AG+  PS    P+  +D
Sbjct: 7051 LEKGNKYLYRVSAENKAGVSDPSEILGPLTADD 7083



 Score =  145 bits (365), Expect = 4e-34
 Identities = 186/848 (21%), Positives = 322/848 (37%), Gaps = 115/848 (13%)

Query: 165   VWEHTTVLLTCTVQASPPPQVTWYKNDTRI----DPRLF--RAGKYRITNNYGLLSLEIR 218
             V E T V +   ++  P P +TW+K   +     +P L+     K  + +   L+  + R
Sbjct: 9823  VEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSR 9882

Query: 219   RCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLK 278
             R    D+  YT+   N  G AS   ++ V    G   G              ++F SV  
Sbjct: 9883  R---SDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVG-------------PIKFESV-- 9924

Query: 279   PVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTY-- 336
                    +  +LS    +D   ++   +  +    R + R+  ++   +      CTY  
Sbjct: 9925  -----SADQMTLSWFPPKDDGGSKITNYVIEK---REANRKTWVHVSSEPK---ECTYTI 9973

Query: 337   ----KEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENP----GAPGSPLNVRCLDVNRDC 388
                 +  E ++ +   + +G  E        D+E E        PG+P       V R+ 
Sbjct: 9974  PKLLEGHEYVFRIMAQNKYGIGEPL------DSEPETARNLFSVPGAPDKPTVSSVTRNS 10027

Query: 389   LILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQ----GLVEGQSYR 444
             + + W  P    G+P+T Y +E     S  W   +  P       +     GL+EG  Y+
Sbjct: 10028 MTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQ 10087

Query: 445   FRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPP 504
             FRV AI+  G    S  S      D   AR                     D +  P PP
Sbjct: 10088 FRVYAINAAGVGPASLPS------DPATAR---------------------DPIAPPGPP 10120

Query: 505   TNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVL 563
                  ++  ++   L W  P     + +T Y +E    G   WE    +  VR  +  V 
Sbjct: 10121 FP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEK-GKDKEVRGTKLVVT 10178

Query: 564   DLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVS---- 619
              L++   Y FRVRA+N  G+ +P E ++ I ++     + P  Q+ A    +  V     
Sbjct: 10179 GLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKD--RLVSPDLQLDASVRDRIVVHAGGV 10236

Query: 620   ---LTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSV 676
                + +   K P  + + +  R +   +  T+    I  +   +   +   +  + + + 
Sbjct: 10237 IRIIAYVSGKPPPTVTWNMNERTL--PQEATIETTAISSS-MVIKNCQRSHQGVYSLLAK 10293

Query: 677   SEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFL 736
             +EAG  + +   + + V   + TP     F   N       + W  P+  GG  I  Y +
Sbjct: 10294 NEAGERKKTIIVDVLDVPGPVGTP-----FLAHNLTNESCKLTWFSPEDDGGSPITNYVI 10348

Query: 737   DQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKE 796
             ++ +S+   W  V    +  +   V  L +G  Y FR  A N  G+G     S     +E
Sbjct: 10349 EKRESDRRAWTPVTYT-VTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIRE 10407

Query: 797   WTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPI 856
               +  P  P D+   EV   ++ L W PP Y G   +  Y +  +  G+E++  VT   +
Sbjct: 10408 -PITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNL 10466

Query: 857   SGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDK---PGAH-----EIEVG 908
                   V  L+ G +Y ++V A+N  G G+PS  T P+  +D+   P  H     ++ + 
Sbjct: 10467 LSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIR 10526

Query: 909   VDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGT 968
             V E   +   +     P  S   W KD    L+  R  I+       +   +    D G 
Sbjct: 10527 VGEAFALTGRYSGKPKPKVS---WFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGK 10583

Query: 969   YSVIVTDA 976
             Y V+V ++
Sbjct: 10584 YCVVVENS 10591



 Score =  143 bits (360), Expect = 1e-33
 Identities = 145/603 (24%), Positives = 242/603 (40%), Gaps = 65/603 (10%)

Query: 308   RDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEA 367
             RDG  L+++ R     T    ++ +  +   D G Y +   +  G  +    ++V D   
Sbjct: 20207 RDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIVVLD--- 20263

Query: 368   ENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPG 427
               PG P  P+ +   D+  + + L W PP    G+ +T Y + + +  +  W        
Sbjct: 20264 -RPGPPTGPVVIS--DITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVA 20320

Query: 428   GTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDH-DAARRKTEIPFDLGNK 486
              T    +  L  G+ Y+FR++A +R G S            DH D+A    ++P+     
Sbjct: 20321 RTMM-KVMKLTTGEEYQFRIKAENRFGIS------------DHIDSACVTVKLPY----- 20362

Query: 487   ITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEP-SPRDRAPLTYSLEKSVIGSGT 545
                         T P PP+    + +    + + W EP S    A + Y LE     S  
Sbjct: 20363 ------------TTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSIL 20410

Query: 546   WEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPP 605
             W+  +++  +R+  F V  +     Y FRV A N  G+  PS PSEP+          PP
Sbjct: 20411 WQK-ANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAID---ACEPP 20466

Query: 606   AQVQAFRDTQTSVSLTW-DPVKD--PELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPG 662
               V+    ++ SVSL+W  P  D   ++ GY +  R +    W   +   +  T+F + G
Sbjct: 20467 RNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISG 20526

Query: 663   LRTGKEYEFCVRSVSEAG-VGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWK 721
             L    +YEF V + +  G +   S    PI    +   P            K     G  
Sbjct: 20527 LTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYR--AGTS 20584

Query: 722   PPKRRG-GGKILGYFLDQHDSEELDWHAV----NQQPIPTRVCKVSDLHEGHFYEFRARA 776
                R G  GK         D +EL  +A+    N   + + + K +D      YE + R 
Sbjct: 20585 VKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRN 20644

Query: 777   ANWAGVGELSAPSSLFECKEWTMPQPGPP-YDVRASEVRATSLVLQWEPPLYMGAGPVTG 835
             A    +G  SA       +   + +PGPP   +    V A  + L W PP   G   +T 
Sbjct: 20645 A----MGSASA-----TIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITH 20695

Query: 836   YHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVL 895
             Y V  +E     W  V+   +    +  + +  G  Y+F+V+A+N  G+G+P + +D V+
Sbjct: 20696 YIVEKRETSRVVWSMVSE-HLEECIITTTKIIKGNEYIFRVRAVNKYGIGEP-LESDSVV 20753

Query: 896   LED 898
              ++
Sbjct: 20754 AKN 20756



 Score =  141 bits (355), Expect = 5e-33
 Identities = 165/692 (23%), Positives = 269/692 (38%), Gaps = 113/692 (16%)

Query: 303   SIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLV 362
             ++ W +DG  L+ + R  +  +    SL +    KED G Y + V +  G       ++V
Sbjct: 19120 TVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIV 19179

Query: 363   RDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIAC 422
              D     PG PG    +R  +V+ D + ++W PP    G  I+ Y +E+ +  S  W   
Sbjct: 19180 LD----RPGPPGP---IRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIV 19232

Query: 423   HEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPS----------------------- 459
              +A   T    I  L  G  Y+FRV A +R G S  S                       
Sbjct: 19233 SQAVARTS-IKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVV 19291

Query: 460   ---KASELV------------VMGDHDAARRKTEIPFDLGNKITISTDAFE--------- 495
                K++ LV            V+G H   + ++ I +   NKI I+    +         
Sbjct: 19292 HATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLM 19351

Query: 496   ------------------DTVTIPS-----PPTNVHASEIREAYVVLAWEEPSPRDRAPL 532
                                   +P+     PP     + I    V L W +P     A +
Sbjct: 19352 YEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKI 19411

Query: 533   T-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQY-GLSDPSEPS 590
             T Y +E+  +  G W   +  + ++   F V +L + + Y FRV A N    +S+PSE +
Sbjct: 19412 TGYIVERRELPDGRWLKCNYTN-IQETYFEVTELTEDQRYEFRVFARNAADSVSEPSEST 19470

Query: 591   EPIALRGPPATLPPPAQVQA-FRDTQTSVSLTWDPVKDPELLGYY--IYSRKVGTSEWQT 647
              PI ++      PP   +   FRD           VK  E+L     I  R +    W  
Sbjct: 19471 GPIIVKDDVE--PPRVMMDVKFRDVIV--------VKAGEVLKINADIAGRPLPVISWAK 19520

Query: 648   VNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGE------SSAATEPIRVK-QALATP 700
                +  +  R  +  + T       V+       G+      + A T  + V  + L  P
Sbjct: 19521 DGIEIEERARTEI--ISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKP 19578

Query: 701   SAPYGFALLN-CGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVC 759
               P G   +N     +  + W  P+  GG  I  Y +++ ++  L W  + +  +    C
Sbjct: 19579 GPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAW-TICEGELQMTSC 19637

Query: 760   KVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLV 819
             KV+ L +G+ Y FR    N  GVGE     ++     +T+P P  P  +  + V   S+ 
Sbjct: 19638 KVTKLLKGNEYIFRVTGVNKYGVGEPLESVAIKALDPFTVPSP--PTSLEITSVTKESMT 19695

Query: 820   LQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAM 879
             L W  P   G   ++GY +  +E+ S +W  V   P+    ++ + L+ G  Y ++V A 
Sbjct: 19696 LCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAE 19755

Query: 880   NSAGLGQPSMPT------DPVLLEDKPGAHEI 905
             N+AGL  PS  +      DPV L   P   +I
Sbjct: 19756 NAAGLSLPSETSPLIRAEDPVFLPSPPSKPKI 19787



 Score =  140 bits (353), Expect = 9e-33
 Identities = 178/759 (23%), Positives = 305/759 (40%), Gaps = 100/759 (13%)

Query: 173   LTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRV 232
             L+C +   P P + WY    R    L ++ KY+++++    +L +     ED   YT   
Sbjct: 24247 LSCQIVGRPLPDIKWY----RFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIA 24302

Query: 233   KNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSC 292
              N  G+  + +K+L++       G+     K   +G +V  T  L  ++     P     
Sbjct: 24303 TNEVGEVETSSKLLLQATPQFHPGYP---LKEKYYG-AVGSTLRLHVMYIGRPVP----- 24353

Query: 293   LFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKV-SCTYKEDEGLYMVRVPSPF 351
                       ++ WF    LL++S    I  T+    L + +   K   G Y V++ + F
Sbjct: 24354 ----------AMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVF 24403

Query: 352   GPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIER 411
             G  +    V ++D     P  P  P+ +  L  N    +++W PP+D  G+ IT Y +E+
Sbjct: 24404 GTVDAILDVEIQD----KPDKPTGPIVIEALLKNS--AVISWKPPADDGGSWITNYVVEK 24457

Query: 412   CQGESG-EWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDH 470
             C+ + G EW     A   T  C I  L E   Y FRV A +  G S P + S +V++   
Sbjct: 24458 CEAKEGAEWQLVSSAISVT-TCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVII--- 24513

Query: 471   DAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRA 530
                    + PF+                  P  P     + + +   V+AW+ P+    A
Sbjct: 24514 -------KSPFEK-----------------PGAPGKPTITAVTKDSCVVAWKPPASDGGA 24549

Query: 531   PL-TYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEP 589
              +  Y LEK       W ++++E  +R   F+V +L +   Y FRV+  N  G S+ SE 
Sbjct: 24550 KIRNYYLEKREKKQNKWISVTTEE-IRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEI 24608

Query: 590   SEPIALRGPPATLPPPAQVQAFRDT--------QTSVSLTWDPVKDPELLGYYIYSRKVG 641
             SEPI  +        P Q   F++         Q++ +L       P+ +  +    K  
Sbjct: 24609 SEPITPKS-----DVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEI 24663

Query: 642   TSEWQTVNNKPIQG--TRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALAT 699
              ++      +  +G   +  +  +       + VR+ ++ G    +A+ E + V   +  
Sbjct: 24664 IADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLE-VEVPAKIHL 24722

Query: 700   PSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTR-- 757
             P    G   ++  + E V+  K P       ++ +       ++L  +  + Q I TR  
Sbjct: 24723 PKTLEGMGAVHALRGE-VVSIKIPFSGKPDPVITW----QKGQDLIDNNGHYQVIVTRSF 24777

Query: 758   ----VCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEV 813
                      +  +  FY   A+  N  G+ + +    + +        P PP  V+ S+V
Sbjct: 24778 TSLVFPNGVERKDAGFYVVCAK--NRFGIDQKTVELDVADV-------PDPPRGVKVSDV 24828

Query: 814   RATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYV 873
                S+ L W  P   G   +T Y V      +E+W  V  G    T   V +L    SY 
Sbjct: 24829 SRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRV--GQARETRYTVINLFGKTSYQ 24886

Query: 874   FQVQAMNSAGLGQPSMPTDPVLL-EDKPGAHEIEVGVDE 911
             F+V A N  GL +PS P++P +  EDK  A   +  VDE
Sbjct: 24887 FRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDE 24925



 Score =  139 bits (351), Expect = 1e-32
 Identities = 175/744 (23%), Positives = 286/744 (38%), Gaps = 101/744 (13%)

Query: 213   LSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVE 272
             L+  + R   +    + V+ KN  G            Y      F S I K     P+ +
Sbjct: 22296 LTFTVERLVEKTEYEFRVKAKNDAG------------YSEPREAFSSVIIKEPQIEPTAD 22343

Query: 273   FTSVLKPVFA-REKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLK 331
              T +   +   +   PF++    S     A  + W  +   L+ + R  I  T  + +L 
Sbjct: 22344 LTGITNQLITCKAGSPFTIDVPISGR--PAPKVTWKLEEMRLKETDRVSITTTKDRTTLT 22401

Query: 332   VSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLIL 391
             V  + + D G Y + + +  G +  S  V+V       PG    P+ V    V+ +  +L
Sbjct: 22402 VKDSMRGDSGRYFLTLENTAGVKTFSVTVVV----IGRPGPVTGPIEVS--SVSAESCVL 22455

Query: 392   TWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAIS 451
             +W  P D  G  IT Y +E+ +  +  W   + +   T +  +  L +   Y FRV + +
Sbjct: 22456 SWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRT-QIKVTHLTKYMEYSFRVSSEN 22514

Query: 452   RVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASE 511
             R G S P +++ ++            E PF                   PS PT      
Sbjct: 22515 RFGVSKPLESAPII-----------AEHPF-----------------VPPSAPTRPEVYH 22546

Query: 512   IREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKS 570
             +    + + WEEP     + +  Y +EK    +  W    ++ P     + V  L +   
Sbjct: 22547 VSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILW-VKENKVPCLECNYKVTGLVEGLE 22605

Query: 571   YVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWD-PVKD-- 627
             Y FR  A+N  G+S  SE S PI  + P   +  P + +    T+++VSL W  P  D  
Sbjct: 22606 YQFRTYALNAAGVSKASEASRPIMAQNP---VDAPGRPEVTDVTRSTVSLIWSAPAYDGG 22662

Query: 628   PELLGYYIYSR---KVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGV-GE 683
              +++GY I  +   +VG   W   N   +    FTV  L  G  YEF V + + AGV  +
Sbjct: 22663 SKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISK 22722

Query: 684   SSAATEPIRVKQALATPSAPYGFAL------LNCGKN---EMVIGWKPPKR---RGGGKI 731
              S +T P+  +   A P A     L      +  G +   +  +G KP  +     G K 
Sbjct: 22723 GSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDK- 22781

Query: 732   LGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSL 791
                 LD  +   L +         T V K  D  +   Y    +  N +G   +S    +
Sbjct: 22782 ---ELDLCEKVSLQYTGKR----ATAVIKFCDRSDSGKYTLTVK--NASGTKAVSVMVKV 22832

Query: 792   FECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPV 851
              +        PGP   +  S V      L W  P   G   +T Y V  +E     W  +
Sbjct: 22833 LD-------SPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNW-VI 22884

Query: 852   TPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVL------LEDKPGAHEI 905
               G        V+ L     Y+F+V+A+N  G G P + ++P++      +   PG  E 
Sbjct: 22885 VEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVP-VESEPIVARNSFTIPSPPGIPE- 22942

Query: 906   EVGVDEEGFIYLAFEAPEAPDSSE 929
             EVG  +E  I + +  PE+   +E
Sbjct: 22943 EVGTGKE-HIIIQWTKPESDGGNE 22965



 Score =  139 bits (349), Expect = 3e-32
 Identities = 185/823 (22%), Positives = 318/823 (38%), Gaps = 100/823 (12%)

Query: 181   PPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQAS 240
             PPP VTW K++  +        +Y I N      L I +    D+  Y + ++N  G+  
Sbjct: 20994 PPPTVTWRKDEKNLGSD----ARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEP- 21048

Query: 241   SFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFT-SVLKPVFAREKEPFSLSCLFSEDVL 299
                                   K ST    V  T +  + +  +     +++ L+   ++
Sbjct: 21049 ----------------------KSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLI 21086

Query: 300   DAES--IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQ- 356
             D  S  I +  +           + +     S K+    ++    + V   +  G  E  
Sbjct: 21087 DGGSPIINYVIEKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPC 21146

Query: 357   STYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGES 416
              T   V+ AE     AP   L+++  D  +  +IL+W  P    G+ IT Y +ER +G+ 
Sbjct: 21147 ETTEPVKAAEVP---APIRDLSMK--DSTKTSVILSWTKPDFDGGSVITEYVVER-KGK- 21199

Query: 417   GEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRK 476
             GE    H     TC   +  L E     FRV A +  G S P     + V          
Sbjct: 21200 GEQTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITV---------- 21249

Query: 477   TEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWE-EPSP-----RDRA 530
                      ++ I+ +   D   IP     V        ++ L ++ +P P     +D  
Sbjct: 21250 --------KELIITPEV--DLSDIPGAQVTVRIGH--NVHLELPYKGKPKPSISWLKDGL 21297

Query: 531   PLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPS 590
             PL  S           E +           ++ + +K+    + V   N   +   + P 
Sbjct: 21298 PLKES-----------EFVRFSKTENKITLSIKNAKKEHGGKYTVILDN--AVCRIAVPI 21344

Query: 591   EPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDP---ELLGYYIYSRKVGTSEWQT 647
               I L GPP+    P +    +    SV L+WD  +D    E+  Y I  R+   + W+ 
Sbjct: 21345 TVITL-GPPSKPKGPIRFDEIK--ADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKM 21401

Query: 648   VNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFA 707
             V +  +  T F VP L    EY+F VR+ +  GV +   ++  I  K     P  P    
Sbjct: 21402 VCSS-VARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSSI-IVAKHQFRIPGPPGKPV 21459

Query: 708   LLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEG 767
             + N   + M + W  P   GG ++ G+ +++ +   + W  VN  PI  R  + + L EG
Sbjct: 21460 IYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEG 21519

Query: 768   HFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLY 827
               Y+FR  A N AG+   S PS  F      +  PG P  +   +V   ++ L+W PPL 
Sbjct: 21520 LDYQFRVYAENSAGLSSPSDPSK-FTLAVSPVDPPGTPDYI---DVTRETITLKWNPPLR 21575

Query: 828   MGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAG-LGQ 886
              G   + GY +  + +G+E+W       +S     V+ L PG  Y F++ A N+ G +  
Sbjct: 21576 DGGSKIVGYSIE-KRQGNERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISP 21634

Query: 887   PSMPTDPVLLEDKPGAHEIEVGVDE-EGFIYLAFEA------PEAPDSSEFQWSKDYKGP 939
             PS  +  ++  D+     +E G +  +G I  + E+       +        W KD    
Sbjct: 21635 PSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEI 21694

Query: 940   LDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISA 982
                  ++I D +  + + +++   +  G Y+V   +A     A
Sbjct: 21695 EKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKA 21737



 Score =  135 bits (341), Expect = 2e-31
 Identities = 214/959 (22%), Positives = 379/959 (39%), Gaps = 115/959 (11%)

Query: 169   TTVLLTCT----------VQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIR 218
             T  L+TC           +   P P+VTW   + R+        +  IT      +L ++
Sbjct: 22348 TNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLK----ETDRVSITTTKDRTTLTVK 22403

Query: 219   RCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLK 278
                  DS  Y + ++N  G  +    V+V    G   G              +E +SV  
Sbjct: 22404 DSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTG-------------PIEVSSV-- 22448

Query: 279   PVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKE 338
                    E   LS    +D    E   +  +     ++  + +  + ++  +KV+   K 
Sbjct: 22449 -----SAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKY 22503

Query: 339   DEGLYMVRVPSPFG---PREQSTYVLVRDAEAENPGAPGS-PLNVRCLDVNRDCLILTWA 394
              E  + V   + FG   P E +  +      AE+P  P S P       V+ + + + W 
Sbjct: 22504 MEYSFRVSSENRFGVSKPLESAPII------AEHPFVPPSAPTRPEVYHVSANAMSIRWE 22557

Query: 395   PPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVG 454
              P    G+ I  Y +E+ +  +  W+  ++ P   C   + GLVEG  Y+FR  A++  G
Sbjct: 22558 EPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAG 22617

Query: 455   SSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVT-IPSPPTNVHASEIR 513
              S  S+AS  ++  +   A  + E+           TD    TV+ I S P     S++ 
Sbjct: 22618 VSKASEASRPIMAQNPVDAPGRPEV-----------TDVTRSTVSLIWSAPAYDGGSKV- 22665

Query: 514   EAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVF 573
               Y++         +R P+      S +G G W    + + V    F V  L +  +Y F
Sbjct: 22666 VGYII---------ERKPV------SEVGDGRW-LKCNYTIVSDNFFTVTALSEGDTYEF 22709

Query: 574   RVRAMNQYG-LSDPSEPSEPIALRGPPATLPPPAQVQA-FRDTQTSVSLTWDPVKDPELL 631
             RV A N  G +S  SE + P+  R   A  PP A++ A       ++    D V D  + 
Sbjct: 22710 RVLAKNAAGVISKGSESTGPVTCRDEYA--PPKAELDARLHGDLVTIRAGSDLVLDAAVG 22767

Query: 632   G----YYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVS--EAGVGESS 685
             G      I+++  G  E        +Q T     G R     +FC RS S       +++
Sbjct: 22768 GKPEPKIIWTK--GDKELDLCEKVSLQYT-----GKRATAVIKFCDRSDSGKYTLTVKNA 22820

Query: 686   AATEPIRVKQALATPSAPYG-FALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEEL 744
             + T+ + V   +     P G   +    + +  + W  P+  GG +I  Y +++ ++  L
Sbjct: 22821 SGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRL 22880

Query: 745   DWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQ-PG 803
             +W  V  +  PT    V+ L + + Y FR RA N  G G       +     +T+P  PG
Sbjct: 22881 NWVIVEGE-CPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPG 22939

Query: 804   PPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPG-PISGTHLR 862
              P +V   +     +++QW  P   G   ++ Y V  +E+ S +W  V     +  T L+
Sbjct: 22940 IPEEVGTGK---EHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLK 22996

Query: 863   VSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED---KPGAHEIEVGVD-EEGFIYLA 918
             V+ L  G  Y F+V A+N+AG  +PS  ++ +   +    PG       VD  +  I LA
Sbjct: 22997 VTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLA 23056

Query: 919   FEAP---EAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTD 975
             +  P      D   +      K      RV     +  ++  + +  +    ++ V   +
Sbjct: 23057 WTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVN 23116

Query: 976   ADEDISASHTLTE-EELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPA 1034
                    S ++ E E +E+++    E+ + + K ++     I     +RL + V    P 
Sbjct: 23117 VKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVT-----IRAGASLRLMVSVSGRPPP 23171

Query: 1035  AELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITL 1093
                 +I  +K+     +R I  D  +    +I+  ++  D G YT + ++   K   T+
Sbjct: 23172 ----VITWSKQGIDLASRAI-IDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATV 23225



 Score =  120 bits (301), Expect = 9e-27
 Identities = 179/830 (21%), Positives = 305/830 (36%), Gaps = 90/830 (10%)

Query: 171   VLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTV 230
             + L   V+  P P+VTW K    ID  + R G+  + +    L   I     +DS  Y++
Sbjct: 12319 IRLFAIVRGRPAPKVTWRK--VGID-NVVRKGQVDLVDTMAFLV--IPNSTRDDSGKYSL 12373

Query: 231   RVKNAHGQASSFAKVLVRTYLGKDAGFD-SEIFKRSTFGPSVEFTSVLKPVFAREKEPFS 289
              + N  G+ + F  V V    G  +    S++ K S         S   P    E +  S
Sbjct: 12374 TLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCH------VSWAPP----ENDGGS 12423

Query: 290   LSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPS 349
                 +  +  +A+   W              +    ++ S  V+     +E  + V   +
Sbjct: 12424 QVTHYIVEKREADRKTW------------STVTPEVKKTSFHVTNLVPGNEYYFRVTAVN 12471

Query: 350   PFGPREQSTY---VLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITA 406
              +GP   +     VL  D  +E    P  P  +   ++ ++   L W PP    G  I  
Sbjct: 12472 EYGPGVPTDVPKPVLASDPLSE----PDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDG 12527

Query: 407   YTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVV 466
             Y     + E         +        + GL EG+ Y+FRV A + VG S+P +A     
Sbjct: 12528 YITSYREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAE---- 12583

Query: 467   MGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSP 526
              G ++A  +       +  +ITI                 + A    + +    W++   
Sbjct: 12584 -GVYEAKEQLLPPKILMPEQITIKA----------GKKLRIEAHVYGKPHPTCKWKKG-- 12630

Query: 527   RDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDP 586
                       E  V+ S       ++S   S    + D+ +K S  + + A N  G    
Sbjct: 12631 ----------EDEVVTSSHLAVHKADS---SSILIIKDVTRKDSGYYSLTAENSSGTDTQ 12677

Query: 587   SEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWD-PVKD--PELLGYYIYSRKVGTS 643
                   +   GPP    PP  +        + SL+W  P++D    +  Y +    V   
Sbjct: 12678 KIKVVVMDAPGPPQ---PPFDISDI--DADACSLSWHIPLEDGGSNITNYIVEKCDVSRG 12732

Query: 644   EWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQ-ALATPSA 702
             +W T     +  T   V  L  G+EY F VR+ +  G+ E    T P  V Q     PS 
Sbjct: 12733 DWVTALAS-VTKTSCRVGKLIPGQEYIFRVRAENRFGISEP--LTSPKMVAQFPFGVPSE 12789

Query: 703   PYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVS 762
             P    +    K+ + + W  P   GG  I+GY +++ +   L W   N   + +     +
Sbjct: 12790 PKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVKANDTLVRSTEYPCA 12849

Query: 763   DLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQW 822
              L EG  Y FR  A N AG    S P+     +    P PG P  +   +V  +++ L W
Sbjct: 12850 GLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDP-PGKPEVI---DVTKSTVSLIW 12905

Query: 823   EPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP--ISGTHLRVSDLQPGKSYVFQVQAMN 880
               P + G   + GY V   +   ++W      P  I       + L+    Y F+  A  
Sbjct: 12906 ARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIART 12965

Query: 881   SAGLGQPSMPTDPVLLEDKPGAHEIEVGVDEEGFIYLAFEAPEAPDSSEF-------QWS 933
             +  +  PS P+DPV +  +     I++ V  +  + +        D++ F        W 
Sbjct: 12966 AVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWK 13025

Query: 934   KDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISAS 983
             KD       + +K+  + N   + L     +D G Y++   ++    SA+
Sbjct: 13026 KDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSAT 13075



 Score =  110 bits (274), Expect = 1e-23
 Identities = 170/767 (22%), Positives = 290/767 (37%), Gaps = 128/767 (16%)

Query: 171   VLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTV 230
             + LT  ++  P P   W K    I  R   A     T       L I+     DS TY +
Sbjct: 23849 IRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTE------LVIKEADRGDSGTYDL 23902

Query: 231   RVKNAHGQASSFAKVLVRTYLGKDAG---FDSEIFK--RSTFGPSVEF--TSVLKPVFAR 283
              ++N  G+ + + KV V        G   +D    +  R ++ P  +     +L  +  R
Sbjct: 23903 VLENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILER 23962

Query: 284   EKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
              + P                  W+   S +R +            SL V    +  E  +
Sbjct: 23963 REVP---------------KAAWYTIDSRVRGT------------SLVVKGLKENVEYHF 23995

Query: 344   MVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNV--------RCLDVNRDCLILTWAP 395
              V   + FG        + +  ++E P  P +PLN           LDV +  + L+W+ 
Sbjct: 23996 RVSAENQFG--------ISKPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSR 24047

Query: 396   PSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGS 455
             P D  G+ +T Y IER +  + +W+  ++    T    + GLV    Y+FR+ A + VG 
Sbjct: 24048 PKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGL 24107

Query: 456   SVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREA 515
             S  S ASE VV  D          PFD                  PS P  +    I + 
Sbjct: 24108 SETSPASEPVVCKD----------PFDK-----------------PSQPGELEILSISKD 24140

Query: 516   YVVLAWEEPS-PRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFR 574
              V L WE+P     +  L Y +E    G   W+  S++  ++  +F +  L +   Y FR
Sbjct: 24141 SVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKK-SNKERIKDKQFTIGGLLEATEYEFR 24199

Query: 575   VRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYY 634
             V A N+ GLS P   +  ++++    +   P   +  +D  T +        +   L   
Sbjct: 24200 VFAENETGLSRPRRTA--MSIKTKLTSGEAPGIRKEMKDVTTKLG-------EAAQLSCQ 24250

Query: 635   IYSRKVGTSEWQTVNNKPIQGTRF---------TVPGLRTGKEYEFCVRSVSEAGVGESS 685
             I  R +   +W     + IQ  ++         T+  +   +E E     ++   VGE  
Sbjct: 24251 IVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVE 24310

Query: 686   AATEPIRVKQALATPSAP-----YGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHD 740
              +++ +        P  P     YG        + M IG   P        + +F  Q  
Sbjct: 24311 TSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVP-------AMTWFHGQKL 24363

Query: 741   SEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMP 800
              +  +   +      T +   +   + H  +++ + +N  G  +      + +  +    
Sbjct: 24364 LQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPD---- 24419

Query: 801   QPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQE--EGSEQWKPVTPGPISG 858
             +P  P  + A  +   S V+ W+PP   G   +T Y V   E  EG+E W+ V+   IS 
Sbjct: 24420 KPTGPIVIEA--LLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAE-WQLVS-SAISV 24475

Query: 859   THLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLE---DKPGA 902
             T  R+ +L     Y F+V A N+ G+  P   +  V+++   +KPGA
Sbjct: 24476 TTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGA 24522



 Score = 84.0 bits (206), Expect = 1e-15
 Identities = 85/314 (27%), Positives = 128/314 (40%), Gaps = 31/314 (9%)

Query: 152   RGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITN-NY 210
             + P F   LR+  V   +   L C V   P P V WY+    I   +    KYRI     
Sbjct: 24621 QAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEI---IADGLKYRIQEFKG 24677

Query: 211   GLLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPS 270
             G   L I     +D+  Y VR  N  G  S  A + V           ++I    T    
Sbjct: 24678 GYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEV--------PAKIHLPKTL--- 24726

Query: 271   VEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASL 330
                   +  V A   E  S+   FS        I W +   L+ ++   +++ T    SL
Sbjct: 24727 ----EGMGAVHALRGEVVSIKIPFSGK--PDPVITWQKGQDLIDNNGHYQVIVTRSFTSL 24780

Query: 331   KV-SCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCL 389
                +   ++D G Y+V   + FG  +++  + V D        P  P  V+  DV+RD +
Sbjct: 24781 VFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADV-------PDPPRGVKVSDVSRDSV 24833

Query: 390   ILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRA 449
              LTW  P+   G+ IT Y +E+C   +  W+   +A     R  +  L    SY+FRV A
Sbjct: 24834 NLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQA--RETRYTVINLFGKTSYQFRVIA 24891

Query: 450   ISRVGSSVPSKASE 463
              ++ G S PS+ SE
Sbjct: 24892 ENKFGLSKPSEPSE 24905



 Score = 75.5 bits (184), Expect = 3e-13
 Identities = 113/488 (23%), Positives = 184/488 (37%), Gaps = 48/488 (9%)

Query: 338   EDEGLYM-VRVPSPFG---PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTW 393
             E+ G Y  V   + FG   P E S+ V+++ +  E PGAPG P       V +D  ++ W
Sbjct: 24485 ENAGYYFRVSAQNTFGISDPLEVSSVVIIK-SPFEKPGAPGKPTITA---VTKDSCVVAW 24540

Query: 394   APPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRV 453
              PP+   G  I  Y +E+ + +  +WI+            ++ L+EG  Y FRV+  +  
Sbjct: 24541 KPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLG 24600

Query: 454   GSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIR 513
             G S  S+ SE +          K+++P        I    F++ +       N++     
Sbjct: 24601 GESEWSEISEPITP--------KSDVP--------IQAPHFKEELR------NLNVRYQS 24638

Query: 514   EAYVVL-AWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYV 572
              A +V      P P  +    Y   K +I  G    I  E      +  +  +    + V
Sbjct: 24639 NATLVCKVTGHPKPIVK---WYRQGKEIIADGLKYRIQ-EFKGGYHQLIIASVTDDDATV 24694

Query: 573   FRVRAMNQYGL--SDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPEL 630
             ++VRA NQ G      S   E  A    P TL     V A R    S+ + +    DP +
Sbjct: 24695 YQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVI 24754

Query: 631   LGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEP 690
                           +Q +  +      F   G+       + V + +  G+ + +   + 
Sbjct: 24755 TWQKGQDLIDNNGHYQVIVTRSFTSLVFP-NGVERKDAGFYVVCAKNRFGIDQKTVELDV 24813

Query: 691   IRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVN 750
               V      P  P G  + +  ++ + + W  P   GG KI  Y +++  +    W  V 
Sbjct: 24814 ADV------PDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVG 24867

Query: 751   QQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRA 810
             Q    TR   V +L     Y+FR  A N  G+ + S PS     KE         YD   
Sbjct: 24868 QAR-ETRY-TVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKE--DKTRAMNYDEEV 24923

Query: 811   SEVRATSL 818
              E R  S+
Sbjct: 24924 DETREVSM 24931



 Score = 71.6 bits (174), Expect = 5e-12
 Identities = 79/340 (23%), Positives = 140/340 (41%), Gaps = 58/340 (17%)

Query: 1132  EDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQ---YDPETGTGLLCIEELSKKDKGIYR 1188
             E   V+  CK+ N  + T+  W+F   ++ + +      E G  +L +++++K D G YR
Sbjct: 25276 EGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYR 25335

Query: 1189  AMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVE 1248
               V +D GED +  +L    +  ++    R      T  KI+   + +R+  +   + + 
Sbjct: 25336 CKVVNDYGEDSSYAELFVKGVREVYDYYCR-----RTMKKIKRRTDTMRLLERPPEFTLP 25390

Query: 1249  -YMKTTWFHKDKRLESGDRIRTGTTL------DEIWL---HILDPKDSDKGKYTLEIAAG 1298
              Y KT +         G+ +R G T+         W      + P D+DK KYT E   G
Sbjct: 25391 LYNKTAYV--------GENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDK-KYTFESDKG 25441

Query: 1299  ---KEVRQLSTD-------LSGQAFEDAMAEHQRLKTL--AIIEKNRAKVVRGLPDVATI 1346
                  +  ++TD       ++   + +   + +   TL     +     + + L   A  
Sbjct: 25442 LYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAEC 25501

Query: 1347  MEDKTLCLTCIVSGDPTPEISWLKNDQPVTF----------LDRYRMEVRGTEVTITIEK 1396
              E +++C    VSG P P + W K+ QP++           LD Y + +R T        
Sbjct: 25502 QEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDT-------- 25553

Query: 1397  VNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELKS 1436
                ED+G Y V   N  GS + Q  + V +   + +E KS
Sbjct: 25554 -LPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQEFKS 25592



 Score = 64.7 bits (156), Expect = 6e-10
 Identities = 89/459 (19%), Positives = 159/459 (34%), Gaps = 88/459 (19%)

Query: 1061  GLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDF----DKLLRKADAKRRDWK- 1115
             G  E+ I NL+E D+G Y  ++      ++  L  +   F    +K+ + ++ K+ D K 
Sbjct: 26467 GTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKT 26526

Query: 1116  ------RKQGPYFERPLQWK-----------VTEDCQVQLTCKVTNTKKETRFQWFFQRA 1158
                   RK  P    P+  K           V+ D   +   K T   + T       +A
Sbjct: 26527 TESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKA 26586

Query: 1159  EMPDGQY--DPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALD------ 1210
                 G+Y    + G   L I +    D G+Y   V +  G   +   LT  A+       
Sbjct: 26587 ITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQK 26646

Query: 1211  --------------AIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNV----EYMKT 1252
                           A+  E     AL +  +K+   +   ++  K +   V    E  K+
Sbjct: 26647 VSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKS 26706

Query: 1253  TWFHKDKRLESGDRIRTGTTLDEIWLHI--------LDPKDSDKGKYTLEIAAGKEVRQL 1304
                  +K +   +  +T    +E+  H         +   +  +      IA   +V+ +
Sbjct: 26707 AATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGATDVKWV 26766

Query: 1305  STDL--------------SGQAFEDAMAEHQRLKTLAIIEKNRAKVVR------------ 1338
                +              S Q      A H+    L  I K +  +V+            
Sbjct: 26767 LNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELS 26826

Query: 1339  ------GLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTI 1392
                     P    I E + +  TC +SG+P+PEI W KN+ P++      +       ++
Sbjct: 26827 DAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSL 26886

Query: 1393  TIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEP 1431
              I   +  DSG+Y +  KN  G  +   ++ V    +EP
Sbjct: 26887 EIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEP 26925



 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 59/227 (25%), Positives = 93/227 (40%), Gaps = 28/227 (12%)

Query: 133   RRTEEKVQEAKELRELCYGRGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDT 192
             RRT +K++   +   L   R P F +PL +   +    V    T+   P P VTWYK+  
Sbjct: 25365 RRTMKKIKRRTDTMRLLE-RPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQ 25423

Query: 193   RIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLG 252
             +I P      KY   ++ GL  L I     +D A YTV  +N +G+ S  AK+ V  +  
Sbjct: 25424 KIKPG-DNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLH-- 25480

Query: 253   KDAGFDSEIFKRSTFGPSVEFTSVLKPVFARE------KEPFSLSCLFSEDVLDAESIQW 306
                             P  +  S L+P+F R       +E  S+        +   +++W
Sbjct: 25481 ---------------PPPTD--STLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKW 25523

Query: 307   FRDGSLLRSSRRRKILYTDRQ-ASLKVSCTYKEDEGLYMVRVPSPFG 352
              +DG  L      +I++      +L +  T  ED G Y V   +  G
Sbjct: 25524 EKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAG 25570



 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 61/287 (21%), Positives = 112/287 (39%), Gaps = 38/287 (13%)

Query: 1145  TKKETRFQWFFQRAEMPDGQYDPETGT-GLLCIEELS--KKDKGIYRAMVSDDRGE--DD 1199
             +K     +W+    E+ +      T T G+L +E L     D G YRA+ ++ +GE  D 
Sbjct: 26094 SKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDY 26153

Query: 1200  TILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDK 1259
               LD+TG                  T    Q  +E +      +    E    + F K  
Sbjct: 26154 ATLDVTGG---------------DYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTS 26198

Query: 1260  RLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAE 1319
              +E+   +R      E+   + + ++S                  S ++   A E+   E
Sbjct: 26199 EMEASSSVR------EVKSQMTETRES----------LSSYEHSASAEMKSAALEEKSLE 26242

Query: 1320  HQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLD 1379
              +   T   I+   A  +   P   T+ E ++   +C   G+P P ++WL+  Q ++   
Sbjct: 26243 EK--STTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSA 26300

Query: 1380  RYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFK 1426
             R+++     + T  I  V + D G Y V V+N  G +  + T+++ K
Sbjct: 26301 RHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQK 26347



 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 105/490 (21%), Positives = 187/490 (38%), Gaps = 82/490 (16%)

Query: 919  FEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADE 978
            FE   + ++++ +W KD       ++  I  K     +++ +  L+D   YS  V  A  
Sbjct: 6088 FECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTART 6147

Query: 979  DISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELH 1038
              S   T+ EEE    K L+              NI++ E   ++L  EV K  P AE+ 
Sbjct: 6148 --SGMLTVLEEEAVFTKNLA--------------NIEVSETDTIKLVCEVSK--PGAEVI 6189

Query: 1039 LIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDD 1098
                ++EI  +   +I  +  K ++  +IQN   ED G+Y  +L   +   ++ +  +  
Sbjct: 6190 WYKGDEEIIETGRYEILTEGRKRIL--VIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAA 6247

Query: 1099 DFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRA 1158
            +F                       +P   ++ E  + +  C ++  K+    QW     
Sbjct: 6248 EF---------------------ISKPQNLEILEGEKAEFVCSIS--KESFPVQWKRDDK 6284

Query: 1159 EMPDG-QYD--PETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTE 1215
             +  G +YD   +    +L +++ + +D G Y  MV   R            A      E
Sbjct: 6285 TLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARA-----------AAHLTVIE 6333

Query: 1216 LGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDE 1275
              RI      PLK    +E   +    +  N E  K  WF  ++ +    +         
Sbjct: 6334 KLRI----VVPLKDTRVKEQQEVVFNCEV-NTEGAKAKWFRNEEAIFDSSK--------- 6379

Query: 1276 IWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAK 1335
               +I+  KD     YTL I       Q + ++S     +   E+ +     I+E+   +
Sbjct: 6380 ---YIILQKDL---VYTLRIRDAHLDDQANYNVS---LTNHRGENVKSAANLIVEEEDLR 6430

Query: 1336 VVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIE 1395
            +V  L D+ T ME K++   C V+      + W KN + V F +R    V   +  +TI+
Sbjct: 6431 IVEPLKDIET-MEKKSVTFWCKVNR-LNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIK 6488

Query: 1396 KVNSEDSGRY 1405
                 D G Y
Sbjct: 6489 DCGFPDEGEY 6498



 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 4/94 (4%)

Query: 154   PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLL 213
             P F    RS  + E   VL TC +   P P++ W+KN+  I      +    I+ +  + 
Sbjct: 26829 PAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISI----SSNVSISRSRNVY 26884

Query: 214   SLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLV 247
             SLEIR  ++ DS  YT++ KN  GQ S+ A ++V
Sbjct: 26885 SLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV 26918



 Score = 61.2 bits (147), Expect = 7e-09
 Identities = 52/232 (22%), Positives = 98/232 (42%), Gaps = 30/232 (12%)

Query: 1227  LKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIW-LHILDPKD 1285
             LK + ++E  ++   V+   +   + TW+   K+L+     +   + D  + L I +  +
Sbjct: 26419 LKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTE 26478

Query: 1286  SDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAK---------- 1335
             SD+G+Y  EI+      + +    GQAF+     H+++  ++  +K+  K          
Sbjct: 26479 SDQGEYVCEISGEGGTSKTNLQFMGQAFKSI---HEKVSKISETKKSDQKTTESTVTRKT 26535

Query: 1336  -------------VVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYR 1382
                          +V GL D  T+  D         +G+P P   W K+ + +T   +Y+
Sbjct: 26536 EPKAPEPISSKPVIVTGLQDT-TVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYK 26594

Query: 1383  MEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETG--QVTISVFKHGDEPK 1432
             +        + I K ++ DSG Y   VKN  GS +   ++TI   K  +  K
Sbjct: 26595 LSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQK 26646



 Score = 57.8 bits (138), Expect = 7e-08
 Identities = 56/219 (25%), Positives = 93/219 (42%), Gaps = 22/219 (10%)

Query: 152 RGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYG 211
           + P F  PL+S  V E +T      +   P P+V+W+++   I          +I+ + G
Sbjct: 4   QAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPG--VQISFSDG 61

Query: 212 LLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSV 271
              L I      +S  Y+++  N  GQA+S A++LV               K  T  P+ 
Sbjct: 62  RAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLV---------------KAETAPPN- 105

Query: 272 EFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLK 331
            F   L+ +  R+     L    +   +    ++++RDG+ ++SS   +I       SL 
Sbjct: 106 -FVQRLQSMTVRQGSQVRLQVRVTG--IPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLL 162

Query: 332 VSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENP 370
           ++  Y ED G Y V   +  G R  ST  L+   E E P
Sbjct: 163 IAEAYPEDSGTYSVNATNSVG-RATSTAELLVQGEEEVP 200



 Score = 55.8 bits (133), Expect = 3e-07
 Identities = 55/237 (23%), Positives = 90/237 (37%), Gaps = 48/237 (20%)

Query: 160  LRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRR 219
            L++  V E  +V L C +   P P VTWY+ D +I+  +     ++IT   G+  L IR 
Sbjct: 903  LKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSI----DFQITFQSGIARLMIRE 958

Query: 220  CAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTS---- 275
               EDS  +T    N  G  S+   + V+          SE F++ T   + +FT+    
Sbjct: 959  AFAEDSGRFTCSAVNEAGTVSTSCYLAVQV---------SEEFEKETTAVTEKFTTEEKR 1009

Query: 276  -----------------------------VLKPVFAREKEPFSLSCLFSEDVLDAESIQW 306
                                         + KPV  +  E  S+             + W
Sbjct: 1010 FVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYW 1069

Query: 307  FRDGSLLRSSRRRKILYTDR--QASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVL 361
             + G  L +  R K+ Y  +  +  L +S T+ +D G Y + V +  G    S  +L
Sbjct: 1070 KKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLL 1126



 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 33/111 (29%), Positives = 48/111 (43%), Gaps = 4/111 (3%)

Query: 133   RRTEEKVQEAKELRELCYGRGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDT 192
             ++T E+  E    +       P   + +RSH V           VQ+ P  +V WY N  
Sbjct: 26048 QKTSERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGV 26107

Query: 193   RIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFA 243
              +      + K   TN  G+L+LEI  C  +DS TY     N  G+AS +A
Sbjct: 26108 ELQ----ESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYA 26154



 Score = 55.1 bits (131), Expect = 5e-07
 Identities = 26/90 (28%), Positives = 48/90 (53%), Gaps = 2/90 (2%)

Query: 1337  VRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTE--VTITI 1394
             +  LP   +I E K L + C  +G+PTPE++W    + +   ++ R  +  T+   T+ I
Sbjct: 27026 IEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLII 27085

Query: 1395  EKVNSEDSGRYGVFVKNKYGSETGQVTISV 1424
               V  +D G Y + + N++GS++  V I +
Sbjct: 27086 MDVQKQDGGLYTLSLGNEFGSDSATVNIHI 27115



 Score = 54.7 bits (130), Expect = 6e-07
 Identities = 38/144 (26%), Positives = 66/144 (45%), Gaps = 17/144 (11%)

Query: 1284  KDSDKGK-YTLEIAAGKEVRQ-LSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLP 1341
             KD  +GK YT  ++A  E  +   ++++  A +D +A    LK              GLP
Sbjct: 13638 KDLTEGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLK--------------GLP 13683

Query: 1342  DVATIM-EDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSE 1400
             D+  +  E+    L   + G P P +SW K + P+    R  +E      T+ +      
Sbjct: 13684 DLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKS 13743

Query: 1401  DSGRYGVFVKNKYGSETGQVTISV 1424
             D+G+Y + +KN  G++ G ++I V
Sbjct: 13744 DAGKYTITLKNVAGTKEGTISIKV 13767



 Score = 54.3 bits (129), Expect = 8e-07
 Identities = 51/196 (26%), Positives = 74/196 (37%), Gaps = 39/196 (19%)

Query: 156  FWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSL 215
            F  PL    V E  T +L C V      +V W+KN T I     ++ KY I  +  +  L
Sbjct: 5982 FTKPLEDQTVEEGATAVLECEVSRENA-KVKWFKNGTEI----LKSKKYEIVADGRVRKL 6036

Query: 216  EIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRS----TFGPSV 271
             I  C  ED  TYT                            D++ FK S       P V
Sbjct: 6037 VIHDCTPEDIKTYTC---------------------------DAKDFKTSCNLNVVPPHV 6069

Query: 272  EFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLK 331
            EF   L  +  REKE     C  S +      ++WF+DG+ ++  ++  I+       L 
Sbjct: 6070 EFLRPLTDLQVREKEMARFECELSRE---NAKVKWFKDGAEIKKGKKYDIISKGAVRILV 6126

Query: 332  VSCTYKEDEGLYMVRV 347
            ++    +DE  Y   V
Sbjct: 6127 INKCLLDDEAEYSCEV 6142



 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 52/246 (21%), Positives = 88/246 (35%), Gaps = 34/246 (13%)

Query: 154  PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLL 213
            P F   L++  + E + + +      +P P + W KN   I P  +   K RI    G  
Sbjct: 1510 PMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYP--KIRIEGTKGEA 1567

Query: 214  SLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEF 273
            +L+I     +DSA YT    N  G+ ++  KV V     +       I  R T+      
Sbjct: 1568 ALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIA 1627

Query: 274  TSVLKPVFAR------------EKE--------------------PFSLSCLFSEDVLDA 301
               L+P+  R            +KE                    P    C  +      
Sbjct: 1628 APELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPT 1687

Query: 302  ESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVL 361
              ++W  DG  L ++ R +++      SL     Y  D G+   R  + +G    S  ++
Sbjct: 1688 MVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLI 1747

Query: 362  VRDAEA 367
            V+D ++
Sbjct: 1748 VKDEKS 1753



 Score = 53.5 bits (127), Expect = 1e-06
 Identities = 75/395 (18%), Positives = 148/395 (37%), Gaps = 51/395 (12%)

Query: 919  FEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADE 978
            FE   +      QW KD +      R+KI+ +    ++++    + D G Y+V+   A  
Sbjct: 3031 FECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVV---AGG 3087

Query: 979  DISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELH 1038
            ++S +    E    +++ +  E++             ++E+   R  +E E      + H
Sbjct: 3088 NVSTAKLFVEGRDVRIRSIKKEVQ-------------VIEKQ--RAVVEFEVNEDDVDAH 3132

Query: 1039 LIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDD 1098
               +  EI      +  +  E+ +  + I    + D G YT     G+ ++ +TL +   
Sbjct: 3133 WYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYT--FVAGRNRSSVTLYV--- 3187

Query: 1099 DFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRA 1158
                               + P   + LQ    +  +    C V + + + +  W+ +  
Sbjct: 3188 ----------------NAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQ 3231

Query: 1159 EMPDG-----QYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIF 1213
             +  G      +D +  T LL   E   +D  +Y     +D G   T   L+ +  + + 
Sbjct: 3232 LLSTGFKCKFLHDGQEYTLLLI--EAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVS 3289

Query: 1214 T--ELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGT 1271
               E+        TPL+   T EG     + +    + +K +W+ KDK+++     R   
Sbjct: 3290 PDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTD-LKVSWYSKDKKIKPSRFFRMTQ 3348

Query: 1272 TLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLST 1306
              D   L I +    D+G YT    A   V Q+S+
Sbjct: 3349 FEDTYQLEIAEAYPEDEGTYT--FVASNAVGQVSS 3381



 Score = 52.8 bits (125), Expect = 2e-06
 Identities = 31/92 (33%), Positives = 48/92 (52%), Gaps = 4/92 (4%)

Query: 1342  DVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSE- 1400
             D  TI   +   LT   SG P P++SW K++  V  L+  R  ++ T  T+ +EK+ ++ 
Sbjct: 10521 DKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADV--LEDDRTHIKTTPATLALEKIKAKR 10578

Query: 1401  -DSGRYGVFVKNKYGSETGQVTISVFKHGDEP 1431
              DSG+Y V V+N  GS  G   ++V      P
Sbjct: 10579 SDSGKYCVVVENSTGSRKGFCQVNVVDRPGPP 10610



 Score = 52.8 bits (125), Expect = 2e-06
 Identities = 33/106 (31%), Positives = 50/106 (47%), Gaps = 2/106 (1%)

Query: 1329  IEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGT 1388
             IE    ++   L  V  +    TL L   + G P PE+ W K +  +T  DR ++EV  +
Sbjct: 18797 IEPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT--DRAQIEVTSS 18854

Query: 1389  EVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKEL 1434
                + I+ V   DSGRY + ++N  GS+T  V + V      P  L
Sbjct: 18855 FTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNL 18900



 Score = 52.8 bits (125), Expect = 2e-06
 Identities = 26/83 (31%), Positives = 41/83 (49%)

Query: 1342  DVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSED 1401
             D+ TI     L L   V G P P+I W K D+ +   ++  ++  G   T  I+  +  D
Sbjct: 22750 DLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSD 22809

Query: 1402  SGRYGVFVKNKYGSETGQVTISV 1424
             SG+Y + VKN  G++   V + V
Sbjct: 22810 SGKYTLTVKNASGTKAVSVMVKV 22832



 Score = 52.0 bits (123), Expect = 4e-06
 Identities = 118/565 (20%), Positives = 210/565 (37%), Gaps = 105/565 (18%)

Query: 917  LAFEAPEAPDSSEFQW---SKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIV 973
            +AFE   + D+   +W   S + K P D  R+  E KV+K  ++L+     D G Y+ +V
Sbjct: 2766 VAFEVSVSHDTVPVKWFHKSVEIK-PSDKHRLVSERKVHK--LMLQNISPSDAGEYTAVV 2822

Query: 974  TDAD-------EDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWL 1026
               +       E +  + T+   E+ + K  S E        +S +N+         +WL
Sbjct: 2823 GQLECKAKLFVETLHITKTMKNIEVPETKTASFECE------VSHFNVP-------SMWL 2869

Query: 1027 EVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGK 1086
            +              N  EI  S   KI    +  L ++II N S ED   YT     G 
Sbjct: 2870 K--------------NGVEIEMSEKFKIVVQGK--LHQLIIMNTSTEDSAEYTFVC--GN 2911

Query: 1087 AKNQITLTLVDDDFDKLLRKADAKRRD---------WKRKQGPYFERPLQWKVTEDCQVQ 1137
             +   TLT+       +L+  +A+ +D         ++     + +  ++ K T+ CQ++
Sbjct: 2912 DQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMR 2971

Query: 1138 LTCKVTNTKKETRFQWFFQRAEMPDGQY--DPETGTGLLCIE----ELSKKDKGIY---- 1187
             T K+T++       +     +  D  +     T T  L +E    E  K  K I     
Sbjct: 2972 -TKKLTHSLNIRNVHF----GDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEK 3026

Query: 1188 -RAMVSDDRGEDDTILDLTGDALDAIFTELGRI--------------------------- 1219
             RAM   +  E D  +    D  +   T+  +I                           
Sbjct: 3027 KRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAG 3086

Query: 1220 GALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLH 1279
            G +S   L ++G +  IR   K      +      F  ++     D +      D I ++
Sbjct: 3087 GNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNE-----DDVDAHWYKDGIEIN 3141

Query: 1280 ILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRG 1339
                +  ++ KY +E    +     +       +      ++   TL +      +V++ 
Sbjct: 3142 F---QVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQE 3198

Query: 1340 LPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNS 1399
            L  V T+   K      ++SG P P+ISW K +Q ++   + +    G E T+ + +   
Sbjct: 3199 LQPV-TVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFP 3257

Query: 1400 EDSGRYGVFVKNKYGSETGQVTISV 1424
            ED+  Y    KN YG  T   ++SV
Sbjct: 3258 EDAAVYTCEAKNDYGVATTSASLSV 3282



 Score = 51.6 bits (122), Expect = 5e-06
 Identities = 104/528 (19%), Positives = 201/528 (38%), Gaps = 96/528 (18%)

Query: 904  EIEVGVDEEGFIYLAFEAPEAPDSSEFQWSKD----YKGPLDPQRVKIEDKVNKSKVILK 959
            E++  V +E      FE   +    + +W KD    ++G  D  R+  + KV+   ++  
Sbjct: 2133 ELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEG--DKYRMHSDRKVHFLSILTI 2190

Query: 960  EPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILER 1019
            +    D   YS ++ + +   + +  + E  + +  K   +I  P  +  SG        
Sbjct: 2191 DTS--DAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVP--ESYSG-------- 2238

Query: 1020 GEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYT 1079
                   E+E +     +   + + ++    N K      +G   + ++++++ED+G Y+
Sbjct: 2239 -------ELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYS 2291

Query: 1080 AQLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLT 1139
              + DGK               K   K   K R     QG   +     KV E   VQL 
Sbjct: 2292 FVI-DGK---------------KTTCKLKMKPRPIAILQGLSDQ-----KVCEGDIVQLE 2330

Query: 1140 CKVTNTKKETRFQWFFQRAEMPDGQYDP-ETGTGLLCIEELSKKDKGIYRAMVSDDRGED 1198
             KV+    E  +    Q  +  D  +   +  + +L IE+++K+D G Y           
Sbjct: 2331 VKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNY----------- 2379

Query: 1199 DTILDLTGDALDAIFTELGRIGALSA---TPLKIQGTEEGIRIFSKVKYYNVEYMKTTWF 1255
                  T  AL    +  GR+   S    TPLK     EG +   + K    +     W+
Sbjct: 2380 ----SFTIPALG--LSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWY 2433

Query: 1256 HKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFED 1315
              D++++  DR++      +  L I     SD+G Y L +                    
Sbjct: 2434 LNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVG------------------- 2474

Query: 1316 AMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPV 1375
                  R++T   +   + K++RGL D+ T  E + +     +S     ++ W   D+ +
Sbjct: 2475 ------RVETNCNLSVEKIKIIRGLRDL-TCTETQNVVFEVELSHSGI-DVLWNFKDKEI 2526

Query: 1376 TFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTIS 1423
                +Y++E  G    +T+  +  +D G+Y  +      S  G++T++
Sbjct: 2527 KPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTS--GKLTVA 2572



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 113/506 (22%), Positives = 194/506 (38%), Gaps = 78/506 (15%)

Query: 957  ILKEPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIK--LISGW-N 1013
            + KE G+   GT     T  +E     H   E ++ +  ++   +  PV    L+SG  N
Sbjct: 852  VKKEVGVSITGT-----TVREERFEVLHG-REAKVTETARVPAPVEIPVTPPTLVSGLKN 905

Query: 1014 IDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEE 1073
            + ++E   V L   +    P+  +     + +I SS + +I F  + G+  ++I+    E
Sbjct: 906  VTVIEGESVTLECHISGY-PSPTVTWYREDYQIESSIDFQITF--QSGIARLMIREAFAE 962

Query: 1074 DKGSYTAQL--QDGKAKNQITLTL-VDDDFDK---------------LLRKADAKRRDWK 1115
            D G +T     + G       L + V ++F+K                +   D    D  
Sbjct: 963  DSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTS 1022

Query: 1116 RKQ---------GPYF-ERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDG-- 1163
              +          PYF  +P+  K+ E   V   C+V    K   + W      +  G  
Sbjct: 1023 LTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVY-WKKSGVPLTTGYR 1081

Query: 1164 ---QYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGR-- 1218
                Y+ +TG   L I      D G Y  +V +  GE      L  +A   +  +  +  
Sbjct: 1082 YKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEM 1141

Query: 1219 -----IGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTL 1273
                 + A    P K+  T  G  ++S+   Y  EY K     + K  +  D +   T +
Sbjct: 1142 LYQTQVTAFVQEP-KVGETAPGF-VYSE---YEKEYEKEQALIRKKMAK--DTVVVRTYV 1194

Query: 1274 DEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNR 1333
            ++   HI     S + +   EI    E R + T L     E+ + E    K    I ++ 
Sbjct: 1195 EDQEFHI----SSFEERLIKEI----EYRIIKTTL-----EELLEEDGEEKMAVDISESE 1241

Query: 1334 AKVVRGLPDVAT---IMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRME-VRGTE 1389
            A V  G         I+E   +   C +SG P P+I+W K+ + +   +RY+M+ ++   
Sbjct: 1242 A-VESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGR 1300

Query: 1390 VTITIEKVNSEDSGRYGVFVKNKYGS 1415
             ++ I  V  ED G Y  F  N  G+
Sbjct: 1301 ASLRIPVVLPEDEGIYTAFASNIKGN 1326



 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 92/519 (17%), Positives = 189/519 (36%), Gaps = 100/519 (19%)

Query: 917  LAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTD- 975
            + F      + ++ +W ++ +   D  +  I  K     + +++  L+D   Y+V +T+ 
Sbjct: 6352 VVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNH 6411

Query: 976  -ADEDISASHTLTEEE----LEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEK 1030
              +   SA++ + EEE    +E LK                 +I+ +E+  V  W +V +
Sbjct: 6412 RGENVKSAANLIVEEEDLRIVEPLK-----------------DIETMEKKSVTFWCKVNR 6454

Query: 1031 LSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQ 1090
            L+    L    N +E+          D+ K ++   I++    D+G Y       K+  +
Sbjct: 6455 LN--VTLKWTKNGEEVPFDNRVSYRVDKYKHMLT--IKDCGFPDEGEYIVTAGQDKSVAE 6510

Query: 1091 ITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETR 1150
            + +     +F + L                         VTE      +C+++  K   +
Sbjct: 6511 LLIIEAPTEFVEHLEDQT---------------------VTEFDDAVFSCQLSREKANVK 6549

Query: 1151 FQWFFQRAEMPDGQYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDT-----ILDLT 1205
              W+    E+ +G+            +   +KD  I+R ++ D R +D+      + D  
Sbjct: 6550 --WYRNGREIKEGK------------KYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRK 6595

Query: 1206 GDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGD 1265
              A   +F E   +  +      ++     +   +++   N + ++  W   +  +  GD
Sbjct: 6596 SRA--RLFVEEIPVEIIRPPQDILEAPGADVVFLAEL---NKDKVEVQWLRNNMVVVQGD 6650

Query: 1266 RIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKT 1325
            + +  +      L I D K  D+G+Y   IA  KE R                       
Sbjct: 6651 KHQMMSEGKIHRLQICDIKPRDQGEYRF-IAKDKEAR----------------------- 6686

Query: 1326 LAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEV 1385
             A +E   A  ++       +   K L +       P  E  W K ++P   L    ++ 
Sbjct: 6687 -AKLELAAAPKIKTADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEP---LSTKTIDT 6742

Query: 1386 RGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISV 1424
               + +  I +    D GRY + ++NK+G   G + + V
Sbjct: 6743 TAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKV 6781



 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 52/195 (26%), Positives = 80/195 (41%), Gaps = 36/195 (18%)

Query: 160  LRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRR 219
            ++S  V + +       V   P P+  WYKN  +I+ R  R   Y   +N  +  L IR 
Sbjct: 2038 IQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIE-RSDRIYWYWPEDN--VCELVIRD 2094

Query: 220  CAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKP 279
               EDSA+  V+  N  G+ SS A +LV+                      + FT  L+ 
Sbjct: 2095 VTAEDSASIMVKAINIAGETSSHAFLLVQA------------------KQLITFTQELQD 2136

Query: 280  VFAREKEPF-SLSCLFSEDVLDAESIQWFRDGS--------LLRSSRR---RKILYTDRQ 327
            V A+EK+   +  C  SE  +    ++W++DG          + S R+     IL  D  
Sbjct: 2137 VVAKEKDTMATFECETSEPFV---KVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTS 2193

Query: 328  ASLKVSCTYKEDEGL 342
             +   SC   EDE +
Sbjct: 2194 DAEDYSCVLVEDENV 2208



 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 52/220 (23%), Positives = 92/220 (41%), Gaps = 16/220 (7%)

Query: 151  GRGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNY 210
            G GP F   + +  +       L+ TV   P P++ W+ N   + P    +  Y+   + 
Sbjct: 3646 GTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTP----SADYKFVFDG 3701

Query: 211  GLLSLEIRRCAIEDSATYTVRVKNAHGQ--ASSFAKVLVRTYLGKDAGFDSEIFK--RST 266
               SL I    +ED   YT    N +G+   S++ K+  +    KD   +S + K     
Sbjct: 3702 DDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKL 3761

Query: 267  FGP-SVEFTSVLKPVFAREKEPFSLSCLFSEDVL--DAESIQWFRDGSLLRSSRRRKILY 323
             GP    F   LKP+   +     L  +F   V+   A ++ WF++   L +S    I++
Sbjct: 3762 GGPCPPHFLKELKPIRCAQ----GLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIH 3817

Query: 324  T-DRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLV 362
              +   +  V+   +ED GLY+ +  +  G    +  +LV
Sbjct: 3818 NPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLV 3857



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 24/96 (25%), Positives = 45/96 (46%)

Query: 1340  LPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNS 1399
             +  + T+     +CL   V G P P +SW K+   +   +  +M ++    T+ +  VN 
Sbjct: 12996 MKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNR 13055

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
             +DSG Y +  +N  GS++  + + V      P  +K
Sbjct: 13056 KDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVK 13091



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 23/75 (30%), Positives = 38/75 (50%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             +SG P P I+W K+  P+    R  +       T++I++ + +D G+YG+ V N  G +T
Sbjct: 16948 ISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKT 17007

Query: 1418  GQVTISVFKHGDEPK 1432
               + I      D PK
Sbjct: 17008 ASIEIVTLDKPDPPK 17022



 Score = 48.1 bits (113), Expect = 6e-05
 Identities = 25/87 (28%), Positives = 43/87 (49%)

Query: 1345  TIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGR 1404
             +I   + L +   V G P P ISW+K+ +P+    R  +E   T   + I++ N +D G+
Sbjct: 18017 SIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGK 18076

Query: 1405  YGVFVKNKYGSETGQVTISVFKHGDEP 1431
             Y V   N  G+ T  +++ V +    P
Sbjct: 18077 YTVTATNSAGTATENLSVIVLEKPGPP 18103



 Score = 48.1 bits (113), Expect = 6e-05
 Identities = 50/180 (27%), Positives = 73/180 (40%), Gaps = 21/180 (11%)

Query: 124   QRRDWKTLRRRTEEKVQEAKELRELCYGRGPWFWIPLRSHAVWEHTTVLLTCTVQASPPP 183
             Q+    T+ R+TE K  E    +       P     L+   V   +           P P
Sbjct: 26524 QKTTESTVTRKTEPKAPEPISSK-------PVIVTGLQDTTVSSDSVAKFAVKATGEPRP 26576

Query: 184   QVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFA 243
                W K+   I     + GKY+++ + G   LEI +    DS  YT  VKN+ G  SS  
Sbjct: 26577 TAIWTKDGKAIT----QGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSC 26632

Query: 244   KVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVLDAES 303
             K+ ++      A  D+E  K ST   S E T   K V    +E  S   L SE++  +E+
Sbjct: 26633 KLTIK------AIKDTEAQKVSTQKTS-EITPQKKAVV---QEEISQKALRSEEIKMSEA 26682



 Score = 47.8 bits (112), Expect = 8e-05
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 2/96 (2%)

Query: 1340  LPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNS 1399
             L  +  I    +L L   + G PTPE+ W K D  +   D   ++V  +  ++ ++ VN 
Sbjct: 16643 LRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIR--DAAIIDVTSSFTSLVLDNVNR 16700

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
              DSG+Y + ++N  G+++  VT+ V      P  LK
Sbjct: 16701 YDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLK 16736



 Score = 47.8 bits (112), Expect = 8e-05
 Identities = 40/170 (23%), Positives = 78/170 (45%), Gaps = 16/170 (9%)

Query: 1257  KDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQA-FED 1315
             ++K  +   R+ T  T+      + D K   K  Y+  +AA         ++ G + + +
Sbjct: 23076 QEKDTDQWYRVHTNATIRNTEFTVPDLKMGQK--YSFRVAA--------VNVKGMSEYSE 23125

Query: 1316  AMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPV 1375
             ++AE + ++ + I +   A     L    TI    +L L   VSG P P I+W K  Q +
Sbjct: 23126 SIAEIEPVERIEIPDLELAD---DLKKTVTIRAGASLRLMVSVSGRPPPVITWSK--QGI 23180

Query: 1376  TFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVF 1425
                 R  ++   +   + ++KVN  D+G+Y +  +N+ G ++  V + V+
Sbjct: 23181 DLASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVY 23230



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 23/84 (27%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 1341 PDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEV--RGTEVTITIEKVN 1398
            P V  ++E  ++   C V G+P P + W K+  P+T   RY++    +  E  + I    
Sbjct: 1042 PVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTF 1101

Query: 1399 SEDSGRYGVFVKNKYGSETGQVTI 1422
            ++D+G Y + V+NK+G  +   ++
Sbjct: 1102 ADDAGEYTIVVRNKHGETSASASL 1125



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 30/96 (31%), Positives = 47/96 (48%), Gaps = 2/96 (2%)

Query: 1340  LPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNS 1399
             L  V TI    TL L   + G P PE+ W ++      LD+  +E   +   + +  VN 
Sbjct: 15561 LRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGES--LDKASIESTSSYTLLIVGNVNR 15618

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
              DSG+Y + V+N  GS++  V + V      P++LK
Sbjct: 15619 FDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLK 15654



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 40/167 (23%), Positives = 72/167 (43%), Gaps = 14/167 (8%)

Query: 177  VQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAH 236
            +   P P+++WYK +  +    F+         Y LL +E      ED+A YT   KN +
Sbjct: 3216 ISGRPQPKISWYKEEQLLSTG-FKCKFLHDGQEYTLLLIE---AFPEDAAVYTCEAKNDY 3271

Query: 237  GQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSE 296
            G A++ A + V   + +    D E+     + P++   + L+     E +P    C  S 
Sbjct: 3272 GVATTSASLSVE--VPEVVSPDQEM---PVYPPAI--ITPLQDTVTSEGQPARFQCRVSG 3324

Query: 297  DVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
              L    + W+     ++ SR  ++   +    L+++  Y EDEG Y
Sbjct: 3325 TDL---KVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTY 3368



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 49/227 (21%), Positives = 93/227 (40%), Gaps = 26/227 (11%)

Query: 1219  IGALSATPLKIQGTEEG-IRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIW 1277
             IG +S   +   G E G ++   K++ Y+ +  + TW+   ++LE+ ++           
Sbjct: 25262 IGPVSGQIMHAVGEEGGHVKYVCKIENYD-QSTQVTWYFGVRQLENSEKYEITYEDGVAI 25320

Query: 1278  LHILDPKDSDKGKYTLEIAAGKEVRQLSTDLS-GQAFEDAMAE-------------HQRL 1323
             L++ D    D G Y  ++     V     D S  + F   + E              +R 
Sbjct: 25321 LYVKDITKLDDGTYRCKV-----VNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRT 25375

Query: 1324  KTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLD---R 1380
              T+ ++E+     +      A + E+    +T  V   P P ++W K+ Q +   D   +
Sbjct: 25376 DTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVH--PEPHVTWYKSGQKIKPGDNDKK 25433

Query: 1381  YRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKH 1427
             Y  E       +TI  V ++D   Y V  +NKYG ++ +  ++V  H
Sbjct: 25434 YTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLH 25480



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 2/85 (2%)

Query: 1351  TLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVK 1410
             TL L+ I+ G P P+++W K D+      + R++V      + I     ED G Y + V+
Sbjct: 10930 TLRLSAIIKGVPFPKVTWKKEDRDAP--TKARIDVTPVGSKLEIRNAAHEDGGIYSLTVE 10987

Query: 1411  NKYGSETGQVTISVFKHGDEPKELK 1435
             N  GS+T  V + V      P++L+
Sbjct: 10988 NPAGSKTVSVKVLVLDKPGPPRDLE 11012



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 34/149 (22%), Positives = 68/149 (45%), Gaps = 7/149 (4%)

Query: 1282 DPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFE------DAMAEHQRLKTLAIIEKNRAK 1335
            D  D+ K +  +E+     V    T +  + FE        + E  R+     I      
Sbjct: 839  DTPDTYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPT 898

Query: 1336 VVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIE 1395
            +V GL +V T++E +++ L C +SG P+P ++W + D  +     +++  +     + I 
Sbjct: 899  LVSGLKNV-TVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIR 957

Query: 1396 KVNSEDSGRYGVFVKNKYGSETGQVTISV 1424
            +  +EDSGR+     N+ G+ +    ++V
Sbjct: 958  EAFAEDSGRFTCSAVNEAGTVSTSCYLAV 986



 Score = 45.1 bits (105), Expect = 5e-04
 Identities = 46/183 (25%), Positives = 68/183 (37%), Gaps = 31/183 (16%)

Query: 165  VWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIED 224
            V E  T+ L C V + P  +V WYK D  I       G+Y I        L I+   +ED
Sbjct: 6169 VSETDTIKLVCEV-SKPGAEVIWYKGDEEI----IETGRYEILTEGRKRILVIQNAHLED 6223

Query: 225  SATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFARE 284
            +  Y  R+ ++          L   ++ K      EI +    G   EF      V +  
Sbjct: 6224 AGNYNCRLPSSRTDGKVKVHELAAEFISKPQNL--EILE----GEKAEF------VCSIS 6271

Query: 285  KEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYM 344
            KE F               +QW RD   L S  +  ++   ++  L V     +D G Y+
Sbjct: 6272 KESFP--------------VQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYV 6317

Query: 345  VRV 347
            V V
Sbjct: 6318 VMV 6320



 Score = 44.7 bits (104), Expect = 7e-04
 Identities = 33/149 (22%), Positives = 67/149 (44%), Gaps = 7/149 (4%)

Query: 1279  HILDPKDSDKGKYTL-EIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVV 1337
             H ++ +   K +YT+ ++ AG+E +   + ++G    D+      +K +  +      + 
Sbjct: 21996 HKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDID 22055

Query: 1338  RGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEV--TITIE 1395
                     +    ++ L     G PTP   W K D  ++     R ++  T+   T+T+E
Sbjct: 22056 ANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSL----RADIHTTDSFSTLTVE 22111

Query: 1396  KVNSEDSGRYGVFVKNKYGSETGQVTISV 1424
               N  D+G+Y + V+N  GS++   T+ V
Sbjct: 22112 NCNRNDAGKYTLTVENNSGSKSITFTVKV 22140



 Score = 44.3 bits (103), Expect = 9e-04
 Identities = 48/237 (20%), Positives = 85/237 (35%), Gaps = 51/237 (21%)

Query: 161   RSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRC 220
             RS  V+E  +   +C     P P VTW +    +      + ++++T      + EI   
Sbjct: 26263 RSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLST----SARHQVTTTKYKSTFEISSV 26318

Query: 221   AIEDSATYTVRVKNAHG-QASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLK- 278
                D   Y+V V+N+ G Q + F   + +  + + A       K     P V+    +K 
Sbjct: 26319 QASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPE--PRVKSPEAVKS 26376

Query: 279   -------------------------------PVFA-----------REKEPFSLSCLFSE 296
                                            PV A             KE   L+C+   
Sbjct: 26377 PKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVVES 26436

Query: 297   DVLDAESIQWFRDGSLLRSSRRRKILYT-DRQASLKVSCTYKEDEGLYMVRVPSPFG 352
              VL A+ + W++DG  L+ +   +  Y+ D    LK++   + D+G Y+  +    G
Sbjct: 26437 SVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGG 26493



 Score = 43.5 bits (101), Expect = 0.001
 Identities = 45/185 (24%), Positives = 74/185 (40%), Gaps = 19/185 (10%)

Query: 1251 KTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKD-SDKGKYTLEIAAGKEVRQLSTDLS 1309
            +T WFH  +++ +    +     D     I+ P   SD G++T+          +S  L+
Sbjct: 1441 ETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILT 1500

Query: 1310 GQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWL 1369
             +A      EHQ         KN             I E   L +    +G+P P+I WL
Sbjct: 1501 VEA-----VEHQVKPMFVEKLKN-----------VNIKEGSRLEMKVRATGNPNPDIVWL 1544

Query: 1370 KNDQPVTFLDRYRMEVRGT--EVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKH 1427
            KN   +      ++ + GT  E  + I+   S+DS  Y     NK G +T +  ++V   
Sbjct: 1545 KNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVE 1604

Query: 1428 GDEPK 1432
              EP+
Sbjct: 1605 FAEPE 1609



 Score = 42.7 bits (99), Expect = 0.002
 Identities = 69/301 (22%), Positives = 125/301 (41%), Gaps = 49/301 (16%)

Query: 1120 PYFERPLQWKVT-EDCQVQLTCKVTNTKKETRFQWFFQRAEM-PDGQYDPETG--TGLLC 1175
            PYF   L  K   E  ++ L C+V+   K+   +WF    E+ P  +Y  +      +L 
Sbjct: 5358 PYFTVKLHDKTAVEKDEITLKCEVS---KDVPVKWFKDGEEIVPSPKYSIKADGLRRILK 5414

Query: 1176 IEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEG 1235
            I++   KDKG Y      D G D T  ++T                + A  +K++    G
Sbjct: 5415 IKKADLKDKGEYVC----DCGTDKTKANVT----------------VEARLIKVEKPLYG 5454

Query: 1236 IRIF-SKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLE 1294
            + +F  +  ++ +E  +    H   +L+ G  +      + I          + GK  + 
Sbjct: 5455 VEVFVGETAHFEIELSEPD-VHGQWKLK-GQPLTASPDCEII----------EDGKKHIL 5502

Query: 1295 IAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCL 1354
            I    ++  ++ ++S QA     A + ++K L +I       +  L DV    +D+    
Sbjct: 5503 ILHNCQLG-MTGEVSFQAANAKSAANLKVKELPLI------FITPLSDVKVFEKDEAK-F 5554

Query: 1355 TCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYG 1414
             C VS +P     WLK  Q +T  DR+ +   GT+ ++ I+    ED  +Y    ++K+ 
Sbjct: 5555 ECEVSREPKT-FRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHT 5613

Query: 1415 S 1415
            S
Sbjct: 5614 S 5614



 Score = 42.7 bits (99), Expect = 0.002
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 2/75 (2%)

Query: 1360  GDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQ 1419
             G PTPEI+W + +    F D+ ++E       ++I+  +  D+G+Y + ++N  GS++  
Sbjct: 17745 GRPTPEITWSREEGE--FTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAF 17802

Query: 1420  VTISVFKHGDEPKEL 1434
             VT+ V      P+ L
Sbjct: 17803 VTVKVLDTPGPPQNL 17817



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 34/102 (33%), Positives = 42/102 (41%), Gaps = 11/102 (10%)

Query: 159  PLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIR 218
            PL+     E       C V  +   +V+WY  D +I P  F    +R+T       LEI 
Sbjct: 3304 PLQDTVTSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRF----FRMTQFEDTYQLEIA 3358

Query: 219  RCAIEDSATYTVRVKNAHGQASSFA------KVLVRTYLGKD 254
                ED  TYT    NA GQ SS A      + L R   GKD
Sbjct: 3359 EAYPEDEGTYTFVASNAVGQVSSTANLSLEVQALDRQSSGKD 3400



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 1/80 (1%)

Query: 1346 IMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRY 1405
            IM  KTL +  +V+G P P   W K +  +   DR  ++  GT+  + I+    +D GRY
Sbjct: 8811 IMAGKTLRIPAVVTGRPVPTKVWTKEEGELD-KDRVVIDNVGTKSELIIKDALRKDHGRY 8869

Query: 1406 GVFVKNKYGSETGQVTISVF 1425
             +   N  GS+     + VF
Sbjct: 8870 VITATNSCGSKFAAARVEVF 8889



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 8/104 (7%)

Query: 1337 VRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKND----QPVTFLDRYRMEVRGTEVT- 1391
            VRG  D   +   + + +   V+G P P+I W KN+    +P   L   + EV  +E   
Sbjct: 9098 VRG--DTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKT 9155

Query: 1392 -ITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKEL 1434
             ++I K   ED G Y V   N+ GS    V + V+     P+ L
Sbjct: 9156 ELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNL 9199



 Score = 42.0 bits (97), Expect = 0.004
 Identities = 23/93 (24%), Positives = 40/93 (43%)

Query: 1340  LPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNS 1399
             +P+  TI   K L +   V G P P   W K +  V       +    +   + I+ V  
Sbjct: 12599 MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTR 12658

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPK 1432
             +DSG Y +  +N  G++T ++ + V      P+
Sbjct: 12659 KDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQ 12691



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 32/189 (16%)

Query: 156  FWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSL 215
            F  PL    V E  T    C + +     V W+KND +    L  +    I++      L
Sbjct: 5271 FMSPLEDQTVKEGETATFVCEL-SHEKMHVVWFKNDAK----LHTSRTVLISSEGKTHKL 5325

Query: 216  EIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTS 275
            E++   ++D +    +VK    + SS A++ V          +++ +          FT 
Sbjct: 5326 EMKEVTLDDISQIKAQVK----ELSSTAQLKV---------LEADPY----------FTV 5362

Query: 276  VLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCT 335
             L    A EK+  +L C  S+DV     ++WF+DG  +  S +  I     +  LK+   
Sbjct: 5363 KLHDKTAVEKDEITLKCEVSKDV----PVKWFKDGEEIVPSPKYSIKADGLRRILKIKKA 5418

Query: 336  YKEDEGLYM 344
              +D+G Y+
Sbjct: 5419 DLKDKGEYV 5427



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 23/91 (25%), Positives = 42/91 (46%)

Query: 1346 IMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRY 1405
            ++E + L +       P P +SW K+ + V   DR  M+       + + K    D+G Y
Sbjct: 8093 VIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIY 8152

Query: 1406 GVFVKNKYGSETGQVTISVFKHGDEPKELKS 1436
             + ++NK GS T  + + V       K++K+
Sbjct: 8153 TITLENKLGSATASINVKVIGLPGPCKDIKA 8183



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 20/67 (29%), Positives = 35/67 (52%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             +SG P P+++W   +  +   DR  +       T+T++     DSGRY + ++N  G +T
Sbjct: 22366 ISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKT 22425

Query: 1418  GQVTISV 1424
               VT+ V
Sbjct: 22426 FSVTVVV 22432



 Score = 41.2 bits (95), Expect = 0.007
 Identities = 94/487 (19%), Positives = 174/487 (35%), Gaps = 91/487 (18%)

Query: 925  PDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASH 984
            PD +  +W  + +      RV+   K  K ++++      D G Y +IV   + + + S 
Sbjct: 2425 PDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLS- 2483

Query: 985  TLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNK 1044
                  +EK            IK+I G   D+       +  EVE      ++   F +K
Sbjct: 2484 ------VEK------------IKIIRGLR-DLTCTETQNVVFEVELSHSGIDVLWNFKDK 2524

Query: 1045 EIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLL 1104
            EI   P+ K   +    + ++ + N+ ++D+G YT    +     ++T+           
Sbjct: 2525 EI--KPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVA---------- 2572

Query: 1105 RKADAKRRDWKRKQGPYFERPL-QWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDG 1163
                          G    +PL    V E  +    C+V N   +++ +W      + DG
Sbjct: 2573 --------------GGAISKPLTDQTVAESQEAVFECEVANP--DSKGEW------LRDG 2610

Query: 1164 QYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALS 1223
            ++ P T    +  E    K + I  A   DD GE  T    T      +  E  +I    
Sbjct: 2611 KHLPLTNN--IRSESDGHKRRLIIAATKLDDIGEY-TYKVATSKTSAKLKVEAVKI---K 2664

Query: 1224 ATPLKIQGTEEGIRIFS-KVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILD 1282
             T   +  TE    +F+ ++ + NV+ ++  W      LES ++           L I +
Sbjct: 2665 KTLKNLTVTETQDAVFTVELTHPNVKGVQ--WIKNGVVLESNEKYAISVKGTIYSLRIKN 2722

Query: 1283 PKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPD 1342
                D+  Y   +                          RL   A +     K+++   D
Sbjct: 2723 CAIVDESVYGFRLG-------------------------RLGASARLHVETVKIIKKPKD 2757

Query: 1343 VATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDS 1402
            V T +E+ T+     VS D  P + W      +   D++R+        + ++ ++  D+
Sbjct: 2758 V-TALENATVAFEVSVSHDTVP-VKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDA 2815

Query: 1403 GRYGVFV 1409
            G Y   V
Sbjct: 2816 GEYTAVV 2822



 Score = 41.2 bits (95), Expect = 0.007
 Identities = 20/77 (25%), Positives = 37/77 (48%)

Query: 1359 SGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETG 1418
            +G P P  +W   D+ +   DR +M+       + I      D G Y + ++N+  + +G
Sbjct: 7114 TGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISG 7173

Query: 1419 QVTISVFKHGDEPKELK 1435
            ++ ++V      PKELK
Sbjct: 7174 EIDVNVIARPSAPKELK 7190



 Score = 40.0 bits (92), Expect = 0.016
 Identities = 26/100 (26%), Positives = 46/100 (46%), Gaps = 2/100 (2%)

Query: 1330 EKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTE 1389
            EK +  +V   P+   ++E +T    C V+G P P+++W  N Q +    R+R+   G  
Sbjct: 1791 EKQKPDIVL-YPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIH 1849

Query: 1390 VTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGD 1429
              + I    S D+G   V  +N  G    +V + + +  D
Sbjct: 1850 Y-LDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQRED 1888



 Score = 40.0 bits (92), Expect = 0.016
 Identities = 36/161 (22%), Positives = 68/161 (42%), Gaps = 22/161 (13%)

Query: 1252 TTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQ 1311
            TTW      +    + R      +  LHI+D + SD G+YT  +  G + +  +  L   
Sbjct: 4844 TTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKL--- 4900

Query: 1312 AFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKN 1371
                            ++E+   + V+ L +  T+++ + L L+C ++ +   ++ W K+
Sbjct: 4901 ----------------VVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKE--RDVVWRKD 4942

Query: 1372 DQPVTFL-DRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKN 1411
             + V     R    V G    +TI   +  D+G Y V V+N
Sbjct: 4943 GKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVEN 4983



 Score = 40.0 bits (92), Expect = 0.016
 Identities = 97/527 (18%), Positives = 193/527 (36%), Gaps = 94/527 (17%)

Query: 920  EAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADED 979
            E   + ++++ +W K+    L  ++ +I       K+++ +   ED+ TY+    D    
Sbjct: 6000 ECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKT- 6058

Query: 980  ISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHL 1039
             S +  +    +E L+ L+              ++ + E+   R   E+ + +  A++  
Sbjct: 6059 -SCNLNVVPPHVEFLRPLT--------------DLQVREKEMARFECELSREN--AKVKW 6101

Query: 1040 IFNNKEIFSSPNRKINFDREKGLVEVIIQNLSE-EDKGSYTAQLQDGKAKNQITLTLVDD 1098
              +  EI       I     KG V +++ N    +D+  Y+ +++  +    +T+   + 
Sbjct: 6102 FKDGAEIKKGKKYDII---SKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEEA 6158

Query: 1099 DFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRA 1158
             F K L   +                     V+E   ++L C+V+    E    W+    
Sbjct: 6159 VFTKNLANIE---------------------VSETDTIKLVCEVSKPGAEVI--WYKGDE 6195

Query: 1159 EMPD-GQYD--PETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTE 1215
            E+ + G+Y+   E    +L I+    +D G Y   +   R +    +            E
Sbjct: 6196 EIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVH-----------E 6244

Query: 1216 LGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDE 1275
            L          L+I   E+   + S  K    E     W   DK LESGD+        +
Sbjct: 6245 LAAEFISKPQNLEILEGEKAEFVCSISK----ESFPVQWKRDDKTLESGDKYDVIADGKK 6300

Query: 1276 IWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAK 1335
              L + D    D G Y + + A +    L+                      +IEK R  
Sbjct: 6301 RVLVVKDATLQDMGTYVVMVGAARAAAHLT----------------------VIEKLR-- 6336

Query: 1336 VVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIE 1395
            +V  L D   + E + +   C V+ +   +  W +N++ +    +Y +  +    T+ I 
Sbjct: 6337 IVVPLKDTR-VKEQQEVVFNCEVNTEGA-KAKWFRNEEAIFDSSKYIILQKDLVYTLRIR 6394

Query: 1396 KVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGD----EP-KELKSM 1437
              + +D   Y V + N  G         + +  D    EP K++++M
Sbjct: 6395 DAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETM 6441



 Score = 39.7 bits (91), Expect = 0.021
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 2/81 (2%)

Query: 1346 IMEDKTLCLTCIVSGDPTPEISWLKNDQPV--TFLDRYRMEVRGTEVTITIEKVNSEDSG 1403
            ++E  T      +SG P PE+SW ++ Q +  + L   ++        +TI  V   +SG
Sbjct: 17   VLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSG 76

Query: 1404 RYGVFVKNKYGSETGQVTISV 1424
            RY +   N  G  T    + V
Sbjct: 77   RYSLKATNGSGQATSTAELLV 97



 Score = 39.7 bits (91), Expect = 0.021
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 4/74 (5%)

Query: 174  TCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVK 233
            TC +Q++P  +  W+K    I    + + K  I ++  + SLEI R  + D   YT +  
Sbjct: 4549 TCEIQSAPNVRFQWFKAGREI----YESDKCSIRSSKYISSLEILRTQVVDCGEYTCKAS 4604

Query: 234  NAHGQASSFAKVLV 247
            N +G  S  A + V
Sbjct: 4605 NEYGSVSCTATLTV 4618



 Score = 39.7 bits (91), Expect = 0.021
 Identities = 80/412 (19%), Positives = 157/412 (38%), Gaps = 69/412 (16%)

Query: 1001 IRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREK 1060
            ++ P ++         +E G   + LE E     A++    N  EI  S   +I  D   
Sbjct: 5975 VKEPPVEFTKPLEDQTVEEGATAV-LECEVSRENAKVKWFKNGTEILKSKKYEIVADGR- 6032

Query: 1061 GLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGP 1120
             + +++I + + ED  +YT   +D K    + +     +F + L     + ++  R    
Sbjct: 6033 -VRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMAR---- 6087

Query: 1121 YFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQ-YD--PETGTGLLCIE 1177
             FE          C++        +++  + +WF   AE+  G+ YD   +    +L I 
Sbjct: 6088 -FE----------CEL--------SRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVIN 6128

Query: 1178 ELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIR 1237
            +    D+  Y   V   R    T   LT    +A+FT+       +   +++  T+  I+
Sbjct: 6129 KCLLDDEAEYSCEVRTAR----TSGMLTVLEEEAVFTK-------NLANIEVSETDT-IK 6176

Query: 1238 IFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAA 1297
            +  +V     E +   W+  D+ +    R    T   +  L I +    D G Y   + +
Sbjct: 6177 LVCEVSKPGAEVI---WYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPS 6233

Query: 1298 GKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCI 1357
             +      TD   +  E A     + + L I+E  +A+ V                  C 
Sbjct: 6234 SR------TDGKVKVHELAAEFISKPQNLEILEGEKAEFV------------------CS 6269

Query: 1358 VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFV 1409
            +S +  P + W ++D+ +   D+Y +   G +  + ++    +D G Y V V
Sbjct: 6270 ISKESFP-VQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMV 6320



 Score = 39.7 bits (91), Expect = 0.021
 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 1/86 (1%)

Query: 1340  LPDVATIMEDKTLCLTCI-VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVN 1398
             + D  TI    T+ L  I + G P P+ SW K  + +   D  ++    T   +TI+   
Sbjct: 14079 IKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYAT 14138

Query: 1399  SEDSGRYGVFVKNKYGSETGQVTISV 1424
              +D+G Y +   N +G++   V ++V
Sbjct: 14139 RKDAGEYTITATNPFGTKVEHVKVTV 14164



 Score = 39.7 bits (91), Expect = 0.021
 Identities = 21/67 (31%), Positives = 29/67 (43%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             V G P P ++W K DQ +    R   E   T   + I +    DSG Y +  +N  G   
Sbjct: 14784 VLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEVG 14843

Query: 1418  GQVTISV 1424
               +TI V
Sbjct: 14844 DVITIQV 14850



 Score = 39.7 bits (91), Expect = 0.021
 Identities = 20/73 (27%), Positives = 33/73 (45%)

Query: 1360  GDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQ 1419
             G P P ISWLK+  P+   +  R      ++T++I+    E  G+Y V + N        
Sbjct: 21284 GKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVP 21343

Query: 1420  VTISVFKHGDEPK 1432
             +T+       +PK
Sbjct: 21344 ITVITLGPPSKPK 21356



 Score = 39.3 bits (90), Expect = 0.028
 Identities = 62/309 (20%), Positives = 114/309 (36%), Gaps = 40/309 (12%)

Query: 1117 KQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDG---QYDPETGTGL 1173
            KQ   F + LQ  V ++     T +   ++   + +W+    E+ +G   +   +     
Sbjct: 2125 KQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHF 2184

Query: 1174 LCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTE 1233
            L I  +   D   Y  ++ +D     T   +   A+     EL  I      P    G  
Sbjct: 2185 LSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDI----EVPESYSGEL 2240

Query: 1234 EGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTL 1293
            E I         + E ++  W+H D  L+S  +    +      L + D    D+G+Y+ 
Sbjct: 2241 ECI--------VSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSF 2292

Query: 1294 EIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLC 1353
             I   K   +L                 + + +AI++        GL D   + E   + 
Sbjct: 2293 VIDGKKTTCKLK---------------MKPRPIAILQ--------GLSD-QKVCEGDIVQ 2328

Query: 1354 LTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKY 1413
            L   VS +    + W+K+ Q V   DR  + +      + IE +  ED+G Y   +    
Sbjct: 2329 LEVKVSLESVEGV-WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALG 2387

Query: 1414 GSETGQVTI 1422
             S +G+V++
Sbjct: 2388 LSTSGRVSV 2396



 Score = 39.3 bits (90), Expect = 0.028
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTE--VTITIEKVNSEDSGRYGVFVKNKYGS 1415
             + G P P I W+K DQ ++  +  R+E++ T+   +++++     DSG Y +  KN  G 
Sbjct: 16262 IYGKPIPTIQWIKGDQELS--NTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGE 16319

Query: 1416  ETGQVTISVFKHGDEPK 1432
              +  V + V      P+
Sbjct: 16320 RSVTVNVKVLDRPGPPE 16336



 Score = 39.3 bits (90), Expect = 0.028
 Identities = 21/76 (27%), Positives = 36/76 (47%)

Query: 1360  GDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQ 1419
             G P   ++W K+ Q +    R  +    T  +++I++ + ED G Y + V N  GS T  
Sbjct: 19115 GRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVP 19174

Query: 1420  VTISVFKHGDEPKELK 1435
             +TI V      P  ++
Sbjct: 19175 ITIIVLDRPGPPGPIR 19190



 Score = 38.9 bits (89), Expect = 0.036
 Identities = 39/157 (24%), Positives = 69/157 (43%), Gaps = 13/157 (8%)

Query: 93   ELEERGQKRVGFGNDWERTEI-AFLQTHRLLRQRRDWKTLRRRTEEKVQEAKELRELCYG 151
            +LE+ G+      ND+ +T   A+L+ +      +D       TE +   AK L +L   
Sbjct: 3712 KLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKD-------TETESAVAKSLEKLGGP 3764

Query: 152  RGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNN-Y 210
              P F   L+     +    +   TV   P P VTW+K + ++   ++    Y I +N  
Sbjct: 3765 CPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVY----YTIIHNPN 3820

Query: 211  GLLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLV 247
            G  +  +     EDS  Y  + +N  G+++  A++LV
Sbjct: 3821 GSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLV 3857



 Score = 38.9 bits (89), Expect = 0.036
 Identities = 18/74 (24%), Positives = 36/74 (48%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             +SG P P+++  ++  P+    R+  E+    +TI +++  + D+GRY +   N  G+  
Sbjct: 20195 ISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTK 20254

Query: 1418  GQVTISVFKHGDEP 1431
               + I V      P
Sbjct: 20255 AFINIVVLDRPGPP 20268



 Score = 38.9 bits (89), Expect = 0.036
 Identities = 46/199 (23%), Positives = 79/199 (39%), Gaps = 36/199 (18%)

Query: 184   QVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFA 243
             QVTWY    +++     + KY IT   G+  L ++     D  TY  +V N +G+ SS+A
Sbjct: 25294 QVTWYFGVRQLE----NSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYA 25349

Query: 244   KVLVRTYLGKDAGFD------SEIFKRST-----FGPSVEFTSVL--KPVFAREKEPFSL 290
             ++ V+   G    +D       +  KR T          EFT  L  K  +  E   F +
Sbjct: 25350 ELFVK---GVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGV 25406

Query: 291   SCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSP 350
             +      V     + W++ G  ++     K              T++ D+GLY + + S 
Sbjct: 25407 TI----TVHPEPHVTWYKSGQKIKPGDNDK------------KYTFESDKGLYQLTINSV 25450

Query: 351   FGPREQSTYVLVRDAEAEN 369
                 +    V+ R+   E+
Sbjct: 25451 TTDDDAEYTVVARNKYGED 25469



 Score = 38.5 bits (88), Expect = 0.047
 Identities = 24/105 (22%), Positives = 39/105 (37%), Gaps = 8/105 (7%)

Query: 1339 GLPDVATIMEDKTLCLTCIVSGDPTPEISW--------LKNDQPVTFLDRYRMEVRGTEV 1390
            G  D         + +  ++ G PTP+ SW           D      +  ++E      
Sbjct: 9510 GAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSS 9569

Query: 1391 TITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
             I I +     +G+Y +  KNK G +T    + V      PK+LK
Sbjct: 9570 VIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLK 9614



 Score = 38.5 bits (88), Expect = 0.047
 Identities = 22/76 (28%), Positives = 40/76 (52%), Gaps = 4/76 (5%)

Query: 1351  TLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGT--EVTITIEKVNSEDSGRYGVF 1408
             T+ L   V G P P+I+W K +  V   DR  ++++ T  +  +  E VN  D+G+Y + 
Sbjct: 13405 TMRLYVPVKGRPPPKITWSKPN--VNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILT 13462

Query: 1409  VKNKYGSETGQVTISV 1424
             ++N  G +   + + V
Sbjct: 13463 LENSCGKKEYTIVVKV 13478



 Score = 38.5 bits (88), Expect = 0.047
 Identities = 18/61 (29%), Positives = 29/61 (47%)

Query: 1354  LTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKY 1413
             L+C + G P P+I W +  + +    +Y+M   G   T+T+     ED G Y     N+ 
Sbjct: 24247 LSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEV 24306

Query: 1414  G 1414
             G
Sbjct: 24307 G 24307



 Score = 38.1 bits (87), Expect = 0.061
 Identities = 45/220 (20%), Positives = 86/220 (39%), Gaps = 28/220 (12%)

Query: 1220 GALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLH 1279
            G +  TPL    +EEG  +       N +  +  W+ ++K + S ++ +           
Sbjct: 4434 GPMIHTPLVDTVSEEGDIVHLTTSITNAK--EVNWYFENKLVPSDEKFKCL--------- 4482

Query: 1280 ILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLA--IIEKNRAKVV 1337
                   D+  YTL I      +  + D  G+   +A+ +  +  T A   + K  A V+
Sbjct: 4483 ------QDQNTYTLVID-----KVNTEDHQGEYVCEALNDSGKTATSAKLTVVKRAAPVI 4531

Query: 1338 RGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKV 1397
            +   +   +        TC +   P     W K  + +   D+    +R ++   ++E +
Sbjct: 4532 KRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDK--CSIRSSKYISSLEIL 4589

Query: 1398 NSE--DSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
             ++  D G Y     N+YGS +   T++V   G E K  K
Sbjct: 4590 RTQVVDCGEYTCKASNEYGSVSCTATLTVTVPGGEKKVRK 4629



 Score = 38.1 bits (87), Expect = 0.061
 Identities = 25/90 (27%), Positives = 40/90 (44%), Gaps = 5/90 (5%)

Query: 158  IPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEI 217
            +PL+   V E   V+  C V      +  W++N+  I    F + KY I     + +L I
Sbjct: 6339 VPLKDTRVKEQQEVVFNCEVNTEGA-KAKWFRNEEAI----FDSSKYIILQKDLVYTLRI 6393

Query: 218  RRCAIEDSATYTVRVKNAHGQASSFAKVLV 247
            R   ++D A Y V + N  G+    A  L+
Sbjct: 6394 RDAHLDDQANYNVSLTNHRGENVKSAANLI 6423



 Score = 38.1 bits (87), Expect = 0.061
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 4/92 (4%)

Query: 1342  DVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTE--VTITIEKVNS 1399
             DV  +   + L +   ++G P P ISW K+   +   +R R E+  T+    +T++    
Sbjct: 19492 DVIVVKAGEVLKINADIAGRPLPVISWAKDG--IEIEERARTEIISTDNHTLLTVKDCIR 19549

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEP 1431
              D+G+Y + +KN  G+ +  V   V      P
Sbjct: 19550 RDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPP 19581



 Score = 37.7 bits (86), Expect = 0.080
 Identities = 60/287 (20%), Positives = 103/287 (35%), Gaps = 60/287 (20%)

Query: 137  EKVQEAKELRELCYGRGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDP 196
            E  + +KE  +   G  P  ++ L+   V    T    C ++      VTW     +I+ 
Sbjct: 3472 ESTELSKECAKESTGEAPKIFLHLQDVTVKCGDTAQFLCVLKDDSFIDVTWTHEGAKIE- 3530

Query: 197  RLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVR-------- 248
                + + + + N  +  L I    + D   Y+  V N  G+ ++ A + V         
Sbjct: 3531 ---ESERLKQSQNGNIQFLTICNVQLVDQGLYSCIVHNDCGERTTSAVLSVEGAPESILH 3587

Query: 249  ----------------TYLG-KDAGFDSEIFKRSTFGPSVEFTS---VLKPVFAREKEPF 288
                            ++L  ++ G  S   + S    ++E  S   V    F  EKE  
Sbjct: 3588 ERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYPTKFDSEKE-- 3645

Query: 289  SLSCLFSEDVLDAE-------------------SIQWFRDGSLLRSSRRRKILYTDRQAS 329
                +F ++V +A+                    IQWF +G LL  S   K ++     S
Sbjct: 3646 GTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHS 3705

Query: 330  LKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLV-------RDAEAEN 369
            L +  T  EDEG Y     + +G    S Y+ +       +D E E+
Sbjct: 3706 LIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETES 3752



 Score = 37.7 bits (86), Expect = 0.080
 Identities = 22/93 (23%), Positives = 45/93 (48%), Gaps = 3/93 (3%)

Query: 1342  DVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGT--EVTITIEKVNS 1399
             DV  +   +T  L   + G P P++ W K+ + +      RME++ T  + T+ ++    
Sbjct: 18410 DVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELE-ETAARMEIKSTIQKTTLVVKDCIR 18468

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPK 1432
              D G+Y + + N  G+++  +T+ V      P+
Sbjct: 18469 TDGGQYILKLSNVGGTKSIPITVKVLDRPGPPE 18501



 Score = 37.7 bits (86), Expect = 0.080
 Identities = 23/93 (24%), Positives = 39/93 (41%), Gaps = 2/93 (2%)

Query: 284   EKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
             E E    SC    D     ++ W R G +L +S R ++  T  +++ ++S     DEG Y
Sbjct: 26269 EGESARFSC--DTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNY 26326

Query: 344   MVRVPSPFGPREQSTYVLVRDAEAENPGAPGSP 376
              V V +  G +E    + ++ A          P
Sbjct: 26327 SVVVENSEGKQEAEFTLTIQKARVTEKAVTSPP 26359



 Score = 37.4 bits (85), Expect = 0.10
 Identities = 27/97 (27%), Positives = 42/97 (43%), Gaps = 4/97 (4%)

Query: 1335 KVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITI 1394
            K++ GL    T+     + L   V+G P P+I+W K D  +    R  +E    + T+TI
Sbjct: 7390 KLLAGL----TVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTI 7445

Query: 1395 EKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEP 1431
                  D+G Y +   N  G  T  V ++V      P
Sbjct: 7446 VDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPP 7482



 Score = 37.4 bits (85), Expect = 0.10
 Identities = 17/67 (25%), Positives = 37/67 (55%), Gaps = 2/67 (2%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             + G P PE++W K++  +   +R  +E   +   + I + N  D+G++ + ++N  G ++
Sbjct: 14495 IKGRPAPEVTWTKDN--INLKNRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKS 14552

Query: 1418  GQVTISV 1424
             G V + V
Sbjct: 14553 GFVNVRV 14559



 Score = 37.4 bits (85), Expect = 0.10
 Identities = 20/79 (25%), Positives = 36/79 (45%), Gaps = 2/79 (2%)

Query: 1354  LTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKY 1413
             LT  + G P P   W K  Q ++   R  +    T   + I++ +  DSG Y + ++NK 
Sbjct: 23851 LTIPIKGKPFPICKWTKEGQDIS--KRAMIATSETHTELVIKEADRGDSGTYDLVLENKC 23908

Query: 1414  GSETGQVTISVFKHGDEPK 1432
             G +   + + V    + P+
Sbjct: 23909 GKKAVYIKVRVIGSPNSPE 23927



 Score = 37.0 bits (84), Expect = 0.14
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 4/93 (4%)

Query: 1342  DVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTE--VTITIEKVNS 1399
             D   +   +T  L   V G P P I WL+ D+ +   +  R E++ T+    + ++    
Sbjct: 17328 DTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIE--ESARCEIKNTDFKALLIVKDAIR 17385

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPK 1432
              D G+Y +   N  GS++  V + V      P+
Sbjct: 17386 IDGGQYILRASNVAGSKSFPVNVKVLDRPGPPE 17418



 Score = 37.0 bits (84), Expect = 0.14
 Identities = 21/83 (25%), Positives = 36/83 (43%), Gaps = 2/83 (2%)

Query: 167   EHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSA 226
             E   + + C     P P+VTW     +I  +    G++ I N   L +L I     +D  
Sbjct: 27037 EGKVLTVACAFTGEPTPEVTWSCGGRKIHSQ--EQGRFHIENTDDLTTLIIMDVQKQDGG 27094

Query: 227   TYTVRVKNAHGQASSFAKVLVRT 249
              YT+ + N  G  S+   + +R+
Sbjct: 27095 LYTLSLGNEFGSDSATVNIHIRS 27117



 Score = 36.6 bits (83), Expect = 0.18
 Identities = 47/218 (21%), Positives = 87/218 (39%), Gaps = 30/218 (13%)

Query: 1220 GALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLH 1279
            GA+S  PL  Q   E      + +  N +  K  W    K L   + IR+ +   +  L 
Sbjct: 2574 GAISK-PLTDQTVAESQEAVFECEVANPD-SKGEWLRDGKHLPLTNNIRSESDGHKRRLI 2631

Query: 1280 ILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRG 1339
            I   K  D G+YT ++A  K   +L  +        A+   + LK L             
Sbjct: 2632 IAATKLDDIGEYTYKVATSKTSAKLKVE--------AVKIKKTLKNL------------- 2670

Query: 1340 LPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNS 1399
                 T+ E +    T  ++      + W+KN   +   ++Y + V+GT  ++ I+    
Sbjct: 2671 -----TVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAI 2725

Query: 1400 EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELKSM 1437
             D   YG F   + G+ + ++ +   K   +PK++ ++
Sbjct: 2726 VDESVYG-FRLGRLGA-SARLHVETVKIIKKPKDVTAL 2761



 Score = 36.6 bits (83), Expect = 0.18
 Identities = 30/119 (25%), Positives = 48/119 (40%), Gaps = 10/119 (8%)

Query: 1318 AEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTF 1377
            +E +    + I E + A +  G  DVAT        L+  V G P P+I W  N   +T 
Sbjct: 3642 SEKEGTGPIFIKEVSNADISMG--DVAT--------LSVTVIGIPKPKIQWFFNGVLLTP 3691

Query: 1378 LDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELKS 1436
               Y+    G + ++ I     ED G Y     N YG       + +   G+  K+ ++
Sbjct: 3692 SADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTET 3750



 Score = 36.6 bits (83), Expect = 0.18
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 1359  SGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEK-VNSEDSGRYGVFVKNKYGSET 1417
             SG P P I+W K    +     Y++ V  +  ++     V  +D+G Y V  KN++G + 
Sbjct: 24747 SGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQ 24806

Query: 1418  GQVTISVFKHGDEPKELK 1435
               V + V    D P+ +K
Sbjct: 24807 KTVELDVADVPDPPRGVK 24824



 Score = 36.2 bits (82), Expect = 0.23
 Identities = 61/331 (18%), Positives = 136/331 (41%), Gaps = 49/331 (14%)

Query: 882  AGLGQPSMP---TDPVLLEDKPGAHEI---EVGVDEEGFIYLAFEAPEAPDSSEFQWSKD 935
            AG G+P+ P   T PV+ +   G   +   +VG + +  +Y  ++    P ++ +++   
Sbjct: 1028 AGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVY--WKKSGVPLTTGYRYKVS 1085

Query: 936  YKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTLTEE-ELEKL 994
            Y             +  + K+++     +D G Y+++V +   + SAS +L EE + E L
Sbjct: 1086 YN-----------KQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELL 1134

Query: 995  KKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKI 1054
             K   E               +L + +V  +++  K+   A   +    ++ +      I
Sbjct: 1135 MKSQQE---------------MLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALI 1179

Query: 1055 NFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLRKADAKR--- 1111
               R+K   + ++     ED+  + +  ++   K +I   ++    ++LL +   ++   
Sbjct: 1180 ---RKKMAKDTVVVRTYVEDQEFHISSFEERLIK-EIEYRIIKTTLEELLEEDGEEKMAV 1235

Query: 1112 --RDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDG---QYD 1166
               + +  +  +  R   +++ E   V   CK++      +  W+     +  G   Q D
Sbjct: 1236 DISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPL-PKIAWYKDGKRIKHGERYQMD 1294

Query: 1167 -PETGTGLLCIEELSKKDKGIYRAMVSDDRG 1196
              + G   L I  +  +D+GIY A  S+ +G
Sbjct: 1295 FLQDGRASLRIPVVLPEDEGIYTAFASNIKG 1325



 Score = 36.2 bits (82), Expect = 0.23
 Identities = 22/87 (25%), Positives = 36/87 (41%)

Query: 1345  TIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGR 1404
             T++  + L +     G PTP ++W K++ P+    R   E       +TI+    ED G 
Sbjct: 15853 TVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGH 15912

Query: 1405  YGVFVKNKYGSETGQVTISVFKHGDEP 1431
             Y V + N  G     + + V      P
Sbjct: 15913 YVVKLTNSAGEAIETLNVIVLDKPGPP 15939



 Score = 35.8 bits (81), Expect = 0.31
 Identities = 54/249 (21%), Positives = 84/249 (33%), Gaps = 22/249 (8%)

Query: 1176 IEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEG 1235
            I E  + D G Y  +    R      L +       +  EL  +   S  P +      G
Sbjct: 3161 ISETRQSDAGEYTFVAG--RNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISG 3218

Query: 1236 IRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEI 1295
             R   K+ +Y  E + +T F K K L  G          E  L +++    D   YT E 
Sbjct: 3219 -RPQPKISWYKEEQLLSTGF-KCKFLHDGQ---------EYTLLLIEAFPEDAAVYTCEA 3267

Query: 1296 AAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLT 1355
                 V   S  LS +  E    + +       +      ++  L D  T  E +     
Sbjct: 3268 KNDYGVATTSASLSVEVPEVVSPDQE-------MPVYPPAIITPLQDTVT-SEGQPARFQ 3319

Query: 1356 CIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGS 1415
            C VSG    ++SW   D+ +     +RM        + I +   ED G Y     N  G 
Sbjct: 3320 CRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQ 3378

Query: 1416 ETGQVTISV 1424
             +    +S+
Sbjct: 3379 VSSTANLSL 3387



 Score = 35.8 bits (81), Expect = 0.31
 Identities = 19/81 (23%), Positives = 36/81 (44%), Gaps = 2/81 (2%)

Query: 1354  LTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKY 1413
             +T    G P P + W K D  +    R  ++   +  ++TIE  N  DSG+Y + ++N  
Sbjct: 19901 MTVPFRGRPVPNVLWSKPDTDLR--TRAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVL 19958

Query: 1414  GSETGQVTISVFKHGDEPKEL 1434
              + +  + + V      P  +
Sbjct: 19959 SAASLTLVVKVLDTPGPPTNI 19979



 Score = 35.8 bits (81), Expect = 0.31
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 2/63 (3%)

Query: 1251  KTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKY--TLEIAAGKEVRQLSTDL 1308
             K TW  ++ RL+  DR+   TT D   L + D    D G+Y  TLE  AG +   ++  +
Sbjct: 22373 KVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVV 22432

Query: 1309  SGQ 1311
              G+
Sbjct: 22433 IGR 22435



 Score = 35.0 bits (79), Expect = 0.52
 Identities = 20/65 (30%), Positives = 30/65 (46%)

Query: 1360 GDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQ 1419
            GDPT  + WL + +P+   +R RM       ++      S DSG       NKYG++   
Sbjct: 1684 GDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTS 1743

Query: 1420 VTISV 1424
             T+ V
Sbjct: 1744 ATLIV 1748



 Score = 35.0 bits (79), Expect = 0.52
 Identities = 19/43 (44%), Positives = 25/43 (58%)

Query: 1253 TWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEI 1295
            TW   DK LE+GDR++  T      L I   + SDKG YTL++
Sbjct: 7122 TWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKL 7164



 Score = 34.7 bits (78), Expect = 0.68
 Identities = 32/148 (21%), Positives = 70/148 (47%), Gaps = 13/148 (8%)

Query: 955  KVILKEPGLEDLGTYSVI----VTDADEDISASHTLTEEELEKLK-----KLSHEIRNPV 1005
            K+++++PG    G   ++    + DAD+  + ++T+T E    L+     K+   IR+ +
Sbjct: 4944 KIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWL 5003

Query: 1006 IKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEV 1065
            +K I   ++    +G      ++ K +P  +    ++  EI + PN K    R+   + +
Sbjct: 5004 VKPIRDQHVK--PKGTAIFACDIAKDTPNIKWFKGYD--EIPAEPNDKTEILRDGNHLYL 5059

Query: 1066 IIQNLSEEDKGSYTAQLQDGKAKNQITL 1093
             I+N   ED   Y  +++  +   ++TL
Sbjct: 5060 KIKNAMPEDIAEYAVEIEGKRYPAKLTL 5087



 Score = 34.3 bits (77), Expect = 0.89
 Identities = 24/89 (26%), Positives = 37/89 (41%), Gaps = 5/89 (5%)

Query: 160  LRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRIT-NNYGLLSLEIR 218
            ++++ + E   V   C +   P P++ WYK+  RI        +Y++     G  SL I 
Sbjct: 1251 IKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIK----HGERYQMDFLQDGRASLRIP 1306

Query: 219  RCAIEDSATYTVRVKNAHGQASSFAKVLV 247
                ED   YT    N  G A    K+ V
Sbjct: 1307 VVLPEDEGIYTAFASNIKGNAICSGKLYV 1335



 Score = 34.3 bits (77), Expect = 0.89
 Identities = 35/184 (19%), Positives = 76/184 (41%), Gaps = 15/184 (8%)

Query: 1228 KIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSD 1287
            +++G +   R+F  V    +++M      +D+ ++ G+       L    +H++  K+  
Sbjct: 5252 EVEGKKTSARLF--VTGIRLKFMSPL---EDQTVKEGETATFVCELSHEKMHVVWFKNDA 5306

Query: 1288 KGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIM 1347
            K   +  +    E +    ++     +D      ++K L+     + KV+   P     +
Sbjct: 5307 KLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELS--STAQLKVLEADPYFTVKL 5364

Query: 1348 EDKT------LCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSED 1401
             DKT      + L C VS D    + W K+ + +    +Y ++  G    + I+K + +D
Sbjct: 5365 HDKTAVEKDEITLKCEVSKDVP--VKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKD 5422

Query: 1402 SGRY 1405
             G Y
Sbjct: 5423 KGEY 5426



 Score = 33.9 bits (76), Expect = 1.2
 Identities = 32/114 (28%), Positives = 50/114 (43%), Gaps = 7/114 (6%)

Query: 1299 KEVRQLSTDLSGQAFEDAM-----AEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLC 1353
            K+  + S  +   AFED       AE +      IIE  R K +  L DV T  E ++  
Sbjct: 5584 KDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDV-TAKEKESAV 5642

Query: 1354 LTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGV 1407
             T  +S D    + W KNDQ +       M+  G   +IT + ++ +D+ +  V
Sbjct: 5643 FTVELSHDNI-RVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRV 5695



 Score = 33.9 bits (76), Expect = 1.2
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 4/74 (5%)

Query: 1354  LTCIVSGDPTPEISWLKNDQPVTFLD--RYRM-EVRGTEVTITIEKVNSEDSGRYGVFVK 1410
             L C V+G P P + W +  + +   D  +YR+ E +G    + I  V  +D+  Y V   
Sbjct: 24642 LVCKVTGHPKPIVKWYRQGKEI-IADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRAT 24700

Query: 1411  NKYGSETGQVTISV 1424
             N+ GS +G  ++ V
Sbjct: 24701 NQGGSVSGTASLEV 24714



 Score = 33.5 bits (75), Expect = 1.5
 Identities = 21/86 (24%), Positives = 38/86 (44%), Gaps = 2/86 (2%)

Query: 1345 TIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGR 1404
            T+ +   + L   V+G PTP + + ++   +     +++   G   ++ I +   EDSG 
Sbjct: 114  TVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGT 173

Query: 1405 YGVFVKNKYGSETGQVTISVFKHGDE 1430
            Y V   N  G  T   T  +   G+E
Sbjct: 174  YSVNATNSVGRATS--TAELLVQGEE 197



 Score = 33.5 bits (75), Expect = 1.5
 Identities = 18/74 (24%), Positives = 34/74 (45%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             +SG P P I W K+D+ +       +E      +I I+  +  +SG Y + ++N  GS +
Sbjct: 20591 ISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSAS 20650

Query: 1418  GQVTISVFKHGDEP 1431
               + + +      P
Sbjct: 20651 ATIRVQILDKPGPP 20664



 Score = 33.1 bits (74), Expect = 2.0
 Identities = 51/224 (22%), Positives = 88/224 (39%), Gaps = 42/224 (18%)

Query: 304  IQWFRDGSLLRSSRRRKILYT-DRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLV 362
            I W++DG  ++   R ++ +  D +ASL++     EDEG+Y     +  G    S  + V
Sbjct: 1276 IAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYV 1335

Query: 363  RDAEAENPGAP-GSPLNVRCLD------------VNRDCLILTWAPPSDTRGNPITAYTI 409
                   P AP G+P  +  L+            V+R  + ++ A  S  R +P      
Sbjct: 1336 ------EPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPA 1389

Query: 410  ERCQGESGEWIACHEAPGGTCRCPIQGL-------VEGQSYRFRVRAISRVGSSVPSKAS 462
                G   E     E+       P+  L       +EGQ+ RF ++    VG  +P    
Sbjct: 1390 RMSPGRRLE--ETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKV---VGRPMPE--- 1441

Query: 463  ELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTN 506
                   HD      +I  D  +K+ I  D  +  + +P+ P++
Sbjct: 1442 ---TFWFHDG----QQIVNDYTHKVVIKEDGTQSLIIVPATPSD 1478



 Score = 33.1 bits (74), Expect = 2.0
 Identities = 37/166 (22%), Positives = 69/166 (41%), Gaps = 29/166 (17%)

Query: 179  ASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT-VRVKNAHG 237
            + P  +V WYK+   +        KYR+ ++  +  L I      D+  Y+ V V++ + 
Sbjct: 2153 SEPFVKVKWYKDGMEVH----EGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENV 2208

Query: 238  QASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSED 297
            + +  AK++V                    G  VEF   L+ +   E     L C+ S +
Sbjct: 2209 KTT--AKLIVE-------------------GAVVEFVKELQDIEVPESYSGELECIVSPE 2247

Query: 298  VLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
             ++ +   W+ +   L+S+ +  I     + +L V    KED+G Y
Sbjct: 2248 NIEGK---WYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEY 2290



 Score = 32.3 bits (72), Expect = 3.4
 Identities = 38/177 (21%), Positives = 64/177 (36%), Gaps = 33/177 (18%)

Query: 167  EHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSA 226
            E+ TV    +V     P V W+     I P    + K+R+ +   +  L ++  +  D+ 
Sbjct: 2762 ENATVAFEVSVSHDTVP-VKWFHKSVEIKP----SDKHRLVSERKVHKLMLQNISPSDAG 2816

Query: 227  TYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKE 286
             YT  V    GQ    AK+ V T                     +  T  +K +   E +
Sbjct: 2817 EYTAVV----GQLECKAKLFVET---------------------LHITKTMKNIEVPETK 2851

Query: 287  PFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
              S  C  S   + +    W ++G  +  S + KI+   +   L +  T  ED   Y
Sbjct: 2852 TASFECEVSHFNVPS---MWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEY 2905



 Score = 32.3 bits (72), Expect = 3.4
 Identities = 28/120 (23%), Positives = 52/120 (43%), Gaps = 13/120 (10%)

Query: 227  TYTVRVKNAH-GQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREK 285
            T+++ ++N H G A+ +      T++   A   + ++  +     +EF   +K +   EK
Sbjct: 2976 THSLNIRNVHFGDAADY------TFVAGKATSTATLYVEARH---IEFRKHIKDIKVLEK 3026

Query: 286  EPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMV 345
            +     C  SE  +   ++QW +D   L+ + R KI        L +  T   D G Y V
Sbjct: 3027 KRAMFECEVSEPDI---TVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTV 3083



 Score = 32.3 bits (72), Expect = 3.4
 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 2/67 (2%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYG--S 1415
             ++G P P  SW      +   +R  +E       +TI +    D+G Y + +KN  G  S
Sbjct: 23457 IAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTS 23516

Query: 1416  ETGQVTI 1422
             ET +V I
Sbjct: 23517 ETIKVII 23523



 Score = 32.0 bits (71), Expect = 4.4
 Identities = 20/99 (20%), Positives = 39/99 (39%), Gaps = 7/99 (7%)

Query: 1340 LPDVATIMEDKTLCLTCIVSGDPTPEISWLK-------NDQPVTFLDRYRMEVRGTEVTI 1392
            L +   + E   + +   + G P P ++W K       N +PV +       V     T+
Sbjct: 9817 LKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTL 9876

Query: 1393 TIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEP 1431
             I +    D+G Y +   N  G+ + ++ ++V      P
Sbjct: 9877 VIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPP 9915



 Score = 31.6 bits (70), Expect = 5.8
 Identities = 22/73 (30%), Positives = 28/73 (38%), Gaps = 5/73 (6%)

Query: 165  VWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIED 224
            V E  T    C V   P P+V WY N      +L R  K       G+  L+I  C   D
Sbjct: 1806 VLEGETARFRCRVTGYPQPKVNWYLNG-----QLIRKSKRFRVRYDGIHYLDIVDCKSYD 1860

Query: 225  SATYTVRVKNAHG 237
            +    V  +N  G
Sbjct: 1861 TGEVKVTAENPEG 1873



 Score = 31.2 bits (69), Expect = 7.5
 Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 2/92 (2%)

Query: 275 SVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSC 334
           S LK V   E E  +L C  S     + ++ W+R+   + SS   +I +    A L +  
Sbjct: 901 SGLKNVTVIEGESVTLECHISG--YPSPTVTWYREDYQIESSIDFQITFQSGIARLMIRE 958

Query: 335 TYKEDEGLYMVRVPSPFGPREQSTYVLVRDAE 366
            + ED G +     +  G    S Y+ V+ +E
Sbjct: 959 AFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSE 990



 Score = 31.2 bits (69), Expect = 7.5
 Identities = 43/182 (23%), Positives = 64/182 (35%), Gaps = 25/182 (13%)

Query: 1251 KTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAA--GKEV--RQLST 1306
            K  WF     L      +     D+  L IL  K  D+G+YT   +   GK +    L  
Sbjct: 3679 KIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKI 3738

Query: 1307 DLSGQAFEDAMAEHQRLKTLAII----------EKNRAKVVRGLPDVATIMEDKTLCLTC 1356
            +  G+  +D   E    K+L  +          E    +  +GLP +             
Sbjct: 3739 NSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAI----------FEY 3788

Query: 1357 IVSGDPTPEISWLK-NDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGS 1415
             V G+P P ++W K N Q  T +    +       T  +     EDSG Y    +N  G 
Sbjct: 3789 TVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGE 3848

Query: 1416 ET 1417
             T
Sbjct: 3849 ST 3850



 Score = 31.2 bits (69), Expect = 7.5
 Identities = 16/67 (23%), Positives = 28/67 (41%), Gaps = 2/67 (2%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             VSG P P ++W  N++  T      +E      ++ I+       G Y +  KN+ G   
Sbjct: 10243 VSGKPPPTVTWNMNER--TLPQEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERK 10300

Query: 1418  GQVTISV 1424
               + + V
Sbjct: 10301 KTIIVDV 10307



 Score = 31.2 bits (69), Expect = 7.5
 Identities = 23/115 (20%), Positives = 48/115 (41%), Gaps = 1/115 (0%)

Query: 1321  QRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDR 1380
             + +K   I+E     +   +  +  +     + L  IV G P P+++W K       + +
Sbjct: 12288 EAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGID-NVVRK 12346

Query: 1381  YRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
              ++++  T   + I     +DSG+Y + + N  G +   V + V        +LK
Sbjct: 12347 GQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLK 12401



 Score = 31.2 bits (69), Expect = 7.5
 Identities = 34/168 (20%), Positives = 66/168 (39%), Gaps = 31/168 (18%)

Query: 1253  TWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQA 1312
             +W    + L+   R+    T     LHI +    D GKYT+           +T+ +G A
Sbjct: 18039 SWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTV----------TATNSAGTA 18088

Query: 1313  FEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTP-----EIS 1367
              E+         ++ ++EK         P V  +  D+      ++S +P       +IS
Sbjct: 18089 TENL--------SVIVLEKPG-------PPVGPVRFDEVSADFVVISWEPPAYTGGCQIS 18133

Query: 1368  -WLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYG 1414
              ++   +  T    + +       TI I K+ +    ++ +F +N+YG
Sbjct: 18134 NYIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYG 18181



 Score = 30.8 bits (68), Expect = 9.8
 Identities = 15/38 (39%), Positives = 18/38 (47%)

Query: 159  PLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDP 196
            PL+   V E T  +L C V       V WY ND +I P
Sbjct: 2404 PLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKP 2441



 Score = 30.8 bits (68), Expect = 9.8
 Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 1051  NRKINFDREKGLVEVIIQNLSEEDKGSYTA----QLQDGKAKNQITLTLVDDDFDKLLR 1105
             ++K  F+ +KGL ++ I +++ +D   YT     +  +   K ++T+TL     D  LR
Sbjct: 25431 DKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLR 25489



 Score = 30.8 bits (68), Expect = 9.8
 Identities = 30/123 (24%), Positives = 55/123 (44%), Gaps = 6/123 (4%)

Query: 977   DEDISASHTLTEEELEKLK---KLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSP 1033
             DE I    + T+E + K +    LS E+ +    +    + +I E   V    E+    P
Sbjct: 26798 DEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISG-EP 26856

Query: 1034  AAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITL 1093
             + E+    NN  I  S N  ++  R + +  + I+N S  D G YT + ++ + +   T 
Sbjct: 26857 SPEIEWFKNNLPISISSN--VSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATA 26914

Query: 1094  TLV 1096
             +L+
Sbjct: 26915 SLM 26917


>gi|110349713 titin isoform novex-1 [Homo sapiens]
          Length = 27051

 Score =  274 bits (701), Expect = 4e-73
 Identities = 215/831 (25%), Positives = 361/831 (43%), Gaps = 81/831 (9%)

Query: 169  TTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATY 228
            T + L  TV   P P++TW    T+ D  L +  +  I N     ++ I      D+ TY
Sbjct: 7334 TKIELPATVTGKPEPKITW----TKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTY 7389

Query: 229  TVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPF 288
             +   N  G+A++  +V V    G  A FD               T V            
Sbjct: 7390 IIEAVNVCGRATAVVEVNVLDKPGPPAAFD--------------ITDVTNE--------- 7426

Query: 289  SLSCLFS----EDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYM 344
              SCL +     D   ++   +  +     S    K+  T +  + K +      E ++ 
Sbjct: 7427 --SCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFR 7484

Query: 345  VRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPI 404
            V   + +G  E      +      +P  PG P  +   D+ +D + LTW  P D  G+PI
Sbjct: 7485 VAAENMYGVGEPVQASPITAKYQFDP--PGPPTRLEPSDITKDAVTLTWCEPDDDGGSPI 7542

Query: 405  TAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASEL 464
            T Y +ER   ++ +W+ C++ P       ++GL   + YRFRV A +  G   PSK++E 
Sbjct: 7543 TGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEP 7602

Query: 465  VVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEP 524
            +++                           +D +  P PP      ++ +  V L W +P
Sbjct: 7603 ILI---------------------------KDPIDPPWPPGKPTVKDVGKTSVRLNWTKP 7635

Query: 525  SPRDRAPL-TYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGL 583
                 A + +Y +E    G+  W  ++   P  + +  +  L + + Y FRVRA+N+ G 
Sbjct: 7636 EHDGGAKIESYVIEMLKTGTDEWVRVAEGVP--TTQHLLPGLMEGQEYSFRVRAVNKAGE 7693

Query: 584  SDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWD-PVKD--PELLGYYIYSRKV 640
            S+PSEPS+P+  R       PP  ++    T+ +  L W  P KD    +  Y +  R V
Sbjct: 7694 SEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDV 7753

Query: 641  GTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATP 700
                WQTV+   ++ T+ TV  L  G  Y F V + +  G  + +   + +  K    TP
Sbjct: 7754 RRKGWQTVDTT-VKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTP 7812

Query: 701  SAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCK 760
              PY  A+++  K  + + W+PPK  GG  I  Y +++ +     W    +   P    +
Sbjct: 7813 GPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFR 7872

Query: 761  VSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVL 820
            V+D+ EG   +F+ RA N AGVG  S P+ +   ++ T P P PP D+  ++     + +
Sbjct: 7873 VTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSP-PSPPLDLHVTDAGRKHIAI 7931

Query: 821  QWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSD-LQPGKSYVFQVQAM 879
             W+PP   G  P+ GYHV     G+E+W  V   PI     +V + + P K YV +V+A+
Sbjct: 7932 AWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAV 7991

Query: 880  NSAGLGQPSMPTDPVLLED---KP----GAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQW 932
            N+ G+ +PS  ++ V+ +D   KP      H+I V   E+  I + F A   P  S   W
Sbjct: 7992 NAIGVSEPSEISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVS---W 8048

Query: 933  SKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISAS 983
             KD K      R+ +++    + + + +    D G Y++ + +     +AS
Sbjct: 8049 HKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATAS 8099



 Score =  227 bits (579), Expect = 5e-59
 Identities = 173/602 (28%), Positives = 259/602 (43%), Gaps = 86/602 (14%)

Query: 373  PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRC 432
            P  P NV+  D   + + LTW PP +  G+ I  Y +ERC   S +W+AC E P    + 
Sbjct: 7216 PDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGE-PVAETKM 7274

Query: 433  PIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARR----------------- 475
             + GL EG+ Y +RV+A++R G+S PS+ +E +   D   A                   
Sbjct: 7275 EVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGT 7334

Query: 476  KTEIPFDLGNK-------------------ITISTDAFEDTVTI---------------- 500
            K E+P  +  K                   ITI     + TVTI                
Sbjct: 7335 KIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAV 7394

Query: 501  -----------------PSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIG 542
                             P PP     +++     +L W  P     + +T Y +E+    
Sbjct: 7395 NVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATD 7454

Query: 543  SGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALR---GPP 599
            S  W  +S  S V+   F    L   K Y+FRV A N YG+ +P + S PI  +    PP
Sbjct: 7455 SEVWHKLS--STVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQAS-PITAKYQFDPP 7511

Query: 600  ATLPPPAQVQAFRDTQTSVSLTW-DPVKD--PELLGYYIYSRKVGTSEWQTVNNKPIQGT 656
                PP +++    T+ +V+LTW +P  D    + GY++      T +W   N  P++ T
Sbjct: 7512 G---PPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDT 7568

Query: 657  RFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEM 716
             + V GL   K+Y F V + + AG G+ S +TEPI +K  +  P  P    + + GK  +
Sbjct: 7569 TYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSV 7628

Query: 717  VIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARA 776
             + W  P+  GG KI  Y ++   +   +W  V  + +PT    +  L EG  Y FR RA
Sbjct: 7629 RLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRV-AEGVPTTQHLLPGLMEGQEYSFRVRA 7687

Query: 777  ANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGY 836
             N AG  E S PS    C+E   P P PP  +    +   +  L+W  P   G  P+T Y
Sbjct: 7688 VNKAGESEPSEPSDPVLCREKLYP-PSPPRWLEVINITKNTADLKWTVPEKDGGSPITNY 7746

Query: 837  HVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLL 896
             V  ++   + W+ V    +  T   V+ L  G  YVF+V A N+ G    +   D VL 
Sbjct: 7747 IVEKRDVRRKGWQTVDT-TVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLA 7805

Query: 897  ED 898
            +D
Sbjct: 7806 KD 7807



 Score =  221 bits (564), Expect = 3e-57
 Identities = 228/925 (24%), Positives = 366/925 (39%), Gaps = 96/925 (10%)

Query: 194   IDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVK--NAHGQASSFAKVLVRTYL 251
             ++ RL    K+    N  LLS +     +++  TY  RV   N  GQ             
Sbjct: 10381 LESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQ------------- 10427

Query: 252   GKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGS 311
             GK +     I  +    P          +  R  E F+L+  +S        + WF+D +
Sbjct: 10428 GKPSFCTKPITCKDELAPPTLHLDFRDKLTIRVGEAFALTGRYSGK--PKPKVSWFKDEA 10485

Query: 312   LLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPG 371
              +    R  I  T    +L+     + D G Y V V +  G R+    V V D     PG
Sbjct: 10486 DVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVD----RPG 10541

Query: 372   APGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCR 431
              P  P++    +V +D ++++W PP D  G+ IT Y IE+ +     W+    A   T  
Sbjct: 10542 PPVGPVSFD--EVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKT-T 10598

Query: 432   CPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITIST 491
             C +  L+EG+ Y FR+ A +  G S P  +  +                           
Sbjct: 10599 CKVSKLLEGKDYIFRIHAENLYGISDPLVSDSMKA------------------------- 10633

Query: 492   DAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISS 551
                +D   +P  P     +E+ +   ++ W +P    +    Y LEK    S  W  ++ 
Sbjct: 10634 ---KDRFRVPDAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKRETMSKRWARVTK 10690

Query: 552   ESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAF 611
             +      +F V DL +   Y FRV A N+ G+ DPS PS+P+  + P A   PP   +A 
Sbjct: 10691 DPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAI 10750

Query: 612   RDTQTSVSLTWDPVK---DPELLGYYIYSRKVGTSEWQTVNNKP--IQGTRFTVPGLRTG 666
               T  SV LTW P +     ++LGY +  +KVG  EW+  N+ P     T++ V GLR G
Sbjct: 10751 DTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDG 10810

Query: 667   KEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRR 726
             + Y+F V +V+ AG  + +   EP+ VK  L  P         N  + + +       + 
Sbjct: 10811 QTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPEL---ILDANMAREQHI-------KV 10860

Query: 727   GGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELS 786
             G    L   +      ++ W     +  PT+  ++     G   E R  A    G+  L+
Sbjct: 10861 GDTLRLSAIIKGVPFPKVTWKK-EDRDAPTK-ARIDVTPVGSKLEIRNAAHEDGGIYSLT 10918

Query: 787   ----APSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQE 842
                 A S     K   + +PGPP D+  SE+R  S  L W+ PL  G   +T Y V  ++
Sbjct: 10919 VENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRD 10978

Query: 843   EGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLG------QPSMPTDPVLL 896
               S QW P++      +H     L  G  Y+F+V A N  G G      +P    DP+  
Sbjct: 10979 VASAQWSPLSATSKKKSHF-AKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHP 11037

Query: 897   EDKP-GAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQ-WSKDYKGPLDPQRVKIEDKVNKS 954
                P   H ++V   E   + L +  P+    S    +  +Y+       +K +   N  
Sbjct: 11038 PGPPKDLHHVDVDKTE---VSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKTVTNLE 11094

Query: 955   KVILKEPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNI 1014
              V+    GL+   TY   V  A+  +      T   +E  +KL        +KLI G   
Sbjct: 11095 CVV---TGLQQGKTYRFRV-KAENIVGLGLPDTTIPIECQEKLVPPSVELDVKLIEGL-- 11148

Query: 1015  DILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEED 1074
              +++ G    +  + +  P        +  EI +  +  +  D    +  + I+N    D
Sbjct: 11149 -VVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSV--LTIKNCLRRD 11205

Query: 1075  KGSY--TAQLQDGKAKNQITLTLVD 1097
              G Y  T     G     + LT++D
Sbjct: 11206 TGEYQITVSNAAGSKTVAVHLTVLD 11230



 Score =  213 bits (542), Expect = 1e-54
 Identities = 170/663 (25%), Positives = 296/663 (44%), Gaps = 72/663 (10%)

Query: 338   EDEGLYMVRVPSPFG---PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWA 394
             E +  + VR  + FG   P E       RD        P  P+ ++   + ++ + L+W 
Sbjct: 9606  EQQYFFRVRAENRFGIGPPVETIQRTTARDPIYP----PDPPIKLKIGLITKNTVHLSWK 9661

Query: 395   PPSDTRGNPITAYTIERCQGE-----SGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRA 449
             PP +  G+P+T Y +E    +        W  C++      +  ++ LVEG  Y FRV+A
Sbjct: 9662  PPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKA 9721

Query: 450   ISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHA 509
             ++  G S PS       +G  D  R       DL   + +     E+   +     N+ A
Sbjct: 9722  VNAAGVSKPS-----ATVGPCDCQRPDMPPSIDLKEFMEV-----EEGTNV-----NIVA 9766

Query: 510   SEIREAYVVLAWEEPSPR---DRAPLTYSLE-KSVIGSGTWEAISSESPVRSPRFAVLDL 565
                   +  L W +  P+   ++ P+ Y      ++   T   +  +S            
Sbjct: 9767  KIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQS------------ 9814

Query: 566   EKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPV 625
              +  + ++ + A+N  G +        +   GPP     P + ++    Q  ++L+W P 
Sbjct: 9815  RRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVG---PIKFESVSADQ--MTLSWFPP 9869

Query: 626   KDP---ELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVG 682
             KD    ++  Y I  R+     W  V+++P + T +T+P L  G EY F + + ++ G+G
Sbjct: 9870  KDDGGSKITNYVIEKREANRKTWVHVSSEPKECT-YTIPKLLEGHEYVFRIMAQNKYGIG 9928

Query: 683   ESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSE 742
             E    +EP   +   + P AP    + +  +N M + W+ P+  GG  + GY+L+  D+ 
Sbjct: 9929  EP-LDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTT 9987

Query: 743   ELDWHAVNQQPIPTRVC----KVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWT 798
                W  VN+ PI         KV+ L EG  Y+FR  A N AGVG  S PS     ++  
Sbjct: 9988  SKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPI 10047

Query: 799   MPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISG 858
              P PGPP+  + ++   +S  L+W PPL  G   VTGY V ++EEG E+W+      + G
Sbjct: 10048 AP-PGPPFP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRG 10105

Query: 859   THLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEVGVDEEGFI--- 915
             T L V+ L+ G  Y F+V+A+N AG+G+P   TD + ++D+  + ++++       I   
Sbjct: 10106 TKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVH 10165

Query: 916   ------YLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTY 969
                    +A+ + + P +    W+ + +    PQ   IE     S +++K       G Y
Sbjct: 10166 AGGVIRIIAYVSGKPPPT--VTWNMNER--TLPQEATIETTAISSSMVIKNCQRSHQGVY 10221

Query: 970   SVI 972
             S++
Sbjct: 10222 SLL 10224



 Score =  206 bits (524), Expect = 1e-52
 Identities = 222/873 (25%), Positives = 358/873 (41%), Gaps = 94/873 (10%)

Query: 139  VQEAKELRELCYGRGPWF--WIPLRSH--AVWEHTTVLLTCTVQASPPPQVTWYKNDTRI 194
            V E  E+ E    + P     I L +H   V E   + +    +A P P V+W+K+   +
Sbjct: 7996 VSEPSEISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEV 8055

Query: 195  DPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKD 254
                  + +  + N++    LE+ +    D+  YT+ ++N  G A++   V V    G  
Sbjct: 8056 KA----SDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPC 8111

Query: 255  AGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLR 314
                +    +S                         SC  + +  + +         L R
Sbjct: 8112 KDIKASDITKS-------------------------SCKLTWEPPEFDGGTPILHYVLER 8146

Query: 315  SSRRRKILYTDRQASLKVSCTYKE--DEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGA 372
                R+          K+S T K+    G Y  RV +           L     A++P  
Sbjct: 8147 REAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQ 8206

Query: 373  PGSP-LNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCR 431
            P  P ++V   +   + + +TW PP    G+ I  Y IE+       W  C+E       
Sbjct: 8207 PPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILT 8266

Query: 432  CPIQGLVEGQSYRFRVRAISRVGSSVPSKASE-----------LVVMGDHDAARRKTEIP 480
               +GL EG+ Y+FRVRA +  G S PS+A+             V++      +R  EI 
Sbjct: 8267 YTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIA 8326

Query: 481  FDL---GNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLE 537
             D    G+     T   ++ V +P       A  +R     +  EEP      PLT  L 
Sbjct: 8327 LDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFV---LPLTQRLS 8383

Query: 538  KSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRG 597
                  G       ES +R     V D  +    ++ ++  N +G++        +   G
Sbjct: 8384 IDNSKKG-------ESQLR-----VRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPG 8431

Query: 598  PPATLPPPAQVQAFRDTQ-TSVSLTWDPVKDP---ELLGYYIYSRKVGT--SEWQTVNNK 651
            PP           F D + TSV   W+P  D    E++ Y +  +      SEW  V + 
Sbjct: 8432 PPINF-------VFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTST 8484

Query: 652  PIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNC 711
             ++  +++V  L  GKEY F VR+ +  G G     ++P+  K     P AP    + + 
Sbjct: 8485 -LRHCKYSVTKLIEGKEYLFRVRAENRFGPGPP-CVSKPLVAKDPFGPPDAPDKPIVEDV 8542

Query: 712  GKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYE 771
              N M++ W  PK  G   ILGY+L++ +     W  VN+  +      V  L EG  Y 
Sbjct: 8543 TSNSMLVKWNEPKDNGS-PILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYV 8601

Query: 772  FRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAG 831
            FR  A N AG G+ S PS      +   P PGPP   R ++  +T++ L+WEPP + G G
Sbjct: 8602 FRVCAENAAGPGKFSPPSDPKTAHDPISP-PGPPIP-RVTDTSSTTIELEWEPPAFNGGG 8659

Query: 832  PVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPT 891
             + GY V  Q  G+ +W   T   I      V +++ G  Y  +V A+N+AG G P   T
Sbjct: 8660 EIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPG-ET 8718

Query: 892  DPVLLED--KPGAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQ------WSKDYKGPLDPQ 943
             PV + +  +P A E++V V + G   +A +    P     +      W+K+ +G LD  
Sbjct: 8719 QPVTVAEPQEPPAVELDVSV-KGGIQIMAGKTLRIPAVVTGRPVPTKVWTKE-EGELDKD 8776

Query: 944  RVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDA 976
            RV I++   KS++I+K+   +D G Y +  T++
Sbjct: 8777 RVVIDNVGTKSELIIKDALRKDHGRYVITATNS 8809



 Score =  201 bits (512), Expect = 3e-51
 Identities = 209/819 (25%), Positives = 323/819 (39%), Gaps = 106/819 (12%)

Query: 179  ASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQ 238
            A P  +  W+K +  +  +        I       S  I      D   Y + ++N HG+
Sbjct: 6653 AYPKAEAEWFKENEPLSTKT-------IDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGK 6705

Query: 239  ASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDV 298
            A  F  + V                       ++    ++ +   E     +S  + E +
Sbjct: 6706 AEGFINLKV-----------------------IDVPGPVRNLEVTETFDGEVSLAWEEPL 6742

Query: 299  LDAES--IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGL-YMVRVPSPFGPRE 355
             D  S  I +  +   ++  R+  +L TDR  S + + T  +  G+ Y+ RV +      
Sbjct: 6743 TDGGSKIIGYVVERRDIK--RKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSA------ 6794

Query: 356  QSTYVLVRDAEAENP-------GAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYT 408
            ++        E +NP         PG PLNV   DVNR  + LTW PP    G  IT Y 
Sbjct: 6795 RNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYV 6854

Query: 409  IERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMG 468
            IE     S  W              +  +VEGQ Y FRVRA +R+G   PS A+  V + 
Sbjct: 6855 IELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVA 6914

Query: 469  DHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRD 528
            D                            +  PSPP N+ +S+  ++ V L WE P    
Sbjct: 6915 D---------------------------PIERPSPPVNLTSSDQTQSSVQLKWEPPLKDG 6947

Query: 529  RAP-LTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPS 587
             +P L Y +E+   G   W   + +  V    + V  LEK   Y++RV A N+ G+SDPS
Sbjct: 6948 GSPILGYIIERCEEGKDNWIRCNMKL-VPELTYKVTGLEKGNKYLYRVSAENKAGVSDPS 7006

Query: 588  EPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQT 647
            E   P  L    A + P   + AF+D    +      V +P  +          T+ W  
Sbjct: 7007 EILGP--LTADDAFVEPTMDLSAFKDGLEVI------VPNPITILVPSTGYPRPTATWCF 7058

Query: 648  VNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVK-----QALATPSA 702
             +     G R  +  L    E        S+ G+           +        +A PSA
Sbjct: 7059 GDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSA 7118

Query: 703  PYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVS 762
            P      +  K+ + + W+PP   GG  + GY +++ +     W  V    +      V 
Sbjct: 7119 PKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV-MDFVTDLEFTVP 7177

Query: 763  DLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQ--PGPPYDVRASEVRATSLVL 820
            DL +G  Y F+  A N  G GE   P+ + E    + P   P PP +V+  +  A S+ L
Sbjct: 7178 DLVQGKEYLFKVCARNKCGPGE---PAYVDEPVNMSTPATVPDPPENVKWRDRTANSIFL 7234

Query: 821  QWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPG-PISGTHLRVSDLQPGKSYVFQVQAM 879
             W+PP   G   + GY V     GS++W  V  G P++ T + V+ L+ GK Y ++V+A+
Sbjct: 7235 TWDPPKNDGGSRIKGYIVERCPRGSDKW--VACGEPVAETKMEVTGLEEGKWYAYRVKAL 7292

Query: 880  NSAGLGQPSMPTDPVLLEDKPGAHEIEVGVD-EEGFIYLAFEAPEAP------DSSEFQW 932
            N  G  +PS PT+ +   D   A EI + V    G    A    E P         +  W
Sbjct: 7293 NRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITW 7352

Query: 933  SKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSV 971
            +K        +R+ IE+   KS V + +    D GTY +
Sbjct: 7353 TKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYII 7391



 Score =  199 bits (506), Expect = 2e-50
 Identities = 177/674 (26%), Positives = 281/674 (41%), Gaps = 59/674 (8%)

Query: 376   PLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQ 435
             P NVR  D++++ + L+W  P+   G+ IT Y +ER     G W           +  I 
Sbjct: 20399 PRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIIS 20458

Query: 436   GLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFE 495
             GL +   Y FRV A + VGS   S  SE+V                     IT       
Sbjct: 20459 GLTQNSQYEFRVFARNAVGSI--SNPSEVV-------------------GPITCIDSYGG 20497

Query: 496   DTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPV 555
               + +P   T V       +  + A     P   AP T    K      T   +  E+  
Sbjct: 20498 PVIDLPLEYTEVVKYRAGTSVKLRAGISGKP---AP-TIEWYKDDKELQTNALVCVENTT 20553

Query: 556   RSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQ 615
                   + D ++  S  + ++  N  G +  +   + +   GPP        ++    T 
Sbjct: 20554 DLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPG-----GPIEFKTVTA 20608

Query: 616   TSVSLTWDPVKDP---ELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFC 672
               ++L W P  D    ++  Y +  R+     W  V+   ++    T   +  G EY F 
Sbjct: 20609 EKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEH-LEECIITTTKIIKGNEYIFR 20667

Query: 673   VRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKIL 732
             VR+V++ G+GE    ++ +  K A  TP  P    +    KN M + W  P   GG  I 
Sbjct: 20668 VRAVNKYGIGEP-LESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDIS 20726

Query: 733   GYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLF 792
             GYFL++ D + L W  V ++ I     KV+ L E   Y++R  A N AG G  S PS  +
Sbjct: 20727 GYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFY 20786

Query: 793   ECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPV- 851
             +  +   P PGPP  +R ++   +S+ L W  P+Y G   VTGY V  ++   E+W  V 
Sbjct: 20787 KAADPIDP-PGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVS 20845

Query: 852   TPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEVGV-- 909
             T G +  T   VS+L+PG +Y F+V A+N AG G+P    +PV  +D   A EI++ V  
Sbjct: 20846 TKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVAL 20905

Query: 910   --------DEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEP 961
                      E+  + + F+    P  +   W KD K      R  IE+  + S + + + 
Sbjct: 20906 RTSVIAKAGEDVQVLIPFKGRPPPTVT---WRKDEKNLGSDARYSIENTDSSSLLTIPQV 20962

Query: 962   GLEDLGTYSVIVTDA-----DEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDI 1016
                D G Y + + +         +S     T    +KL ++ H  R  V  L   W+  +
Sbjct: 20963 TRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKL-QVKHVSRGTVTLL---WDPPL 21018

Query: 1017  LERGEVRLWLEVEK 1030
             ++ G   +   +EK
Sbjct: 21019 IDGGSPIINYVIEK 21032



 Score =  193 bits (491), Expect = 9e-49
 Identities = 171/677 (25%), Positives = 283/677 (41%), Gaps = 77/677 (11%)

Query: 238   QASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSED 297
             +A S + ++++    KD+G+ S   + S+   + +   V+       + PF +S + +  
Sbjct: 12577 KADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDA-- 12634

Query: 298   VLDAESIQW---FRDGS-------LLRSSRRRKILYTDRQASLKVSCTYKE----DEGLY 343
               DA S+ W     DG        + +    R    T   +  K SC   +     E ++
Sbjct: 12635 --DACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIF 12692

Query: 344   MVRVPSPFGPREQSTYVLVRDAEAENP-GAPGSPLNVRCLDVNRDCLILTWAPPSDTRGN 402
              VR  + FG  E  T   +    A+ P G P  P N R   VN+DC+ + W  P    G+
Sbjct: 12693 RVRAENRFGISEPLTSPKM---VAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGS 12749

Query: 403   PITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKAS 462
             PI  Y IER +  S  W+  ++    +   P  GLVEG  Y FR+ A+++ GSS PSK +
Sbjct: 12750 PIIGYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPT 12809

Query: 463   ELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWE 522
             E V             +P D                    PP      ++ ++ V L W 
Sbjct: 12810 EYVT----------ARMPVD--------------------PPGKPEVIDVTKSTVSLIWA 12839

Query: 523   EPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPR--FAVLDLEKKKSYVFRVRAMN 579
              P     + +  Y +E   +    W   ++ +P + P+  +    LE+K  Y FR  A  
Sbjct: 12840 RPKHDGGSKIIGYFVEACKLPGDKWVRCNT-APHQIPQEEYTATGLEEKAQYQFRAIART 12898

Query: 580   QYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRK 639
                +S PSEPS+P+ +      +PP   +     +  +V    +   D  + G     + 
Sbjct: 12899 AVNISPPSEPSDPVTILA--ENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFG-----KP 12951

Query: 640   VGTSEWQTVNN--KPIQGTRFTVPGLRTGKEYEFCVRSVSEAG----VGESSAATEPIRV 693
             + T  W+      KP +G +  +   R     E    +  ++G      E+S+ ++   +
Sbjct: 12952 MPTVSWKKDGTLLKPAEGIKMAMQ--RNLCTLELFSVNRKDSGDYTITAENSSGSKSATI 13009

Query: 694   K-QALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQ 752
             K + L  P  P    +     +  ++ W+PP   GG +I  Y +D+ ++   +W  V+  
Sbjct: 13010 KLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVS-A 13068

Query: 753   PIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMP-QPGPPYDVRAS 811
              +P   C V  L EGH Y+FR  A N  GVG+            +  P +  PP     S
Sbjct: 13069 TVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDPPV---IS 13125

Query: 812   EVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKS 871
              +    + + W+PP   G  P+TGY +  +E  +  W  V   PI    L+ + LQ G  
Sbjct: 13126 NITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTE 13185

Query: 872   YVFQVQAMNSAGLGQPS 888
             Y F+V A+N AG G+PS
Sbjct: 13186 YEFRVTAINKAGPGKPS 13202



 Score =  192 bits (487), Expect = 3e-48
 Identities = 216/903 (23%), Positives = 365/903 (40%), Gaps = 121/903 (13%)

Query: 154   PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLL 213
             P   +P  ++++     + +   V   P P ++W K+    +P L +  +  +       
Sbjct: 17940 PSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDG---EP-LKQTTRVNVEETATST 17995

Query: 214   SLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAG---FDSEIFKRSTFGPS 270
              L I+    +D   YTV   N+ G A+    V+V    G   G   FD           S
Sbjct: 17996 VLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEV---------S 18046

Query: 271   VEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASL 330
              +F      V + E   ++  C  S  +++       RD +   ++    +  T  + ++
Sbjct: 18047 ADFV-----VISWEPPAYTGGCQISNYIVEK------RDTT---TTTWHMVSATVARTTI 18092

Query: 331   KVSCTYKEDEGLYMVRVPSPFGPRE--QSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDC 388
             K++      E  + +   + +G      S  V+V+    E PG PG+P       +++D 
Sbjct: 18093 KITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKE-PGPPGTPF---VTSISKDQ 18148

Query: 389   LILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVR 448
             +++ W  P +  G  I  Y +E+ +  S  W+  ++ P    +    GL EG  Y F+V 
Sbjct: 18149 MLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVS 18208

Query: 449   AISRVGSSVPSKASELVVMGD---------------HDAARRKTEIPFDLGNKIT---IS 490
             A + VG   PSK SE  V  D               ++   +  +  +D G+KIT   + 
Sbjct: 18209 AENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVE 18268

Query: 491   TDAFEDTVTIPSPPTNVHASEI---------REAYVVLA------WEEPSP-------RD 528
                  D   + +  TNV  +E          R  + V+A      + EPS        RD
Sbjct: 18269 KKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARD 18328

Query: 529   R-------------------APLTYSLEKSVIGSG----TWEAISSESPVRSPRFAVLDL 565
                                 A  T+ LE  + G       W     E    + R  +   
Sbjct: 18329 EIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKST 18388

Query: 566   EKKKSYVFRVRAMNQYG-----LSDPS-EPSEPIALRGPPATLPPPAQVQAFRDTQTSVS 619
              +K + V +       G     LS+     S PI ++      PP   ++    T     
Sbjct: 18389 IQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCY 18448

Query: 620   LTWDP-VKD--PELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSV 676
             L W+P ++D    +  Y I  R+     W  V+ + +Q   + V  L  G EY F V +V
Sbjct: 18449 LAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTE-VQALNYKVTKLLPGNEYIFRVMAV 18507

Query: 677   SEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFL 736
             ++ G+GE    + P+        P  P    +    K+ MV+ W  P   GG +I GY L
Sbjct: 18508 NKYGIGEP-LESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYIL 18566

Query: 737   DQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKE 796
             ++ D E + W   N++ +     +V+ L EGH YEFR  A N AGVGE S PS  +   +
Sbjct: 18567 EKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACD 18626

Query: 797   WTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP- 855
                P PGPP + + ++   +S+ L W  P+Y G  PV GY V  +E  +++W   TP   
Sbjct: 18627 ALYP-PGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTG 18685

Query: 856   ISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEVGVDEEGFI 915
             + G    V+ L+    Y F++ A+NS G+G+P+     V+ +++    EIE+  D    +
Sbjct: 18686 LQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVV 18745

Query: 916   YL-------AFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGT 968
              L        F   +     E +W K  +G L   R +IE   + + +++      D G 
Sbjct: 18746 VLRASATLRLFVTIKGRPEPEVKWEK-AEGIL-TDRAQIEVTSSFTMLVIDNVTRFDSGR 18803

Query: 969   YSV 971
             Y++
Sbjct: 18804 YNL 18806



 Score =  191 bits (486), Expect = 3e-48
 Identities = 201/819 (24%), Positives = 336/819 (41%), Gaps = 89/819 (10%)

Query: 170   TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT 229
             T+ L+  ++  P P+VTW K D R  P      K RI        LEIR  A ED   Y+
Sbjct: 10863 TLRLSAIIKGVPFPKVTWKKED-RDAPT-----KARIDVTPVGSKLEIRNAAHEDGGIYS 10916

Query: 230   VRVKNAHGQASSFAKVLVRTYLGKDAGFD-SEIFKRSTFGPSVEFTSVLKPVFAREKEPF 288
             + V+N  G  +   KVLV    G     + SEI K S +                 KEP 
Sbjct: 10917 LTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCY--------------LTWKEPL 10962

Query: 289   ----SLSCLFSEDVLDAESIQWFR-DGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
                 S+   +  +  D  S QW     +  + S   K L    Q   +V+   +   G +
Sbjct: 10963 DDGGSVITNYVVERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPF 11022

Query: 344   MVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNP 403
              V  P P           ++  +  +P  PG P ++  +DV++  + L W  P    G+P
Sbjct: 11023 -VETPKP-----------IKALDPLHP--PGPPKDLHHVDVDKTEVSLVWNKPDRDGGSP 11068

Query: 404   ITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASE 463
             IT Y +E  +  + +WI           C + GL +G++YRFRV+A + VG  +P     
Sbjct: 11069 ITGYLVEYQEEGTQDWIKFKTVTN--LECVVTGLQQGKTYRFRVKAENIVGLGLPD---- 11122

Query: 464   LVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEE 523
                          T IP +   K+     + E  V +         + +R   ++     
Sbjct: 11123 -------------TTIPIECQEKLV--PPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPV 11167

Query: 524   PSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGL 583
             P+ +      ++ + S I   T E  + E+   S    + +  ++ +  +++   N  G 
Sbjct: 11168 PTAK------WTTDGSEIK--TDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGS 11219

Query: 584   SDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDP---ELLGYYIYSRKV 640
                +     + + GPP        +     T   ++++W P KD     ++ Y +  +  
Sbjct: 11220 KTVAVHLTVLDVPGPPT-----GPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDT 11274

Query: 641   GTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATP 700
                 W  V++   + T+  +P L+ G EY F VR+ ++ GVG    +T P   K   + P
Sbjct: 11275 RKDTWGVVSSGSSK-TKLKIPHLQKGCEYVFRVRAENKIGVGPPLDST-PTVAKHKFSPP 11332

Query: 701   SAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCK 760
             S P    + +  +N   + W  PK  GG  I GY++++ +     W  VN+ PI     +
Sbjct: 11333 SPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREVTG-KWVRVNKTPIADLKFR 11391

Query: 761   VSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVL 820
             V+ L+EG+ YEFR  A N AG+ + S  S   +      P PGPP + +  +    +  L
Sbjct: 11392 VTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKP-PGPPINPKLKDKSRETADL 11450

Query: 821   QWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP-ISGTHLRVSDLQPGKSYVFQVQAM 879
              W  PL  G  P+ GY V  Q+ G+ QW  +     I     RV  L  G  Y F+++A 
Sbjct: 11451 VWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAA 11510

Query: 880   NSAGLGQPSMPTDPVLLEDKPGAHEIEVGVD-------EEGFIYLAFEAPEAPDSSEFQW 932
             N  G G+P    + V+ +D     E+E+ V          G         +     +  W
Sbjct: 11511 NIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITW 11570

Query: 933   SKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSV 971
             +K+ K  +  +RV +   + + ++ +KE    D G Y +
Sbjct: 11571 TKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYII 11609



 Score =  189 bits (480), Expect = 2e-47
 Identities = 164/614 (26%), Positives = 260/614 (42%), Gaps = 54/614 (8%)

Query: 373   PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRC 432
             PG P     +++ R+ + L W  P    G+ +T Y +E+    S  W+  +      C  
Sbjct: 13905 PGKP---EVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAF 13961

Query: 433   PIQGLVEGQSYRFRVRAISRVGS-SVPSKASELVVMGDHDAARRKTEIPFDLGNKITIST 491
              +  LVEG  Y FR+RA +  G+ S PS+++E ++  D      + E P       TI  
Sbjct: 13962 TVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKD------EYEAP-------TIVL 14008

Query: 492   D-AFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAIS 550
             D   +D +TI +  T V       A  +L   +P P+       S  K+       +   
Sbjct: 14009 DPTIKDGLTIKAGDTIV-----LNAISILG--KPLPKS------SWSKAGKDIRPSDITQ 14055

Query: 551   SESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQA 610
               S   S    +    +K +  + + A N +G          + + GPP        V+ 
Sbjct: 14056 ITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPPGP------VEI 14109

Query: 611   FRDTQTSVSLTWDPVKDP---ELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGK 667
                +    +LTW P  +     +  Y +  R+     W TV ++ IQ  R     L  G 
Sbjct: 14110 SNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLW-TVVSEDIQSCRHVATKLIQGN 14168

Query: 668   EYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRG 727
             EY F V +V+  G GE    +EP+++      P  P    + N  KN   + WK P   G
Sbjct: 14169 EYIFRVSAVNHYGKGEP-VQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDG 14227

Query: 728   GGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSA 787
             G +I GY +++ + + L W    + P+    CKV+ L EG  YEFR  A N AG+G  S 
Sbjct: 14228 GSEITGYHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSE 14287

Query: 788   PSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQ 847
              S     K+   P PGPP +   ++    S  L W  P Y G   +TGY V  Q+ G E 
Sbjct: 14288 ASDSVLMKDAAYP-PGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEA 14346

Query: 848   W-KPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIE 906
             W K  T   +  T   V DLQ  + Y F++ A+N AG+G+P++  D  ++E +  A + E
Sbjct: 14347 WIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVE-REMAPDFE 14405

Query: 907   VGVD-------EEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILK 959
             +  +         G     F   +   + E  W+KD        R  IE+  + + +I+ 
Sbjct: 14406 LDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINL--KNRANIENTESFTLLIIP 14463

Query: 960   EPGLEDLGTYSVIV 973
             E    D G + + +
Sbjct: 14464 ECNRYDTGKFVMTI 14477



 Score =  189 bits (479), Expect = 2e-47
 Identities = 201/842 (23%), Positives = 336/842 (39%), Gaps = 108/842 (12%)

Query: 170   TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT 229
             T +L   ++  P P V W K+   ++     A +  I +     +L ++ C   D   Y 
Sbjct: 18352 TFVLEADIRGKPIPDVVWSKDGKELEET---AARMEIKSTIQKTTLVVKDCIRTDGGQYI 18408

Query: 230   VRVKNAHGQASSFAKVLVRTYLG------KDAGFDSEIFKRSTFGPSVEFTSVLKPVFAR 283
             +++ N  G  S    V V    G      K  G  +E    +   P  +  + +      
Sbjct: 18409 LKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIE 18468

Query: 284   EKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQA-SLKVSCTYKEDEGL 342
             ++E   LS              W +             + T+ QA + KV+     +E +
Sbjct: 18469 KRETSRLS--------------WTQ-------------VSTEVQALNYKVTKLLPGNEYI 18501

Query: 343   YMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGN 402
             + V   + +G  E      V       P  PG P       + +D +++TWA P D  G 
Sbjct: 18502 FRVMAVNKYGIGEPLESGPVTACNPYKP--PGPPSTPEVSAITKDSMVVTWARPVDDGGT 18559

Query: 403   PITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKAS 462
              I  Y +E+   E   W  C++      R  + GL EG SY FRV A +  G   PS+ S
Sbjct: 18560 EIEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPS 18619

Query: 463   ELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWE 522
                    + A                       D +  P PP+N   ++   + V LAW 
Sbjct: 18620 VF-----YRAC----------------------DALYPPGPPSNPKVTDTSRSSVSLAWS 18652

Query: 523   EPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQY 581
             +P     AP+  Y +E     +  W   +  + ++  +F V  L++   Y FR+ A+N  
Sbjct: 18653 KPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSE 18712

Query: 582   GLSDPSE-PSEPIALRG--PP-----ATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGY 633
             G+ +P+  P   +A     PP     A L     ++A    +  V++   P  +PE+   
Sbjct: 18713 GVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFVTIKGRP--EPEV--- 18767

Query: 634   YIYSRKVGTSEWQTVNNKPIQGTR-FTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIR 692
                  K   +E    +   I+ T  FT+  +     ++    +++      S  A   +R
Sbjct: 18768 -----KWEKAEGILTDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVR 18822

Query: 693   VKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQ 752
             V   L +PSAP    +    K+ + + W+PP   GG KI  Y +++ ++    +  +   
Sbjct: 18823 V---LDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNN 18879

Query: 753   PIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASE 812
                T   ++ +L EG  Y FR  A+N  G+G    P+   E  + + P P PP  V   +
Sbjct: 18880 CTKT-TFRIENLQEGCSYYFRVLASNEYGIG---LPAETTEPVKVSEP-PLPPGRVTLVD 18934

Query: 813   VRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSY 872
             V   +  ++WE P   G   +TGY V  Q +GSE+W   T   +      +S L  G+ Y
Sbjct: 18935 VTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCT--QVKTLEATISGLTAGEEY 18992

Query: 873   VFQVQAMNSAGLGQPSMPTDPVLLED---KPGA----HEIEVGVDEEGFIYLAFEA-PEA 924
             VF+V A+N  G   P     PV+  D   KP      H   V   E+  I + F+  P+A
Sbjct: 18993 VFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKIDVPFKGRPQA 19052

Query: 925   PDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASH 984
                    W KD +   +  RV +      + + +KE   ED+GTY + V+++   I+   
Sbjct: 19053 ----TVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPI 19108

Query: 985   TL 986
             T+
Sbjct: 19109 TI 19110



 Score =  186 bits (471), Expect = 2e-46
 Identities = 162/628 (25%), Positives = 268/628 (42%), Gaps = 63/628 (10%)

Query: 373   PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRC 432
             PG P+    L++ R  + L WA P  T G  IT+Y +E+    +G W+  + +       
Sbjct: 14988 PGKPVP---LNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEF 15044

Query: 433   PIQGLVEGQSYRFRVRAISRVGS-SVPSKASELVVMGDH-DAARRKTEIPFDLGNKITIS 490
              + GL E  +Y FRV A +  G+ S PS+ S+ +   D  +A + K ++ F     I  +
Sbjct: 15045 TVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFK-DTVILKA 15103

Query: 491   TDAF--EDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEA 548
              +AF  E  V+   PPT             + W +         T  LE  +    T   
Sbjct: 15104 GEAFRLEADVSGRPPPT-------------MEWSKDGKELEG--TAKLEIKIADFST-NL 15147

Query: 549   ISSESPVRSPRFAVLDLEKKKSY---VFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPP 605
             ++ +S  R      L       +   +F V+ +++ G                    PP 
Sbjct: 15148 VNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPG--------------------PPE 15187

Query: 606   AQVQAFRDTQTSVSLTWDPVKDP---ELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPG 662
               +     T     L+W P  D    ++  Y +  R+     W  V ++ +Q T+  V  
Sbjct: 15188 GPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASE-VQVTKLKVTK 15246

Query: 663   LRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKP 722
             L  G EY F V +V++ GVGE    +EP+        P  P    +    K+ MV+ W  
Sbjct: 15247 LLKGNEYIFRVMAVNKYGVGEP-LESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGH 15305

Query: 723   PKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGV 782
             P   GG +I+ Y +++ D     W   N++ +     KVS L EGH YEFR  A N AG+
Sbjct: 15306 PDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGI 15365

Query: 783   GELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQE 842
                S  S  ++  + T+ +PGPP + R  +   +S+ + W  P+Y G   +TGY V    
Sbjct: 15366 SAPSPTSPFYKACD-TVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIAL 15424

Query: 843   EGSEQWKPVT-PGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPG 901
                ++W+ VT P  +  T   ++ L   + Y  ++ AMNS GLG+P++       ED+  
Sbjct: 15425 PEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRML 15484

Query: 902   AHEIEVGVDEEGFIYL-------AFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKS 954
               EIE+  D    + +        F   +   + E +W++D+   LD  +  IE   + +
Sbjct: 15485 PPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLD--KASIESTSSYT 15542

Query: 955   KVILKEPGLEDLGTYSVIVTDADEDISA 982
              +I+      D G Y + V ++    SA
Sbjct: 15543 LLIVGNVNRFDSGKYILTVENSSGSKSA 15570



 Score =  184 bits (466), Expect = 7e-46
 Identities = 263/1176 (22%), Positives = 454/1176 (38%), Gaps = 191/1176 (16%)

Query: 318   RRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPL 377
             + +I  T   + L++     ED G+Y + V +P G +  S  VLV D        PG P 
Sbjct: 10890 KARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDK-------PGPPR 10942

Query: 378   NVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGL 437
             ++   ++ +D   LTW  P D  G+ IT Y +ER    S +W               + L
Sbjct: 10943 DLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHFA-KHL 11001

Query: 438   VEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDT 497
              EG  Y FRV A ++ G                         PF    K   + D     
Sbjct: 11002 NEGNQYLFRVAAENQYGRG-----------------------PFVETPKPIKALDPLHP- 11037

Query: 498   VTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVR 556
                P PP ++H  ++ +  V L W +P     +P+T Y +E    G+  W    +   V 
Sbjct: 11038 ---PGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKT---VT 11091

Query: 557   SPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQT 616
             +    V  L++ K+Y FRV+A N  GL  P + + PI  +     L PP+     +  + 
Sbjct: 11092 NLECVVTGLQQGKTYRFRVKAENIVGLGLP-DTTIPIECQ---EKLVPPSVELDVKLIEG 11147

Query: 617   SVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVP--GLRTGKEYEFCVR 674
              V      V+ P +    I    V T++W T  ++      +TV      +    + C+R
Sbjct: 11148 LVVKAGTTVRFPAI----IRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLR 11203

Query: 675   -SVSEAGVGESSAA-TEPIRVK-QALATPSAPYG-FALLNCGKNEMVIGWKPPKRRGGGK 730
                 E  +  S+AA ++ + V    L  P  P G   +L+     M I W+PPK  GG  
Sbjct: 11204 RDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSP 11263

Query: 731   ILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGE-LSAPS 789
             ++ Y +++ D+ +  W  V+     T++ K+  L +G  Y FR RA N  GVG  L +  
Sbjct: 11264 VINYIVEKQDTRKDTWGVVSSGSSKTKL-KIPHLQKGCEYVFRVRAENKIGVGPPLDSTP 11322

Query: 790   SLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWK 849
             ++ + K      P PP     +++   +  + W  P   G  P+TGY++  + E + +W 
Sbjct: 11323 TVAKHK---FSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYME-RREVTGKWV 11378

Query: 850   PVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLL--EDKPGAHEIEV 907
              V   PI+    RV+ L  G +Y F+V A N AGL +PS  +DP+      KP    I  
Sbjct: 11379 RVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKPPGPPINP 11438

Query: 908   GVDEEGFIYLAFEAPEAPDSSEFQWSK---DYKGPLDPQRVKIE-------DKVNKSKVI 957
              + ++           + ++++  W+K   D   P+    V+ +       +++NK ++I
Sbjct: 11439 KLKDK-----------SRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELI 11487

Query: 958   ----LKEPGLEDLGTYSVIVTDAD-----------EDISASHTLTEEELEKLKKLSHEIR 1002
                  + PGL +   Y   +  A+           E + A   L   E+E    L    R
Sbjct: 11488 RQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVE----LDVTCR 11543

Query: 1003  NPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGL 1062
             + VI +  G  I IL R + R         P  ++      K +     ++++  ++   
Sbjct: 11544 D-VITVRVGQTIRILARVKGR---------PEPDITWTKEGKVLVRE--KRVDLIQDLPR 11591

Query: 1063  VEVIIQNLSEEDKGSY--TAQLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGP 1120
             VE+ I+     D G Y  +A+   G A+    + ++D                   + GP
Sbjct: 11592 VELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLD-------------------RPGP 11632

Query: 1121  YFERPLQWKVTEDCQVQLTCKVTNTKKE-TRFQWFFQRAEMPDGQYDPETGTGLLCIEEL 1179
                  +     E+C +     + N   E T F   +++             T  L    L
Sbjct: 11633 CQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIKANL 11692

Query: 1180  SKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIF 1239
                ++  +R    +  G   TI   T                L+  P+   G  E + I 
Sbjct: 11693 LANNEYYFRVCAENKVGVGPTIETKTP--------------ILAINPIDRPGEPENLHIA 11738

Query: 1240  SKVKYYNVEYMKTTW-------------FHKDKRLESGD---RIRTGTTLDEIWLHILDP 1283
              K K +   Y+K  W             +H ++RL+  D   R+  G+  +         
Sbjct: 11739 DKGKTF--VYLK--WRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKET-------- 11786

Query: 1284  KDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLP-- 1341
                    Y ++     ++ +       +  E    + + +    +++++  K V  L   
Sbjct: 11787 ------HYMVDRCVENQIYEFRVQTKNEGGESDWVKTEEV----VVKEDLQKPVLDLKLS 11836

Query: 1342  DVATIMEDKTLCLTCIVSGDPTPEISWLKNDQ--PVTFLDRYRMEVRGTEVTITIEKVNS 1399
              V T+    T+ L   V G P PE++W K+     +T   R +++ R      ++ K   
Sbjct: 11837 GVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKR 11896

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
              D G+Y V   N  GS     T++V       + LK
Sbjct: 11897 SDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLK 11932



 Score =  182 bits (463), Expect = 2e-45
 Identities = 207/847 (24%), Positives = 333/847 (39%), Gaps = 107/847 (12%)

Query: 170   TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT 229
             T  L   V   P P + W + D  I+     + +  I N      L ++     D   Y 
Sbjct: 17270 TFRLEADVHGKPLPTIEWLRGDKEIE----ESARCEIKNTDFKALLIVKDAIRIDGGQYI 17325

Query: 230   VRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFS 289
             +R  N  G  S    V V    G   G              V+ T V       EK   +
Sbjct: 17326 LRASNVAGSKSFPVNVKVLDRPGPPEG-------------PVQVTGVTS-----EKCSLT 17367

Query: 290   LSCLFSEDVLD-AESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVP 348
              S    +   D +  +   R+ S L  +     + T+   SLKV+   + +E ++ +   
Sbjct: 17368 WSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTN---SLKVTKLLEGNEYVFRIMAV 17424

Query: 349   SPFGPRE--QSTYVLVRDAEAENPGA-PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPIT 405
             + +G  E  +S  VL++     NP   PG P ++   ++ +D + + W  P    G+ I 
Sbjct: 17425 NKYGVGEPLESAPVLMK-----NPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEII 17479

Query: 406   AYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELV 465
              Y +E+       WI C++      R  + GL E   Y FRV A +  G   PS A    
Sbjct: 17480 GYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPA---- 17535

Query: 466   VMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPS 525
                                   T+   A  D V  P PPTN H  +  +  + LAW +P 
Sbjct: 17536 ----------------------TVYYKAC-DPVFKPGPPTNAHIVDTTKNSITLAWGKPI 17572

Query: 526   PRDRAP-LTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLS 584
                 +  L Y +E        W+ ++ ++ +R  RF +  L + + Y  RV A+N+ GL 
Sbjct: 17573 YDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLG 17632

Query: 585   D----PSEPSEPIALRGPPATLPPPAQ----VQAFRDTQTSVSLTWDPVKDPELLGYYIY 636
             +    P        L  P   L    +    V+A    +  +     P   PE+     +
Sbjct: 17633 EATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPT--PEIT----W 17686

Query: 637   SRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQA 696
             SR+ G    +    K +  T+ ++         ++ ++  + +G   S +A   ++V   
Sbjct: 17687 SREEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSG---SKSAFVTVKV--- 17740

Query: 697   LATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPT 756
             L TP  P   A+    K+   + W+PP   GG K+  Y +D+ +S    +  V+ +   T
Sbjct: 17741 LDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKT 17800

Query: 757   RVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRAT 816
                KV +L EG  Y FR  A N  GVG    P    +  +   P P PP  V  ++V  T
Sbjct: 17801 SF-KVENLTEGAIYYFRVMAENEFGVG---VPVETVDAVKAAEP-PSPPGKVTLTDVSQT 17855

Query: 817   SLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQV 876
             S  L WE P + G   V GY V  Q +G+E+W  V    +   +  V+ L  G+ Y F+V
Sbjct: 17856 SASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKV--CNAVVTGLSSGQEYQFRV 17913

Query: 877   QAMNSAGLGQPSMPTDPVLLEDKP---------GAHEIEVGVDEEGFIYLAFEAPE-APD 926
             +A N  G   P +   PV+ +D             + I+ G D      L  E P     
Sbjct: 17914 KAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGED------LKIEIPVIGRP 17967

Query: 927   SSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTL 986
                  W KD +      RV +E+    + + +KE   +D G Y+V  T++    +A+  L
Sbjct: 17968 RPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAG--TATENL 18025

Query: 987   TEEELEK 993
             +   LEK
Sbjct: 18026 SVIVLEK 18032



 Score =  182 bits (461), Expect = 3e-45
 Identities = 197/775 (25%), Positives = 320/775 (41%), Gaps = 86/775 (11%)

Query: 249   TYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFARE--KEPFSLSCLFSEDVL-DAESIQ 305
             T L     +   IF  + +G S    S   P+ A+   KEP      F+  +  D+  IQ
Sbjct: 17013 TKLKTGTEYQFRIFAENRYGQSFALES--DPIVAQYPYKEPGPPGTPFATAISKDSMVIQ 17070

Query: 306   WFRD---------GSLLRSSRRRKILYTDRQASLKVSCTYKE---DEGL-YMVRVPSP-- 350
             W            G  L    R  IL+T    ++     +K    +EG+ Y  RV +   
Sbjct: 17071 WHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENI 17130

Query: 351   --FGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYT 408
                G   +++   V     + PG P  P+ V+     R+ + L W  P    G+ IT Y 
Sbjct: 17131 VGVGKASKNSECYVARDPCDPPGTP-EPIMVK-----RNEITLQWTKPVYDGGSMITGYI 17184

Query: 409   IERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGS-SVPSKASELVVM 467
             +E+     G W+          +  + GL E Q Y FRV A +  G+ S PS ++  +  
Sbjct: 17185 VEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPI-- 17242

Query: 468   GDHDAARRKTEIPFDLGNKITISTD-AFEDTVTIPSPPT-NVHASEIREAYVVLAWEEPS 525
                  A+ + E+P        IS D  F DT+ + +  T  + A    +    + W    
Sbjct: 17243 ----TAKDEVELP-------RISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRG- 17290

Query: 526   PRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSD 585
                        +K +  S   E  +++         V D  +     + +RA N  G   
Sbjct: 17291 -----------DKEIEESARCEIKNTDF---KALLIVKDAIRIDGGQYILRASNVAG--- 17333

Query: 586   PSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWD-PVKD--PELLGYYIYSRKVGT 642
                 S P+ ++      PP   VQ    T    SLTW  P++D   ++  Y +  R+   
Sbjct: 17334 --SKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSR 17391

Query: 643   SEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSA 702
               W  V ++ +  +   V  L  G EY F + +V++ GVGE    + P+ +K     P  
Sbjct: 17392 LAWTVVASEVVTNS-LKVTKLLEGNEYVFRIMAVNKYGVGE-PLESAPVLMKNPFVLPGP 17449

Query: 703   PYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVS 762
             P    + N  K+ M + W  P   GG +I+GY +++ D   + W   N++ I     +V+
Sbjct: 17450 PKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVT 17509

Query: 763   DLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQW 822
              L E H YEFR  A N AGVGE S P++++      + +PGPP +    +    S+ L W
Sbjct: 17510 GLTEDHEYEFRVSAENAAGVGEPS-PATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAW 17568

Query: 823   EPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP-ISGTHLRVSDLQPGKSYVFQVQAMNS 881
               P+Y G   + GY V   +   E+W+ VTP   +  T   +S L   + Y  +V A+N 
Sbjct: 17569 GKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNK 17628

Query: 882   AGLGQPSMPTDPVLLEDKPGAHEIE----------VGVDEEGFIYLAFEAPEAPDSSEFQ 931
              GLG+ +     V  EDK  A E++          V       I++ F+    P   E  
Sbjct: 17629 VGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTP---EIT 17685

Query: 932   WSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTL 986
             WS++     D  +V+IE  VN +++ +      D G Y + + ++    SA  T+
Sbjct: 17686 WSREEGEFTD--KVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTV 17738



 Score =  181 bits (459), Expect = 4e-45
 Identities = 191/817 (23%), Positives = 328/817 (40%), Gaps = 91/817 (11%)

Query: 169   TTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATY 228
             T VL   ++   P P+ +W K    I P    +   +IT+      L I+    +D+  Y
Sbjct: 14023 TIVLNAISILGKPLPKSSWSKAGKDIRP----SDITQITSTPTSSMLTIKYATRKDAGEY 14078

Query: 229   TVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPF 288
             T+   N  G      KV V    G               GP VE ++V     + EK   
Sbjct: 14079 TITATNPFGTKVEHVKVTVLDVPGPP-------------GP-VEISNV-----SAEKATL 14119

Query: 289   SLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTY------KEDEGL 342
             + +    +     +S        +L      ++L+T     ++ SC +      + +E +
Sbjct: 14120 TWTPPLEDGGSPIKSY-------ILEKRETSRLLWTVVSEDIQ-SCRHVATKLIQGNEYI 14171

Query: 343   YMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGN 402
             + V   + +G  E      V+  +   P  PG P      +V ++   ++W  P D  G+
Sbjct: 14172 FRVSAVNHYGKGEPVQSEPVKMVDRFGP--PGPPEKPEVSNVTKNTATVSWKRPVDDGGS 14229

Query: 403   PITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKAS 462
              IT Y +ER + +S  W+   + P    RC + GL EG +Y FRV A +R G   PS+AS
Sbjct: 14230 EITGYHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEAS 14289

Query: 463   ELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWE 522
             + V+M                           +D    P PP+N H ++  +    LAW 
Sbjct: 14290 DSVLM---------------------------KDAAYPPGPPSNPHVTDTTKKSASLAWG 14322

Query: 523   EPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQY 581
             +P       +T Y +E   +G   W   ++ + +R  +F V DL+ K+ Y FR+ A+N  
Sbjct: 14323 KPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDA 14382

Query: 582   GLSDPSE-PSEPIALRGPPATLPPPAQVQAFRDTQTSVSL-TWDPVKDPELLGYYIYSRK 639
             G+ +P+  P   I  R         A+++     +  +S+  + P+K             
Sbjct: 14383 GVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDN 14442

Query: 640   VGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALAT 699
             +       + N     T   +P        +F +   + AG     +    +RV   L T
Sbjct: 14443 INLKNRANIENTE-SFTLLIIPECNRYDTGKFVMTIENPAG---KKSGFVNVRV---LDT 14495

Query: 700   PSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVC 759
             P         +  K+ + + W  P   GG +I  Y +++ ++    +     +       
Sbjct: 14496 PGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTK-CHKCTY 14554

Query: 760   KVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLV 819
             KV+ L EG  Y FR  A N  G+GE +  +   +  E     P PP  +   ++  +++ 
Sbjct: 14555 KVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASE----APSPPDSLNIMDITKSTVS 14610

Query: 820   LQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAM 879
             L W  P + G   +TGY +  Q +GS+QW  +T   + G    V +L  G+ Y FQV A+
Sbjct: 14611 LAWPKPKHDGGSKITGYVIEAQRKGSDQWTHIT--TVKGLECVVRNLTEGEEYTFQVMAV 14668

Query: 880   NSAGLGQPSMPTDPVLLEDKPGAHEIEV-GVDEEGFIYLAFE--APEAP----DSSEFQW 932
             NSAG   P   + PV+++++    E+++ G+ ++  I  A +    E P          W
Sbjct: 14669 NSAGRSAP-RESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTW 14727

Query: 933   SKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTY 969
              K  +     QRV  E     + + + E    D G Y
Sbjct: 14728 KKGDQILKQTQRVNFETTATSTILNINECVRSDSGPY 14764



 Score =  181 bits (458), Expect = 6e-45
 Identities = 156/580 (26%), Positives = 239/580 (41%), Gaps = 71/580 (12%)

Query: 341   GLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTR 400
             G Y +   +  G +  +  V V D        PG P +++  D+ R    L+W  P D  
Sbjct: 9515  GKYSITAKNKAGQKTANCRVKVMDV-------PGPPKDLKVSDITRGSCRLSWKMPDDDG 9567

Query: 401   GNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSK 460
             G+ I  Y IE+   +   W   +   G T    +  L+  Q Y FRVRA +R G   P +
Sbjct: 9568  GDRIKGYVIEKRTIDGKAWTKVNPDCGST-TFVVPDLLSEQQYFFRVRAENRFGIGPPVE 9626

Query: 461   ASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLA 520
                                        TI      D +  P PP  +    I +  V L+
Sbjct: 9627  ---------------------------TIQRTTARDPIYPPDPPIKLKIGLITKNTVHLS 9659

Query: 521   WEEPSPRDRAPLTYSLEKSVIGSGT------WEAISSESPVRSPRFAVLDLEKKKSYVFR 574
             W+ P     +P+T+ + + +    T      W   +    V   +F V DL +   Y FR
Sbjct: 9660  WKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRD-VEELQFTVEDLVEGGEYEFR 9718

Query: 575   VRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRD----TQTSVSLTWDPVKDPEL 630
             V+A+N  G+S PS    P   + P   +PP   ++ F +    T  ++      V  P L
Sbjct: 9719  VKAVNAAGVSKPSATVGPCDCQRP--DMPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPTL 9776

Query: 631   LGYYIYSRKVGTSE---WQTVNNKPIQGTRFT--VPGLRTGKEYEFCVRSVSEAGVGESS 685
               +    +K    E   + T  NK +     T  +P  R      + + +V+  G     
Sbjct: 9777  TWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLG----- 9831

Query: 686   AATEPIRVKQALATPSAPYG-FALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEEL 744
              A++ +R+   L  P  P G     +   ++M + W PPK  GG KI  Y +++ ++   
Sbjct: 9832  TASKEMRL-NVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEKREANRK 9890

Query: 745   DWHAVNQQPIPTRVC--KVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQP 802
              W  V+ +P   + C   +  L EGH Y FR  A N  G+GE     S  E        P
Sbjct: 9891  TWVHVSSEP---KECTYTIPKLLEGHEYVFRIMAQNKYGIGE--PLDSEPETARNLFSVP 9945

Query: 803   GPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPIS----G 858
             G P     S V   S+ + WE P Y G  PVTGY +  ++  S++WK V   PI     G
Sbjct: 9946  GAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLG 10005

Query: 859   THLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED 898
                +V+ L  G  Y F+V A+N+AG+G  S+P+DP    D
Sbjct: 10006 VSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARD 10045



 Score =  181 bits (458), Expect = 6e-45
 Identities = 157/619 (25%), Positives = 252/619 (40%), Gaps = 78/619 (12%)

Query: 304   IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVR 363
             I W +    LR      I  TD    L+     K D G Y++ + +  G +E +  V V 
Sbjct: 13353 ITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVL 13412

Query: 364   DAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACH 423
             D        PG P+NV   ++++D   +TW PP    G+PI  Y +++   E   W    
Sbjct: 13413 DT-------PGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTVT 13465

Query: 424   EAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDL 483
                  T    +  L EG+SY FRV A +  G   P +                       
Sbjct: 13466 TECSKTS-FRVANLEEGKSYFFRVFAENEYGIGDPGE----------------------- 13501

Query: 484   GNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGS 543
                   + DA + + T P P  ++    + ++   + W++P     + +   +   +   
Sbjct: 13502 ------TRDAVKASQT-PGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTEE 13554

Query: 544   GTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSE---------PSEPIA 594
               W+ +       S +++  DL + K Y FRV A N+ G   PSE          +  + 
Sbjct: 13555 NKWQRVMKSL---SLQYSAKDLTEGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLD 13611

Query: 595   LRGPPATLPPPAQVQAFR-----DTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVN 649
             L+G P       +   FR       + + S++W   +DP           + T    +V 
Sbjct: 13612 LKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDP-----------LATDTRVSVE 13660

Query: 650   NKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALL 709
             +  +  T   V   +     ++ +   + AG  E + +   I+V      P+ P  F  +
Sbjct: 13661 SSAVN-TTLIVYDCQKSDAGKYTITLKNVAGTKEGTIS---IKVVGKPGIPTGPIKFDEV 13716

Query: 710   NCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHF 769
                   M + W PPK  GG +I  Y L++ DS    W       +     +V+ LHEG  
Sbjct: 13717 TA--EAMTLKWAPPKDDGGSEITNYILEKRDSVNNKW-VTCASAVQKTTFRVTRLHEGME 13773

Query: 770   YEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMG 829
             Y FR  A N  GVGE      +     + +P   PP ++   +VR  S+ L W  P   G
Sbjct: 13774 YTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNI--VDVRHDSVSLTWTDPKKTG 13831

Query: 830   AGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSM 889
               P+TGYH+ F+E  S  WK     PI     +V+ L  G  Y F+V A+N AG+G+PS+
Sbjct: 13832 GSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSL 13891

Query: 890   PTDPVLL---EDKPGAHEI 905
             P++PV+     D PG  E+
Sbjct: 13892 PSEPVVALDPIDPPGKPEV 13910



 Score =  181 bits (458), Expect = 6e-45
 Identities = 201/832 (24%), Positives = 324/832 (38%), Gaps = 115/832 (13%)

Query: 173   LTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRV 232
             L   V   PPP + W K+   ++       K  I       +L  +     DS  YT+  
Sbjct: 15109 LEADVSGRPPPTMEWSKDGKELEG----TAKLEIKIADFSTNLVNKDSTRRDSGAYTLTA 15164

Query: 233   KNAHGQASSFAKVLVRTYLGKDAG------FDSEIFKRSTFGPSVEFTSVLKPVFAREKE 286
              N  G A     V V    G   G        SE    S F P  +  + +     +++E
Sbjct: 15165 TNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRE 15224

Query: 287   PFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVR 346
                L+              W    S ++ ++            LKV+   K +E ++ V 
Sbjct: 15225 TSRLA--------------WTNVASEVQVTK------------LKVTKLLKGNEYIFRVM 15258

Query: 347   VPSPFGPRE--QSTYVLVRDAEAENP-GAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNP 403
               + +G  E  +S  VL     A NP G P  P N     + +D +++ W  P    G+ 
Sbjct: 15259 AVNKYGVGEPLESEPVL-----AVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSE 15313

Query: 404   ITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASE 463
             I  Y +ER       WI C++      R  + GL EG  Y FR+ A +  G S PS  S 
Sbjct: 15314 IINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTS- 15372

Query: 464   LVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEE 523
                             PF              DTV  P PP N    +   + + +AW +
Sbjct: 15373 ----------------PFYKAC----------DTVFKPGPPGNPRVLDTSRSSISIAWNK 15406

Query: 524   PSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYG 582
             P     + +T Y +E ++     W+ ++  + +++  + +  L + + Y  R+ AMN  G
Sbjct: 15407 PIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEG 15466

Query: 583   LSDPS-EPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLT-------WDPVKD---PELL 631
             L +P+  P  P   +     LPP  ++ A  D +  V++        + P+K    PE+ 
Sbjct: 15467 LGEPALVPGTP---KAEDRMLPPEIELDA--DLRKVVTIRACCTLRLFVPIKGRPAPEVK 15521

Query: 632   GYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPI 691
                 ++R  G S  +         T   V  +      ++ +   + +G   S +A   +
Sbjct: 15522 ----WARDHGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSG---SKSAFVNV 15574

Query: 692   RVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQ 751
             RV   L TP  P    +    K  + + W PP   GG KI  Y +++ +S    +  V  
Sbjct: 15575 RV---LDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVAT 15631

Query: 752   QPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRAS 811
                 T   KV  L EG  Y FR  A N  G+G  +  +   +  E    +P PP  +   
Sbjct: 15632 NCHKTS-WKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASE----RPLPPGKITLM 15686

Query: 812   EVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKS 871
             +V   S+ L WE P + G   + GY V  Q +GS++W   T   +  T   ++ L  G+ 
Sbjct: 15687 DVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKW--ATCATVKVTEATITGLIQGEE 15744

Query: 872   YVFQVQAMNSAGLGQPSMPTDPVLLEDK--PGAHEI-----EVGVDEEGFIYLAFEAPEA 924
             Y F+V A N  G+  P   + PV+ +D   P A ++      V   E+  + + F     
Sbjct: 15745 YSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPT 15804

Query: 925   PDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDA 976
             P      W KD        RV  E   N S + +K+   ED+G Y V +T++
Sbjct: 15805 P---AVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNS 15853



 Score =  179 bits (454), Expect = 2e-44
 Identities = 155/612 (25%), Positives = 260/612 (42%), Gaps = 65/612 (10%)

Query: 303   SIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLV 362
             ++ W +DG+LL+ +   K+       +L++    ++D G Y +   +  G +  +  + V
Sbjct: 12954 TVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKV 13013

Query: 363   RDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIAC 422
              D        PG P +V+   +  D  +L+W PP +  G+ IT Y +++ +     W A 
Sbjct: 13014 LDK-------PGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNW-AQ 13065

Query: 423   HEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFD 482
               A      C ++ L+EG  Y+FR+ A ++ G   P      +    +D   R       
Sbjct: 13066 VSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRC------ 13119

Query: 483   LGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVI 541
                                 PP     S I + ++ ++W+ P+    +P+T Y LEK   
Sbjct: 13120 -------------------DPPV---ISNITKDHMTVSWKPPADDGGSPITGYLLEKRET 13157

Query: 542   GSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPAT 601
              +  W  ++ + P+         L++   Y FRV A+N+ G   PS+ S+    R P   
Sbjct: 13158 QAVNWTKVNRK-PIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYP 13216

Query: 602   LPPPAQVQAFRDTQTSVSLTW-DPVKD--PELLGYYIYSRKVGTSEWQTVN-NKPIQGTR 657
               PPA  + +  T++SVSL+W  P  D    ++GY +  ++  +  W   N  + +Q TR
Sbjct: 13217 PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTR 13276

Query: 658   FTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMV 717
             F V GL    +Y+F V +V++ G  + S   +    K  L  P       L    +  ++
Sbjct: 13277 FEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADL----RKTLI 13332

Query: 718   IGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEF-RARA 776
             +      R G    L   +      ++ W   N   +  R     D+    F  F R   
Sbjct: 13333 L------RAGVTMRLYVPVKGRPPPKITWSKPN---VNLRDRIGLDIKSTDFDTFLRCEN 13383

Query: 777   ANWAGVGE--LSAPSSLFECKEWT-----MPQPGPPYDVRASEVRATSLVLQWEPPLYMG 829
              N    G+  L+  +S  + KE+T     +  PGPP +V   E+   S  + WEPP+  G
Sbjct: 13384 VNKYDAGKYILTLENSCGK-KEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDG 13442

Query: 830   AGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSM 889
               P+  Y V  ++   + W  VT    S T  RV++L+ GKSY F+V A N  G+G P  
Sbjct: 13443 GSPIINYVVQKRDAERKSWSTVTT-ECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGE 13501

Query: 890   PTDPVLLEDKPG 901
               D V     PG
Sbjct: 13502 TRDAVKASQTPG 13513



 Score =  179 bits (454), Expect = 2e-44
 Identities = 197/755 (26%), Positives = 292/755 (38%), Gaps = 105/755 (13%)

Query: 167   EHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSA 226
             E++   L   ++  P P V+W K +   DP L    +  + ++    +L +  C   D+ 
Sbjct: 13624 ENSNFRLKIPIKGKPAPSVSWKKGE---DP-LATDTRVSVESSAVNTTLIVYDCQKSDAG 13679

Query: 227   TYTVRVKNAHGQASSFAKVLVRTYLGKDAG---FDSEIFKRSTFGPSVEFTSVLKPVFAR 283
              YT+ +KN  G       + V    G   G   FD    +  T          LK    +
Sbjct: 13680 KYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMT----------LKWAPPK 13729

Query: 284   EKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKI-LYTDRQASLKVSCTYKEDEGL 342
             +     ++    E   D+ + +W    S ++ +  R   L+   + + +VS   K   G 
Sbjct: 13730 DDGGSEITNYILEK-RDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGE 13788

Query: 343   YMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGN 402
              +   P            +V     + P AP  P     +DV  D + LTW  P  T G+
Sbjct: 13789 GLKSEP------------IVARHPFDVPDAPPPP---NIVDVRHDSVSLTWTDPKKTGGS 13833

Query: 403   PITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKAS 462
             PIT Y +E  +  S  W   ++ P       + GL EG  Y FRV AI+  G   PS  S
Sbjct: 13834 PITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPS 13893

Query: 463   ELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWE 522
             E VV  D          P D                    PP       I    V L W 
Sbjct: 13894 EPVVALD----------PID--------------------PPGKPEVINITRNSVTLIWT 13923

Query: 523   EPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQY 581
             EP       LT Y +EK  + S +W   +  + V    F V DL +   Y FR+RA N  
Sbjct: 13924 EPKYDGGHKLTGYIVEKRDLPSKSWMKANHVN-VPECAFTVTDLVEGGKYEFRIRAKNTA 13982

Query: 582   G-LSDPSEPSEPIALR----GPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIY 636
             G +S PSE +E I  +     P   L P       +D      LT        L    I 
Sbjct: 13983 GAISAPSESTETIICKDEYEAPTIVLDP-----TIKD-----GLTIKAGDTIVLNAISIL 14032

Query: 637   SRKVGTSEWQTVNN--KPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESS-AATEPIRV 693
              + +  S W       +P   T+ T     T       ++  +    GE +  AT P   
Sbjct: 14033 GKPLPKSSWSKAGKDIRPSDITQIT----STPTSSMLTIKYATRKDAGEYTITATNPFGT 14088

Query: 694   K------QALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWH 747
             K        L  P  P    + N    +  + W PP   GG  I  Y L++ ++  L W 
Sbjct: 14089 KVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWT 14148

Query: 748   AVNQQPIPTRVCK--VSDLHEGHFYEFRARAANWAGVGE--LSAPSSLFECKEWTMPQPG 803
              V++     + C+   + L +G+ Y FR  A N  G GE   S P  + +        PG
Sbjct: 14149 VVSED---IQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQSEPVKMVD----RFGPPG 14201

Query: 804   PPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRV 863
             PP     S V   +  + W+ P+  G   +TGYHV  +E+ S +W      P+S    +V
Sbjct: 14202 PPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDLRCKV 14261

Query: 864   SDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED 898
             + LQ G +Y F+V A N AG+G PS  +D VL++D
Sbjct: 14262 TGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKD 14296



 Score =  179 bits (453), Expect = 2e-44
 Identities = 150/611 (24%), Positives = 255/611 (41%), Gaps = 62/611 (10%)

Query: 304   IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVR 363
             I W +DG  +    R +I+ TD    L V    + D G Y++ + +  G R     V V 
Sbjct: 19449 ISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRS----VAVN 19504

Query: 364   DAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACH 423
                 + PG P  PL +  L   +    L+W  P +  G  I  Y +E+ +     W  C 
Sbjct: 19505 CKVLDKPGPPAGPLEINGLTAEK--CSLSWGRPQEDGGADIDYYIVEKRETSHLAWTIC- 19561

Query: 424   EAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDL 483
             E       C +  L++G  Y FRV  +++ G   P ++  +  +                
Sbjct: 19562 EGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLESVAIKAL---------------- 19605

Query: 484   GNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIG 542
                         D  T+PSPPT++  + + +  + L W  P     + ++ Y +E+    
Sbjct: 19606 ------------DPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSEISGYIIERREKN 19653

Query: 543   SGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATL 602
             S  W  + ++ PV   R     L +   Y +RV A N  GLS PSE S  I    P    
Sbjct: 19654 SLRWVRV-NKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLP 19712

Query: 603   PPPAQVQAFRDTQTSVSLTW-DPVKD--PELLGYYIYSRKVGTSEWQTVNNKPIQGTRFT 659
              PP++ +     +T++++ W  P+ D    + GY +  +K   ++W+T + + ++GT +T
Sbjct: 19713 SPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKT-SIQSLRGTEYT 19771

Query: 660   VPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATP-----SAPYGFALLNCGKN 714
             + GL TG EY F V+SV++ G  + S +++P   K+    P     S      ++  G +
Sbjct: 19772 ISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGAS 19831

Query: 715   -EMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFR 773
               M + ++       G+ +   L      +L   A            + + +     ++ 
Sbjct: 19832 FTMTVPFR-------GRPVPNVLWSKPDTDLRTRAYVDTTDSRTSLTIENANRNDSGKYT 19884

Query: 774   ARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPV 833
                 N      LSA S     K   +  PGPP ++   +V   S VL W+ P   G  PV
Sbjct: 19885 LTIQN-----VLSAASLTLVVK--VLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPV 19937

Query: 834   TGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDP 893
               YH+  +E   + W  VT    +    +V++LQ G  Y F+V   N  G+G P+   + 
Sbjct: 19938 KNYHIEKREASKKAWVSVT-NNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEG 19996

Query: 894   VLLEDKPGAHE 904
             V + +KP   E
Sbjct: 19997 VKITEKPSPPE 20007



 Score =  179 bits (453), Expect = 2e-44
 Identities = 190/806 (23%), Positives = 301/806 (37%), Gaps = 147/806 (18%)

Query: 171   VLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTV 230
             V L   +   PPP  +W+   ++    L  + +  +  +  +  L IR   I D+  YT+
Sbjct: 23384 VELVIPIAGRPPPAASWFFAGSK----LRESERVTVETHTKVAKLTIRETTIRDTGEYTL 23439

Query: 231   RVKNAHGQASSFAKVLVRTYLGKDAG------FDSEIFKRSTFGPSVEFTSVLKPVFARE 284
              +KN  G  S   KV++    G   G       D+     S   P ++  + L      +
Sbjct: 23440 ELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPELDGGAPLSGYVVEQ 23499

Query: 285   KEPFSLSCLFSEDVLDAESIQWFR-DGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
             +              DA    W     S+ RS+ +   L    +   +V+ T +   G Y
Sbjct: 23500 R--------------DAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFGIGSY 23545

Query: 344   MVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNP 403
             +           QS  +  R +       PG P  ++  DV+RD + LTW PP D  G+ 
Sbjct: 23546 L-----------QSEVIECRSSIR----IPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQ 23590

Query: 404   ITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASE 463
             +T Y +ER +  +  W+  ++ P    R    GL EG  Y  RV AI+  GS  PS+ S+
Sbjct: 23591 VTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSK 23650

Query: 464   LVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEE 523
              +V                             D +  P  P N   ++     V LAW  
Sbjct: 23651 PIVA---------------------------MDPIAPPGKPQNPRVTDTTRTSVSLAWSV 23683

Query: 524   PSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYG 582
             P     + +T Y +E   +    W   ++ +P +   + +  L +   Y FRV A N  G
Sbjct: 23684 PEDEGGSKVTGYLIEMQKVDQHEWTKCNT-TPTKIREYTLTHLPQGAEYRFRVLACNAGG 23742

Query: 583   LSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGT 642
                P EP+E       P T                       VK  E+L Y  Y      
Sbjct: 23743 ---PGEPAEV------PGT-----------------------VKVTEMLEYPDYELDERY 23770

Query: 643   SEWQTVNNKPIQGTRFTVPGLRTGKEYEFCV-----RSVSEAGVGESSAATEPIRVKQAL 697
              E   V    +   R T+P    GK +  C      + +S+  +  +S     + +K+A 
Sbjct: 23771 QEGIFVRQGGV--IRLTIP--IKGKPFPICKWTKEGQDISKRAMIATSETHTELVIKEAD 23826

Query: 698   ATPSAPYGFALLN-CGKNEMVI---------------------------GWKPPKRRGGG 729
                S  Y   L N CGK  + I                            W+PP   GG 
Sbjct: 23827 RGDSGTYDLVLENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGA 23886

Query: 730   KILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPS 789
              ILGY L++ +  +  W+ ++ +   T +  V  L E   Y FR  A N  G+ +     
Sbjct: 23887 DILGYILERREVPKAAWYTIDSRVRGTSLV-VKGLKENVEYHFRVSAENQFGISKPLKSE 23945

Query: 790   SLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWK 849
                  K    P   P       +V  +S+ L W  P   G   VTGY++  +E  +++W 
Sbjct: 23946 EPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWV 24005

Query: 850   PVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED------KPGAH 903
                   I+ T   V+ L P   Y F++ A N  GL + S  ++PV+ +D      +PG  
Sbjct: 24006 RHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPG-- 24063

Query: 904   EIEVGVDEEGFIYLAFEAPEAPDSSE 929
             E+E+    +  + L +E PE     E
Sbjct: 24064 ELEILSISKDSVTLQWEKPECDGGKE 24089



 Score =  177 bits (450), Expect = 5e-44
 Identities = 215/843 (25%), Positives = 344/843 (40%), Gaps = 113/843 (13%)

Query: 170  TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRIT-NNYGLLS-LEIRRCAIEDSAT 227
            T+ +   V   P P   W K +  +D       K R+  +N G  S L I+    +D   
Sbjct: 8749 TLRIPAVVTGRPVPTKVWTKEEGELD-------KDRVVIDNVGTKSELIIKDALRKDHGR 8801

Query: 228  YTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEP 287
            Y +   N+ G   + A+V V         FD         GP ++    LKPV    K  
Sbjct: 8802 YVITATNSCGSKFAAARVEV---------FDVP-------GPVLD----LKPVVTNRK-- 8839

Query: 288  FSLSCLFS----EDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
                CL +    ED   +E   +  +    +    R+ + T+R +   ++   +  E  +
Sbjct: 8840 ---MCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETER-SKCDITGLLEGQEYKF 8895

Query: 344  MVRVPSPFG--PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRG 401
             V   + FG  P  +   +L  D      G P SP  +   +  +  + L W  P    G
Sbjct: 8896 RVIAKNKFGCGPPVEIGPILAVDPL----GPPTSPERLTYTERTKSTITLDWKEPRSNGG 8951

Query: 402  NPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKA 461
            +PI  Y IE+ + +  ++   ++    T    ++ L E Q Y FRV+A++ +G S PS  
Sbjct: 8952 SPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLP 9011

Query: 462  SELVVMGDHDAARRKTEIPFDLGNKITISTDAFE----DTVTIPSPPTNVHASEIREAYV 517
              +V+  D        E+P  +  ++++  D  +    + V IP+  T +   +I  +  
Sbjct: 9012 LNVVIQDD--------EVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKN 9063

Query: 518  VLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRA 577
                E+P+  D   +T   ++ V  S     +S    VR         E K +Y   V A
Sbjct: 9064 ETVIEKPT--DALQIT---KEEVSRSEAKTELSIPKAVR---------EDKGTYT--VTA 9107

Query: 578  MNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQT-SVSLTWDPVKD---PELLGY 633
             N+ G    +   E      PP  L       A  D +  S  LTWD   D    E+  Y
Sbjct: 9108 SNRLGSVFRNVHVEVYDRPSPPRNL-------AVTDIKAESCYLTWDAPLDNGGSEITHY 9160

Query: 634  YIYSRKVG--TSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPI 691
             I  R      +EW+ V N  ++  R+ +  L    +YEF VR+V++ G+ +    ++ +
Sbjct: 9161 VIDKRDASRKKAEWEEVTNTAVE-KRYGIWKLIPNGQYEFRVRAVNKYGISD-ECKSDKV 9218

Query: 692  RVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQ 751
             ++     P  P    +L   K  M++ W PP   GG  I GY+L++ +     W  V++
Sbjct: 9219 VIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSR 9278

Query: 752  QPIPTRV------CKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPP 805
             PI T+V        V  L EG  Y+FRA A N AG+G  S PS      +   P PGPP
Sbjct: 9279 API-TKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFP-PGPP 9336

Query: 806  YDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP--ISGTHLRV 863
                  +   +S+ L W+PP   G  P+ GY V  QEEG+  WK V      I+     V
Sbjct: 9337 SCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCECVV 9396

Query: 864  SDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEVGVDEEGF--------- 914
             +L+  + Y F+V+A+N AG  +PS  T  +   D     E+ + +  +           
Sbjct: 9397 PNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQI 9456

Query: 915  -IYLAFEAPEAPDSSEFQWSKDYKGPLD-----PQRVKIEDKVNKSKVILKEPGLEDLGT 968
             I    +    P SS     K  K   D     P+  ++E   N S +I+ E      G 
Sbjct: 9457 RIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHTGK 9516

Query: 969  YSV 971
            YS+
Sbjct: 9517 YSI 9519



 Score =  177 bits (450), Expect = 5e-44
 Identities = 197/851 (23%), Positives = 347/851 (40%), Gaps = 100/851 (11%)

Query: 150   YGRGPWFWIPLRSHAVWEH---TTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRI 206
             YG GP   +PL    V ++   T+V L   +   P P + WYK+D  +           +
Sbjct: 20495 YG-GPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVC----V 20549

Query: 207   TNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRST 266
              N   L S+ I+     +S  Y ++++NA G AS+  +V +    G   G     FK  T
Sbjct: 20550 ENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPIE--FKTVT 20607

Query: 267   FGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDR 326
                + + T + +P      +  +    +  +  +   + W    S++       I+ T +
Sbjct: 20608 ---AEKITLLWRPP---ADDGGAKITHYIVEKRETSRVVW----SMVSEHLEECIITTTK 20657

Query: 327   QASLKVSCTYKEDEGLYMVRVPSPFGPRE--QSTYVLVRDAEAENPGAPGSPLNVRCLDV 384
                       K +E ++ VR  + +G  E  +S  V+ ++A    PG PG P       +
Sbjct: 20658 --------IIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAFV-TPGPPGIP---EVTKI 20705

Query: 385   NRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYR 444
              ++ + + W+ P    G+ I+ Y +E+   +S  W    +      R  + GL E   Y+
Sbjct: 20706 TKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQ 20765

Query: 445   FRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPP 504
             +RV A++  G    S+ SE      + AA                      D +  P PP
Sbjct: 20766 YRVCAVNAAGQGPFSEPSEF-----YKAA----------------------DPIDPPGPP 20798

Query: 505   TNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVL 563
               +  ++  ++ + L W +P     + +T Y +E        W  +S++  VR+  + V 
Sbjct: 20799 AKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVS 20858

Query: 564   DLEKKKSYVFRVRAMNQYGLSDPSEPSEPI----ALRGPPATLPPPAQ----VQAFRDTQ 615
             +L+   +Y FRV A+N  G  +P E +EP+     L  P   L    +     +A  D Q
Sbjct: 20859 NLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQ 20918

Query: 616   TSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRS 675
               +     P   P  + +    + +G+    ++ N     +  T+P +      ++ +  
Sbjct: 20919 VLIPFKGRP---PPTVTWRKDEKNLGSDARYSIENTD-SSSLLTIPQVTRNDTGKYIL-- 20972

Query: 676   VSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYF 735
               E GVGE  ++T  ++V   L TP+A     + +  +  + + W PP   GG  I+ Y 
Sbjct: 20973 TIENGVGEPKSSTVSVKV---LDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYV 21029

Query: 736   LDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECK 795
             +++ D+ +  W  V+ +   T   K+ DL E   + FR  A N  G+GE    +   +  
Sbjct: 21030 IEKRDATKRTWSVVSHKCSSTSF-KLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAA 21088

Query: 796   EWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP 855
             E     P P  D+   +   TS++L W  P + G   +T Y V  + +G + W     G 
Sbjct: 21089 E----VPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHA--GI 21142

Query: 856   ISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQP----------SMPTDPVLLEDKPGAHEI 905
                  + VS L+      F+V A N  GL  P           + T  V L D PGA ++
Sbjct: 21143 SKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPGA-QV 21201

Query: 906   EVGVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLED 965
              V +     + L ++    P  S   W KD     + + V+     NK  + +K    E 
Sbjct: 21202 TVRIGHNVHLELPYKGKPKPSIS---WLKDGLPLKESEFVRFSKTENKITLSIKNAKKEH 21258

Query: 966   LGTYSVIVTDA 976
              G Y+VI+ +A
Sbjct: 21259 GGKYTVILDNA 21269



 Score =  177 bits (450), Expect = 5e-44
 Identities = 161/611 (26%), Positives = 259/611 (42%), Gaps = 76/611 (12%)

Query: 304   IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVR 363
             I W + G  L S  R  I  T+  + L V    + D G Y +   +  G +  +  V V 
Sbjct: 23106 ITWSKQGIDLAS--RAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVY 23163

Query: 364   DAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACH 423
             D        PG   +V+  +V+RD + +TW  P+   G P+  Y +E+ +       A  
Sbjct: 23164 DT-------PGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREA------AMR 23210

Query: 424   EAPGGTCRCP-----IQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTE 478
                  T +C      I GLVEG  Y FRV   +  G   P + S+ V++ +         
Sbjct: 23211 AFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSE--------- 23261

Query: 479   IPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLE 537
                                  +P  P  +   ++ ++ V LAWE+P     + LT Y LE
Sbjct: 23262 ---------------------VPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLE 23300

Query: 538   KSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIA--- 594
                 G+  W  + +  P       V  L + + Y+FR+RA N+ G+S+P E    +    
Sbjct: 23301 ACKAGTERWMKVVTLKPT-VLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQD 23359

Query: 595   LRGPP----ATLPPPA-QVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTV- 648
             LR  P    +T+P     V A R  +  + +   P   P    ++    K+  SE  TV 
Sbjct: 23360 LRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRP---PPAASWFFAGSKLRESERVTVE 23416

Query: 649   NNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYG-FA 707
              +  +         +R   EY   +++V       +   +E I+V   L  P  P G   
Sbjct: 23417 THTKVAKLTIRETTIRDTGEYTLELKNV-------TGTTSETIKV-IILDKPGPPTGPIK 23468

Query: 708   LLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEG 767
             +       + I W+PP+  GG  + GY ++Q D+    W  V++  +     K + L EG
Sbjct: 23469 IDEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSES-VTRSTFKFTRLTEG 23527

Query: 768   HFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLY 827
             + Y FR  A N  G+G     S + EC+  ++  PGPP  ++  +V    + L W PP  
Sbjct: 23528 NEYVFRVAATNRFGIGSY-LQSEVIECRS-SIRIPGPPETLQIFDVSRDGMTLTWYPPED 23585

Query: 828   MGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQP 887
              G   VTGY V  +E  +++W  V   P++ T  R + L  G  Y  +V A+N+ G G+P
Sbjct: 23586 DGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKP 23645

Query: 888   SMPTDPVLLED 898
             S P+ P++  D
Sbjct: 23646 SRPSKPIVAMD 23656



 Score =  175 bits (443), Expect = 3e-43
 Identities = 264/1228 (21%), Positives = 457/1228 (37%), Gaps = 184/1228 (14%)

Query: 301   AESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYV 360
             A +I+W++D   L+++    +  T   AS+ +    + + G Y +++ +  G    +  V
Sbjct: 20529 APTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRV 20588

Query: 361   LVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWI 420
              + D     PG PG P+  + +   +  + L W PP+D  G  IT Y +E+ +     W 
Sbjct: 20589 QILD----KPGPPGGPIEFKTVTAEK--ITLLWRPPADDGGAKITHYIVEKRETSRVVWS 20642

Query: 421   ACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIP 480
                E     C      +++G  Y FRVRA+++ G   P ++  +V               
Sbjct: 20643 MVSEHLE-ECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVA-------------- 20687

Query: 481   FDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKS 539
                           ++    P PP     ++I +  + + W  P     + ++ Y LEK 
Sbjct: 20688 --------------KNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKR 20733

Query: 540   VIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPP 599
                S  W  +  E+ +R  R  V  L +   Y +RV A+N  G    SEPSE      P 
Sbjct: 20734 DKKSLGWFKVLKET-IRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPI 20792

Query: 600   ATLPPPAQVQAFRDTQTSVSLTWD-PVKD--PELLGYYIYSRKVGTSEWQTVNNK-PIQG 655
                 PPA+++    T++S++L W  PV D    + GY +  R+    EW TV+ K  ++ 
Sbjct: 20793 DPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRT 20852

Query: 656   TRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFAL-----LN 710
             T + V  L+ G  Y F V +V+ AG GE     EP++ K  L  P      AL       
Sbjct: 20853 TEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAK 20912

Query: 711   CGKNEMVI----GWKPPKR--RGGGKILG----YFLDQHDSEELDWHAVNQQPIPTRVCK 760
              G++  V+    G  PP    R   K LG    Y ++  DS  L                
Sbjct: 20913 AGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSL--------------LT 20958

Query: 761   VSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVL 820
             +  +      ++     N  GVGE    SS    K   +  P     ++   V   ++ L
Sbjct: 20959 IPQVTRNDTGKYILTIEN--GVGE--PKSSTVSVK--VLDTPAACQKLQVKHVSRGTVTL 21012

Query: 821   QWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMN 880
              W+PPL  G  P+  Y +  ++     W  V+    S T  ++ DL     + F+V A N
Sbjct: 21013 LWDPPLIDGGSPIINYVIEKRDATKRTWSVVSH-KCSSTSFKLIDLSEKTPFFFRVLAEN 21071

Query: 881   SAGLGQPSMPTDPVLLEDKPGA-HEIEVGVDEEGFIYLAFEAPEAPDSS---EFQWSKDY 936
               G+G+P   T+PV   + P    ++ +    +  + L++  P+    S   E+   +  
Sbjct: 21072 EIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKG 21131

Query: 937   KGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKK 996
             KG        I          LKE  + +   ++       + ++    +T +EL     
Sbjct: 21132 KGEQTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIG-PITVKEL----- 21185

Query: 997   LSHEIRNPVIKL--ISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKI 1054
                 I  P + L  I G  + +     V L L   K  P   +  + +   +  S    +
Sbjct: 21186 ----IITPEVDLSDIPGAQVTVRIGHNVHLELPY-KGKPKPSISWLKDGLPLKES--EFV 21238

Query: 1055  NFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDD----------FDKLL 1104
              F + +  + + I+N  +E  G YT  L +   +  + +T++             FD++ 
Sbjct: 21239 RFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKGPIRFDEI- 21297

Query: 1105  RKADAKRRDW-----------------KRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKK 1147
              KAD+    W                 KR+          WK+      + T KV N  K
Sbjct: 21298 -KADSVILSWDVPEDNGGGEITCYSIEKRETSQ-----TNWKMVCSSVARTTFKVPNLVK 21351

Query: 1148  ETRFQWFFQRAEMPDGQYDPETGTGLLCIEEL---SKKDKGIYRAMVSD----------- 1193
             +  +Q F  RAE   G   P   + ++   +        K +   + SD           
Sbjct: 21352 DAEYQ-FRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVY 21410

Query: 1194  DRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTT 1253
             D G + T   +     ++I  +      +S    +  G  EG+    +V   N   + + 
Sbjct: 21411 DGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGLSSP 21470

Query: 1254  WFHKDKRLESGDRIRTGT---------TLDEIWLHILDPKDSDKGKYTLEIAAGKE--VR 1302
                    L        GT         T+   W   L    S    Y++E   G E  VR
Sbjct: 21471 SDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVGYSIEKRQGNERWVR 21530

Query: 1303  QLSTDLS-----------GQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIME--- 1348
                TD+S           G  +E  +     + T++   ++   ++    +V  I+E   
Sbjct: 21531 CNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGP 21590

Query: 1349  ----------DKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGT--EVTITIEK 1396
                        ++L +  +V G P P ++W K+   V    R  ME+       ++ +  
Sbjct: 21591 EYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDG--VEIEKRMNMEITDVLGSTSLFVRD 21648

Query: 1397  VNSEDSGRYGVFVKNKYGSETGQVTISV 1424
                +  G Y V  KN  GS   ++ + V
Sbjct: 21649 ATRDHRGVYTVEAKNASGSAKAEIKVKV 21676



 Score =  174 bits (442), Expect = 4e-43
 Identities = 161/669 (24%), Positives = 276/669 (41%), Gaps = 89/669 (13%)

Query: 305   QWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRD 364
             +W  DGS +++     +   +  + L +    + D G Y + V +  G +  + ++ V D
Sbjct: 11171 KWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLD 11230

Query: 365   AEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHE 424
                  PG P  P+N+  LDV  + + ++W PP D  G+P+  Y +E+       W     
Sbjct: 11231 V----PGPPTGPINI--LDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSS 11284

Query: 425   APGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLG 484
                 T +  I  L +G  Y FRVRA +++G   P                        L 
Sbjct: 11285 GSSKT-KLKIPHLQKGCEYVFRVRAENKIGVGPP------------------------LD 11319

Query: 485   NKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGS 543
             +  T++   F      PSPP     ++I E    ++W  P     +P+T Y +E+  + +
Sbjct: 11320 STPTVAKHKFSP----PSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREV-T 11374

Query: 544   GTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLP 603
             G W  + +++P+   +F V  L +  +Y FRV A N  GLS PS  S+PI    P     
Sbjct: 11375 GKWVRV-NKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKPPG 11433

Query: 604   PPAQVQAFRDTQTSVSLTW-DPVKD--PELLGYYIYSRKVGTSEWQTVN-NKPIQGTRFT 659
             PP   +    ++ +  L W  P+ D    +LGY +  +K GT++W  +N ++ I+   F 
Sbjct: 11434 PPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFR 11493

Query: 660   VPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNC-------- 711
             VPGL  G EY F +++ +  G GE     E +  K  L  P         +         
Sbjct: 11494 VPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQT 11553

Query: 712   --------GKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSD 763
                     G+ E  I W        GK+L         + +D      Q +P    ++ +
Sbjct: 11554 IRILARVKGRPEPDITWTKE-----GKVL------VREKRVDL----IQDLPRVELQIKE 11598

Query: 764   LHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWE 823
                    ++   A N +G  + SA  ++ +       +PGP  +++ + V   +  + WE
Sbjct: 11599 AVRADHGKYIISAKNSSGHAQGSAIVNVLD-------RPGPCQNLKVTNVTKENCTISWE 11651

Query: 824   PPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAG 883
              PL  G   +T + V +++   + W  V         L  ++L     Y F+V A N  G
Sbjct: 11652 NPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTK--RLIKANLLANNEYYFRVCAENKVG 11709

Query: 884   LGQPSMPTDPVLL---EDKPGAHE-IEVGVDEEGFIYLAFEAPEAPDSS---EFQWSKDY 936
             +G       P+L     D+PG  E + +    + F+YL +  P+    S    +   +  
Sbjct: 11710 VGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRL 11769

Query: 937   KGPLDPQRV 945
             KG  D +RV
Sbjct: 11770 KGSDDWERV 11778



 Score =  174 bits (442), Expect = 4e-43
 Identities = 147/610 (24%), Positives = 257/610 (42%), Gaps = 64/610 (10%)

Query: 305   QWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRD 364
             +W +    + +S    +   D  + L +    ++D G Y +   +  G   Q   V+V D
Sbjct: 12559 KWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMD 12618

Query: 365   AEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHE 424
             A    PG P  P ++   D++ D   L+W  P +  G+ IT Y +E+C    G+W+    
Sbjct: 12619 A----PGPPQPPFDIS--DIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALA 12672

Query: 425   APGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLG 484
             +   T  C +  L+ GQ Y FRVRA +R G S P  + ++V            + PF   
Sbjct: 12673 SVTKT-SCRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMV-----------AQFPFG-- 12718

Query: 485   NKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGS 543
                            +PS P N   +++ +  + +AW+ P     +P+  Y +E+    S
Sbjct: 12719 ---------------VPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNS 12763

Query: 544   GTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLP 603
               W   ++++ VRS  +    L +   Y FR+ A+N+ G S PS+P+E +  R P   + 
Sbjct: 12764 LLW-VKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMP---VD 12819

Query: 604   PPAQVQAFRDTQTSVSLTWDPVK---DPELLGYYIYSRKVGTSEWQTVNNKP--IQGTRF 658
             PP + +    T+++VSL W   K     +++GY++ + K+   +W   N  P  I    +
Sbjct: 12820 PPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEY 12879

Query: 659   TVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVI 718
             T  GL    +Y+F   + +   +   S  ++P+ +      P      A+    K+ + +
Sbjct: 12880 TATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAM----KSLLTV 12935

Query: 719   GWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEF----RA 774
                   + G    L   +       + W        P    K++        E     R 
Sbjct: 12936 ------KAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRK 12989

Query: 775   RAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVT 834
              + ++    E S+ S     K   + +PGPP  V+ +++ +   +L WEPPL  G   +T
Sbjct: 12990 DSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEIT 13049

Query: 835   GYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPV 894
              Y V  +E     W  V+   +  T   V  L  G  Y F++ A N  G+G P   T+P 
Sbjct: 13050 NYIVDKRETSRPNWAQVS-ATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVF-TEPA 13107

Query: 895   LLE---DKPG 901
             + +   D PG
Sbjct: 13108 IAKNPYDPPG 13117



 Score =  174 bits (442), Expect = 4e-43
 Identities = 140/540 (25%), Positives = 234/540 (43%), Gaps = 43/540 (7%)

Query: 373   PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRC 432
             PG+P     +DV R+ + L W PP    G+ I  Y+IE+ QG    W+ C+      C+ 
Sbjct: 21486 PGTP---DYIDVTRETITLKWNPPLRDGGSKIVGYSIEKRQGNE-RWVRCNFTDVSECQY 21541

Query: 433   PIQGLVEGQSYRFRVRAISRVGS-SVPSKASELVVMGDHDAARRKTEIPFDLGNKITIST 491
              + GL  G  Y FR+ A + VG+ S PS++S +++  D +        P      +    
Sbjct: 21542 TVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVP------PI-----VEFGP 21590

Query: 492   DAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISS 551
             + F+  +        + A         + W +        +   +   V+GS +      
Sbjct: 21591 EYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEIT-DVLGSTS------ 21643

Query: 552   ESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAF 611
                       V D  +    V+ V A N  G    ++    + ++  P  +  P  ++  
Sbjct: 21644 --------LFVRDATRDHRGVYTVEAKNASG---SAKAEIKVKVQDTPGKVVGP--IRFT 21690

Query: 612   RDTQTSVSLTWD-PVKD--PELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKE 668
               T   ++L WD P+ D    +  Y I  R+     W  + +K  +   +T   L  G E
Sbjct: 21691 NITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDK-CEAQSYTAIKLINGNE 21749

Query: 669   YEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGG 728
             Y+F V +V++ GVG     ++P+  +     P AP      N   N + + W  P+  GG
Sbjct: 21750 YQFRVSAVNKFGVGRP-LDSDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGG 21808

Query: 729   GKILGYFLDQHDSEELDW-HAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSA 787
              +I  Y L++ + +   W   ++++PI     KV+ L EG+ YEF   A N AGVG  S 
Sbjct: 21809 SEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASG 21868

Query: 788   PSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQ 847
              S L +C+E   P PGPP  V+ ++   T++ L+W  P++ G   + GY +   +     
Sbjct: 21869 ISRLIKCREPVNP-PGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGD 21927

Query: 848   WKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEV 907
             W  V       T   V+DLQ G+ Y F+V A+N AG G     T  +   D+  A E+++
Sbjct: 21928 WHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDI 21987



 Score =  174 bits (440), Expect = 7e-43
 Identities = 169/657 (25%), Positives = 270/657 (41%), Gaps = 90/657 (13%)

Query: 295   SEDVLDAE-------SIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRV 347
             S+ VLDA         I W +    L    +  + YT ++A+  +    + D G Y + V
Sbjct: 22691 SDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTV 22750

Query: 348   PSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAY 407
              +  G +  S  V V D       +PG    +    V ++   L W+ P +  G  IT Y
Sbjct: 22751 KNASGTKAVSVMVKVLD-------SPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHY 22803

Query: 408   TIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVM 467
              +ER +     W+   E    T    +  L++   Y FRVRA+++ G  VP ++  +V  
Sbjct: 22804 IVERRETSRLNWVIV-EGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVA- 22861

Query: 468   GDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEP-SP 526
                                         ++ TIPSPP         + ++++ W +P S 
Sbjct: 22862 ---------------------------RNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESD 22894

Query: 527   RDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDP 586
                    Y ++K    S  W  ++ +  V   R  V  L +   Y FRV A+N  G S+P
Sbjct: 22895 GGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEP 22954

Query: 587   SEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTW-DPVKD--PELLGYYIYSRKVGTS 643
             SE S  I+ R P  T  PP+  +    T+ S+SL W  P+ D   +++GY +  ++  T 
Sbjct: 22955 SEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTD 23014

Query: 644   EWQTVN-NKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATP-- 700
             +W  V+ N  I+ T FTVP L+ G++Y F V +V+  G+ E S +   I   + +  P  
Sbjct: 23015 QWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPDL 23074

Query: 701   --------------SAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDW 746
                            A     +   G+   VI W    ++G        +D  +S  L  
Sbjct: 23075 ELADDLKKTVTIRAGASLRLMVSVSGRPPPVITW---SKQGIDLASRAIIDTTESYSL-- 23129

Query: 747   HAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPY 806
                        V KV+    G   ++   A N +G    +    +++        PGP  
Sbjct: 23130 ---------LIVDKVNRYDAG---KYTIEAENQSGKKSATVLVKVYD-------TPGPCP 23170

Query: 807   DVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDL 866
              V+  EV   S+ + WE P   G  PV  Y V  +E     +K VT    S T  R+S L
Sbjct: 23171 SVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREAAMRAFKTVTT-KCSKTLYRISGL 23229

Query: 867   QPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKP-GAHEIEVGVDEEGFIYLAFEAP 922
               G  Y F+V   N  G+G+P   +D VL+ + P    ++EV    +  + LA+E P
Sbjct: 23230 VEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKP 23286



 Score =  173 bits (439), Expect = 9e-43
 Identities = 167/665 (25%), Positives = 277/665 (41%), Gaps = 93/665 (13%)

Query: 299  LDAESIQWFRDGSLLRSSR------RRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFG 352
            L    I+W ++ +++          + ++  ++ +  L +    +ED+G Y V   +  G
Sbjct: 9053 LPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLG 9112

Query: 353  PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIER- 411
               ++ +V V D        P  P N+   D+  +   LTW  P D  G+ IT Y I++ 
Sbjct: 9113 SVFRNVHVEVYDR-------PSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKR 9165

Query: 412  -CQGESGEWIACHEAPGGTC---RCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVM 467
                +  EW    E    T    R  I  L+    Y FRVRA+++ G S   K+ ++V+ 
Sbjct: 9166 DASRKKAEW----EEVTNTAVEKRYGIWKLIPNGQYEFRVRAVNKYGISDECKSDKVVI- 9220

Query: 468  GDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPR 527
                                       +D   +P PP         +  ++++W  P   
Sbjct: 9221 ---------------------------QDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDN 9253

Query: 528  DRAPLT-YSLEKSVIGSGTWEAIS----SESPVRSPRFAVLDLEKKKSYVFRVRAMNQYG 582
              +P+T Y LEK   GS  W  +S    ++  ++   F V  L +   Y FR  A+N  G
Sbjct: 9254 GGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAG 9313

Query: 583  LSDPSEPSEPIALRGPPATLPPPAQVQAFRD-TQTSVSLTWDP-VKD--PELLGYYIYSR 638
            +  PSEPS+P  + G P   P P      +D T++S+SL W P  KD    + GY +  +
Sbjct: 9314 IGPPSEPSDP-EVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQ 9372

Query: 639  KVGTSEWQTVN--NKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQA 696
            + GT++W+ VN  +K I      VP L+  ++Y F V++V+EAG  E S  T  I     
Sbjct: 9373 EEGTTDWKRVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDI 9432

Query: 697  LATPSAPYGFALLNCG--------KNEMVIGWKPPKRRG---GGKILGYFLDQ-HDSEEL 744
               P         +C         +   VI  +P  +      GK      D  HD  E 
Sbjct: 9433 QEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPE- 9491

Query: 745  DWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGP 804
               A  +    + V  + +    H  ++   A N AG            C+   M  PGP
Sbjct: 9492 --DAQLETAENSSVIIIPECKRSHTGKYSITAKNKAG-------QKTANCRVKVMDVPGP 9542

Query: 805  PYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVS 864
            P D++ S++   S  L W+ P   G   + GY +  +    + W  V P   S T + V 
Sbjct: 9543 PKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFV-VP 9601

Query: 865  DLQPGKSYVFQVQAMNSAGLGQP------SMPTDPVLLEDKPGAHEIEVGVDEEGFIYLA 918
            DL   + Y F+V+A N  G+G P      +   DP+   D P   ++++G+  +  ++L+
Sbjct: 9602 DLLSEQQYFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPP--IKLKIGLITKNTVHLS 9659

Query: 919  FEAPE 923
            ++ P+
Sbjct: 9660 WKPPK 9664



 Score =  173 bits (439), Expect = 9e-43
 Identities = 182/737 (24%), Positives = 287/737 (38%), Gaps = 93/737 (12%)

Query: 177   VQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAH 236
             VQ  P P+VTW+K+   I+ R+       IT+  G  SL +R    +    YTV  KNA 
Sbjct: 21610 VQGRPVPRVTWFKDGVEIEKRM----NMEITDVLGSTSLFVRDATRDHRGVYTVEAKNAS 21665

Query: 237   GQASSFAKVLVRTYLGKDAG---FDSEIFKRSTFGPSVEFTSVLKPV---FAREKEPFSL 290
             G A +  KV V+   GK  G   F +   ++ T            P+      ++E   L
Sbjct: 21666 GSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRL 21725

Query: 291   SCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSP 350
             +    ED  +A+S    +             L    +   +VS   K   G         
Sbjct: 21726 AWALIEDKCEAQSYTAIK-------------LINGNEYQFRVSAVNKFGVG--------- 21763

Query: 351   FGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIE 410
                R   +  +V   +   P APG P      ++  + + LTWA P    G+ I  Y +E
Sbjct: 21764 ---RPLDSDPVVAQIQYTVPDAPGIP---EPSNITGNSITLTWARPESDGGSEIQQYILE 21817

Query: 411   RCQGESGEWI-ACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGD 469
             R + +S  W+    + P    R  + GL EG  Y F V A +  G    S  S L+    
Sbjct: 21818 RREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLI---- 21873

Query: 470   HDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEP-SPRD 528
                                       + V  P PPT V  ++  +  V L W +P     
Sbjct: 21874 -----------------------KCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGG 21910

Query: 529   RAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSE 588
                + Y +E      G W  +++E+ V++ R+ V DL+  + Y FRV A+N  G  D  E
Sbjct: 21911 MEIIGYIIEMCKADLGDWHKVNAEACVKT-RYTVTDLQAGEEYKFRVSAINGAGKGDSCE 21969

Query: 589   PSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEW-QT 647
              +  I  +       P   + A    QT V      ++    L      R   T+ W + 
Sbjct: 21970 VTGTI--KAVDRLTAPELDIDA-NFKQTHVVRAGASIR----LFIAYQGRPTPTAVWSKP 22022

Query: 648   VNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAG-----VGESSAATEPIRVKQALATPSA 702
              +N  ++    T     T    E C R  ++AG     V  +S +       + L TP  
Sbjct: 22023 DSNLSLRADIHTTDSFST-LTVENCNR--NDAGKYTLTVENNSGSKSITFTVKVLDTPGP 22079

Query: 703   PYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVS 762
             P      +  +    + W  P   GG +I  Y +++ ++    W  ++++    ++ KV+
Sbjct: 22080 PGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISEK-CTRQIFKVN 22138

Query: 763   DLHEGHFYEFRARAANWAGVGE-LSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQ 821
             DL EG  Y FR  A N  GVGE    P  +   +     QP PP  +   +   +S VL 
Sbjct: 22139 DLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATE-----QPAPPRRLDVVDTSKSSAVLA 22193

Query: 822   WEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNS 881
             W  P + G   +TGY +  +++GS+ W  V  G        V  L     Y F+V+A N 
Sbjct: 22194 WLKPDHDGGSRITGYLLEMRQKGSDFW--VEAGHTKQLTFTVERLVEKTEYEFRVKAKND 22251

Query: 882   AGLGQPSMPTDPVLLED 898
             AG  +P      V++++
Sbjct: 22252 AGYSEPREAFSSVIIKE 22268



 Score =  172 bits (437), Expect = 2e-42
 Identities = 153/644 (23%), Positives = 258/644 (40%), Gaps = 86/644 (13%)

Query: 373   PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRC 432
             PG P N R  D  R  + L W+ P D  G+ +T Y IE  + +  EW  C+  P      
Sbjct: 23661 PGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREY 23720

Query: 433   PIQGLVEGQSYRFRVRAISRVGSSVPS------KASELVVMGDHDAARRKTEIPF-DLGN 485
              +  L +G  YRFRV A +  G   P+      K +E++   D++   R  E  F   G 
Sbjct: 23721 TLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQGG 23780

Query: 486   KITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAW----EEPSPRDRAPLTYSLEKSVI 541
              I +       T+ I   P           + +  W    ++ S R     + +  + VI
Sbjct: 23781 VIRL-------TIPIKGKP-----------FPICKWTKEGQDISKRAMIATSETHTELVI 23822

Query: 542   ------GSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIAL 595
                    SGT++ +                  KK+   +VR      +  P+ P  P+  
Sbjct: 23823 KEADRGDSGTYDLVLENKC------------GKKAVYIKVRV-----IGSPNSPEGPLE- 23864

Query: 596   RGPPATLPPPAQVQAFRDTQT-SVSLTWDPVKDP---ELLGYYIYSRKVGTSEWQTVNNK 651
                            + D Q  SV ++W P  D    ++LGY +  R+V  + W T++++
Sbjct: 23865 ---------------YDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSR 23909

Query: 652   PIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFA-LLN 710
              ++GT   V GL+   EY F V + ++ G+ +   + EP+  K  L  P  P     +L+
Sbjct: 23910 -VRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVLD 23968

Query: 711   CGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFY 770
               K+ + + W  PK  GG ++ GY++++ ++    W   N+  I T +  V+ L     Y
Sbjct: 23969 VTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEY 24028

Query: 771   EFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGA 830
             +FR  A N  G+ E S  S    CK+    +P  P ++    +   S+ LQWE P   G 
Sbjct: 24029 QFRIIAQNDVGLSETSPASEPVVCKD-PFDKPSQPGELEILSISKDSVTLQWEKPECDGG 24087

Query: 831   GPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMP 890
               + GY V +++ G   WK      I      +  L     Y F+V A N  GL +P   
Sbjct: 24088 KEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRT 24147

Query: 891   TDPVLLE----DKPGAH----EIEVGVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDP 942
                +  +    + PG      ++   + E   +         PD    +W +  K  +  
Sbjct: 24148 AMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPD---IKWYRFGKELIQS 24204

Query: 943   QRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTL 986
             ++ K+        + +     ED G Y+ I T+   ++  S  L
Sbjct: 24205 RKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKL 24248



 Score =  172 bits (436), Expect = 2e-42
 Identities = 159/611 (26%), Positives = 255/611 (41%), Gaps = 65/611 (10%)

Query: 304   IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTY--KEDEGLYMVRVPSPFGPREQSTYVL 361
             + W +D      +R  ++    R  S K S T   + D G Y+V   +  G       V 
Sbjct: 11861 VAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVN 11920

Query: 362   VRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIA 421
             V D        PG   N++ +DV+ D   + W PP D  G  I  Y +E+C+ +   W +
Sbjct: 11921 VLDK-------PGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVW-S 11972

Query: 422   CHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPF 481
              + A   T    +  L+EG  Y FRVRA +++G+  P+++  ++    +D   R      
Sbjct: 11973 TYSATVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYDKPGR------ 12026

Query: 482   DLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSV 540
                                P PP     +++ +  + + W  P       +T Y LEK  
Sbjct: 12027 -------------------PDPP---EVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKE 12064

Query: 541   IGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPA 600
               S  W  ++ +S +   R  V +L     Y FRV+A N+ G+ +PS PS P+  + P  
Sbjct: 12065 KHSTRWVPVN-KSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIE 12123

Query: 601   TLPPPAQVQAFRDTQTSVSLTWD-PVKD--PELLGYYIYSR-KVGTSE----WQTVNNKP 652
                PP   +    T+ S++L W  PV D    ++GY +  R K+  +     W+  N   
Sbjct: 12124 PPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAA 12183

Query: 653   -IQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNC 711
              +    FTV  L   +EYEF V + ++ G+G  +   E I+ K+ L  P        L+ 
Sbjct: 12184 QLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEID-----LDA 12238

Query: 712   GKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYE 771
                ++VI      R G    L   +    + ++ W  V    +  R  +V  +    F  
Sbjct: 12239 SMRKLVI-----VRAGCPIRLFAIVRGRPAPKVTWRKVGIDNV-VRKGQVDLVDTMAFLV 12292

Query: 772   FRARAANWAGVGELSAPSSLFECKEW----TMPQPGPPYDVRASEVRATSLVLQWEPPLY 827
                   + +G   L+  +   E   +     +  PGP  D++ S+V  TS  + W PP  
Sbjct: 12293 IPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPEN 12352

Query: 828   MGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQP 887
              G   VT Y V  +E   + W  VTP  +  T   V++L PG  Y F+V A+N  G G P
Sbjct: 12353 DGGSQVTHYIVEKREADRKTWSTVTP-EVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVP 12411

Query: 888   SMPTDPVLLED 898
             +    PVL  D
Sbjct: 12412 TDVPKPVLASD 12422



 Score =  172 bits (435), Expect = 3e-42
 Identities = 157/594 (26%), Positives = 245/594 (41%), Gaps = 57/594 (9%)

Query: 310   GSLLRSSRRRKILYTDRQASLKVSCTYKED---EGL------YMVRVPSPFGPREQSTYV 360
             G L+    R  +L+     +L  S  Y      EGL      Y +       P + + YV
Sbjct: 12753 GYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYV 12812

Query: 361   LVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWI 420
               R    + PG P        +DV +  + L WA P    G+ I  Y +E C+    +W+
Sbjct: 12813 TAR-MPVDPPGKP------EVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWV 12865

Query: 421   ACHEAPGGTCR--CPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTE 478
              C+ AP    +      GL E   Y+FR  A + V  S PS+ S+ V           T 
Sbjct: 12866 RCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPV-----------TI 12914

Query: 479   IPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEK 538
             +  ++  +I +S  A +  +T+ +  TNV             + +P P      T S +K
Sbjct: 12915 LAENVPPRIDLSV-AMKSLLTVKAG-TNVCLD-------ATVFGKPMP------TVSWKK 12959

Query: 539   SVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGP 598
                     E I            +  + +K S  + + A N  G    +   + +   GP
Sbjct: 12960 DGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGP 13019

Query: 599   PATLPPPAQVQAFRDTQTSVSLTWDPVKDP---ELLGYYIYSRKVGTSEWQTVNNKPIQG 655
             PA+      V+  +       L+W+P  +    E+  Y +  R+     W  V+   +  
Sbjct: 13020 PAS------VKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVS-ATVPI 13072

Query: 656   TRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNE 715
             T  +V  L  G EY+F + + ++ GVG+    TEP   K     P       + N  K+ 
Sbjct: 13073 TSCSVEKLIEGHEYQFRICAENKYGVGDP-VFTEPAIAKNPYDPPGRCDPPVISNITKDH 13131

Query: 716   MVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRAR 775
             M + WKPP   GG  I GY L++ +++ ++W  VN++PI  R  K + L EG  YEFR  
Sbjct: 13132 MTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVT 13191

Query: 776   AANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTG 835
             A N AG G+ S  S     ++   P PGPP   +  +   +S+ L W  P Y G  P+ G
Sbjct: 13192 AINKAGPGKPSDASKAAYARDPQYP-PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIG 13250

Query: 836   YHVSFQEEGSEQW-KPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPS 888
             Y V  +   S+ W +   P  +  T   V+ L     Y F+V A+N  G   PS
Sbjct: 13251 YLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPS 13304



 Score =  171 bits (432), Expect = 6e-42
 Identities = 194/832 (23%), Positives = 310/832 (37%), Gaps = 116/832 (13%)

Query: 169   TTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATY 228
             T V L  TV   P P V+W K+ T + P    A   ++     L +LE+     +DS  Y
Sbjct: 12939 TNVCLDATVFGKPMPTVSWKKDGTLLKP----AEGIKMAMQRNLCTLELFSVNRKDSGDY 12994

Query: 229   TVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPF 288
             T+  +N+ G  S+  K+ V    G  A              SV+   +         EP 
Sbjct: 12995 TITAENSSGSKSATIKLKVLDKPGPPA--------------SVKINKMYSDRAMLSWEP- 13039

Query: 289   SLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVP 348
                     +   +E   +  D          ++  T    S  V    +  E  + +   
Sbjct: 13040 ------PLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAE 13093

Query: 349   SPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCL-DVNRDCLILTWAPPSDTRGNPITAY 407
             + +G  +    V    A A+NP  P    +   + ++ +D + ++W PP+D  G+PIT Y
Sbjct: 13094 NKYGVGDP---VFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGY 13150

Query: 408   TIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVM 467
              +E+ + ++  W   +  P         GL EG  Y FRV AI++ G   PS AS+    
Sbjct: 13151 LLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKA--- 13207

Query: 468   GDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPR 527
                 A  R  + P                    P PP      +   + V L+W +P+  
Sbjct: 13208 ----AYARDPQYP--------------------PGPPAFPKVYDTTRSSVSLSWGKPAYD 13243

Query: 528   DRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDP 586
               +P+  Y +E     S  W   +    ++  RF V  L +   Y FRV A+N+ G SDP
Sbjct: 13244 GGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLMEDTQYQFRVYAVNKIGYSDP 13303

Query: 587   SEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQ 646
             S+  +      P   L PP                 +   D +L    I    V    + 
Sbjct: 13304 SDVPDK---HYPKDILIPP-----------------EGELDADLRKTLILRAGVTMRLYV 13343

Query: 647   TVNNKPIQGTRFTVPGLRTGKEYEFCVRSVS-------------EAG-----VGESSAAT 688
              V  +P     ++ P +         ++S               +AG     +  S    
Sbjct: 13344 PVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKK 13403

Query: 689   EPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHA 748
             E   V + L TP  P    +    K+   + W+PP   GG  I+ Y + + D+E   W  
Sbjct: 13404 EYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWST 13463

Query: 749   VNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDV 808
             V  +   T   +V++L EG  Y FR  A N  G+G+        +  +     PGP  D+
Sbjct: 13464 VTTECSKTSF-RVANLEEGKSYFFRVFAENEYGIGDPGETRDAVKASQ----TPGPVVDL 13518

Query: 809   RASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQP 868
             +   V  +S  + W+ P   G   + GY V F  E   +W+ V             DL  
Sbjct: 13519 KVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTE-ENKWQRVMKS--LSLQYSAKDLTE 13575

Query: 869   GKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEV-GVDEEGFIYLAFEAP----- 922
             GK Y F+V A N  G G PS  T  V+  D   A ++++ G+ +    YLA E       
Sbjct: 13576 GKEYTFRVSAENENGEGTPSEIT--VVARDDVVAPDLDLKGLPD--LCYLAKENSNFRLK 13631

Query: 923   ---EAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSV 971
                +   +    W K         RV +E     + +I+ +    D G Y++
Sbjct: 13632 IPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTI 13683



 Score =  171 bits (432), Expect = 6e-42
 Identities = 199/832 (23%), Positives = 332/832 (39%), Gaps = 126/832 (15%)

Query: 177   VQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAH 236
             ++  P P+VTW K++  +  R        I N      L I  C   D+  + + ++N  
Sbjct: 14428 IKGRPAPEVTWTKDNINLKNRA------NIENTESFTLLIIPECNRYDTGKFVMTIENPA 14481

Query: 237   GQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSE 296
             G+ S F  V V                  T GP +     L+P               ++
Sbjct: 14482 GKKSGFVNVRVL----------------DTPGPVLN----LRP---------------TD 14506

Query: 297   DVLDAESIQWFRDGSLLRS-SRRRKILYTDRQASLKV---------SCTYKE---DEGL- 342
                D+ ++ W  D  L+   SR    +   R+A+ K           CTYK     EG  
Sbjct: 14507 ITKDSVTLHW--DLPLIDGGSRITNYIVEKREATRKSYSTATTKCHKCTYKVTGLSEGCE 14564

Query: 343   YMVRVPSPFGPREQSTYVLVRDAEAENP----GAPGSPLNVRCLDVNRDCLILTWAPPSD 398
             Y  RV +      ++ Y +    E   P     AP  P ++  +D+ +  + L W  P  
Sbjct: 14565 YFFRVMA------ENEYGIGEPTETTEPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKH 14618

Query: 399   TRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVP 458
               G+ IT Y IE  +  S +W       G    C ++ L EG+ Y F+V A++  G S P
Sbjct: 14619 DGGSKITGYVIEAQRKGSDQWTHITTVKG--LECVVRNLTEGEEYTFQVMAVNSAGRSAP 14676

Query: 459   SKASELVVMGDHDAARRKTEIP-FDLGN---KITISTDAFEDTVTIPSPPTNVHASEIRE 514
              ++  ++V       + +T +P  DL     K+ I+       V IP             
Sbjct: 14677 RESRPVIV-------KEQTMLPELDLRGIYQKLVIAKAGDNIKVEIP------------- 14716

Query: 515   AYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFR 574
                VL   +P+      +T+     ++     + ++ E+   S    + +  +  S  + 
Sbjct: 14717 ---VLGRPKPT------VTWKKGDQILKQT--QRVNFETTATSTILNINECVRSDSGPYP 14765

Query: 575   VRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDP---ELL 631
             + A N  G     E  + I ++      PP   ++    +   V+ +WDP ++     + 
Sbjct: 14766 LTARNIVG-----EVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPIS 14820

Query: 632   GYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPI 691
              Y +  R+  ++ W  +    I+ T +    L TG EY+F V++ +  GVG    +   I
Sbjct: 14821 NYVVEMRQTDSTTWVELATTVIR-TTYKATRLTTGLEYQFRVKAQNRYGVGPGITSA-CI 14878

Query: 692   RVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQ 751
                     P  P    +    K+ M I W  P   GG  ILGY +++ +   + W  V++
Sbjct: 14879 VANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSK 14938

Query: 752   QPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRAS 811
               +P  + K S L +G  YEFR  A N AG  + S PS      +   P PG P  +  +
Sbjct: 14939 ALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDP-PGKPVPLNIT 14997

Query: 812   EVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKS 871
                 T   L+W  P Y G   +T Y V  ++  + +W       I      VS L    +
Sbjct: 14998 RHTVT---LKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAA 15054

Query: 872   YVFQVQAMNSAG-LGQPSMPTDPVLLEDKPGAHEIEVGVD-EEGFIYLAFEA--PEAPDS 927
             Y F+V A N+AG +  PS P+D +   D   A +I+V V  ++  I  A EA   EA  S
Sbjct: 15055 YEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVS 15114

Query: 928   SE----FQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTD 975
                    +WSKD K      +++I+     + ++ K+    D G Y++  T+
Sbjct: 15115 GRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATN 15166



 Score =  170 bits (431), Expect = 8e-42
 Identities = 188/740 (25%), Positives = 291/740 (39%), Gaps = 96/740 (12%)

Query: 170   TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT 229
             T+ +   V+  P P +TW    T+    L R  +  +  +   + L+I+     D   Y 
Sbjct: 11553 TIRILARVKGRPEPDITW----TKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYI 11608

Query: 230   VRVKNA--HGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGP--SVEFTSVLKPVFAREK 285
             +  KN+  H Q S+   VL R                   GP  +++ T+V K       
Sbjct: 11609 ISAKNSSGHAQGSAIVNVLDRP------------------GPCQNLKVTNVTKE------ 11644

Query: 286   EPFSLSCLFS-EDVLD--AESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGL 342
                  +C  S E+ LD     I  F       + +   I+ +D    L  +     +E  
Sbjct: 11645 -----NCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIKANLLANNEYY 11699

Query: 343   YMVRVPSPFGPR---EQSTYVLVRDAEAENP-GAPGSPLNVRCLDVNRDCLILTWAPPSD 398
             + V   +  G     E  T +L     A NP   PG P N+   D  +  + L W  P  
Sbjct: 11700 FRVCAENKVGVGPTIETKTPIL-----AINPIDRPGEPENLHIADKGKTFVYLKWRRPDY 11754

Query: 399   TRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVP 458
               G+P  +Y +ER    S +W   H+         +   VE Q Y FRV+  +  G S  
Sbjct: 11755 DGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDW 11814

Query: 459   SKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVV 518
              K  E+VV  D     +K  +   L   +T+      DT+ +        A    + +  
Sbjct: 11815 VKTEEVVVKED----LQKPVLDLKLSGVLTVKAG---DTIRL-------EAGVRGKPFPE 11860

Query: 519   LAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAM 578
             +AW +   +D   LT S             +  ++   S +F++   ++     + V A 
Sbjct: 11861 VAWTKD--KDATDLTRS-----------PRVKIDTRADSSKFSLTKAKRSDGGKYVVTAT 11907

Query: 579   NQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDP---ELLGYYI 635
             N  G          +   GP   L     V + R T     + WDP +D    E+  Y +
Sbjct: 11908 NTAGSFVAYATVNVLDKPGPVRNLKI-VDVSSDRCT-----VCWDPPEDDGGCEIQNYIL 11961

Query: 636   YSRKVGTSEWQTVNNKPIQ-GTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVK 694
                +     W T +   +  GT  TV  L  G EY F VR+ ++ G G  + + +P+  K
Sbjct: 11962 EKCETKRMVWSTYSATVLTPGT--TVTRLIEGNEYIFRVRAENKIGTGPPTES-KPVIAK 12018

Query: 695   QALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPI 754
                  P  P    +    K EM + W PP+  GG  I GYFL++ +     W  VN+  I
Sbjct: 12019 TKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAI 12078

Query: 755   PTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVR 814
             P R  KV +L   H Y+FR +A N  G+GE S PS     K+   P PGPP + R  +  
Sbjct: 12079 PERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEP-PGPPTNFRVVDTT 12137

Query: 815   ATSLVLQWEPPLYMGAGPVTGYHVSFQEE-----GSEQWKPV-TPGPISGTHLRVSDLQP 868
               S+ L W  P+Y G  P+ GY V  + +       E WK       +      V+ L  
Sbjct: 12138 KHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDE 12197

Query: 869   GKSYVFQVQAMNSAGLGQPS 888
              + Y F+V A N  G+G+P+
Sbjct: 12198 NQEYEFRVCAQNQVGIGRPA 12217



 Score =  170 bits (430), Expect = 1e-41
 Identities = 149/565 (26%), Positives = 249/565 (44%), Gaps = 50/565 (8%)

Query: 353   PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERC 412
             P + S   + RD   + PG P        + V R+ + L W  P+   G+ IT Y +E+ 
Sbjct: 16054 PSKVSECYVARDP-CDPPGRP------EAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKK 16106

Query: 413   QGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGS-SVPSKASELVVMGDHD 471
             +   G W+             + GLVE   Y FRV A +  G  S PS+++  +      
Sbjct: 16107 ELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAIT----- 16161

Query: 472   AARRKTEIPFDLGNKITISTDA-FEDTVTIPSPPT-NVHASEIREAYVVLAWEEPSPRDR 529
              AR + + P        IS D  ++DT+ + +  +  V A    +    + W +      
Sbjct: 16162 -ARDEVDPP-------RISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGD--QE 16211

Query: 530   APLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEP 589
                T  LE       T  ++     V S  +    L+ K     R   +N   L  P  P
Sbjct: 16212 LSNTARLEIKSTDFATSLSVKDAVRVDSGNYI---LKAKNVAGERSVTVNVKVLDRPGPP 16268

Query: 590   SEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDP-VKD--PELLGYYIYSRKVGTSEWQ 646
               P+ + G                T    +L W P ++D   +++ Y +  R+     W 
Sbjct: 16269 EGPVVISGV---------------TAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVW- 16312

Query: 647   TVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGF 706
             TV +  +Q     V  L  G EY F + +V++ GVGE    +EP+  K     P AP   
Sbjct: 16313 TVVDANVQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEP-LESEPVVAKNPFVVPDAPKAP 16371

Query: 707   ALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHE 766
              +    K+ M++ W+ P   GG +ILGY L++ D E + W   +++ I     +V+ L E
Sbjct: 16372 EVTTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIE 16431

Query: 767   GHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPL 826
              H YEFR  A N AG+ E S PS+  +  +  + +PGPP + +  ++  +S+ L W  P+
Sbjct: 16432 NHDYEFRVSAENAAGLSEPSPPSAYQKACD-PIYKPGPPNNPKVIDITRSSVFLSWSKPI 16490

Query: 827   YMGAGPVTGYHVSFQEEGSEQWKPVTPGP-ISGTHLRVSDLQPGKSYVFQVQAMNSAGLG 885
             Y G   + GY V   +    +W   TP   I+ T++ V  L     Y F++ A+N AG+G
Sbjct: 16491 YDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVG 16550

Query: 886   QPSMPTDPVLLEDKPGAHEIEVGVD 910
             + +    P+++E+K  A +I++ ++
Sbjct: 16551 EHADVPGPIIVEEKLEAPDIDLDLE 16575



 Score =  169 bits (427), Expect = 2e-41
 Identities = 153/602 (25%), Positives = 252/602 (41%), Gaps = 55/602 (9%)

Query: 307   FRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGL-YMVRVPSP----FGPREQSTYVL 361
             +++ S +  S+  KIL  D Q  +KVS     DEGL Y  RV +      G   +S   +
Sbjct: 19253 YKERSSILWSKANKILIADTQ--MKVSGL---DEGLMYEYRVYAENIAGIGKCSKSCEPV 19307

Query: 362   VRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIA 421
                   + PG P         ++ R  + L W+ P    G  IT Y +ER +   G W+ 
Sbjct: 19308 PARDPCDPPGQP------EVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLK 19361

Query: 422   CHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGS-SVPSKASELVVMGDHDAARRKTEIP 480
             C+          +  L E Q Y FRV A +   S S PS+++  +++ D           
Sbjct: 19362 CNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKD----------- 19410

Query: 481   FDLGNKITISTDAFEDTVTIPSPPT-NVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKS 539
              D+     +    F D + + +     ++A        V++W     +D   +       
Sbjct: 19411 -DVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWA----KDGIEIEERARTE 19465

Query: 540   VIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPP 599
             +I +     ++ +  +R      + L  K     R  A+N   L  P  P+ P+ + G  
Sbjct: 19466 IISTDNHTLLTVKDCIRRDTGQYV-LTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGL- 19523

Query: 600   ATLPPPAQVQAFRDTQTSVSLTWD-PVKDPEL-LGYYIYSRKVGTSEWQTVNNKPIQGTR 657
                           T    SL+W  P +D    + YYI  ++  +    T+    +Q T 
Sbjct: 19524 --------------TAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQMTS 19569

Query: 658   FTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMV 717
               V  L  G EY F V  V++ GVGE   +   I+       PS P    + +  K  M 
Sbjct: 19570 CKVTKLLKGNEYIFRVTGVNKYGVGEPLESVA-IKALDPFTVPSPPTSLEITSVTKESMT 19628

Query: 718   IGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAA 777
             + W  P+  GG +I GY +++ +   L W  VN++P+     K + L EG  YE+R  A 
Sbjct: 19629 LCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAE 19688

Query: 778   NWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYH 837
             N AG+   S  S L   ++     P PP   +  +   T++ + W  PL+ G  P+TGY 
Sbjct: 19689 NAAGLSLPSETSPLIRAEDPVF-LPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYT 19747

Query: 838   VSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLE 897
             V +++     WK  +   + GT   +S L  G  YVF+V+++N  G   PS  +DP + +
Sbjct: 19748 VEYKKSDDTDWK-TSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAK 19806

Query: 898   DK 899
             ++
Sbjct: 19807 ER 19808



 Score =  169 bits (427), Expect = 2e-41
 Identities = 198/866 (22%), Positives = 338/866 (39%), Gaps = 151/866 (17%)

Query: 173   LTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRV 232
             +T   +  P P V W K DT +  R +      +       SL I      DS  YT+ +
Sbjct: 19834 MTVPFRGRPVPNVLWSKPDTDLRTRAY------VDTTDSRTSLTIENANRNDSGKYTLTI 19887

Query: 233   KNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSC 292
             +N    AS    V V                  T GP    T          ++    S 
Sbjct: 19888 QNVLSAASLTLVVKVL----------------DTPGPPTNITV---------QDVTKESA 19922

Query: 293   LFSEDVLDAESIQWFRDGSLLR--SSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVP-- 348
             + S DV + +     ++  + +  +S++  +  T+    L    T  ++  +Y  RV   
Sbjct: 19923 VLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGE 19982

Query: 349   SPFG---PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPIT 405
             + FG   P E    V + +        P  P  +    +++D + LTW  P    G+ I 
Sbjct: 19983 NEFGVGIPAETKEGVKITEK-------PSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIV 20035

Query: 406   AYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELV 465
              Y +E  +     W+ C  A   +    + GL E   Y FRV A ++ G S P +    V
Sbjct: 20036 HYVVEALEKGQKNWVKC--AVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPV 20093

Query: 466   VMGDH-------------------DAARRKTEIPFDLGN---KITISTDAFEDTVTIPSP 503
             ++ +                      +  K +IP   G    K+T+S D       +P  
Sbjct: 20094 LIKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPIS-GKPLPKVTLSRDG------VPLK 20146

Query: 504   PTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIG-SGTWEAISSESPVRSPRFAV 562
              T    +EI                   LT +L++SV   +G +E  ++ S   +  F  
Sbjct: 20147 ATMRFNTEITAEN---------------LTINLKESVTADAGRYEITAANSSGTTKAF-- 20189

Query: 563   LDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTW 622
                            +N   L  P  P+ P+ +                  T+ SV+L W
Sbjct: 20190 ---------------INIVVLDRPGPPTGPVVISDI---------------TEESVTLKW 20219

Query: 623   DPVK---DPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEA 679
             +P K     ++  Y +  R+  T+ W  V+   +  T   V  L TG+EY+F +++ +  
Sbjct: 20220 EPPKYDGGSQVTNYILLKRETSTAVWTEVS-ATVARTMMKVMKLTTGEEYQFRIKAENRF 20278

Query: 680   GVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQH 739
             G+ +   +   + VK    TP  P    + N  +  + +GW  P   GG  ++GY L+  
Sbjct: 20279 GISDHIDSA-CVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMK 20337

Query: 740   DSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPS----SLFECK 795
             D   + W   N+  I T   KV+ +  G  YEFR  A N AGVG+ S PS    ++  C+
Sbjct: 20338 DRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACE 20397

Query: 796   EWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP 855
                     PP +VR +++   S+ L W+ P + G   +TGY V  ++    +W   +   
Sbjct: 20398 --------PPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTN 20449

Query: 856   ISGTHLRVSDLQPGKSYVFQVQAMNSAG-LGQPSMPTDPVLLEDKPGAHEIEVGVD-EEG 913
             ++ T   +S L     Y F+V A N+ G +  PS    P+   D  G   I++ ++  E 
Sbjct: 20450 VTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEV 20509

Query: 914   FIYLAFEAPE------APDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLG 967
               Y A  + +         +   +W KD K       V +E+  + + +++K+    + G
Sbjct: 20510 VKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSG 20569

Query: 968   TYSVIVTDADEDISASHTLTEEELEK 993
              Y + + +A    SAS T+  + L+K
Sbjct: 20570 CYELKLRNAMG--SASATIRVQILDK 20593



 Score =  167 bits (424), Expect = 5e-41
 Identities = 199/830 (23%), Positives = 319/830 (38%), Gaps = 105/830 (12%)

Query: 173   LTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRV 232
             LT      P P+V+W+K++  +        +  I      L+LE  +    DS  Y V V
Sbjct: 10466 LTGRYSGKPKPKVSWFKDEADV----LEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVV 10521

Query: 233   KNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSC 292
             +N+ G    F +V V    G   G              V F  V K       +P     
Sbjct: 10522 ENSTGSRKGFCQVNVVDRPGPPVG-------------PVSFDEVTKDYMVISWKP----- 10563

Query: 293   LFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFG 352
                 D   ++   +  +   +       +     + + KVS   +  + ++ +   + +G
Sbjct: 10564 --PLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDYIFRIHAENLYG 10621

Query: 353   PREQSTYVLVRDAEAEN-----PGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAY 407
               +     LV D+         P AP  P+     +V +D  ++TW  P D  G PIT Y
Sbjct: 10622 ISDP----LVSDSMKAKDRFRVPDAPDQPI---VTEVTKDSALVTWNKPHD-GGKPITNY 10673

Query: 408   TIERCQGESGEWIACHEAP-GGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVV 466
              +E+ +  S  W    + P     +  +  L+EG  Y FRV A + +G   PS  S+ V 
Sbjct: 10674 ILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVF 10733

Query: 467   MGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSP 526
                                         +D +  PSPP N  A +     V L W+ P  
Sbjct: 10734 A---------------------------KDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRH 10766

Query: 527   RDRAP-LTYSLEKSVIGSGTWEAISSESPVRSP--RFAVLDLEKKKSYVFRVRAMNQYGL 583
                +  L Y +E   +G   W   ++ +P   P  ++ V  L   ++Y FRV A+N  G 
Sbjct: 10767 DGGSKILGYIVEYQKVGDEEWRR-ANHTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGE 10825

Query: 584   SDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTS 643
             SDP+   EP+ ++      PP   + A    +  +      V D   L   I        
Sbjct: 10826 SDPAHVPEPVLVK--DRLEPPELILDANMAREQHIK-----VGDTLRLSAIIKGVPFPKV 10878

Query: 644   EWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGV----GESSAATEPIRVK-QALA 698
              W+  +       R  V  +  G + E    +  + G+     E+ A ++ + VK   L 
Sbjct: 10879 TWKKEDRDAPTKARIDVTPV--GSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLD 10936

Query: 699   TPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRV 758
              P  P    +    K+   + WK P   GG  I  Y +++ D     W      P+    
Sbjct: 10937 KPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQW-----SPLSATS 10991

Query: 759   CKVS----DLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVR 814
              K S     L+EG+ Y FR  A N  G G         +  +   P PGPP D+   +V 
Sbjct: 10992 KKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHP-PGPPKDLHHVDVD 11050

Query: 815   ATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVF 874
              T + L W  P   G  P+TGY V +QEEG++ W  +    ++     V+ LQ GK+Y F
Sbjct: 11051 KTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDW--IKFKTVTNLECVVTGLQQGKTYRF 11108

Query: 875   QVQAMNSAGLGQPSMPTDPVLLEDK--PGAHEIEVGVDEEGFIYLAFEAPEAP------D 926
             +V+A N  GLG P   T P+  ++K  P + E++V +  EG +  A      P       
Sbjct: 11109 RVKAENIVGLGLPD-TTIPIECQEKLVPPSVELDVKL-IEGLVVKAGTTVRFPAIIRGVP 11166

Query: 927   SSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDA 976
                 +W+ D       +   +E     S + +K     D G Y + V++A
Sbjct: 11167 VPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNA 11216



 Score =  167 bits (422), Expect = 9e-41
 Identities = 182/748 (24%), Positives = 309/748 (41%), Gaps = 108/748 (14%)

Query: 170   TVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT 229
             T+ L  T++  P P+V W K +  +  R     +  +T+++ +L ++       DS  Y 
Sbjct: 18752 TLRLFVTIKGRPEPEVKWEKAEGILTDR----AQIEVTSSFTMLVID--NVTRFDSGRYN 18805

Query: 230   VRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFS 289
             + ++N  G  ++F  V V          DS         PS      ++ V   +K+  +
Sbjct: 18806 LTLENNSGSKTAFVNVRV---------LDS---------PSAPVNLTIREV---KKDSVT 18844

Query: 290   LSCLFSEDVLDA---------ESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDE 340
             LS  +   ++D          E  +  R      ++   K  +  R  +L+  C+Y    
Sbjct: 18845 LS--WEPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKTTF--RIENLQEGCSY---- 18896

Query: 341   GLYMVRVPSPFG---PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPS 397
               + V   + +G   P E +  V V    +E P  PG    V  +DV R+   + W  P 
Sbjct: 18897 -YFRVLASNEYGIGLPAETTEPVKV----SEPPLPPG---RVTLVDVTRNTATIKWEKPE 18948

Query: 398   DTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSV 457
                G+ IT Y +E     S +W  C +    T    I GL  G+ Y FRV A++  G S 
Sbjct: 18949 SDGGSKITGYVVEMQTKGSEKWSTCTQVK--TLEATISGLTAGEEYVFRVAAVNEKGRSD 19006

Query: 458   PSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYV 517
             P +    V+  D +                       + +V +P    NV A E  +  V
Sbjct: 19007 PRQLGVPVIARDIE----------------------IKPSVELPFHTFNVKAREQLKIDV 19044

Query: 518   VLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRA 577
                      R +A + +  +   +   T   +SS   V S   ++ +  K+    + +  
Sbjct: 19045 PF-----KGRPQATVNWRKDGQTLKETTRVNVSSSKTVTS--LSIKEASKEDVGTYELCV 19097

Query: 578   MNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLG----- 632
              N  G    + P   I L  P     PP  ++    +  S++++W+P   PE  G     
Sbjct: 19098 SNSAG--SITVPITIIVLDRPG----PPGPIRIDEVSCDSITISWNP---PEYDGGCQIS 19148

Query: 633   YYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIR 692
              YI  +K  TS    + ++ +  T   +  L TG EY+F  R  +E   G+SS +     
Sbjct: 19149 NYIVEKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQF--RVCAENRYGKSSYSESSAV 19206

Query: 693   VKQALATPSAPYGFA-LLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQ 751
             V +   +P  P G   +++  K+ M++ W+ P   GG +++GY L+  +   + W   N+
Sbjct: 19207 VAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANK 19266

Query: 752   QPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRAS 811
               I     KVS L EG  YE+R  A N AG+G+ S        ++   P PG P     +
Sbjct: 19267 ILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDP-PGQP---EVT 19322

Query: 812   EVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKS 871
              +   S+ L+W  P Y G   +TGY V  +E    +W       I  T+  V++L   + 
Sbjct: 19323 NITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQR 19382

Query: 872   YVFQVQAMNSA-GLGQPSMPTDPVLLED 898
             Y F+V A N+A  + +PS  T P++++D
Sbjct: 19383 YEFRVFARNAADSVSEPSESTGPIIVKD 19410



 Score =  166 bits (421), Expect = 1e-40
 Identities = 157/618 (25%), Positives = 255/618 (41%), Gaps = 79/618 (12%)

Query: 304   IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVR 363
             ++W +   +L    R +I  T     L +    + D G Y + + +  G +     V V 
Sbjct: 18767 VKWEKAEGILTD--RAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVL 18824

Query: 364   DAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIA-C 422
             D+       P +P+N+   +V +D + L+W PP    G  IT Y +E+ +     +    
Sbjct: 18825 DS-------PSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATIT 18877

Query: 423   HEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFD 482
             +     T R  I+ L EG SY FRV A +  G  +P++ +E V + +             
Sbjct: 18878 NNCTKTTFR--IENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEP------------ 18923

Query: 483   LGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVI 541
                               P PP  V   ++      + WE+P     + +T Y +E    
Sbjct: 18924 ------------------PLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTK 18965

Query: 542   GSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRG---- 597
             GS  W   S+ + V++    +  L   + YVFRV A+N+ G SDP +   P+  R     
Sbjct: 18966 GSEKW---STCTQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIK 19022

Query: 598   PPATLP-PPAQVQAFRDTQTSVSLTWDPV------KDPELLGYYIYSRKVGTSEWQTVNN 650
             P   LP     V+A    +  V     P       KD + L     + +V  S  +TV +
Sbjct: 19023 PSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLK---ETTRVNVSSSKTVTS 19079

Query: 651   KPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLN 710
               I+       G      YE CV +        + + T PI +   L  P  P    +  
Sbjct: 19080 LSIKEASKEDVG-----TYELCVSN-------SAGSITVPITI-IVLDRPGPPGPIRIDE 19126

Query: 711   CGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFY 770
                + + I W PP+  GG +I  Y +++ ++    WH V+Q    T + K+  L  G  Y
Sbjct: 19127 VSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSI-KIVRLTTGSEY 19185

Query: 771   EFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGA 830
             +FR  A N  G    S  S++    E+    PGPP   +      +++++ W+ P+  G 
Sbjct: 19186 QFRVCAENRYGKSSYSESSAV--VAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGG 19243

Query: 831   GPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMP 890
               V GYH+ ++E  S  W       I+ T ++VS L  G  Y ++V A N AG+G+ S  
Sbjct: 19244 SRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKS 19303

Query: 891   TDPVLLE---DKPGAHEI 905
              +PV      D PG  E+
Sbjct: 19304 CEPVPARDPCDPPGQPEV 19321



 Score =  165 bits (417), Expect = 3e-40
 Identities = 191/836 (22%), Positives = 318/836 (38%), Gaps = 117/836 (13%)

Query: 177   VQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAH 236
             +   P P + W K D  +        +  I +     SL ++     DS  Y ++ KN  
Sbjct: 16195 IYGKPIPTIQWIKGDQELS----NTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVA 16250

Query: 237   GQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSE 296
             G+ S    V V    G   G            P V      +      K P         
Sbjct: 16251 GERSVTVNVKVLDRPGPPEG------------PVVISGVTAEKCTLAWKPPLQDG---GS 16295

Query: 297   DVLDAESIQWFRDGSLLRSSRRRKILYTDRQA-----SLKVSCTYKEDEGLYMVRVPSPF 351
             D+++           ++      ++++T   A     S KV+   + +E  + +   + +
Sbjct: 16296 DIINY----------IVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEYTFRIMAVNKY 16345

Query: 352   G---PREQSTYVLVRDAEAENPGA-PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAY 407
             G   P E    V      A+NP   P +P       V +D +I+ W  P+   G+ I  Y
Sbjct: 16346 GVGEPLESEPVV------AKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGY 16399

Query: 408   TIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVM 467
              +E+   E   W  CH+   G  R  + GL+E   Y FRV A +  G S PS  S     
Sbjct: 16400 VLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPS----- 16454

Query: 468   GDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPR 527
                  A +K                   D +  P PP N    +I  + V L+W +P   
Sbjct: 16455 -----AYQKAC-----------------DPIYKPGPPNNPKVIDITRSSVFLSWSKPIYD 16492

Query: 528   DRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDP 586
                 +  Y +EK  +  G W   +  + +      V  L +K  Y FR+ A+N+ G+ + 
Sbjct: 16493 GGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEH 16552

Query: 587   SEPSEPIA----LRGPPATLPPPAQVQAFRDTQTSVSLT-WDPVKD---PELLGYYIYSR 638
             ++   PI     L  P   L    +++   + +   SL  + P+K    PE+        
Sbjct: 16553 ADVPGPIIVEEKLEAPDIDLD--LELRKIINIRAGGSLRLFVPIKGRPTPEV-------- 16602

Query: 639   KVGTSEWQTVNNKPIQGTR-FTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQAL 697
             K G  + +  +   I  T  FT   L     Y+    +++      + +A   +RV   L
Sbjct: 16603 KWGKVDGEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRV---L 16659

Query: 698   ATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTR 757
              TPS P    +    K+ + I W+PP   GG KI  Y +++ ++    + AV        
Sbjct: 16660 DTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTN-CHKN 16718

Query: 758   VCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATS 817
               K+  L EG  Y FR  A N  G+G  +  +   +  E     P PP  +   +V   S
Sbjct: 16719 SWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAE----VPQPPGKITVDDVTRNS 16774

Query: 818   LVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQ 877
             + L W  P + G   +  Y V  Q + SE+W       +      +++L  G+ Y+F+V 
Sbjct: 16775 VSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSEC--ARVKSLQAVITNLTQGEEYLFRVV 16832

Query: 878   AMNSAGLGQPSMPTDPVLLED-------KP--GAHEIEVGVDEEGFIYLAFEAP-EAPDS 927
             A+N  G   P     P++ +D       KP   ++ ++VG D      L  E P      
Sbjct: 16833 AVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQD------LKIEVPISGRPK 16886

Query: 928   SEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISAS 983
                 W+KD        R+ + D ++ + + +KE   +D G Y + V +     +AS
Sbjct: 16887 PTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTAS 16942



 Score =  163 bits (413), Expect = 1e-39
 Identities = 152/616 (24%), Positives = 238/616 (38%), Gaps = 78/616 (12%)

Query: 304   IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVR 363
             + WF+DG  +      +I       SL V    ++  G+Y V   +  G  +    V V+
Sbjct: 21618 VTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQ 21677

Query: 364   DAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACH 423
             D     PG    P  +R  ++  + + L W  P +    PIT Y IE+ +     W    
Sbjct: 21678 DT----PGKVVGP--IRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIE 21731

Query: 424   EAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDL 483
             +         I+ L+ G  Y+FRV A+++ G   P  +  +V    +             
Sbjct: 21732 DKCEAQSYTAIK-LINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQY------------- 21777

Query: 484   GNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIG 542
                            T+P  P     S I    + L W  P     + +  Y LE+    
Sbjct: 21778 ---------------TVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKK 21822

Query: 543   SGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATL 602
             S  W  + S+ P+   RF V  L +   Y F V A N  G+   S  S  I  R P    
Sbjct: 21823 STRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPP 21882

Query: 603   PPPAQVQAFRDTQTSVSLTWD-PVKDP--ELLGYYIYSRKVGTSEWQTVNNKPIQGTRFT 659
              PP  V+    ++T+VSL W  PV D   E++GY I   K    +W  VN +    TR+T
Sbjct: 21883 GPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYT 21942

Query: 660   VPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIG 719
             V  L+ G+EY+F V +++ AG G+S   T  I+    L  P         N  +  +V  
Sbjct: 21943 VTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDID---ANFKQTHVV-- 21997

Query: 720   WKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKV--------SDLHEGHFYE 771
                   R G  I  +             A   +P PT V           +D+H    + 
Sbjct: 21998 ------RAGASIRLFI------------AYQGRPTPTAVWSKPDSNLSLRADIHTTDSFS 22039

Query: 772   F-------RARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEP 824
                     R  A  +    E ++ S         +  PGPP  +   +V   S  L W+ 
Sbjct: 22040 TLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDA 22099

Query: 825   PLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGL 884
             PL  G   +  Y V  +E     W+ ++    +    +V+DL  G  Y F+V A+N  G+
Sbjct: 22100 PLLDGGARIHHYVVEKREASRRSWQVISE-KCTRQIFKVNDLAEGVPYYFRVSAVNEYGV 22158

Query: 885   GQPSMPTDPVLLEDKP 900
             G+P    +P++  ++P
Sbjct: 22159 GEPYEMPEPIVATEQP 22174



 Score =  162 bits (409), Expect = 3e-39
 Identities = 184/743 (24%), Positives = 294/743 (39%), Gaps = 109/743 (14%)

Query: 177   VQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLE-IRRCAIEDSATYTVRVKNA 235
             ++  P P+V W K    +D  +  A    +T+++  L L+ + R    DS  YT+ ++N+
Sbjct: 16594 IKGRPTPEVKWGK----VDGEIRDAAIIDVTSSFTSLVLDNVNRY---DSGKYTLTLENS 16646

Query: 236   HGQASSFAKVLVRTYLGKDAGFD-SEIFKRSTF----GPSVEFTSVLKPVFAREKEPFSL 290
              G  S+F  V V            +EI K S       P ++  S +K     ++E    
Sbjct: 16647 SGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRK 16706

Query: 291   SCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSP 350
             S  ++  V +     W  D                    L+  C+Y      + V   + 
Sbjct: 16707 S--YAAVVTNCHKNSWKID-------------------QLQEGCSY-----YFRVTAENE 16740

Query: 351   FG---PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAY 407
             +G   P + +  + V    AE P  PG    +   DV R+ + L+W  P    G+ I  Y
Sbjct: 16741 YGIGLPAQTADPIKV----AEVPQPPGK---ITVDDVTRNSVSLSWTKPEHDGGSKIIQY 16793

Query: 408   TIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSS------VPSKA 461
              +E     S +W  C      + +  I  L +G+ Y FRV A++  G S      VP  A
Sbjct: 16794 IVEMQAKHSEKWSECARVK--SLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVA 16851

Query: 462   SELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAW 521
              +LV+  D   A     +      KI +           P P               + W
Sbjct: 16852 KDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGR------PKP--------------TITW 16891

Query: 522   EEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQY 581
                  +D  PL  +   +V  S     +S           + +  K     + +   N  
Sbjct: 16892 T----KDGLPLKQTTRINVTDSLDLTTLS-----------IKETHKDDGGQYGITVANVV 16936

Query: 582   GLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDP---VKDPELLGYYIYSR 638
             G    S   E + L  P    PP   V+    +  S++L+W+P       ++  Y +  R
Sbjct: 16937 GQKTAS--IEIVTLDKPD---PPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKR 16991

Query: 639   KVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAA-TEPIRVKQAL 697
                T+ W  V+   +  T   V  L+TG EY+F  R  +E   G+S A  ++PI  +   
Sbjct: 16992 DTTTTVWDVVS-ATVARTTLKVTKLKTGTEYQF--RIFAENRYGQSFALESDPIVAQYPY 17048

Query: 698   ATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTR 757
               P  P         K+ MVI W  P   GG  ++GY L++ +   + W  VN+  I   
Sbjct: 17049 KEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDT 17108

Query: 758   VCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATS 817
               K  +L EG  YEFR  A N  GVG+ S  S  +  ++   P PG P  +    V+   
Sbjct: 17109 QFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDP-PGTPEPIM---VKRNE 17164

Query: 818   LVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQ 877
             + LQW  P+Y G   +TGY V  ++    +W   +   +  T   VS L   + Y F+V 
Sbjct: 17165 ITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVI 17224

Query: 878   AMNSAG-LGQPSMPTDPVLLEDK 899
             A N+AG + +PS  T P+  +D+
Sbjct: 17225 AKNAAGAISKPSDSTGPITAKDE 17247



 Score =  162 bits (409), Expect = 3e-39
 Identities = 170/699 (24%), Positives = 266/699 (38%), Gaps = 134/699 (19%)

Query: 173   LTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRV 232
             L  +V   PPP +TW K    +  R         T +Y LL ++  +    D+  YT+  
Sbjct: 23094 LMVSVSGRPPPVITWSKQGIDLASRAI----IDTTESYSLLIVD--KVNRYDAGKYTIEA 23147

Query: 233   KNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSC 292
             +N  G+ S  A VLV+ Y               T GP          V  +E    S++ 
Sbjct: 23148 ENQSGKKS--ATVLVKVY--------------DTPGPCPS-------VKVKEVSRDSVTI 23184

Query: 293   LFSEDVLDAESIQWFRDGSLLRS---SRRRKILYTDRQASLKVSCTYKEDEGL-----YM 344
              +    +D         G+ + +    +R   +   +  + K S T     GL     Y 
Sbjct: 23185 TWEIPTIDG--------GAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYY 23236

Query: 345   VRV--PSPFG---PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDT 399
              RV   + +G   P E S  VLV +        P  P  +  +DV +  + L W  P   
Sbjct: 23237 FRVLPENIYGIGEPCETSDAVLVSEV-------PLVPAKLEVVDVTKSTVTLAWEKPLYD 23289

Query: 400   RGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPS 459
              G+ +T Y +E C+  +  W+             +  L EG+ Y FR+RA +  G S P 
Sbjct: 23290 GGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPR 23349

Query: 460   KASELVVMGD-----------------HDAARRKTEIPFDLGN----------------- 485
             +    V + D                 H  A R  E+   +                   
Sbjct: 23350 ETVTAVTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRE 23409

Query: 486   -------------KITISTDAFEDT--------------------VTIPSP--PTN-VHA 509
                          K+TI      DT                    + +  P  PT  +  
Sbjct: 23410 SERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKI 23469

Query: 510   SEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKK 568
              EI    + ++WE P     APL+ Y +E+       W  + SES  RS  F    L + 
Sbjct: 23470 DEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPV-SESVTRS-TFKFTRLTEG 23527

Query: 569   KSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKD- 627
               YVFRV A N++G+    + SE I  R       PP  +Q F  ++  ++LTW P +D 
Sbjct: 23528 NEYVFRVAATNRFGIGSYLQ-SEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDD 23586

Query: 628   --PELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESS 685
                ++ GY +  ++V    W  VN  P+  TR+   GL  G EYE  V +++  G G+ S
Sbjct: 23587 GGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPS 23646

Query: 686   AATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELD 745
               ++PI     +A P  P    + +  +  + + W  P+  GG K+ GY ++    ++ +
Sbjct: 23647 RPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHE 23706

Query: 746   WHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGE 784
             W   N  P   R   ++ L +G  Y FR  A N  G GE
Sbjct: 23707 WTKCNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGE 23745



 Score =  161 bits (407), Expect = 5e-39
 Identities = 189/778 (24%), Positives = 304/778 (39%), Gaps = 109/778 (14%)

Query: 181   PPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQAS 240
             P P VTW+K++  +  +  R       NN     L I+    ED   Y V++ N+ G+A 
Sbjct: 15803 PTPAVTWHKDNVPLK-QTTRVNAESTENNS---LLTIKDACREDVGHYVVKLTNSAGEAI 15858

Query: 241   SFAKVLVRTYLGKDAG------FDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLF 294
                 V+V    G   G        ++    S   P  +  S +      ++         
Sbjct: 15859 ETLNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKR--------- 15909

Query: 295   SEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPR 354
                  D  +  W     ++ ++  R    T +   LK  C Y+     + +   + +G  
Sbjct: 15910 -----DTSTTTW----QIVSATVART---TIKACRLKTGCEYQ-----FRIAAENRYG-- 15950

Query: 355   EQSTYVLVRDAEAENP----GAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIE 410
              +STY+      A+ P    G PG+P+       +RD + + W  P    G+ +  Y +E
Sbjct: 15951 -KSTYLNSEPTVAQYPFKVPGPPGTPVVTLS---SRDSMEVQWNEPISDGGSRVIGYHLE 16006

Query: 411   RCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDH 470
             R +  S  W+  ++ P    +    GL EG  Y FRV A + VG   PSK SE  V  D 
Sbjct: 16007 RKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARD- 16065

Query: 471   DAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRA 530
                      P D                    PP    A  +    V L W++P+    +
Sbjct: 16066 ---------PCD--------------------PPGRPEAIIVTRNSVTLQWKKPTYDGGS 16096

Query: 531   PLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGL-SDPSE 588
              +T Y +EK  +  G W   +S + +    F V  L +   Y FRV A N  G+ S+PSE
Sbjct: 16097 KITGYIVEKKELPEGRWMK-ASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSE 16155

Query: 589   PSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEW--- 645
              +  I  R     + PP      +   T V    +  K    +   IY + + T +W   
Sbjct: 16156 STGAITARD---EVDPPRISMDPKYKDTIVVHAGESFK----VDADIYGKPIPTIQWIKG 16208

Query: 646   -QTVNNK---PIQGTRF-TVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATP 700
              Q ++N     I+ T F T   ++     +     +    V    + T  ++V      P
Sbjct: 16209 DQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPP 16268

Query: 701   SAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCK 760
               P   + +   K    + WKPP + GG  I+ Y +++ ++  L W  V+   + T  CK
Sbjct: 16269 EGPVVISGVTAEK--CTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDAN-VQTLSCK 16325

Query: 761   VSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVL 820
             V+ L EG+ Y FR  A N  GVGE      +     + +P    P     + V   S+++
Sbjct: 16326 VTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPD--APKAPEVTTVTKDSMIV 16383

Query: 821   QWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMN 880
              WE P   G   + GY +  +++   +W       I    LRV+ L     Y F+V A N
Sbjct: 16384 VWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAEN 16443

Query: 881   SAGLGQPSMPT------DPVLLEDKPGAHEIEVGVD-EEGFIYLAFEAPEAPDSSEFQ 931
             +AGL +PS P+      DP+    KPG       +D     ++L++  P      E Q
Sbjct: 16444 AAGLSEPSPPSAYQKACDPIY---KPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQ 16498



 Score =  158 bits (399), Expect = 4e-38
 Identities = 183/779 (23%), Positives = 309/779 (39%), Gaps = 91/779 (11%)

Query: 327  QASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNR 386
            ++ L+V  + + D GLYM++V +  G  +    V V D        PG P+N    D+ +
Sbjct: 8391 ESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDT-------PGPPINFVFEDIRK 8443

Query: 387  DCLILTWAPPSDTRGNPITAYTIERCQGES--GEWIACHEAPGGTCRCPIQGLVEGQSYR 444
              ++  W PP D  G+ I  YT+E+        EWI         C+  +  L+EG+ Y 
Sbjct: 8444 TSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRH-CKYSVTKLIEGKEYL 8502

Query: 445  FRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPP 504
            FRVRA +R G   P  +  LV                             +D    P  P
Sbjct: 8503 FRVRAENRFGPGPPCVSKPLVA----------------------------KDPFGPPDAP 8534

Query: 505  TNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLD 564
                  ++    +++ W EP       L Y LEK  + S  W  ++ +S + + +  V  
Sbjct: 8535 DKPIVEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVN-KSLLNALKANVDG 8593

Query: 565  LEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQ-TSVSLTWD 623
            L +  +YVFRV A N  G    S PS+P     P +  PP   +    DT  T++ L W+
Sbjct: 8594 LLEGLTYVFRVCAENAAGPGKFSPPSDPKTAHDPIS--PPGPPIPRVTDTSSTTIELEWE 8651

Query: 624  PVK---DPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAG 680
            P       E++GY++  + VGT+EW     K I+  ++TV  +R G +Y+  V +V+ AG
Sbjct: 8652 PPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAG 8711

Query: 681  VGESSAATEPIRVKQALATPSAPYGFAL-----LNCGKN---EMVIGWKPPKRRGGGKIL 732
             G     T+P+ V +    P+     ++     +  GK      V+  +P   +   K  
Sbjct: 8712 EGPPGE-TQPVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEE 8770

Query: 733  GYFLDQHDSEELDWHAVNQQPIPTRV-CKVSDLHEGHFYEFRARAANWAGVGELSAPSSL 791
            G         ELD   V    + T+    + D        +   A N  G    +A   +
Sbjct: 8771 G---------ELDKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEV 8821

Query: 792  FECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPV 851
            F+        PGP  D++         +L W  P   G   +TG+ +  ++     W+  
Sbjct: 8822 FDV-------PGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQ- 8873

Query: 852  TPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGA----HEIEV 907
             P     +   ++ L  G+ Y F+V A N  G G P +   P+L  D  G       +  
Sbjct: 8874 -PIETERSKCDITGLLEGQEYKFRVIAKNKFGCGPP-VEIGPILAVDPLGPPTSPERLTY 8931

Query: 908  GVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLD-PQRVKIEDKVNKSKVILKEPGLEDL 966
                +  I L ++ P +   S  Q     K   D P   ++  ++  +   L E  L++ 
Sbjct: 8932 TERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVE-NLDEH 8990

Query: 967  GTYSVIVTDADE------DISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERG 1020
              Y   V   +E       +  +  + ++E+    KL   +R   IK+ +G  + I    
Sbjct: 8991 QMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHI--PA 9048

Query: 1021 EVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYT 1079
            +V   L + K+  +    +I    +       +++  R +   E+ I     EDKG+YT
Sbjct: 9049 DVT-GLPMPKIEWSKNETVIEKPTDALQITKEEVS--RSEAKTELSIPKAVREDKGTYT 9104



 Score =  157 bits (398), Expect = 5e-38
 Identities = 167/617 (27%), Positives = 247/617 (40%), Gaps = 70/617 (11%)

Query: 300   DAESIQW---FRDGSL------LRSSRRRKILYTDRQASLKVSCTYKED---EGL-YMVR 346
             +A SI+W   + DG        +    R  IL+        + C YK     EGL Y  R
Sbjct: 22483 NAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFR 22542

Query: 347   VPSPFGPREQSTYVLVRDAEAENP-GAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPIT 405
               +             R   A+NP  APG P      DV R  + L W+ P+   G+ + 
Sbjct: 22543 TYALNAAGVSKASEASRPIMAQNPVDAPGRP---EVTDVTRSTVSLIWSAPAYDGGSKVV 22599

Query: 406   AYTIER---CQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKAS 462
              Y IER    +   G W+ C+          +  L EG +Y FRV A +  G  V SK S
Sbjct: 22600 GYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAG--VISKGS 22657

Query: 463   ELV--VMGDHDAARRKTEIPFDL-GNKITI--STDAFEDTVTIPSPPTNVHASEIREAYV 517
             E    V    + A  K E+   L G+ +TI   +D   D      P   +          
Sbjct: 22658 ESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKI---------- 22707

Query: 518   VLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRA 577
                W +                       E +S +   +     +   ++  S  + +  
Sbjct: 22708 --IWTKGDKE---------------LDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTV 22750

Query: 578   MNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWD-PVKD--PELLGYY 634
              N  G    S   + +   GP   L         R TQ   +L W  P +D   E+  Y 
Sbjct: 22751 KNASGTKAVSVMVKVLDSPGPCGKLT------VSRVTQEKCTLAWSLPQEDGGAEITHYI 22804

Query: 635   IYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVK 694
             +  R+     W  V  +      + V  L    EY F VR+V++ G G     +EPI  +
Sbjct: 22805 VERRETSRLNWVIVEGE-CPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVP-VESEPIVAR 22862

Query: 695   QALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPI 754
              +   PS P     +  GK  ++I W  P+  GG +I  Y +D+ + + L W  VN+  +
Sbjct: 22863 NSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYV 22922

Query: 755   --PTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASE 812
                TR+ KV+ L EG  Y+FR  A N AG  E S  S+   C+E +   PGPP   R  +
Sbjct: 22923 VYDTRL-KVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYT-PGPPSAPRVVD 22980

Query: 813   VRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPV-TPGPISGTHLRVSDLQPGKS 871
                 S+ L W  P+Y G   + GY +  QE+ ++QW  V T   I  T   V DL+ G+ 
Sbjct: 22981 TTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQK 23040

Query: 872   YVFQVQAMNSAGLGQPS 888
             Y F+V A+N  G+ + S
Sbjct: 23041 YSFRVAAVNVKGMSEYS 23057



 Score =  156 bits (395), Expect = 1e-37
 Identities = 147/576 (25%), Positives = 232/576 (40%), Gaps = 75/576 (13%)

Query: 337   KEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPP 396
             + D G Y++++ +  G +     V V D        PG P N+   +V +D   L W PP
Sbjct: 17715 RNDAGKYILKLENSSGSKSAFVTVKVLDT-------PGPPQNLAVKEVRKDSAFLVWEPP 17767

Query: 397   SDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSS 456
                 G  +  Y I++ +     +         T    ++ L EG  Y FRV A +  G  
Sbjct: 17768 IIDGGAKVKNYVIDKRESTRKAYANVSSKCSKT-SFKVENLTEGAIYYFRVMAENEFGVG 17826

Query: 457   VPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAY 516
             VP +  + V   +                               PSPP  V  +++ +  
Sbjct: 17827 VPVETVDAVKAAEP------------------------------PSPPGKVTLTDVSQTS 17856

Query: 517   VVLAWEEPS-PRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRV 575
               L WE+P        L Y +E    G+  W +I +ES V +    V  L   + Y FRV
Sbjct: 17857 ASLMWEKPEHDGGSRVLGYVVEMQPKGTEKW-SIVAESKVCNA--VVTGLSSGQEYQFRV 17913

Query: 576   RAMNQYGLSDPSEPSEPIALRG----PPATLP-PPAQVQAFRDTQTSVSLTWDP------ 624
             +A N+ G SDP     P+  +     P   LP     +QA  D +  + +   P      
Sbjct: 17914 KAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISW 17973

Query: 625   VKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGES 684
             VKD E L              QT      +    TV  ++ G + +F   +V+      +
Sbjct: 17974 VKDGEPLK-------------QTTRVNVEETATSTVLHIKEGNKDDFGKYTVT--ATNSA 18018

Query: 685   SAATEPIRVKQALATPSAPYGFALLN-CGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEE 743
               ATE + V   L  P  P G    +    + +VI W+PP   GG +I  Y +++ D+  
Sbjct: 18019 GTATENLSV-IVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTT 18077

Query: 744   LDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAP-SSLFECKEWTMPQP 802
               WH V+     T + K++ L  G  Y+FR  A N  G    SAP  S     ++   +P
Sbjct: 18078 TTWHMVSATVARTTI-KITKLKTGTEYQFRIFAENRYG---KSAPLDSKAVIVQYPFKEP 18133

Query: 803   GPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLR 862
             GPP     + +    +++QW  P+  G   + GYH+  +E+ S  W  +   PI  T  +
Sbjct: 18134 GPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFK 18193

Query: 863   VSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED 898
              + L  G  Y F+V A N  G+G+PS  ++  +  D
Sbjct: 18194 TTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARD 18229



 Score =  155 bits (393), Expect = 2e-37
 Identities = 190/829 (22%), Positives = 307/829 (37%), Gaps = 96/829 (11%)

Query: 169   TTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRI-TNNYGLLSLEIRRCAIEDSAT 227
             TTV     ++  P P   W  + + I         Y + T+N+  + L I+ C   D+  
Sbjct: 11154 TTVRFPAIIRGVPVPTAKWTTDGSEIKTD----EHYTVETDNFSSV-LTIKNCLRRDTGE 11208

Query: 228   YTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEP 287
             Y + V NA G  +    + V    G   G                      P+   +  P
Sbjct: 11209 YQITVSNAAGSKTVAVHLTVLDVPGPPTG----------------------PINILDVTP 11246

Query: 288   FSLSCLFSEDVLDAES--IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMV 345
               ++  +     D  S  I +  +    R      +     +  LK+    K  E ++ V
Sbjct: 11247 EHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRV 11306

Query: 346   RVPSPFG--PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNP 403
             R  +  G  P   ST  + +  +   P  PG P+     D+  +   ++W  P    G+P
Sbjct: 11307 RAENKIGVGPPLDSTPTVAKH-KFSPPSPPGKPV---VTDITENAATVSWTLPKSDGGSP 11362

Query: 404   ITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASE 463
             IT Y +ER +  +G+W+  ++ P    +  + GL EG +Y FRV A +  G S PS +S+
Sbjct: 11363 ITGYYMERRE-VTGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSD 11421

Query: 464   LVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEE 523
              +      A R                       +  P PP N    +       L W +
Sbjct: 11422 PI-----KACR----------------------PIKPPGPPINPKLKDKSRETADLVWTK 11454

Query: 524   PSPRDRAP-LTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYG 582
             P     +P L Y +E    G+  W  I+ +  +R   F V  L +   Y FR++A N  G
Sbjct: 11455 PLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVG 11514

Query: 583   LSDPSEPSEPIALRGPPATLPPPAQVQAF-RDTQT-----SVSLTWDPVKDPELLGYYIY 636
               +P E +E +  +      PP  ++    RD  T     ++ +       PE    +  
Sbjct: 11515 EGEPRELAESVIAKD--ILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTK 11572

Query: 637   SRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQA 696
               KV   E +    + +      +         ++ + + + +G  + SA      +   
Sbjct: 11573 EGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSA------IVNV 11626

Query: 697   LATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPT 756
             L  P       + N  K    I W+ P   GG +I  + ++     +  W  V    +  
Sbjct: 11627 LDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASD-VTK 11685

Query: 757   RVCKVSDLHEGHFYEFRARAANWAGVG---ELSAPSSLFECKEWTMPQPGPPYDVRASEV 813
             R+ K + L    +Y FR  A N  GVG   E   P          + +PG P ++  ++ 
Sbjct: 11686 RLIKANLLANNEYY-FRVCAENKVGVGPTIETKTPILAIN----PIDRPGEPENLHIADK 11740

Query: 814   RATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYV 873
               T + L+W  P Y G  P   YHV  + +GS+ W+ V  G I  TH  V      + Y 
Sbjct: 11741 GKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYE 11800

Query: 874   FQVQAMNSAGLGQPSMPTDPVLLED--KPGAHEIEVGV--DEEGFIYLAFEAPEAPDSSE 929
             F+VQ  N  G        + V+ ED  KP       GV   + G               E
Sbjct: 11801 FRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPE 11860

Query: 930   FQWSKDYKGPLD---PQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTD 975
               W+KD K   D     RVKI+ + + SK  L +    D G Y V  T+
Sbjct: 11861 VAWTKD-KDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATN 11908



 Score =  155 bits (393), Expect = 2e-37
 Identities = 194/833 (23%), Positives = 328/833 (39%), Gaps = 89/833 (10%)

Query: 161   RSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRC 220
             ++H V    ++ L    Q  P P   W K D+ +  R         T+++  L++E   C
Sbjct: 21993 QTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLR----ADIHTTDSFSTLTVE--NC 22046

Query: 221   AIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPV 280
                D+  YT+ V+N  G  S    V V                  T GP         P+
Sbjct: 22047 NRNDAGKYTLTVENNSGSKSITFTVKV----------------LDTPGPP-------GPI 22083

Query: 281   FAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDR--QASLKVSCTYKE 338
               ++    S + ++   +LD  +           +SRR   + +++  +   KV+   + 
Sbjct: 22084 TFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISEKCTRQIFKVNDLAEG 22143

Query: 339   DEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSD 398
                 + V   + +G  E   Y +     A    AP   L+V  +D ++   +L W  P  
Sbjct: 22144 VPYYFRVSAVNEYGVGE--PYEMPEPIVATEQPAPPRRLDV--VDTSKSSAVLAWLKPDH 22199

Query: 399   TRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVP 458
               G+ IT Y +E  Q  S  W+        T    ++ LVE   Y FRV+A +  G S P
Sbjct: 22200 DGGSRITGYLLEMRQKGSDFWVEAGHTKQLT--FTVERLVEKTEYEFRVKAKNDAGYSEP 22257

Query: 459   SKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVV 518
              +A   V++ +       T     + N++         T+ +P                 
Sbjct: 22258 REAFSSVIIKEPQI--EPTADLTGITNQLITCKAGSPFTIDVPI---------------- 22299

Query: 519   LAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAM 578
                   S R    +T+ LE+  +     + +S  +        V D  +  S  + +   
Sbjct: 22300 ------SGRPAPKVTWKLEEMRLKE--TDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLE 22351

Query: 579   NQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKD---PELLGYYI 635
             N  G+      S  + + G P  +  P +V +   +  S  L+W   KD    E+  Y +
Sbjct: 22352 NTAGV---KTFSVTVVVIGRPGPVTGPIEVSSV--SAESCVLSWGEPKDGGGTEITNYIV 22406

Query: 636   YSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQ 695
               R+ GT+ WQ VN+  ++ T+  V  L    EY F V S +  GV +    + PI  + 
Sbjct: 22407 EKRESGTTAWQLVNSS-VKRTQIKVTHLTKYMEYSFRVSSENRFGVSK-PLESAPIIAEH 22464

Query: 696   ALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIP 755
                 PSAP    + +   N M I W+ P   GG KI+GY++++ +   + W   N+ P  
Sbjct: 22465 PFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCL 22524

Query: 756   TRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRA 815
                 KV+ L EG  Y+FR  A N AGV + S  S     +   +  PG P     ++V  
Sbjct: 22525 ECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQN-PVDAPGRP---EVTDVTR 22580

Query: 816   TSLVLQWEPPLYMGAGPVTGYHVS---FQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSY 872
             +++ L W  P Y G   V GY +      E G  +W       +S     V+ L  G +Y
Sbjct: 22581 STVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTY 22640

Query: 873   VFQVQAMNSAG-LGQPSMPTDPVLLEDK--PGAHEIEVGVDEE------GFIYLAFEAPE 923
              F+V A N+AG + + S  T PV   D+  P   E++  +  +      G   +   A  
Sbjct: 22641 EFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVG 22700

Query: 924   APDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDA 976
                  +  W+K  K     ++V ++    ++  ++K     D G Y++ V +A
Sbjct: 22701 GKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNA 22753



 Score =  153 bits (387), Expect = 1e-36
 Identities = 148/599 (24%), Positives = 246/599 (41%), Gaps = 80/599 (13%)

Query: 324   TDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLD 383
             T    SL +    + D G Y + + +  G +  S +V VR  +  +P     P+N++  +
Sbjct: 16620 TSSFTSLVLDNVNRYDSGKYTLTLENSSGTK--SAFVTVRVLDTPSP-----PVNLKVTE 16672

Query: 384   VNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIA----CHEAPGGTCRCPIQGLVE 439
             + +D + +TW PP    G+ I  Y +E+ +     + A    CH+         I  L E
Sbjct: 16673 ITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKN-----SWKIDQLQE 16727

Query: 440   GQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVT 499
             G SY FRV A +  G  +P++ ++ + + +                              
Sbjct: 16728 GCSYYFRVTAENEYGIGLPAQTADPIKVAE------------------------------ 16757

Query: 500   IPSPPTNVHASEIREAYVVLAWEEPSPRDRAP-LTYSLEKSVIGSGTWEAISSESPVRSP 558
             +P PP  +   ++    V L+W +P     +  + Y +E     S  W   S  + V+S 
Sbjct: 16758 VPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKW---SECARVKSL 16814

Query: 559   RFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRG---PPATLP--PPAQVQAFRD 613
             +  + +L + + Y+FRV A+N+ G SDP   + PI  +     P   P      VQ  +D
Sbjct: 16815 QAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQD 16874

Query: 614   TQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLR-----TGKE 668
              +  V ++  P          I   K G    QT           T   ++      G +
Sbjct: 16875 LKIEVPISGRPKPT-------ITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQ 16927

Query: 669   YEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGG 728
             Y   V +V    VG+ +A+ E + + +    P  P  F   +     + + W PP   GG
Sbjct: 16928 YGITVANV----VGQKTASIEIVTLDKP-DPPKGPVKFD--DVSAESITLSWNPPLYTGG 16980

Query: 729   GKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAP 788
              +I  Y + + D+    W  V+     T + KV+ L  G  Y+FR  A N    G+  A 
Sbjct: 16981 CQITNYIVQKRDTTTTVWDVVSATVARTTL-KVTKLKTGTEYQFRIFAEN--RYGQSFAL 17037

Query: 789   SSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQW 848
              S     ++   +PGPP    A+ +   S+V+QW  P+  G  PV GYH+  +E  S  W
Sbjct: 17038 ESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILW 17097

Query: 849   KPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLE---DKPGAHE 904
               V    I  T  +  +L+ G  Y F+V A N  G+G+ S  ++  +     D PG  E
Sbjct: 17098 TKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPE 17156



 Score =  152 bits (385), Expect = 2e-36
 Identities = 157/622 (25%), Positives = 251/622 (40%), Gaps = 76/622 (12%)

Query: 290  LSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPS 349
            L+ +   D       +WF++   L +   + I  T  Q S ++    K D+G Y + + +
Sbjct: 6645 LTMVVPYDAYPKAEAEWFKENEPLST---KTIDTTAEQTSFRILEAKKGDKGRYKIVLQN 6701

Query: 350  PFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTI 409
              G  E    + V D        PG   N+   +     + L W  P    G+ I  Y +
Sbjct: 6702 KHGKAEGFINLKVIDV-------PGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVV 6754

Query: 410  ERCQGESGEWIACHEAPGGTCRCPIQGLVEGQ-SYRFRVRAISRVGSSVPSKASELVVMG 468
            ER   +   W+   +    +C   + GL +G   Y FRV A +RVG+  P +    V   
Sbjct: 6755 ERRDIKRKTWVLATDR-AESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPV--- 6810

Query: 469  DHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRD 528
                AR K ++P                      PP NV  +++    V L WE P    
Sbjct: 6811 ---EARSKYDVP---------------------GPPLNVTITDVNRFGVSLTWEPPEYDG 6846

Query: 529  RAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFA--VLDLEKKKSYVFRVRAMNQYGLSD 585
             A +T Y +E     S  W+   +   VR+   +  V D+ + + Y FRVRA N+ G+  
Sbjct: 6847 GAEITNYVIELRDKTSIRWDTAMT---VRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGK 6903

Query: 586  PSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDP-VKD--PELLGYYIYSRKVGT 642
            PS  +  + +  P     PP  + +   TQ+SV L W+P +KD    +LGY I   + G 
Sbjct: 6904 PSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGK 6963

Query: 643  SEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPS- 701
              W   N K +    + V GL  G +Y + V + ++AGV + S    P+    A   P+ 
Sbjct: 6964 DNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTM 7023

Query: 702  --APYGFALLNCGKNEMVI-----GWKPPKRRG--GGKILGYFLDQHDSEELDWHAVNQQ 752
              + +   L     N + I     G+  P      G K+L    D+   + L  +A    
Sbjct: 7024 DLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETG-DRVKMKTLSAYA---- 7078

Query: 753  PIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASE 812
                 V   S+  +   Y  +         GE+             + +P  P +++  +
Sbjct: 7079 ---ELVISPSERSDKGIYTLKLENRVKTISGEIDVN---------VIARPSAPKELKFGD 7126

Query: 813  VRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSY 872
            +   S+ L WEPP   G  P+TGY V  +E   + W  V    ++     V DL  GK Y
Sbjct: 7127 ITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDF-VTDLEFTVPDLVQGKEY 7185

Query: 873  VFQVQAMNSAGLGQPSMPTDPV 894
            +F+V A N  G G+P+   +PV
Sbjct: 7186 LFKVCARNKCGPGEPAYVDEPV 7207



 Score =  151 bits (381), Expect = 5e-36
 Identities = 151/610 (24%), Positives = 237/610 (38%), Gaps = 73/610 (11%)

Query: 301   AESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYV 360
             A  ++W RD     S  +  I  T     L V    + D G Y++ V +  G +     V
Sbjct: 15517 APEVKWARDHG--ESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNV 15574

Query: 361   LVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWI 420
              V D        PG P +++  +V +  + LTW PP    G+ I  Y +E+ +     + 
Sbjct: 15575 RVLDT-------PGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYS 15627

Query: 421   A----CHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRK 476
                  CH+         +  L EG SY FRV A +  G  +P++ +E V   +       
Sbjct: 15628 TVATNCHKT-----SWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASER------ 15676

Query: 477   TEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAP-LTYS 535
                                     P PP  +   ++    V L+WE+P     +  L Y 
Sbjct: 15677 ------------------------PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYI 15712

Query: 536   LEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIAL 595
             +E    GS  W   ++   V+     +  L + + Y FRV A N+ G+SDP + S P+  
Sbjct: 15713 VEMQTKGSDKWATCAT---VKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIA 15769

Query: 596   RGPPATLPPPAQVQAFRDTQTSVSLTWDPVK-DPELLGYYIYSRKVGTSEWQTVNNKPIQ 654
             +     + PPA    F    T   L  + +K D   +G     R      W   N    Q
Sbjct: 15770 KD---LVIPPAFKLLF---NTFTVLAGEDLKVDVPFIG-----RPTPAVTWHKDNVPLKQ 15818

Query: 655   GTRFTVPGLRTGKEY---EFCVRSVSEAGVGESSAATEPIRVKQ--ALATPSAPYGFALL 709
              TR               + C   V    V  +++A E I       L  P  P G   +
Sbjct: 15819 TTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKM 15878

Query: 710   N-CGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGH 768
             +    + + + W PPK  GG  I  Y +++ D+    W  V+     T + K   L  G 
Sbjct: 15879 DEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTI-KACRLKTGC 15937

Query: 769   FYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYM 828
              Y+FR  A N    G+ +  +S     ++    PGPP     +     S+ +QW  P+  
Sbjct: 15938 EYQFRIAAEN--RYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPISD 15995

Query: 829   GAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPS 888
             G   V GYH+  +E  S  W  +   PI  T  + + L+ G  Y F+V A N  G+G+PS
Sbjct: 15996 GGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPS 16055

Query: 889   MPTDPVLLED 898
               ++  +  D
Sbjct: 16056 KVSECYVARD 16065



 Score =  148 bits (374), Expect = 3e-35
 Identities = 138/607 (22%), Positives = 241/607 (39%), Gaps = 76/607 (12%)

Query: 317   RRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSP 376
             R+ ++   D  A L +  + ++D G Y + + +P G  E++ +V VR  +      PG  
Sbjct: 12278 RKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAG--EKAVFVNVRVLDT-----PGPV 12330

Query: 377   LNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQG 436
              +++  DV +    ++WAPP +  G+ +T Y +E+ + +   W         T    +  
Sbjct: 12331 SDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVKKTS-FHVTN 12389

Query: 437   LVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFED 496
             LV G  Y FRV A++  G  VP                  T++P     K  +++D   +
Sbjct: 12390 LVPGNEYYFRVTAVNEYGPGVP------------------TDVP-----KPVLASDPLSE 12426

Query: 497   TVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVR 556
                 P PP  +  +E+ +    LAW  P     A +   +          +  +  S V+
Sbjct: 12427 ----PDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYSVVK 12482

Query: 557   SPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIA----LRGPPATLPPPAQVQAFR 612
                  V  L++ K Y FRV A N  G+S P E          L  P   +P    ++A +
Sbjct: 12483 DLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQITIKAGK 12542

Query: 613   DTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFC 672
               +                  ++Y +   T +W+   ++ +  +   V   +        
Sbjct: 12543 KLRIEA---------------HVYGKPHPTCKWKKGEDEVVTSSHLAVH--KADSSSILI 12585

Query: 673   VRSVSEAGVG------ESSAATEPIRVK----QALATPSAPYGFALLNCGKNEMVIGWKP 722
             ++ V+    G      E+S+ T+  ++K     A   P  P+  + ++   +   + W  
Sbjct: 12586 IKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDA--DACSLSWHI 12643

Query: 723   PKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGV 782
             P   GG  I  Y +++ D    DW         T  C+V  L  G  Y FR RA N  G+
Sbjct: 12644 PLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTS-CRVGKLIPGQEYIFRVRAENRFGI 12702

Query: 783   GE-LSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQ 841
              E L++P  +    ++    P  P + R ++V    + + W+ P   G  P+ GY +  +
Sbjct: 12703 SEPLTSPKMV---AQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERK 12759

Query: 842   EEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLE---D 898
             E  S  W       +  T    + L  G  Y F++ A+N AG   PS PT+ V      D
Sbjct: 12760 ERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVD 12819

Query: 899   KPGAHEI 905
              PG  E+
Sbjct: 12820 PPGKPEV 12826



 Score =  147 bits (371), Expect = 7e-35
 Identities = 168/753 (22%), Positives = 287/753 (38%), Gaps = 116/753 (15%)

Query: 159  PLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRI--DPRL-FRAGKYRITNNYGLLSL 215
            PL+     E  +V   C V       + W KN   +  D R+ +R  KY+         L
Sbjct: 6367 PLKDIETMEKKSVTFWCKVNRLNVT-LKWTKNGEEVPFDNRVSYRVDKYKHM-------L 6418

Query: 216  EIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTS 275
             I+ C   D   Y V      GQ  S A++L+                        EF  
Sbjct: 6419 TIKDCGFPDEGEYIVTA----GQDKSVAELLI-------------------IEAPTEFVE 6455

Query: 276  VLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCT 335
             L+     E +    SC  S +     +++W+R+G  ++  ++ K         L +   
Sbjct: 6456 HLEDQTVTEFDDAVFSCQLSRE---KANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDC 6512

Query: 336  YKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDV------NRDCL 389
              +DE  Y   V      R+    + V +   E    P   L     DV      N+D +
Sbjct: 6513 RLDDECEYACGVED----RKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKV 6568

Query: 390  ILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRA 449
             + W      R N +        QG+  + ++                 EG+ +R ++  
Sbjct: 6569 EVQWL-----RNNMVVV------QGDKHQMMS-----------------EGKIHRLQICD 6600

Query: 450  ISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHA 509
            I       P    E   +     AR K E    L     I T   +  V +  P T V  
Sbjct: 6601 IK------PRDQGEYRFIAKDKEARAKLE----LAAAPKIKTADQDLVVDVGKPLTMVVP 6650

Query: 510  SEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKK 569
             +   AY            +A   +  E   + + T +  + ++      F +L+ +K  
Sbjct: 6651 YD---AY-----------PKAEAEWFKENEPLSTKTIDTTAEQTS-----FRILEAKKGD 6691

Query: 570  SYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWD-PVKD- 627
               +++   N++G ++     + I + GP   L      +        VSL W+ P+ D 
Sbjct: 6692 KGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNL------EVTETFDGEVSLAWEEPLTDG 6745

Query: 628  -PELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGK-EYEFCVRSVSEAGVGESS 685
              +++GY +  R +    W    ++  +   FTV GL+ G  EY F V + +  G GE  
Sbjct: 6746 GSKIIGYVVERRDIKRKTWVLATDRA-ESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPV 6804

Query: 686  AATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELD 745
                P+  +     P  P    + +  +  + + W+PP+  GG +I  Y ++  D   + 
Sbjct: 6805 ETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIR 6864

Query: 746  WHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPP 805
            W              V+D+ EG  Y FR RA N  GVG+ SA +   +  +  + +P PP
Sbjct: 6865 WDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVAD-PIERPSPP 6923

Query: 806  YDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSD 865
             ++ +S+   +S+ L+WEPPL  G  P+ GY +   EEG + W       +     +V+ 
Sbjct: 6924 VNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTG 6983

Query: 866  LQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED 898
            L+ G  Y+++V A N AG+  PS    P+  +D
Sbjct: 6984 LEKGNKYLYRVSAENKAGVSDPSEILGPLTADD 7016



 Score =  145 bits (365), Expect = 4e-34
 Identities = 186/848 (21%), Positives = 322/848 (37%), Gaps = 115/848 (13%)

Query: 165   VWEHTTVLLTCTVQASPPPQVTWYKNDTRI----DPRLF--RAGKYRITNNYGLLSLEIR 218
             V E T V +   ++  P P +TW+K   +     +P L+     K  + +   L+  + R
Sbjct: 9756  VEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSR 9815

Query: 219   RCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLK 278
             R    D+  YT+   N  G AS   ++ V    G   G              ++F SV  
Sbjct: 9816  R---SDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVG-------------PIKFESV-- 9857

Query: 279   PVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTY-- 336
                    +  +LS    +D   ++   +  +    R + R+  ++   +      CTY  
Sbjct: 9858  -----SADQMTLSWFPPKDDGGSKITNYVIEK---REANRKTWVHVSSEPK---ECTYTI 9906

Query: 337   ----KEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENP----GAPGSPLNVRCLDVNRDC 388
                 +  E ++ +   + +G  E        D+E E        PG+P       V R+ 
Sbjct: 9907  PKLLEGHEYVFRIMAQNKYGIGEPL------DSEPETARNLFSVPGAPDKPTVSSVTRNS 9960

Query: 389   LILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQ----GLVEGQSYR 444
             + + W  P    G+P+T Y +E     S  W   +  P       +     GL+EG  Y+
Sbjct: 9961  MTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQ 10020

Query: 445   FRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPP 504
             FRV AI+  G    S  S      D   AR                     D +  P PP
Sbjct: 10021 FRVYAINAAGVGPASLPS------DPATAR---------------------DPIAPPGPP 10053

Query: 505   TNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVL 563
                  ++  ++   L W  P     + +T Y +E    G   WE    +  VR  +  V 
Sbjct: 10054 FP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEK-GKDKEVRGTKLVVT 10111

Query: 564   DLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVS---- 619
              L++   Y FRVRA+N  G+ +P E ++ I ++     + P  Q+ A    +  V     
Sbjct: 10112 GLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKD--RLVSPDLQLDASVRDRIVVHAGGV 10169

Query: 620   ---LTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSV 676
                + +   K P  + + +  R +   +  T+    I  +   +   +   +  + + + 
Sbjct: 10170 IRIIAYVSGKPPPTVTWNMNERTL--PQEATIETTAISSS-MVIKNCQRSHQGVYSLLAK 10226

Query: 677   SEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFL 736
             +EAG  + +   + + V   + TP     F   N       + W  P+  GG  I  Y +
Sbjct: 10227 NEAGERKKTIIVDVLDVPGPVGTP-----FLAHNLTNESCKLTWFSPEDDGGSPITNYVI 10281

Query: 737   DQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKE 796
             ++ +S+   W  V    +  +   V  L +G  Y FR  A N  G+G     S     +E
Sbjct: 10282 EKRESDRRAWTPVTYT-VTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIRE 10340

Query: 797   WTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPI 856
               +  P  P D+   EV   ++ L W PP Y G   +  Y +  +  G+E++  VT   +
Sbjct: 10341 -PITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNL 10399

Query: 857   SGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDK---PGAH-----EIEVG 908
                   V  L+ G +Y ++V A+N  G G+PS  T P+  +D+   P  H     ++ + 
Sbjct: 10400 LSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIR 10459

Query: 909   VDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGT 968
             V E   +   +     P  S   W KD    L+  R  I+       +   +    D G 
Sbjct: 10460 VGEAFALTGRYSGKPKPKVS---WFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGK 10516

Query: 969   YSVIVTDA 976
             Y V+V ++
Sbjct: 10517 YCVVVENS 10524



 Score =  143 bits (360), Expect = 1e-33
 Identities = 145/603 (24%), Positives = 242/603 (40%), Gaps = 65/603 (10%)

Query: 308   RDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEA 367
             RDG  L+++ R     T    ++ +  +   D G Y +   +  G  +    ++V D   
Sbjct: 20140 RDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIVVLD--- 20196

Query: 368   ENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPG 427
               PG P  P+ +   D+  + + L W PP    G+ +T Y + + +  +  W        
Sbjct: 20197 -RPGPPTGPVVIS--DITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVA 20253

Query: 428   GTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDH-DAARRKTEIPFDLGNK 486
              T    +  L  G+ Y+FR++A +R G S            DH D+A    ++P+     
Sbjct: 20254 RTMM-KVMKLTTGEEYQFRIKAENRFGIS------------DHIDSACVTVKLPY----- 20295

Query: 487   ITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEP-SPRDRAPLTYSLEKSVIGSGT 545
                         T P PP+    + +    + + W EP S    A + Y LE     S  
Sbjct: 20296 ------------TTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSIL 20343

Query: 546   WEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPP 605
             W+  +++  +R+  F V  +     Y FRV A N  G+  PS PSEP+          PP
Sbjct: 20344 WQK-ANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAID---ACEPP 20399

Query: 606   AQVQAFRDTQTSVSLTW-DPVKD--PELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPG 662
               V+    ++ SVSL+W  P  D   ++ GY +  R +    W   +   +  T+F + G
Sbjct: 20400 RNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISG 20459

Query: 663   LRTGKEYEFCVRSVSEAG-VGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWK 721
             L    +YEF V + +  G +   S    PI    +   P            K     G  
Sbjct: 20460 LTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYR--AGTS 20517

Query: 722   PPKRRG-GGKILGYFLDQHDSEELDWHAV----NQQPIPTRVCKVSDLHEGHFYEFRARA 776
                R G  GK         D +EL  +A+    N   + + + K +D      YE + R 
Sbjct: 20518 VKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRN 20577

Query: 777   ANWAGVGELSAPSSLFECKEWTMPQPGPP-YDVRASEVRATSLVLQWEPPLYMGAGPVTG 835
             A    +G  SA       +   + +PGPP   +    V A  + L W PP   G   +T 
Sbjct: 20578 A----MGSASA-----TIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITH 20628

Query: 836   YHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVL 895
             Y V  +E     W  V+   +    +  + +  G  Y+F+V+A+N  G+G+P + +D V+
Sbjct: 20629 YIVEKRETSRVVWSMVSE-HLEECIITTTKIIKGNEYIFRVRAVNKYGIGEP-LESDSVV 20686

Query: 896   LED 898
              ++
Sbjct: 20687 AKN 20689



 Score =  141 bits (355), Expect = 5e-33
 Identities = 165/692 (23%), Positives = 269/692 (38%), Gaps = 113/692 (16%)

Query: 303   SIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLV 362
             ++ W +DG  L+ + R  +  +    SL +    KED G Y + V +  G       ++V
Sbjct: 19053 TVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIV 19112

Query: 363   RDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIAC 422
              D     PG PG    +R  +V+ D + ++W PP    G  I+ Y +E+ +  S  W   
Sbjct: 19113 LD----RPGPPGP---IRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIV 19165

Query: 423   HEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPS----------------------- 459
              +A   T    I  L  G  Y+FRV A +R G S  S                       
Sbjct: 19166 SQAVARTS-IKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVV 19224

Query: 460   ---KASELV------------VMGDHDAARRKTEIPFDLGNKITISTDAFE--------- 495
                K++ LV            V+G H   + ++ I +   NKI I+    +         
Sbjct: 19225 HATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLM 19284

Query: 496   ------------------DTVTIPS-----PPTNVHASEIREAYVVLAWEEPSPRDRAPL 532
                                   +P+     PP     + I    V L W +P     A +
Sbjct: 19285 YEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKI 19344

Query: 533   T-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQY-GLSDPSEPS 590
             T Y +E+  +  G W   +  + ++   F V +L + + Y FRV A N    +S+PSE +
Sbjct: 19345 TGYIVERRELPDGRWLKCNYTN-IQETYFEVTELTEDQRYEFRVFARNAADSVSEPSEST 19403

Query: 591   EPIALRGPPATLPPPAQVQA-FRDTQTSVSLTWDPVKDPELLGYY--IYSRKVGTSEWQT 647
              PI ++      PP   +   FRD           VK  E+L     I  R +    W  
Sbjct: 19404 GPIIVKDDVE--PPRVMMDVKFRDVIV--------VKAGEVLKINADIAGRPLPVISWAK 19453

Query: 648   VNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGE------SSAATEPIRVK-QALATP 700
                +  +  R  +  + T       V+       G+      + A T  + V  + L  P
Sbjct: 19454 DGIEIEERARTEI--ISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKP 19511

Query: 701   SAPYGFALLN-CGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVC 759
               P G   +N     +  + W  P+  GG  I  Y +++ ++  L W  + +  +    C
Sbjct: 19512 GPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAW-TICEGELQMTSC 19570

Query: 760   KVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLV 819
             KV+ L +G+ Y FR    N  GVGE     ++     +T+P P  P  +  + V   S+ 
Sbjct: 19571 KVTKLLKGNEYIFRVTGVNKYGVGEPLESVAIKALDPFTVPSP--PTSLEITSVTKESMT 19628

Query: 820   LQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAM 879
             L W  P   G   ++GY +  +E+ S +W  V   P+    ++ + L+ G  Y ++V A 
Sbjct: 19629 LCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAE 19688

Query: 880   NSAGLGQPSMPT------DPVLLEDKPGAHEI 905
             N+AGL  PS  +      DPV L   P   +I
Sbjct: 19689 NAAGLSLPSETSPLIRAEDPVFLPSPPSKPKI 19720



 Score =  140 bits (353), Expect = 9e-33
 Identities = 178/759 (23%), Positives = 305/759 (40%), Gaps = 100/759 (13%)

Query: 173   LTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRV 232
             L+C +   P P + WY    R    L ++ KY+++++    +L +     ED   YT   
Sbjct: 24180 LSCQIVGRPLPDIKWY----RFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIA 24235

Query: 233   KNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSC 292
              N  G+  + +K+L++       G+     K   +G +V  T  L  ++     P     
Sbjct: 24236 TNEVGEVETSSKLLLQATPQFHPGYP---LKEKYYG-AVGSTLRLHVMYIGRPVP----- 24286

Query: 293   LFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKV-SCTYKEDEGLYMVRVPSPF 351
                       ++ WF    LL++S    I  T+    L + +   K   G Y V++ + F
Sbjct: 24287 ----------AMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVF 24336

Query: 352   GPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIER 411
             G  +    V ++D     P  P  P+ +  L  N    +++W PP+D  G+ IT Y +E+
Sbjct: 24337 GTVDAILDVEIQD----KPDKPTGPIVIEALLKNS--AVISWKPPADDGGSWITNYVVEK 24390

Query: 412   CQGESG-EWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDH 470
             C+ + G EW     A   T  C I  L E   Y FRV A +  G S P + S +V++   
Sbjct: 24391 CEAKEGAEWQLVSSAISVT-TCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVII--- 24446

Query: 471   DAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRA 530
                    + PF+                  P  P     + + +   V+AW+ P+    A
Sbjct: 24447 -------KSPFEK-----------------PGAPGKPTITAVTKDSCVVAWKPPASDGGA 24482

Query: 531   PL-TYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEP 589
              +  Y LEK       W ++++E  +R   F+V +L +   Y FRV+  N  G S+ SE 
Sbjct: 24483 KIRNYYLEKREKKQNKWISVTTEE-IRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEI 24541

Query: 590   SEPIALRGPPATLPPPAQVQAFRDT--------QTSVSLTWDPVKDPELLGYYIYSRKVG 641
             SEPI  +        P Q   F++         Q++ +L       P+ +  +    K  
Sbjct: 24542 SEPITPKS-----DVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEI 24596

Query: 642   TSEWQTVNNKPIQG--TRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALAT 699
              ++      +  +G   +  +  +       + VR+ ++ G    +A+ E + V   +  
Sbjct: 24597 IADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLE-VEVPAKIHL 24655

Query: 700   PSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTR-- 757
             P    G   ++  + E V+  K P       ++ +       ++L  +  + Q I TR  
Sbjct: 24656 PKTLEGMGAVHALRGE-VVSIKIPFSGKPDPVITW----QKGQDLIDNNGHYQVIVTRSF 24710

Query: 758   ----VCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEV 813
                      +  +  FY   A+  N  G+ + +    + +        P PP  V+ S+V
Sbjct: 24711 TSLVFPNGVERKDAGFYVVCAK--NRFGIDQKTVELDVADV-------PDPPRGVKVSDV 24761

Query: 814   RATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYV 873
                S+ L W  P   G   +T Y V      +E+W  V  G    T   V +L    SY 
Sbjct: 24762 SRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRV--GQARETRYTVINLFGKTSYQ 24819

Query: 874   FQVQAMNSAGLGQPSMPTDPVLL-EDKPGAHEIEVGVDE 911
             F+V A N  GL +PS P++P +  EDK  A   +  VDE
Sbjct: 24820 FRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDE 24858



 Score =  139 bits (351), Expect = 1e-32
 Identities = 175/744 (23%), Positives = 286/744 (38%), Gaps = 101/744 (13%)

Query: 213   LSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVE 272
             L+  + R   +    + V+ KN  G            Y      F S I K     P+ +
Sbjct: 22229 LTFTVERLVEKTEYEFRVKAKNDAG------------YSEPREAFSSVIIKEPQIEPTAD 22276

Query: 273   FTSVLKPVFA-REKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLK 331
              T +   +   +   PF++    S     A  + W  +   L+ + R  I  T  + +L 
Sbjct: 22277 LTGITNQLITCKAGSPFTIDVPISGR--PAPKVTWKLEEMRLKETDRVSITTTKDRTTLT 22334

Query: 332   VSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLIL 391
             V  + + D G Y + + +  G +  S  V+V       PG    P+ V    V+ +  +L
Sbjct: 22335 VKDSMRGDSGRYFLTLENTAGVKTFSVTVVV----IGRPGPVTGPIEVS--SVSAESCVL 22388

Query: 392   TWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAIS 451
             +W  P D  G  IT Y +E+ +  +  W   + +   T +  +  L +   Y FRV + +
Sbjct: 22389 SWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRT-QIKVTHLTKYMEYSFRVSSEN 22447

Query: 452   RVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASE 511
             R G S P +++ ++            E PF                   PS PT      
Sbjct: 22448 RFGVSKPLESAPII-----------AEHPF-----------------VPPSAPTRPEVYH 22479

Query: 512   IREAYVVLAWEEPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKS 570
             +    + + WEEP     + +  Y +EK    +  W    ++ P     + V  L +   
Sbjct: 22480 VSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILW-VKENKVPCLECNYKVTGLVEGLE 22538

Query: 571   YVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWD-PVKD-- 627
             Y FR  A+N  G+S  SE S PI  + P   +  P + +    T+++VSL W  P  D  
Sbjct: 22539 YQFRTYALNAAGVSKASEASRPIMAQNP---VDAPGRPEVTDVTRSTVSLIWSAPAYDGG 22595

Query: 628   PELLGYYIYSR---KVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGV-GE 683
              +++GY I  +   +VG   W   N   +    FTV  L  G  YEF V + + AGV  +
Sbjct: 22596 SKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISK 22655

Query: 684   SSAATEPIRVKQALATPSAPYGFAL------LNCGKN---EMVIGWKPPKR---RGGGKI 731
              S +T P+  +   A P A     L      +  G +   +  +G KP  +     G K 
Sbjct: 22656 GSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDK- 22714

Query: 732   LGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSL 791
                 LD  +   L +         T V K  D  +   Y    +  N +G   +S    +
Sbjct: 22715 ---ELDLCEKVSLQYTGKR----ATAVIKFCDRSDSGKYTLTVK--NASGTKAVSVMVKV 22765

Query: 792   FECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPV 851
              +        PGP   +  S V      L W  P   G   +T Y V  +E     W  +
Sbjct: 22766 LD-------SPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNW-VI 22817

Query: 852   TPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVL------LEDKPGAHEI 905
               G        V+ L     Y+F+V+A+N  G G P + ++P++      +   PG  E 
Sbjct: 22818 VEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVP-VESEPIVARNSFTIPSPPGIPE- 22875

Query: 906   EVGVDEEGFIYLAFEAPEAPDSSE 929
             EVG  +E  I + +  PE+   +E
Sbjct: 22876 EVGTGKE-HIIIQWTKPESDGGNE 22898



 Score =  139 bits (349), Expect = 3e-32
 Identities = 185/823 (22%), Positives = 318/823 (38%), Gaps = 100/823 (12%)

Query: 181   PPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQAS 240
             PPP VTW K++  +        +Y I N      L I +    D+  Y + ++N  G+  
Sbjct: 20927 PPPTVTWRKDEKNLGSD----ARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEP- 20981

Query: 241   SFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFT-SVLKPVFAREKEPFSLSCLFSEDVL 299
                                   K ST    V  T +  + +  +     +++ L+   ++
Sbjct: 20982 ----------------------KSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLI 21019

Query: 300   DAES--IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQ- 356
             D  S  I +  +           + +     S K+    ++    + V   +  G  E  
Sbjct: 21020 DGGSPIINYVIEKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPC 21079

Query: 357   STYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGES 416
              T   V+ AE     AP   L+++  D  +  +IL+W  P    G+ IT Y +ER +G+ 
Sbjct: 21080 ETTEPVKAAEVP---APIRDLSMK--DSTKTSVILSWTKPDFDGGSVITEYVVER-KGK- 21132

Query: 417   GEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRK 476
             GE    H     TC   +  L E     FRV A +  G S P     + V          
Sbjct: 21133 GEQTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITV---------- 21182

Query: 477   TEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWE-EPSP-----RDRA 530
                      ++ I+ +   D   IP     V        ++ L ++ +P P     +D  
Sbjct: 21183 --------KELIITPEV--DLSDIPGAQVTVRIGH--NVHLELPYKGKPKPSISWLKDGL 21230

Query: 531   PLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPS 590
             PL  S           E +           ++ + +K+    + V   N   +   + P 
Sbjct: 21231 PLKES-----------EFVRFSKTENKITLSIKNAKKEHGGKYTVILDN--AVCRIAVPI 21277

Query: 591   EPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDP---ELLGYYIYSRKVGTSEWQT 647
               I L GPP+    P +    +    SV L+WD  +D    E+  Y I  R+   + W+ 
Sbjct: 21278 TVITL-GPPSKPKGPIRFDEIK--ADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKM 21334

Query: 648   VNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFA 707
             V +  +  T F VP L    EY+F VR+ +  GV +   ++  I  K     P  P    
Sbjct: 21335 VCSS-VARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSSI-IVAKHQFRIPGPPGKPV 21392

Query: 708   LLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEG 767
             + N   + M + W  P   GG ++ G+ +++ +   + W  VN  PI  R  + + L EG
Sbjct: 21393 IYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEG 21452

Query: 768   HFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLY 827
               Y+FR  A N AG+   S PS  F      +  PG P  +   +V   ++ L+W PPL 
Sbjct: 21453 LDYQFRVYAENSAGLSSPSDPSK-FTLAVSPVDPPGTPDYI---DVTRETITLKWNPPLR 21508

Query: 828   MGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAG-LGQ 886
              G   + GY +  + +G+E+W       +S     V+ L PG  Y F++ A N+ G +  
Sbjct: 21509 DGGSKIVGYSIE-KRQGNERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISP 21567

Query: 887   PSMPTDPVLLEDKPGAHEIEVGVDE-EGFIYLAFEA------PEAPDSSEFQWSKDYKGP 939
             PS  +  ++  D+     +E G +  +G I  + E+       +        W KD    
Sbjct: 21568 PSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEI 21627

Query: 940   LDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISA 982
                  ++I D +  + + +++   +  G Y+V   +A     A
Sbjct: 21628 EKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKA 21670



 Score =  135 bits (341), Expect = 2e-31
 Identities = 214/959 (22%), Positives = 379/959 (39%), Gaps = 115/959 (11%)

Query: 169   TTVLLTCT----------VQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIR 218
             T  L+TC           +   P P+VTW   + R+        +  IT      +L ++
Sbjct: 22281 TNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLK----ETDRVSITTTKDRTTLTVK 22336

Query: 219   RCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLK 278
                  DS  Y + ++N  G  +    V+V    G   G              +E +SV  
Sbjct: 22337 DSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTG-------------PIEVSSV-- 22381

Query: 279   PVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKE 338
                    E   LS    +D    E   +  +     ++  + +  + ++  +KV+   K 
Sbjct: 22382 -----SAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKY 22436

Query: 339   DEGLYMVRVPSPFG---PREQSTYVLVRDAEAENPGAPGS-PLNVRCLDVNRDCLILTWA 394
              E  + V   + FG   P E +  +      AE+P  P S P       V+ + + + W 
Sbjct: 22437 MEYSFRVSSENRFGVSKPLESAPII------AEHPFVPPSAPTRPEVYHVSANAMSIRWE 22490

Query: 395   PPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVG 454
              P    G+ I  Y +E+ +  +  W+  ++ P   C   + GLVEG  Y+FR  A++  G
Sbjct: 22491 EPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAG 22550

Query: 455   SSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVT-IPSPPTNVHASEIR 513
              S  S+AS  ++  +   A  + E+           TD    TV+ I S P     S++ 
Sbjct: 22551 VSKASEASRPIMAQNPVDAPGRPEV-----------TDVTRSTVSLIWSAPAYDGGSKV- 22598

Query: 514   EAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVF 573
               Y++         +R P+      S +G G W    + + V    F V  L +  +Y F
Sbjct: 22599 VGYII---------ERKPV------SEVGDGRW-LKCNYTIVSDNFFTVTALSEGDTYEF 22642

Query: 574   RVRAMNQYG-LSDPSEPSEPIALRGPPATLPPPAQVQA-FRDTQTSVSLTWDPVKDPELL 631
             RV A N  G +S  SE + P+  R   A  PP A++ A       ++    D V D  + 
Sbjct: 22643 RVLAKNAAGVISKGSESTGPVTCRDEYA--PPKAELDARLHGDLVTIRAGSDLVLDAAVG 22700

Query: 632   G----YYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVS--EAGVGESS 685
             G      I+++  G  E        +Q T     G R     +FC RS S       +++
Sbjct: 22701 GKPEPKIIWTK--GDKELDLCEKVSLQYT-----GKRATAVIKFCDRSDSGKYTLTVKNA 22753

Query: 686   AATEPIRVKQALATPSAPYG-FALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEEL 744
             + T+ + V   +     P G   +    + +  + W  P+  GG +I  Y +++ ++  L
Sbjct: 22754 SGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRL 22813

Query: 745   DWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQ-PG 803
             +W  V  +  PT    V+ L + + Y FR RA N  G G       +     +T+P  PG
Sbjct: 22814 NWVIVEGE-CPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPG 22872

Query: 804   PPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPG-PISGTHLR 862
              P +V   +     +++QW  P   G   ++ Y V  +E+ S +W  V     +  T L+
Sbjct: 22873 IPEEVGTGK---EHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLK 22929

Query: 863   VSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLED---KPGAHEIEVGVD-EEGFIYLA 918
             V+ L  G  Y F+V A+N+AG  +PS  ++ +   +    PG       VD  +  I LA
Sbjct: 22930 VTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLA 22989

Query: 919   FEAP---EAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTD 975
             +  P      D   +      K      RV     +  ++  + +  +    ++ V   +
Sbjct: 22990 WTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVN 23049

Query: 976   ADEDISASHTLTE-EELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPA 1034
                    S ++ E E +E+++    E+ + + K ++     I     +RL + V    P 
Sbjct: 23050 VKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVT-----IRAGASLRLMVSVSGRPPP 23104

Query: 1035  AELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITL 1093
                 +I  +K+     +R I  D  +    +I+  ++  D G YT + ++   K   T+
Sbjct: 23105 ----VITWSKQGIDLASRAI-IDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATV 23158



 Score =  120 bits (301), Expect = 9e-27
 Identities = 179/830 (21%), Positives = 305/830 (36%), Gaps = 90/830 (10%)

Query: 171   VLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTV 230
             + L   V+  P P+VTW K    ID  + R G+  + +    L   I     +DS  Y++
Sbjct: 12252 IRLFAIVRGRPAPKVTWRK--VGID-NVVRKGQVDLVDTMAFLV--IPNSTRDDSGKYSL 12306

Query: 231   RVKNAHGQASSFAKVLVRTYLGKDAGFD-SEIFKRSTFGPSVEFTSVLKPVFAREKEPFS 289
              + N  G+ + F  V V    G  +    S++ K S         S   P    E +  S
Sbjct: 12307 TLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCH------VSWAPP----ENDGGS 12356

Query: 290   LSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPS 349
                 +  +  +A+   W              +    ++ S  V+     +E  + V   +
Sbjct: 12357 QVTHYIVEKREADRKTW------------STVTPEVKKTSFHVTNLVPGNEYYFRVTAVN 12404

Query: 350   PFGPREQSTY---VLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITA 406
              +GP   +     VL  D  +E    P  P  +   ++ ++   L W PP    G  I  
Sbjct: 12405 EYGPGVPTDVPKPVLASDPLSE----PDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDG 12460

Query: 407   YTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVV 466
             Y     + E         +        + GL EG+ Y+FRV A + VG S+P +A     
Sbjct: 12461 YITSYREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAE---- 12516

Query: 467   MGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSP 526
              G ++A  +       +  +ITI                 + A    + +    W++   
Sbjct: 12517 -GVYEAKEQLLPPKILMPEQITIKA----------GKKLRIEAHVYGKPHPTCKWKKG-- 12563

Query: 527   RDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDP 586
                       E  V+ S       ++S   S    + D+ +K S  + + A N  G    
Sbjct: 12564 ----------EDEVVTSSHLAVHKADS---SSILIIKDVTRKDSGYYSLTAENSSGTDTQ 12610

Query: 587   SEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWD-PVKD--PELLGYYIYSRKVGTS 643
                   +   GPP    PP  +        + SL+W  P++D    +  Y +    V   
Sbjct: 12611 KIKVVVMDAPGPPQ---PPFDISDI--DADACSLSWHIPLEDGGSNITNYIVEKCDVSRG 12665

Query: 644   EWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQ-ALATPSA 702
             +W T     +  T   V  L  G+EY F VR+ +  G+ E    T P  V Q     PS 
Sbjct: 12666 DWVTALAS-VTKTSCRVGKLIPGQEYIFRVRAENRFGISEP--LTSPKMVAQFPFGVPSE 12722

Query: 703   PYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVS 762
             P    +    K+ + + W  P   GG  I+GY +++ +   L W   N   + +     +
Sbjct: 12723 PKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVKANDTLVRSTEYPCA 12782

Query: 763   DLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQW 822
              L EG  Y FR  A N AG    S P+     +    P PG P  +   +V  +++ L W
Sbjct: 12783 GLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDP-PGKPEVI---DVTKSTVSLIW 12838

Query: 823   EPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGP--ISGTHLRVSDLQPGKSYVFQVQAMN 880
               P + G   + GY V   +   ++W      P  I       + L+    Y F+  A  
Sbjct: 12839 ARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIART 12898

Query: 881   SAGLGQPSMPTDPVLLEDKPGAHEIEVGVDEEGFIYLAFEAPEAPDSSEF-------QWS 933
             +  +  PS P+DPV +  +     I++ V  +  + +        D++ F        W 
Sbjct: 12899 AVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWK 12958

Query: 934   KDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISAS 983
             KD       + +K+  + N   + L     +D G Y++   ++    SA+
Sbjct: 12959 KDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSAT 13008



 Score =  110 bits (274), Expect = 1e-23
 Identities = 170/767 (22%), Positives = 290/767 (37%), Gaps = 128/767 (16%)

Query: 171   VLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTV 230
             + LT  ++  P P   W K    I  R   A     T       L I+     DS TY +
Sbjct: 23782 IRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTE------LVIKEADRGDSGTYDL 23835

Query: 231   RVKNAHGQASSFAKVLVRTYLGKDAG---FDSEIFK--RSTFGPSVEF--TSVLKPVFAR 283
              ++N  G+ + + KV V        G   +D    +  R ++ P  +     +L  +  R
Sbjct: 23836 VLENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILER 23895

Query: 284   EKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
              + P                  W+   S +R +            SL V    +  E  +
Sbjct: 23896 REVP---------------KAAWYTIDSRVRGT------------SLVVKGLKENVEYHF 23928

Query: 344   MVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNV--------RCLDVNRDCLILTWAP 395
              V   + FG        + +  ++E P  P +PLN           LDV +  + L+W+ 
Sbjct: 23929 RVSAENQFG--------ISKPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSR 23980

Query: 396   PSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGS 455
             P D  G+ +T Y IER +  + +W+  ++    T    + GLV    Y+FR+ A + VG 
Sbjct: 23981 PKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGL 24040

Query: 456   SVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREA 515
             S  S ASE VV  D          PFD                  PS P  +    I + 
Sbjct: 24041 SETSPASEPVVCKD----------PFDK-----------------PSQPGELEILSISKD 24073

Query: 516   YVVLAWEEPS-PRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFR 574
              V L WE+P     +  L Y +E    G   W+  S++  ++  +F +  L +   Y FR
Sbjct: 24074 SVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKK-SNKERIKDKQFTIGGLLEATEYEFR 24132

Query: 575   VRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYY 634
             V A N+ GLS P   +  ++++    +   P   +  +D  T +        +   L   
Sbjct: 24133 VFAENETGLSRPRRTA--MSIKTKLTSGEAPGIRKEMKDVTTKLG-------EAAQLSCQ 24183

Query: 635   IYSRKVGTSEWQTVNNKPIQGTRF---------TVPGLRTGKEYEFCVRSVSEAGVGESS 685
             I  R +   +W     + IQ  ++         T+  +   +E E     ++   VGE  
Sbjct: 24184 IVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVE 24243

Query: 686   AATEPIRVKQALATPSAP-----YGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHD 740
              +++ +        P  P     YG        + M IG   P        + +F  Q  
Sbjct: 24244 TSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVP-------AMTWFHGQKL 24296

Query: 741   SEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMP 800
              +  +   +      T +   +   + H  +++ + +N  G  +      + +  +    
Sbjct: 24297 LQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPD---- 24352

Query: 801   QPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQE--EGSEQWKPVTPGPISG 858
             +P  P  + A  +   S V+ W+PP   G   +T Y V   E  EG+E W+ V+   IS 
Sbjct: 24353 KPTGPIVIEA--LLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAE-WQLVS-SAISV 24408

Query: 859   THLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLE---DKPGA 902
             T  R+ +L     Y F+V A N+ G+  P   +  V+++   +KPGA
Sbjct: 24409 TTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGA 24455



 Score = 84.0 bits (206), Expect = 1e-15
 Identities = 85/314 (27%), Positives = 128/314 (40%), Gaps = 31/314 (9%)

Query: 152   RGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITN-NY 210
             + P F   LR+  V   +   L C V   P P V WY+    I   +    KYRI     
Sbjct: 24554 QAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEI---IADGLKYRIQEFKG 24610

Query: 211   GLLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPS 270
             G   L I     +D+  Y VR  N  G  S  A + V           ++I    T    
Sbjct: 24611 GYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEV--------PAKIHLPKTL--- 24659

Query: 271   VEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASL 330
                   +  V A   E  S+   FS        I W +   L+ ++   +++ T    SL
Sbjct: 24660 ----EGMGAVHALRGEVVSIKIPFSGK--PDPVITWQKGQDLIDNNGHYQVIVTRSFTSL 24713

Query: 331   KV-SCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCL 389
                +   ++D G Y+V   + FG  +++  + V D        P  P  V+  DV+RD +
Sbjct: 24714 VFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADV-------PDPPRGVKVSDVSRDSV 24766

Query: 390   ILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRA 449
              LTW  P+   G+ IT Y +E+C   +  W+   +A     R  +  L    SY+FRV A
Sbjct: 24767 NLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQA--RETRYTVINLFGKTSYQFRVIA 24824

Query: 450   ISRVGSSVPSKASE 463
              ++ G S PS+ SE
Sbjct: 24825 ENKFGLSKPSEPSE 24838



 Score = 75.5 bits (184), Expect = 3e-13
 Identities = 113/488 (23%), Positives = 184/488 (37%), Gaps = 48/488 (9%)

Query: 338   EDEGLYM-VRVPSPFG---PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTW 393
             E+ G Y  V   + FG   P E S+ V+++ +  E PGAPG P       V +D  ++ W
Sbjct: 24418 ENAGYYFRVSAQNTFGISDPLEVSSVVIIK-SPFEKPGAPGKPTITA---VTKDSCVVAW 24473

Query: 394   APPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRV 453
              PP+   G  I  Y +E+ + +  +WI+            ++ L+EG  Y FRV+  +  
Sbjct: 24474 KPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLG 24533

Query: 454   GSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIR 513
             G S  S+ SE +          K+++P        I    F++ +       N++     
Sbjct: 24534 GESEWSEISEPITP--------KSDVP--------IQAPHFKEELR------NLNVRYQS 24571

Query: 514   EAYVVL-AWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYV 572
              A +V      P P  +    Y   K +I  G    I  E      +  +  +    + V
Sbjct: 24572 NATLVCKVTGHPKPIVK---WYRQGKEIIADGLKYRIQ-EFKGGYHQLIIASVTDDDATV 24627

Query: 573   FRVRAMNQYGL--SDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPEL 630
             ++VRA NQ G      S   E  A    P TL     V A R    S+ + +    DP +
Sbjct: 24628 YQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVI 24687

Query: 631   LGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEP 690
                           +Q +  +      F   G+       + V + +  G+ + +   + 
Sbjct: 24688 TWQKGQDLIDNNGHYQVIVTRSFTSLVFP-NGVERKDAGFYVVCAKNRFGIDQKTVELDV 24746

Query: 691   IRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVN 750
               V      P  P G  + +  ++ + + W  P   GG KI  Y +++  +    W  V 
Sbjct: 24747 ADV------PDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVG 24800

Query: 751   QQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRA 810
             Q    TR   V +L     Y+FR  A N  G+ + S PS     KE         YD   
Sbjct: 24801 QAR-ETRY-TVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKE--DKTRAMNYDEEV 24856

Query: 811   SEVRATSL 818
              E R  S+
Sbjct: 24857 DETREVSM 24864



 Score = 71.6 bits (174), Expect = 5e-12
 Identities = 104/524 (19%), Positives = 199/524 (37%), Gaps = 62/524 (11%)

Query: 919  FEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADE 978
            FE   +      QW KD +      R+KI+ +    ++++    + D G Y+V+   A  
Sbjct: 3031 FECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVV---AGG 3087

Query: 979  DISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELH 1038
            ++S +    E    +++ +  E++             ++E+   R  +E E      + H
Sbjct: 3088 NVSTAKLFVEGRDVRIRSIKKEVQ-------------VIEKQ--RAVVEFEVNEDDVDAH 3132

Query: 1039 LIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDD 1098
               +  EI      +  +  E+ +  + I    + D G YT     G+ ++ +TL +   
Sbjct: 3133 WYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYT--FVAGRNRSSVTLYV--- 3187

Query: 1099 DFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRA 1158
                               + P   + LQ    +  +    C V + + + +  W+ +  
Sbjct: 3188 ----------------NAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQ 3231

Query: 1159 EMPDG-----QYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIF 1213
             +  G      +D +  T LL   E   +D  +Y     +D G   T   L+ +  + + 
Sbjct: 3232 LLSTGFKCKFLHDGQEYTLLLI--EAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVS 3289

Query: 1214 T--ELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGT 1271
               E+        TPL+   T EG     + +    + +K +W+ KDK+++     R   
Sbjct: 3290 PDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTD-LKVSWYSKDKKIKPSRFFRMTQ 3348

Query: 1272 TLDEIWLHILDPKDSDKGKYTL--EIAAGKEVRQLSTDLSG-QAFEDAMAEHQRLKTLAI 1328
              D   L I +    D+G YT     A G+     +  L G   FE+  +  Q   +L++
Sbjct: 3349 FEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEGFSKFEENTSNSQWHVSLSV 3408

Query: 1329 IEK-----NRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQ---PVTFLDR 1380
              K      +   ++ L  +  +   +T+     VSG P PEI W  N Q   P   +  
Sbjct: 3409 SFKKEPLGQKPSFIQPLSSL-RVHNGETVRFHARVSGIPKPEIQWFHNQQLILPTKDVVF 3467

Query: 1381 YRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISV 1424
            +  E  G  + + ++   SE +G+Y     N  G  T   T++V
Sbjct: 3468 HFEESTGMALMLIVD-AYSEHAGQYSCKAANSAGEATCAATLTV 3510



 Score = 71.6 bits (174), Expect = 5e-12
 Identities = 79/340 (23%), Positives = 140/340 (41%), Gaps = 58/340 (17%)

Query: 1132  EDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQ---YDPETGTGLLCIEELSKKDKGIYR 1188
             E   V+  CK+ N  + T+  W+F   ++ + +      E G  +L +++++K D G YR
Sbjct: 25209 EGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYR 25268

Query: 1189  AMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVE 1248
               V +D GED +  +L    +  ++    R      T  KI+   + +R+  +   + + 
Sbjct: 25269 CKVVNDYGEDSSYAELFVKGVREVYDYYCR-----RTMKKIKRRTDTMRLLERPPEFTLP 25323

Query: 1249  -YMKTTWFHKDKRLESGDRIRTGTTL------DEIWL---HILDPKDSDKGKYTLEIAAG 1298
              Y KT +         G+ +R G T+         W      + P D+DK KYT E   G
Sbjct: 25324 LYNKTAYV--------GENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDK-KYTFESDKG 25374

Query: 1299  ---KEVRQLSTD-------LSGQAFEDAMAEHQRLKTL--AIIEKNRAKVVRGLPDVATI 1346
                  +  ++TD       ++   + +   + +   TL     +     + + L   A  
Sbjct: 25375 LYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAEC 25434

Query: 1347  MEDKTLCLTCIVSGDPTPEISWLKNDQPVTF----------LDRYRMEVRGTEVTITIEK 1396
              E +++C    VSG P P + W K+ QP++           LD Y + +R T        
Sbjct: 25435 QEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDT-------- 25486

Query: 1397  VNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELKS 1436
                ED+G Y V   N  GS + Q  + V +   + +E KS
Sbjct: 25487 -LPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQEFKS 25525



 Score = 64.7 bits (156), Expect = 6e-10
 Identities = 89/459 (19%), Positives = 159/459 (34%), Gaps = 88/459 (19%)

Query: 1061  GLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDF----DKLLRKADAKRRDWK- 1115
             G  E+ I NL+E D+G Y  ++      ++  L  +   F    +K+ + ++ K+ D K 
Sbjct: 26400 GTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKT 26459

Query: 1116  ------RKQGPYFERPLQWK-----------VTEDCQVQLTCKVTNTKKETRFQWFFQRA 1158
                   RK  P    P+  K           V+ D   +   K T   + T       +A
Sbjct: 26460 TESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKA 26519

Query: 1159  EMPDGQY--DPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALD------ 1210
                 G+Y    + G   L I +    D G+Y   V +  G   +   LT  A+       
Sbjct: 26520 ITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQK 26579

Query: 1211  --------------AIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNV----EYMKT 1252
                           A+  E     AL +  +K+   +   ++  K +   V    E  K+
Sbjct: 26580 VSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKS 26639

Query: 1253  TWFHKDKRLESGDRIRTGTTLDEIWLHI--------LDPKDSDKGKYTLEIAAGKEVRQL 1304
                  +K +   +  +T    +E+  H         +   +  +      IA   +V+ +
Sbjct: 26640 AATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGATDVKWV 26699

Query: 1305  STDL--------------SGQAFEDAMAEHQRLKTLAIIEKNRAKVVR------------ 1338
                +              S Q      A H+    L  I K +  +V+            
Sbjct: 26700 LNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELS 26759

Query: 1339  ------GLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTI 1392
                     P    I E + +  TC +SG+P+PEI W KN+ P++      +       ++
Sbjct: 26760 DAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSL 26819

Query: 1393  TIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEP 1431
              I   +  DSG+Y +  KN  G  +   ++ V    +EP
Sbjct: 26820 EIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEP 26858



 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 59/227 (25%), Positives = 93/227 (40%), Gaps = 28/227 (12%)

Query: 133   RRTEEKVQEAKELRELCYGRGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDT 192
             RRT +K++   +   L   R P F +PL +   +    V    T+   P P VTWYK+  
Sbjct: 25298 RRTMKKIKRRTDTMRLLE-RPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQ 25356

Query: 193   RIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLG 252
             +I P      KY   ++ GL  L I     +D A YTV  +N +G+ S  AK+ V  +  
Sbjct: 25357 KIKPG-DNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLH-- 25413

Query: 253   KDAGFDSEIFKRSTFGPSVEFTSVLKPVFARE------KEPFSLSCLFSEDVLDAESIQW 306
                             P  +  S L+P+F R       +E  S+        +   +++W
Sbjct: 25414 ---------------PPPTD--STLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKW 25456

Query: 307   FRDGSLLRSSRRRKILYTDRQ-ASLKVSCTYKEDEGLYMVRVPSPFG 352
              +DG  L      +I++      +L +  T  ED G Y V   +  G
Sbjct: 25457 EKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAG 25503



 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 61/287 (21%), Positives = 112/287 (39%), Gaps = 38/287 (13%)

Query: 1145  TKKETRFQWFFQRAEMPDGQYDPETGT-GLLCIEELS--KKDKGIYRAMVSDDRGE--DD 1199
             +K     +W+    E+ +      T T G+L +E L     D G YRA+ ++ +GE  D 
Sbjct: 26027 SKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDY 26086

Query: 1200  TILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDK 1259
               LD+TG                  T    Q  +E +      +    E    + F K  
Sbjct: 26087 ATLDVTGG---------------DYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTS 26131

Query: 1260  RLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAE 1319
              +E+   +R      E+   + + ++S                  S ++   A E+   E
Sbjct: 26132 EMEASSSVR------EVKSQMTETRES----------LSSYEHSASAEMKSAALEEKSLE 26175

Query: 1320  HQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLD 1379
              +   T   I+   A  +   P   T+ E ++   +C   G+P P ++WL+  Q ++   
Sbjct: 26176 EK--STTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSA 26233

Query: 1380  RYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFK 1426
             R+++     + T  I  V + D G Y V V+N  G +  + T+++ K
Sbjct: 26234 RHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQK 26280



 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 105/490 (21%), Positives = 187/490 (38%), Gaps = 82/490 (16%)

Query: 919  FEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADE 978
            FE   + ++++ +W KD       ++  I  K     +++ +  L+D   YS  V  A  
Sbjct: 6021 FECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTART 6080

Query: 979  DISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELH 1038
              S   T+ EEE    K L+              NI++ E   ++L  EV K  P AE+ 
Sbjct: 6081 --SGMLTVLEEEAVFTKNLA--------------NIEVSETDTIKLVCEVSK--PGAEVI 6122

Query: 1039 LIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDD 1098
                ++EI  +   +I  +  K ++  +IQN   ED G+Y  +L   +   ++ +  +  
Sbjct: 6123 WYKGDEEIIETGRYEILTEGRKRIL--VIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAA 6180

Query: 1099 DFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRA 1158
            +F                       +P   ++ E  + +  C ++  K+    QW     
Sbjct: 6181 EF---------------------ISKPQNLEILEGEKAEFVCSIS--KESFPVQWKRDDK 6217

Query: 1159 EMPDG-QYD--PETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTE 1215
             +  G +YD   +    +L +++ + +D G Y  MV   R            A      E
Sbjct: 6218 TLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARA-----------AAHLTVIE 6266

Query: 1216 LGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDE 1275
              RI      PLK    +E   +    +  N E  K  WF  ++ +    +         
Sbjct: 6267 KLRI----VVPLKDTRVKEQQEVVFNCEV-NTEGAKAKWFRNEEAIFDSSK--------- 6312

Query: 1276 IWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAK 1335
               +I+  KD     YTL I       Q + ++S     +   E+ +     I+E+   +
Sbjct: 6313 ---YIILQKDL---VYTLRIRDAHLDDQANYNVS---LTNHRGENVKSAANLIVEEEDLR 6363

Query: 1336 VVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIE 1395
            +V  L D+ T ME K++   C V+      + W KN + V F +R    V   +  +TI+
Sbjct: 6364 IVEPLKDIET-MEKKSVTFWCKVNR-LNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIK 6421

Query: 1396 KVNSEDSGRY 1405
                 D G Y
Sbjct: 6422 DCGFPDEGEY 6431



 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 4/94 (4%)

Query: 154   PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLL 213
             P F    RS  + E   VL TC +   P P++ W+KN+  I      +    I+ +  + 
Sbjct: 26762 PAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISI----SSNVSISRSRNVY 26817

Query: 214   SLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLV 247
             SLEIR  ++ DS  YT++ KN  GQ S+ A ++V
Sbjct: 26818 SLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV 26851



 Score = 61.2 bits (147), Expect = 7e-09
 Identities = 52/232 (22%), Positives = 98/232 (42%), Gaps = 30/232 (12%)

Query: 1227  LKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIW-LHILDPKD 1285
             LK + ++E  ++   V+   +   + TW+   K+L+     +   + D  + L I +  +
Sbjct: 26352 LKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTE 26411

Query: 1286  SDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAK---------- 1335
             SD+G+Y  EI+      + +    GQAF+     H+++  ++  +K+  K          
Sbjct: 26412 SDQGEYVCEISGEGGTSKTNLQFMGQAFKSI---HEKVSKISETKKSDQKTTESTVTRKT 26468

Query: 1336  -------------VVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYR 1382
                          +V GL D  T+  D         +G+P P   W K+ + +T   +Y+
Sbjct: 26469 EPKAPEPISSKPVIVTGLQDT-TVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYK 26527

Query: 1383  MEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETG--QVTISVFKHGDEPK 1432
             +        + I K ++ DSG Y   VKN  GS +   ++TI   K  +  K
Sbjct: 26528 LSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQK 26579



 Score = 57.8 bits (138), Expect = 7e-08
 Identities = 56/219 (25%), Positives = 93/219 (42%), Gaps = 22/219 (10%)

Query: 152 RGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYG 211
           + P F  PL+S  V E +T      +   P P+V+W+++   I          +I+ + G
Sbjct: 4   QAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPG--VQISFSDG 61

Query: 212 LLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSV 271
              L I      +S  Y+++  N  GQA+S A++LV               K  T  P+ 
Sbjct: 62  RAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLV---------------KAETAPPN- 105

Query: 272 EFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLK 331
            F   L+ +  R+     L    +   +    ++++RDG+ ++SS   +I       SL 
Sbjct: 106 -FVQRLQSMTVRQGSQVRLQVRVTG--IPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLL 162

Query: 332 VSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENP 370
           ++  Y ED G Y V   +  G R  ST  L+   E E P
Sbjct: 163 IAEAYPEDSGTYSVNATNSVG-RATSTAELLVQGEEEVP 200



 Score = 55.8 bits (133), Expect = 3e-07
 Identities = 55/237 (23%), Positives = 90/237 (37%), Gaps = 48/237 (20%)

Query: 160  LRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRR 219
            L++  V E  +V L C +   P P VTWY+ D +I+  +     ++IT   G+  L IR 
Sbjct: 903  LKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSI----DFQITFQSGIARLMIRE 958

Query: 220  CAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTS---- 275
               EDS  +T    N  G  S+   + V+          SE F++ T   + +FT+    
Sbjct: 959  AFAEDSGRFTCSAVNEAGTVSTSCYLAVQV---------SEEFEKETTAVTEKFTTEEKR 1009

Query: 276  -----------------------------VLKPVFAREKEPFSLSCLFSEDVLDAESIQW 306
                                         + KPV  +  E  S+             + W
Sbjct: 1010 FVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYW 1069

Query: 307  FRDGSLLRSSRRRKILYTDR--QASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVL 361
             + G  L +  R K+ Y  +  +  L +S T+ +D G Y + V +  G    S  +L
Sbjct: 1070 KKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLL 1126



 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 33/111 (29%), Positives = 48/111 (43%), Gaps = 4/111 (3%)

Query: 133   RRTEEKVQEAKELRELCYGRGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDT 192
             ++T E+  E    +       P   + +RSH V           VQ+ P  +V WY N  
Sbjct: 25981 QKTSERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGV 26040

Query: 193   RIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFA 243
              +      + K   TN  G+L+LEI  C  +DS TY     N  G+AS +A
Sbjct: 26041 ELQ----ESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYA 26087



 Score = 55.1 bits (131), Expect = 5e-07
 Identities = 26/90 (28%), Positives = 48/90 (53%), Gaps = 2/90 (2%)

Query: 1337  VRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTE--VTITI 1394
             +  LP   +I E K L + C  +G+PTPE++W    + +   ++ R  +  T+   T+ I
Sbjct: 26959 IEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLII 27018

Query: 1395  EKVNSEDSGRYGVFVKNKYGSETGQVTISV 1424
               V  +D G Y + + N++GS++  V I +
Sbjct: 27019 MDVQKQDGGLYTLSLGNEFGSDSATVNIHI 27048



 Score = 54.7 bits (130), Expect = 6e-07
 Identities = 38/144 (26%), Positives = 66/144 (45%), Gaps = 17/144 (11%)

Query: 1284  KDSDKGK-YTLEIAAGKEVRQ-LSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLP 1341
             KD  +GK YT  ++A  E  +   ++++  A +D +A    LK              GLP
Sbjct: 13571 KDLTEGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLK--------------GLP 13616

Query: 1342  DVATIM-EDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSE 1400
             D+  +  E+    L   + G P P +SW K + P+    R  +E      T+ +      
Sbjct: 13617 DLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKS 13676

Query: 1401  DSGRYGVFVKNKYGSETGQVTISV 1424
             D+G+Y + +KN  G++ G ++I V
Sbjct: 13677 DAGKYTITLKNVAGTKEGTISIKV 13700



 Score = 54.3 bits (129), Expect = 8e-07
 Identities = 51/196 (26%), Positives = 74/196 (37%), Gaps = 39/196 (19%)

Query: 156  FWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSL 215
            F  PL    V E  T +L C V      +V W+KN T I     ++ KY I  +  +  L
Sbjct: 5915 FTKPLEDQTVEEGATAVLECEVSRENA-KVKWFKNGTEI----LKSKKYEIVADGRVRKL 5969

Query: 216  EIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRS----TFGPSV 271
             I  C  ED  TYT                            D++ FK S       P V
Sbjct: 5970 VIHDCTPEDIKTYTC---------------------------DAKDFKTSCNLNVVPPHV 6002

Query: 272  EFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLK 331
            EF   L  +  REKE     C  S +      ++WF+DG+ ++  ++  I+       L 
Sbjct: 6003 EFLRPLTDLQVREKEMARFECELSRE---NAKVKWFKDGAEIKKGKKYDIISKGAVRILV 6059

Query: 332  VSCTYKEDEGLYMVRV 347
            ++    +DE  Y   V
Sbjct: 6060 INKCLLDDEAEYSCEV 6075



 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 52/246 (21%), Positives = 88/246 (35%), Gaps = 34/246 (13%)

Query: 154  PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLL 213
            P F   L++  + E + + +      +P P + W KN   I P  +   K RI    G  
Sbjct: 1510 PMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYP--KIRIEGTKGEA 1567

Query: 214  SLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEF 273
            +L+I     +DSA YT    N  G+ ++  KV V     +       I  R T+      
Sbjct: 1568 ALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIA 1627

Query: 274  TSVLKPVFAR------------EKE--------------------PFSLSCLFSEDVLDA 301
               L+P+  R            +KE                    P    C  +      
Sbjct: 1628 APELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPT 1687

Query: 302  ESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVL 361
              ++W  DG  L ++ R +++      SL     Y  D G+   R  + +G    S  ++
Sbjct: 1688 MVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLI 1747

Query: 362  VRDAEA 367
            V+D ++
Sbjct: 1748 VKDEKS 1753



 Score = 52.8 bits (125), Expect = 2e-06
 Identities = 31/92 (33%), Positives = 48/92 (52%), Gaps = 4/92 (4%)

Query: 1342  DVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSE- 1400
             D  TI   +   LT   SG P P++SW K++  V  L+  R  ++ T  T+ +EK+ ++ 
Sbjct: 10454 DKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADV--LEDDRTHIKTTPATLALEKIKAKR 10511

Query: 1401  -DSGRYGVFVKNKYGSETGQVTISVFKHGDEP 1431
              DSG+Y V V+N  GS  G   ++V      P
Sbjct: 10512 SDSGKYCVVVENSTGSRKGFCQVNVVDRPGPP 10543



 Score = 52.8 bits (125), Expect = 2e-06
 Identities = 33/106 (31%), Positives = 50/106 (47%), Gaps = 2/106 (1%)

Query: 1329  IEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGT 1388
             IE    ++   L  V  +    TL L   + G P PE+ W K +  +T  DR ++EV  +
Sbjct: 18730 IEPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT--DRAQIEVTSS 18787

Query: 1389  EVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKEL 1434
                + I+ V   DSGRY + ++N  GS+T  V + V      P  L
Sbjct: 18788 FTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNL 18833



 Score = 52.8 bits (125), Expect = 2e-06
 Identities = 26/83 (31%), Positives = 41/83 (49%)

Query: 1342  DVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSED 1401
             D+ TI     L L   V G P P+I W K D+ +   ++  ++  G   T  I+  +  D
Sbjct: 22683 DLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSD 22742

Query: 1402  SGRYGVFVKNKYGSETGQVTISV 1424
             SG+Y + VKN  G++   V + V
Sbjct: 22743 SGKYTLTVKNASGTKAVSVMVKV 22765



 Score = 52.0 bits (123), Expect = 4e-06
 Identities = 119/563 (21%), Positives = 208/563 (36%), Gaps = 101/563 (17%)

Query: 917  LAFEAPEAPDSSEFQW---SKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIV 973
            +AFE   + D+   +W   S + K P D  R+  E KV+K  ++L+     D G Y+ +V
Sbjct: 2766 VAFEVSVSHDTVPVKWFHKSVEIK-PSDKHRLVSERKVHK--LMLQNISPSDAGEYTAVV 2822

Query: 974  TDAD-------EDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWL 1026
               +       E +  + T+   E+ + K  S E        +S +N+         +WL
Sbjct: 2823 GQLECKAKLFVETLHITKTMKNIEVPETKTASFECE------VSHFNVP-------SMWL 2869

Query: 1027 EVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGK 1086
            +              N  EI  S   KI    +  L ++II N S ED   YT     G 
Sbjct: 2870 K--------------NGVEIEMSEKFKIVVQGK--LHQLIIMNTSTEDSAEYT--FVCGN 2911

Query: 1087 AKNQITLTLVDDDFDKLLRKADAKRRD---------WKRKQGPYFERPLQWKVTEDCQVQ 1137
             +   TLT+       +L+  +A+ +D         ++     + +  ++ K T+ CQ++
Sbjct: 2912 DQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMR 2971

Query: 1138 LTCKVTNTKKETRFQWFFQRAEMPDGQYDPETGTGLLCIE----ELSKKDKGI-----YR 1188
             T K+T++         F  A          T T  L +E    E  K  K I      R
Sbjct: 2972 -TKKLTHSLNIRNVH--FGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKR 3028

Query: 1189 AMVSDDRGEDDTILDLTGDALDAIFTELGRI---------------------------GA 1221
            AM   +  E D  +    D  +   T+  +I                           G 
Sbjct: 3029 AMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGN 3088

Query: 1222 LSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHIL 1281
            +S   L ++G +  IR   K      +      F  ++     D +      D I ++  
Sbjct: 3089 VSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNE-----DDVDAHWYKDGIEINF- 3142

Query: 1282 DPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLP 1341
              +  ++ KY +E    +     +       +      ++   TL +      +V++ L 
Sbjct: 3143 --QVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQ 3200

Query: 1342 DVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSED 1401
             V T+   K      ++SG P P+ISW K +Q ++   + +    G E T+ + +   ED
Sbjct: 3201 PV-TVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPED 3259

Query: 1402 SGRYGVFVKNKYGSETGQVTISV 1424
            +  Y    KN YG  T   ++SV
Sbjct: 3260 AAVYTCEAKNDYGVATTSASLSV 3282



 Score = 51.6 bits (122), Expect = 5e-06
 Identities = 104/528 (19%), Positives = 201/528 (38%), Gaps = 96/528 (18%)

Query: 904  EIEVGVDEEGFIYLAFEAPEAPDSSEFQWSKD----YKGPLDPQRVKIEDKVNKSKVILK 959
            E++  V +E      FE   +    + +W KD    ++G  D  R+  + KV+   ++  
Sbjct: 2133 ELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEG--DKYRMHSDRKVHFLSILTI 2190

Query: 960  EPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILER 1019
            +    D   YS ++ + +   + +  + E  + +  K   +I  P  +  SG        
Sbjct: 2191 DTS--DAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVP--ESYSG-------- 2238

Query: 1020 GEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYT 1079
                   E+E +     +   + + ++    N K      +G   + ++++++ED+G Y+
Sbjct: 2239 -------ELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYS 2291

Query: 1080 AQLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLT 1139
              + DGK               K   K   K R     QG   +     KV E   VQL 
Sbjct: 2292 FVI-DGK---------------KTTCKLKMKPRPIAILQGLSDQ-----KVCEGDIVQLE 2330

Query: 1140 CKVTNTKKETRFQWFFQRAEMPDGQYDP-ETGTGLLCIEELSKKDKGIYRAMVSDDRGED 1198
             KV+    E  +    Q  +  D  +   +  + +L IE+++K+D G Y           
Sbjct: 2331 VKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNY----------- 2379

Query: 1199 DTILDLTGDALDAIFTELGRIGALSA---TPLKIQGTEEGIRIFSKVKYYNVEYMKTTWF 1255
                  T  AL    +  GR+   S    TPLK     EG +   + K    +     W+
Sbjct: 2380 ----SFTIPALG--LSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWY 2433

Query: 1256 HKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFED 1315
              D++++  DR++      +  L I     SD+G Y L +                    
Sbjct: 2434 LNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVG------------------- 2474

Query: 1316 AMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPV 1375
                  R++T   +   + K++RGL D+ T  E + +     +S     ++ W   D+ +
Sbjct: 2475 ------RVETNCNLSVEKIKIIRGLRDL-TCTETQNVVFEVELSHSGI-DVLWNFKDKEI 2526

Query: 1376 TFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTIS 1423
                +Y++E  G    +T+  +  +D G+Y  +      S  G++T++
Sbjct: 2527 KPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTS--GKLTVA 2572



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 113/506 (22%), Positives = 194/506 (38%), Gaps = 78/506 (15%)

Query: 957  ILKEPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIK--LISGW-N 1013
            + KE G+   GT     T  +E     H   E ++ +  ++   +  PV    L+SG  N
Sbjct: 852  VKKEVGVSITGT-----TVREERFEVLHG-REAKVTETARVPAPVEIPVTPPTLVSGLKN 905

Query: 1014 IDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEE 1073
            + ++E   V L   +    P+  +     + +I SS + +I F  + G+  ++I+    E
Sbjct: 906  VTVIEGESVTLECHISGY-PSPTVTWYREDYQIESSIDFQITF--QSGIARLMIREAFAE 962

Query: 1074 DKGSYTAQL--QDGKAKNQITLTL-VDDDFDK---------------LLRKADAKRRDWK 1115
            D G +T     + G       L + V ++F+K                +   D    D  
Sbjct: 963  DSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTS 1022

Query: 1116 RKQ---------GPYF-ERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDG-- 1163
              +          PYF  +P+  K+ E   V   C+V    K   + W      +  G  
Sbjct: 1023 LTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVY-WKKSGVPLTTGYR 1081

Query: 1164 ---QYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGR-- 1218
                Y+ +TG   L I      D G Y  +V +  GE      L  +A   +  +  +  
Sbjct: 1082 YKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEM 1141

Query: 1219 -----IGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTL 1273
                 + A    P K+  T  G  ++S+   Y  EY K     + K  +  D +   T +
Sbjct: 1142 LYQTQVTAFVQEP-KVGETAPGF-VYSE---YEKEYEKEQALIRKKMAK--DTVVVRTYV 1194

Query: 1274 DEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNR 1333
            ++   HI     S + +   EI    E R + T L     E+ + E    K    I ++ 
Sbjct: 1195 EDQEFHI----SSFEERLIKEI----EYRIIKTTL-----EELLEEDGEEKMAVDISESE 1241

Query: 1334 AKVVRGLPDVAT---IMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRME-VRGTE 1389
            A V  G         I+E   +   C +SG P P+I+W K+ + +   +RY+M+ ++   
Sbjct: 1242 A-VESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGR 1300

Query: 1390 VTITIEKVNSEDSGRYGVFVKNKYGS 1415
             ++ I  V  ED G Y  F  N  G+
Sbjct: 1301 ASLRIPVVLPEDEGIYTAFASNIKGN 1326



 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 72/310 (23%), Positives = 126/310 (40%), Gaps = 25/310 (8%)

Query: 61   SAADYALAAALALTASSELSWEAQLRRQTSAVELEERGQKRVGFGNDWERTEIAFLQTHR 120
            SA +   AA L +T  +  S   +   Q   +E++E       F + +   E   L +  
Sbjct: 3498 SAGEATCAATLTVTPKAPESILHERIEQEIEMEMKE-------FSSSFLSAEEEGLHSAE 3550

Query: 121  LLRQRRDWKTLRRRTEEKVQEAKELRELCYGRGPWFWIPLRSHAVWEHTTVLLTCTVQAS 180
            L   + + +TL   +E  V   K   E   G GP F   + +  +       L+ TV   
Sbjct: 3551 LQLSKIN-ETLELLSESPVYPTKFDSEK-EGTGPIFIKEVSNADISMGDVATLSVTVIGI 3608

Query: 181  PPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQ-- 238
            P P++ W+ N   + P    +  Y+   +    SL I    +ED   YT    N +G+  
Sbjct: 3609 PKPKIQWFFNGVLLTP----SADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTI 3664

Query: 239  ASSFAKVLVRTYLGKDAGFDSEIFK--RSTFGP-SVEFTSVLKPVFAREKEPFSLSCLFS 295
             S++ K+  +    KD   +S + K      GP    F   LKP+   +     L  +F 
Sbjct: 3665 CSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQ----GLPAIFE 3720

Query: 296  EDVL--DAESIQWFRDGSLLRSSRRRKILYT-DRQASLKVSCTYKEDEGLYMVRVPSPFG 352
              V+   A ++ WF++   L +S    I++  +   +  V+   +ED GLY+ +  +  G
Sbjct: 3721 YTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLG 3780

Query: 353  PREQSTYVLV 362
                +  +LV
Sbjct: 3781 ESTCAAELLV 3790



 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 92/519 (17%), Positives = 189/519 (36%), Gaps = 100/519 (19%)

Query: 917  LAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTD- 975
            + F      + ++ +W ++ +   D  +  I  K     + +++  L+D   Y+V +T+ 
Sbjct: 6285 VVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNH 6344

Query: 976  -ADEDISASHTLTEEE----LEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEK 1030
              +   SA++ + EEE    +E LK                 +I+ +E+  V  W +V +
Sbjct: 6345 RGENVKSAANLIVEEEDLRIVEPLK-----------------DIETMEKKSVTFWCKVNR 6387

Query: 1031 LSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQ 1090
            L+    L    N +E+          D+ K ++   I++    D+G Y       K+  +
Sbjct: 6388 LN--VTLKWTKNGEEVPFDNRVSYRVDKYKHMLT--IKDCGFPDEGEYIVTAGQDKSVAE 6443

Query: 1091 ITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETR 1150
            + +     +F + L                         VTE      +C+++  K   +
Sbjct: 6444 LLIIEAPTEFVEHLEDQT---------------------VTEFDDAVFSCQLSREKANVK 6482

Query: 1151 FQWFFQRAEMPDGQYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDT-----ILDLT 1205
              W+    E+ +G+            +   +KD  I+R ++ D R +D+      + D  
Sbjct: 6483 --WYRNGREIKEGK------------KYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRK 6528

Query: 1206 GDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGD 1265
              A   +F E   +  +      ++     +   +++   N + ++  W   +  +  GD
Sbjct: 6529 SRA--RLFVEEIPVEIIRPPQDILEAPGADVVFLAEL---NKDKVEVQWLRNNMVVVQGD 6583

Query: 1266 RIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKT 1325
            + +  +      L I D K  D+G+Y   IA  KE R                       
Sbjct: 6584 KHQMMSEGKIHRLQICDIKPRDQGEYRF-IAKDKEAR----------------------- 6619

Query: 1326 LAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEV 1385
             A +E   A  ++       +   K L +       P  E  W K ++P   L    ++ 
Sbjct: 6620 -AKLELAAAPKIKTADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEP---LSTKTIDT 6675

Query: 1386 RGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISV 1424
               + +  I +    D GRY + ++NK+G   G + + V
Sbjct: 6676 TAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKV 6714



 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 52/195 (26%), Positives = 80/195 (41%), Gaps = 36/195 (18%)

Query: 160  LRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRR 219
            ++S  V + +       V   P P+  WYKN  +I+ R  R   Y   +N  +  L IR 
Sbjct: 2038 IQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIE-RSDRIYWYWPEDN--VCELVIRD 2094

Query: 220  CAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKP 279
               EDSA+  V+  N  G+ SS A +LV+                      + FT  L+ 
Sbjct: 2095 VTAEDSASIMVKAINIAGETSSHAFLLVQA------------------KQLITFTQELQD 2136

Query: 280  VFAREKEPF-SLSCLFSEDVLDAESIQWFRDGS--------LLRSSRR---RKILYTDRQ 327
            V A+EK+   +  C  SE  +    ++W++DG          + S R+     IL  D  
Sbjct: 2137 VVAKEKDTMATFECETSEPFV---KVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTS 2193

Query: 328  ASLKVSCTYKEDEGL 342
             +   SC   EDE +
Sbjct: 2194 DAEDYSCVLVEDENV 2208



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 24/96 (25%), Positives = 45/96 (46%)

Query: 1340  LPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNS 1399
             +  + T+     +CL   V G P P +SW K+   +   +  +M ++    T+ +  VN 
Sbjct: 12929 MKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNR 12988

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
             +DSG Y +  +N  GS++  + + V      P  +K
Sbjct: 12989 KDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVK 13024



 Score = 48.5 bits (114), Expect = 5e-05
 Identities = 23/75 (30%), Positives = 38/75 (50%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             +SG P P I+W K+  P+    R  +       T++I++ + +D G+YG+ V N  G +T
Sbjct: 16881 ISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKT 16940

Query: 1418  GQVTISVFKHGDEPK 1432
               + I      D PK
Sbjct: 16941 ASIEIVTLDKPDPPK 16955



 Score = 48.1 bits (113), Expect = 6e-05
 Identities = 25/87 (28%), Positives = 43/87 (49%)

Query: 1345  TIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGR 1404
             +I   + L +   V G P P ISW+K+ +P+    R  +E   T   + I++ N +D G+
Sbjct: 17950 SIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGK 18009

Query: 1405  YGVFVKNKYGSETGQVTISVFKHGDEP 1431
             Y V   N  G+ T  +++ V +    P
Sbjct: 18010 YTVTATNSAGTATENLSVIVLEKPGPP 18036



 Score = 48.1 bits (113), Expect = 6e-05
 Identities = 50/180 (27%), Positives = 73/180 (40%), Gaps = 21/180 (11%)

Query: 124   QRRDWKTLRRRTEEKVQEAKELRELCYGRGPWFWIPLRSHAVWEHTTVLLTCTVQASPPP 183
             Q+    T+ R+TE K  E    +       P     L+   V   +           P P
Sbjct: 26457 QKTTESTVTRKTEPKAPEPISSK-------PVIVTGLQDTTVSSDSVAKFAVKATGEPRP 26509

Query: 184   QVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFA 243
                W K+   I     + GKY+++ + G   LEI +    DS  YT  VKN+ G  SS  
Sbjct: 26510 TAIWTKDGKAIT----QGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSC 26565

Query: 244   KVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVLDAES 303
             K+ ++      A  D+E  K ST   S E T   K V    +E  S   L SE++  +E+
Sbjct: 26566 KLTIK------AIKDTEAQKVSTQKTS-EITPQKKAVV---QEEISQKALRSEEIKMSEA 26615



 Score = 47.8 bits (112), Expect = 8e-05
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 2/96 (2%)

Query: 1340  LPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNS 1399
             L  +  I    +L L   + G PTPE+ W K D  +   D   ++V  +  ++ ++ VN 
Sbjct: 16576 LRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIR--DAAIIDVTSSFTSLVLDNVNR 16633

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
              DSG+Y + ++N  G+++  VT+ V      P  LK
Sbjct: 16634 YDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLK 16669



 Score = 47.8 bits (112), Expect = 8e-05
 Identities = 40/170 (23%), Positives = 78/170 (45%), Gaps = 16/170 (9%)

Query: 1257  KDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQA-FED 1315
             ++K  +   R+ T  T+      + D K   K  Y+  +AA         ++ G + + +
Sbjct: 23009 QEKDTDQWYRVHTNATIRNTEFTVPDLKMGQK--YSFRVAA--------VNVKGMSEYSE 23058

Query: 1316  AMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPV 1375
             ++AE + ++ + I +   A     L    TI    +L L   VSG P P I+W K  Q +
Sbjct: 23059 SIAEIEPVERIEIPDLELAD---DLKKTVTIRAGASLRLMVSVSGRPPPVITWSK--QGI 23113

Query: 1376  TFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVF 1425
                 R  ++   +   + ++KVN  D+G+Y +  +N+ G ++  V + V+
Sbjct: 23114 DLASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVY 23163



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 23/84 (27%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 1341 PDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEV--RGTEVTITIEKVN 1398
            P V  ++E  ++   C V G+P P + W K+  P+T   RY++    +  E  + I    
Sbjct: 1042 PVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTF 1101

Query: 1399 SEDSGRYGVFVKNKYGSETGQVTI 1422
            ++D+G Y + V+NK+G  +   ++
Sbjct: 1102 ADDAGEYTIVVRNKHGETSASASL 1125



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 55/232 (23%), Positives = 82/232 (35%), Gaps = 23/232 (9%)

Query: 159  PLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIR 218
            PL+     E       C V  +   +V+WY  D +I P  F    +R+T       LEI 
Sbjct: 3304 PLQDTVTSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRF----FRMTQFEDTYQLEIA 3358

Query: 219  RCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFD--------SEIFKRSTFGPS 270
                ED  TYT    NA GQ SS A + +  +   +            S  FK+   G  
Sbjct: 3359 EAYPEDEGTYTFVASNAVGQVSSTANLSLEGFSKFEENTSNSQWHVSLSVSFKKEPLGQK 3418

Query: 271  VEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDR--QA 328
              F   L  +     E        S   +    IQWF +  L+  ++     + +    A
Sbjct: 3419 PSFIQPLSSLRVHNGETVRFHARVSG--IPKPEIQWFHNQQLILPTKDVVFHFEESTGMA 3476

Query: 329  SLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVR 380
             + +   Y E  G Y  +  +  G    +  + V       P AP S L+ R
Sbjct: 3477 LMLIVDAYSEHAGQYSCKAANSAGEATCAATLTV------TPKAPESILHER 3522



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 30/96 (31%), Positives = 47/96 (48%), Gaps = 2/96 (2%)

Query: 1340  LPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNS 1399
             L  V TI    TL L   + G P PE+ W ++      LD+  +E   +   + +  VN 
Sbjct: 15494 LRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGES--LDKASIESTSSYTLLIVGNVNR 15551

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
              DSG+Y + V+N  GS++  V + V      P++LK
Sbjct: 15552 FDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLK 15587



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 40/167 (23%), Positives = 72/167 (43%), Gaps = 14/167 (8%)

Query: 177  VQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAH 236
            +   P P+++WYK +  +    F+         Y LL +E      ED+A YT   KN +
Sbjct: 3216 ISGRPQPKISWYKEEQLLSTG-FKCKFLHDGQEYTLLLIE---AFPEDAAVYTCEAKNDY 3271

Query: 237  GQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSE 296
            G A++ A + V   + +    D E+     + P++   + L+     E +P    C  S 
Sbjct: 3272 GVATTSASLSVE--VPEVVSPDQEM---PVYPPAI--ITPLQDTVTSEGQPARFQCRVSG 3324

Query: 297  DVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
              L    + W+     ++ SR  ++   +    L+++  Y EDEG Y
Sbjct: 3325 TDL---KVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTY 3368



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 49/227 (21%), Positives = 93/227 (40%), Gaps = 26/227 (11%)

Query: 1219  IGALSATPLKIQGTEEG-IRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIW 1277
             IG +S   +   G E G ++   K++ Y+ +  + TW+   ++LE+ ++           
Sbjct: 25195 IGPVSGQIMHAVGEEGGHVKYVCKIENYD-QSTQVTWYFGVRQLENSEKYEITYEDGVAI 25253

Query: 1278  LHILDPKDSDKGKYTLEIAAGKEVRQLSTDLS-GQAFEDAMAE-------------HQRL 1323
             L++ D    D G Y  ++     V     D S  + F   + E              +R 
Sbjct: 25254 LYVKDITKLDDGTYRCKV-----VNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRT 25308

Query: 1324  KTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLD---R 1380
              T+ ++E+     +      A + E+    +T  V   P P ++W K+ Q +   D   +
Sbjct: 25309 DTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVH--PEPHVTWYKSGQKIKPGDNDKK 25366

Query: 1381  YRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKH 1427
             Y  E       +TI  V ++D   Y V  +NKYG ++ +  ++V  H
Sbjct: 25367 YTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLH 25413



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 61/272 (22%), Positives = 99/272 (36%), Gaps = 55/272 (20%)

Query: 151  GRGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNY 210
            G+ P F  PL S  V    TV     V   P P++ W+ N   I P   +   +    + 
Sbjct: 3416 GQKPSFIQPLSSLRVHNGETVRFHARVSGIPKPEIQWFHNQQLILPT--KDVVFHFEEST 3473

Query: 211  GLLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLV----------------------- 247
            G+  + I     E +  Y+ +  N+ G+A+  A + V                       
Sbjct: 3474 GMALMLIVDAYSEHAGQYSCKAANSAGEATCAATLTVTPKAPESILHERIEQEIEMEMKE 3533

Query: 248  --RTYL-GKDAGFDSEIFKRSTFGPSVEFTS---VLKPVFAREKE---PFSLSCLFSEDV 298
               ++L  ++ G  S   + S    ++E  S   V    F  EKE   P  +  + + D+
Sbjct: 3534 FSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYPTKFDSEKEGTGPIFIKEVSNADI 3593

Query: 299  --------------LDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYM 344
                          +    IQWF +G LL  S   K ++     SL +  T  EDEG Y 
Sbjct: 3594 SMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYT 3653

Query: 345  VRVPSPFGPREQSTYVLV-------RDAEAEN 369
                + +G    S Y+ +       +D E E+
Sbjct: 3654 CMASNDYGKTICSAYLKINSKGEGHKDTETES 3685



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 2/85 (2%)

Query: 1351  TLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVK 1410
             TL L+ I+ G P P+++W K D+      + R++V      + I     ED G Y + V+
Sbjct: 10863 TLRLSAIIKGVPFPKVTWKKEDRDAP--TKARIDVTPVGSKLEIRNAAHEDGGIYSLTVE 10920

Query: 1411  NKYGSETGQVTISVFKHGDEPKELK 1435
             N  GS+T  V + V      P++L+
Sbjct: 10921 NPAGSKTVSVKVLVLDKPGPPRDLE 10945



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 34/149 (22%), Positives = 68/149 (45%), Gaps = 7/149 (4%)

Query: 1282 DPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFE------DAMAEHQRLKTLAIIEKNRAK 1335
            D  D+ K +  +E+     V    T +  + FE        + E  R+     I      
Sbjct: 839  DTPDTYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPT 898

Query: 1336 VVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIE 1395
            +V GL +V T++E +++ L C +SG P+P ++W + D  +     +++  +     + I 
Sbjct: 899  LVSGLKNV-TVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIR 957

Query: 1396 KVNSEDSGRYGVFVKNKYGSETGQVTISV 1424
            +  +EDSGR+     N+ G+ +    ++V
Sbjct: 958  EAFAEDSGRFTCSAVNEAGTVSTSCYLAV 986



 Score = 45.1 bits (105), Expect = 5e-04
 Identities = 46/183 (25%), Positives = 68/183 (37%), Gaps = 31/183 (16%)

Query: 165  VWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIED 224
            V E  T+ L C V + P  +V WYK D  I       G+Y I        L I+   +ED
Sbjct: 6102 VSETDTIKLVCEV-SKPGAEVIWYKGDEEI----IETGRYEILTEGRKRILVIQNAHLED 6156

Query: 225  SATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFARE 284
            +  Y  R+ ++          L   ++ K      EI +    G   EF      V +  
Sbjct: 6157 AGNYNCRLPSSRTDGKVKVHELAAEFISKPQNL--EILE----GEKAEF------VCSIS 6204

Query: 285  KEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYM 344
            KE F               +QW RD   L S  +  ++   ++  L V     +D G Y+
Sbjct: 6205 KESFP--------------VQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYV 6250

Query: 345  VRV 347
            V V
Sbjct: 6251 VMV 6253



 Score = 44.7 bits (104), Expect = 7e-04
 Identities = 33/149 (22%), Positives = 67/149 (44%), Gaps = 7/149 (4%)

Query: 1279  HILDPKDSDKGKYTL-EIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVV 1337
             H ++ +   K +YT+ ++ AG+E +   + ++G    D+      +K +  +      + 
Sbjct: 21929 HKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDID 21988

Query: 1338  RGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEV--TITIE 1395
                     +    ++ L     G PTP   W K D  ++     R ++  T+   T+T+E
Sbjct: 21989 ANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSL----RADIHTTDSFSTLTVE 22044

Query: 1396  KVNSEDSGRYGVFVKNKYGSETGQVTISV 1424
               N  D+G+Y + V+N  GS++   T+ V
Sbjct: 22045 NCNRNDAGKYTLTVENNSGSKSITFTVKV 22073



 Score = 44.3 bits (103), Expect = 9e-04
 Identities = 48/237 (20%), Positives = 85/237 (35%), Gaps = 51/237 (21%)

Query: 161   RSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRC 220
             RS  V+E  +   +C     P P VTW +    +      + ++++T      + EI   
Sbjct: 26196 RSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLST----SARHQVTTTKYKSTFEISSV 26251

Query: 221   AIEDSATYTVRVKNAHG-QASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLK- 278
                D   Y+V V+N+ G Q + F   + +  + + A       K     P V+    +K 
Sbjct: 26252 QASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPE--PRVKSPEAVKS 26309

Query: 279   -------------------------------PVFA-----------REKEPFSLSCLFSE 296
                                            PV A             KE   L+C+   
Sbjct: 26310 PKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVVES 26369

Query: 297   DVLDAESIQWFRDGSLLRSSRRRKILYT-DRQASLKVSCTYKEDEGLYMVRVPSPFG 352
              VL A+ + W++DG  L+ +   +  Y+ D    LK++   + D+G Y+  +    G
Sbjct: 26370 SVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGG 26426



 Score = 43.5 bits (101), Expect = 0.001
 Identities = 45/185 (24%), Positives = 74/185 (40%), Gaps = 19/185 (10%)

Query: 1251 KTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKD-SDKGKYTLEIAAGKEVRQLSTDLS 1309
            +T WFH  +++ +    +     D     I+ P   SD G++T+          +S  L+
Sbjct: 1441 ETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILT 1500

Query: 1310 GQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWL 1369
             +A      EHQ         KN             I E   L +    +G+P P+I WL
Sbjct: 1501 VEA-----VEHQVKPMFVEKLKN-----------VNIKEGSRLEMKVRATGNPNPDIVWL 1544

Query: 1370 KNDQPVTFLDRYRMEVRGT--EVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKH 1427
            KN   +      ++ + GT  E  + I+   S+DS  Y     NK G +T +  ++V   
Sbjct: 1545 KNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVE 1604

Query: 1428 GDEPK 1432
              EP+
Sbjct: 1605 FAEPE 1609



 Score = 42.7 bits (99), Expect = 0.002
 Identities = 69/301 (22%), Positives = 125/301 (41%), Gaps = 49/301 (16%)

Query: 1120 PYFERPLQWKVT-EDCQVQLTCKVTNTKKETRFQWFFQRAEM-PDGQYDPETG--TGLLC 1175
            PYF   L  K   E  ++ L C+V+   K+   +WF    E+ P  +Y  +      +L 
Sbjct: 5291 PYFTVKLHDKTAVEKDEITLKCEVS---KDVPVKWFKDGEEIVPSPKYSIKADGLRRILK 5347

Query: 1176 IEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEG 1235
            I++   KDKG Y      D G D T  ++T                + A  +K++    G
Sbjct: 5348 IKKADLKDKGEYVC----DCGTDKTKANVT----------------VEARLIKVEKPLYG 5387

Query: 1236 IRIF-SKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLE 1294
            + +F  +  ++ +E  +    H   +L+ G  +      + I          + GK  + 
Sbjct: 5388 VEVFVGETAHFEIELSEPD-VHGQWKLK-GQPLTASPDCEII----------EDGKKHIL 5435

Query: 1295 IAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCL 1354
            I    ++  ++ ++S QA     A + ++K L +I       +  L DV    +D+    
Sbjct: 5436 ILHNCQLG-MTGEVSFQAANAKSAANLKVKELPLI------FITPLSDVKVFEKDEAK-F 5487

Query: 1355 TCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYG 1414
             C VS +P     WLK  Q +T  DR+ +   GT+ ++ I+    ED  +Y    ++K+ 
Sbjct: 5488 ECEVSREPKT-FRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHT 5546

Query: 1415 S 1415
            S
Sbjct: 5547 S 5547



 Score = 42.7 bits (99), Expect = 0.002
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 2/75 (2%)

Query: 1360  GDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQ 1419
             G PTPEI+W + +    F D+ ++E       ++I+  +  D+G+Y + ++N  GS++  
Sbjct: 17678 GRPTPEITWSREEGE--FTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAF 17735

Query: 1420  VTISVFKHGDEPKEL 1434
             VT+ V      P+ L
Sbjct: 17736 VTVKVLDTPGPPQNL 17750



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 1/80 (1%)

Query: 1346 IMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRY 1405
            IM  KTL +  +V+G P P   W K +  +   DR  ++  GT+  + I+    +D GRY
Sbjct: 8744 IMAGKTLRIPAVVTGRPVPTKVWTKEEGELD-KDRVVIDNVGTKSELIIKDALRKDHGRY 8802

Query: 1406 GVFVKNKYGSETGQVTISVF 1425
             +   N  GS+     + VF
Sbjct: 8803 VITATNSCGSKFAAARVEVF 8822



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 8/104 (7%)

Query: 1337 VRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKND----QPVTFLDRYRMEVRGTEVT- 1391
            VRG  D   +   + + +   V+G P P+I W KN+    +P   L   + EV  +E   
Sbjct: 9031 VRG--DTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKT 9088

Query: 1392 -ITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKEL 1434
             ++I K   ED G Y V   N+ GS    V + V+     P+ L
Sbjct: 9089 ELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNL 9132



 Score = 42.0 bits (97), Expect = 0.004
 Identities = 23/93 (24%), Positives = 40/93 (43%)

Query: 1340  LPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNS 1399
             +P+  TI   K L +   V G P P   W K +  V       +    +   + I+ V  
Sbjct: 12532 MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTR 12591

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPK 1432
             +DSG Y +  +N  G++T ++ + V      P+
Sbjct: 12592 KDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQ 12624



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 32/189 (16%)

Query: 156  FWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSL 215
            F  PL    V E  T    C + +     V W+KND +    L  +    I++      L
Sbjct: 5204 FMSPLEDQTVKEGETATFVCEL-SHEKMHVVWFKNDAK----LHTSRTVLISSEGKTHKL 5258

Query: 216  EIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTS 275
            E++   ++D +    +VK    + SS A++ V          +++ +          FT 
Sbjct: 5259 EMKEVTLDDISQIKAQVK----ELSSTAQLKV---------LEADPY----------FTV 5295

Query: 276  VLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCT 335
             L    A EK+  +L C  S+DV     ++WF+DG  +  S +  I     +  LK+   
Sbjct: 5296 KLHDKTAVEKDEITLKCEVSKDV----PVKWFKDGEEIVPSPKYSIKADGLRRILKIKKA 5351

Query: 336  YKEDEGLYM 344
              +D+G Y+
Sbjct: 5352 DLKDKGEYV 5360



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 23/91 (25%), Positives = 42/91 (46%)

Query: 1346 IMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRY 1405
            ++E + L +       P P +SW K+ + V   DR  M+       + + K    D+G Y
Sbjct: 8026 VIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIY 8085

Query: 1406 GVFVKNKYGSETGQVTISVFKHGDEPKELKS 1436
             + ++NK GS T  + + V       K++K+
Sbjct: 8086 TITLENKLGSATASINVKVIGLPGPCKDIKA 8116



 Score = 41.6 bits (96), Expect = 0.006
 Identities = 20/67 (29%), Positives = 35/67 (52%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             +SG P P+++W   +  +   DR  +       T+T++     DSGRY + ++N  G +T
Sbjct: 22299 ISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKT 22358

Query: 1418  GQVTISV 1424
               VT+ V
Sbjct: 22359 FSVTVVV 22365



 Score = 41.2 bits (95), Expect = 0.007
 Identities = 94/487 (19%), Positives = 174/487 (35%), Gaps = 91/487 (18%)

Query: 925  PDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASH 984
            PD +  +W  + +      RV+   K  K ++++      D G Y +IV   + + + S 
Sbjct: 2425 PDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLS- 2483

Query: 985  TLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNK 1044
                  +EK            IK+I G   D+       +  EVE      ++   F +K
Sbjct: 2484 ------VEK------------IKIIRGLR-DLTCTETQNVVFEVELSHSGIDVLWNFKDK 2524

Query: 1045 EIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLL 1104
            EI   P+ K   +    + ++ + N+ ++D+G YT    +     ++T+           
Sbjct: 2525 EI--KPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVA---------- 2572

Query: 1105 RKADAKRRDWKRKQGPYFERPL-QWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDG 1163
                          G    +PL    V E  +    C+V N   +++ +W      + DG
Sbjct: 2573 --------------GGAISKPLTDQTVAESQEAVFECEVANP--DSKGEW------LRDG 2610

Query: 1164 QYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALS 1223
            ++ P T    +  E    K + I  A   DD GE  T    T      +  E  +I    
Sbjct: 2611 KHLPLTNN--IRSESDGHKRRLIIAATKLDDIGEY-TYKVATSKTSAKLKVEAVKI---K 2664

Query: 1224 ATPLKIQGTEEGIRIFS-KVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILD 1282
             T   +  TE    +F+ ++ + NV+ ++  W      LES ++           L I +
Sbjct: 2665 KTLKNLTVTETQDAVFTVELTHPNVKGVQ--WIKNGVVLESNEKYAISVKGTIYSLRIKN 2722

Query: 1283 PKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPD 1342
                D+  Y   +                          RL   A +     K+++   D
Sbjct: 2723 CAIVDESVYGFRLG-------------------------RLGASARLHVETVKIIKKPKD 2757

Query: 1343 VATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDS 1402
            V T +E+ T+     VS D  P + W      +   D++R+        + ++ ++  D+
Sbjct: 2758 V-TALENATVAFEVSVSHDTVP-VKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDA 2815

Query: 1403 GRYGVFV 1409
            G Y   V
Sbjct: 2816 GEYTAVV 2822



 Score = 41.2 bits (95), Expect = 0.007
 Identities = 20/77 (25%), Positives = 37/77 (48%)

Query: 1359 SGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETG 1418
            +G P P  +W   D+ +   DR +M+       + I      D G Y + ++N+  + +G
Sbjct: 7047 TGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISG 7106

Query: 1419 QVTISVFKHGDEPKELK 1435
            ++ ++V      PKELK
Sbjct: 7107 EIDVNVIARPSAPKELK 7123



 Score = 40.0 bits (92), Expect = 0.016
 Identities = 26/100 (26%), Positives = 46/100 (46%), Gaps = 2/100 (2%)

Query: 1330 EKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTE 1389
            EK +  +V   P+   ++E +T    C V+G P P+++W  N Q +    R+R+   G  
Sbjct: 1791 EKQKPDIVL-YPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIH 1849

Query: 1390 VTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGD 1429
              + I    S D+G   V  +N  G    +V + + +  D
Sbjct: 1850 Y-LDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQRED 1888



 Score = 40.0 bits (92), Expect = 0.016
 Identities = 84/420 (20%), Positives = 149/420 (35%), Gaps = 81/420 (19%)

Query: 1036 ELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTL 1095
            +L + + +K+    P+R     + +   ++ I     ED+G+YT    +   +   T  L
Sbjct: 3326 DLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANL 3385

Query: 1096 VDDDFDKLLRKADAKRRDW--------KRK---QGPYFERPLQ-WKVTEDCQVQLTCKVT 1143
              + F K   + +     W        K++   Q P F +PL   +V     V+   +V+
Sbjct: 3386 SLEGFSKF--EENTSNSQWHVSLSVSFKKEPLGQKPSFIQPLSSLRVHNGETVRFHARVS 3443

Query: 1144 NTKKETRFQWFF-QRAEMPDGQ----YDPETGTGLLCIEELSKKDKGIYRAMVSDDRGED 1198
               K    QWF  Q+  +P       ++  TG  L+ I +   +  G Y    ++  GE 
Sbjct: 3444 GIPKP-EIQWFHNQQLILPTKDVVFHFEESTGMALMLIVDAYSEHAGQYSCKAANSAGEA 3502

Query: 1199 D--TILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFH 1256
                 L +T  A ++I  E                     RI  +++    E+  +    
Sbjct: 3503 TCAATLTVTPKAPESILHE---------------------RIEQEIEMEMKEFSSSFLSA 3541

Query: 1257 KDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDA 1316
            +++ L S +                      K   TLE+ +   V     D         
Sbjct: 3542 EEEGLHSAEL------------------QLSKINETLELLSESPVYPTKFD--------- 3574

Query: 1317 MAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVT 1376
             +E +    + I E + A +  G  DVAT        L+  V G P P+I W  N   +T
Sbjct: 3575 -SEKEGTGPIFIKEVSNADISMG--DVAT--------LSVTVIGIPKPKIQWFFNGVLLT 3623

Query: 1377 FLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELKS 1436
                Y+    G + ++ I     ED G Y     N YG       + +   G+  K+ ++
Sbjct: 3624 PSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTET 3683



 Score = 40.0 bits (92), Expect = 0.016
 Identities = 36/161 (22%), Positives = 68/161 (42%), Gaps = 22/161 (13%)

Query: 1252 TTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQ 1311
            TTW      +    + R      +  LHI+D + SD G+YT  +  G + +  +  L   
Sbjct: 4777 TTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKL--- 4833

Query: 1312 AFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKN 1371
                            ++E+   + V+ L +  T+++ + L L+C ++ +   ++ W K+
Sbjct: 4834 ----------------VVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKE--RDVVWRKD 4875

Query: 1372 DQPVTFL-DRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKN 1411
             + V     R    V G    +TI   +  D+G Y V V+N
Sbjct: 4876 GKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVEN 4916



 Score = 40.0 bits (92), Expect = 0.016
 Identities = 97/527 (18%), Positives = 193/527 (36%), Gaps = 94/527 (17%)

Query: 920  EAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADED 979
            E   + ++++ +W K+    L  ++ +I       K+++ +   ED+ TY+    D    
Sbjct: 5933 ECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKT- 5991

Query: 980  ISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHL 1039
             S +  +    +E L+ L+              ++ + E+   R   E+ + +  A++  
Sbjct: 5992 -SCNLNVVPPHVEFLRPLT--------------DLQVREKEMARFECELSREN--AKVKW 6034

Query: 1040 IFNNKEIFSSPNRKINFDREKGLVEVIIQNLSE-EDKGSYTAQLQDGKAKNQITLTLVDD 1098
              +  EI       I     KG V +++ N    +D+  Y+ +++  +    +T+   + 
Sbjct: 6035 FKDGAEIKKGKKYDII---SKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEEA 6091

Query: 1099 DFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRA 1158
             F K L   +                     V+E   ++L C+V+    E    W+    
Sbjct: 6092 VFTKNLANIE---------------------VSETDTIKLVCEVSKPGAEVI--WYKGDE 6128

Query: 1159 EMPD-GQYD--PETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTE 1215
            E+ + G+Y+   E    +L I+    +D G Y   +   R +    +            E
Sbjct: 6129 EIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVH-----------E 6177

Query: 1216 LGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDE 1275
            L          L+I   E+   + S  K    E     W   DK LESGD+        +
Sbjct: 6178 LAAEFISKPQNLEILEGEKAEFVCSISK----ESFPVQWKRDDKTLESGDKYDVIADGKK 6233

Query: 1276 IWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAK 1335
              L + D    D G Y + + A +    L+                      +IEK R  
Sbjct: 6234 RVLVVKDATLQDMGTYVVMVGAARAAAHLT----------------------VIEKLR-- 6269

Query: 1336 VVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIE 1395
            +V  L D   + E + +   C V+ +   +  W +N++ +    +Y +  +    T+ I 
Sbjct: 6270 IVVPLKDTR-VKEQQEVVFNCEVNTEGA-KAKWFRNEEAIFDSSKYIILQKDLVYTLRIR 6327

Query: 1396 KVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGD----EP-KELKSM 1437
              + +D   Y V + N  G         + +  D    EP K++++M
Sbjct: 6328 DAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETM 6374



 Score = 39.7 bits (91), Expect = 0.021
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 2/81 (2%)

Query: 1346 IMEDKTLCLTCIVSGDPTPEISWLKNDQPV--TFLDRYRMEVRGTEVTITIEKVNSEDSG 1403
            ++E  T      +SG P PE+SW ++ Q +  + L   ++        +TI  V   +SG
Sbjct: 17   VLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSG 76

Query: 1404 RYGVFVKNKYGSETGQVTISV 1424
            RY +   N  G  T    + V
Sbjct: 77   RYSLKATNGSGQATSTAELLV 97



 Score = 39.7 bits (91), Expect = 0.021
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 4/74 (5%)

Query: 174  TCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVK 233
            TC +Q++P  +  W+K    I    + + K  I ++  + SLEI R  + D   YT +  
Sbjct: 4482 TCEIQSAPNVRFQWFKAGREI----YESDKCSIRSSKYISSLEILRTQVVDCGEYTCKAS 4537

Query: 234  NAHGQASSFAKVLV 247
            N +G  S  A + V
Sbjct: 4538 NEYGSVSCTATLTV 4551



 Score = 39.7 bits (91), Expect = 0.021
 Identities = 80/412 (19%), Positives = 157/412 (38%), Gaps = 69/412 (16%)

Query: 1001 IRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREK 1060
            ++ P ++         +E G   + LE E     A++    N  EI  S   +I  D   
Sbjct: 5908 VKEPPVEFTKPLEDQTVEEGATAV-LECEVSRENAKVKWFKNGTEILKSKKYEIVADGR- 5965

Query: 1061 GLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGP 1120
             + +++I + + ED  +YT   +D K    + +     +F + L     + ++  R    
Sbjct: 5966 -VRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMAR---- 6020

Query: 1121 YFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQ-YD--PETGTGLLCIE 1177
             FE          C++        +++  + +WF   AE+  G+ YD   +    +L I 
Sbjct: 6021 -FE----------CEL--------SRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVIN 6061

Query: 1178 ELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIR 1237
            +    D+  Y   V   R    T   LT    +A+FT+       +   +++  T+  I+
Sbjct: 6062 KCLLDDEAEYSCEVRTAR----TSGMLTVLEEEAVFTK-------NLANIEVSETDT-IK 6109

Query: 1238 IFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAA 1297
            +  +V     E +   W+  D+ +    R    T   +  L I +    D G Y   + +
Sbjct: 6110 LVCEVSKPGAEVI---WYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPS 6166

Query: 1298 GKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCI 1357
             +      TD   +  E A     + + L I+E  +A+ V                  C 
Sbjct: 6167 SR------TDGKVKVHELAAEFISKPQNLEILEGEKAEFV------------------CS 6202

Query: 1358 VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFV 1409
            +S +  P + W ++D+ +   D+Y +   G +  + ++    +D G Y V V
Sbjct: 6203 ISKESFP-VQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMV 6253



 Score = 39.7 bits (91), Expect = 0.021
 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 1/86 (1%)

Query: 1340  LPDVATIMEDKTLCLTCI-VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVN 1398
             + D  TI    T+ L  I + G P P+ SW K  + +   D  ++    T   +TI+   
Sbjct: 14012 IKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYAT 14071

Query: 1399  SEDSGRYGVFVKNKYGSETGQVTISV 1424
              +D+G Y +   N +G++   V ++V
Sbjct: 14072 RKDAGEYTITATNPFGTKVEHVKVTV 14097



 Score = 39.7 bits (91), Expect = 0.021
 Identities = 21/67 (31%), Positives = 29/67 (43%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             V G P P ++W K DQ +    R   E   T   + I +    DSG Y +  +N  G   
Sbjct: 14717 VLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEVG 14776

Query: 1418  GQVTISV 1424
               +TI V
Sbjct: 14777 DVITIQV 14783



 Score = 39.7 bits (91), Expect = 0.021
 Identities = 20/73 (27%), Positives = 33/73 (45%)

Query: 1360  GDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQ 1419
             G P P ISWLK+  P+   +  R      ++T++I+    E  G+Y V + N        
Sbjct: 21217 GKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVP 21276

Query: 1420  VTISVFKHGDEPK 1432
             +T+       +PK
Sbjct: 21277 ITVITLGPPSKPK 21289



 Score = 39.3 bits (90), Expect = 0.028
 Identities = 62/309 (20%), Positives = 114/309 (36%), Gaps = 40/309 (12%)

Query: 1117 KQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDG---QYDPETGTGL 1173
            KQ   F + LQ  V ++     T +   ++   + +W+    E+ +G   +   +     
Sbjct: 2125 KQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHF 2184

Query: 1174 LCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTE 1233
            L I  +   D   Y  ++ +D     T   +   A+     EL  I      P    G  
Sbjct: 2185 LSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDI----EVPESYSGEL 2240

Query: 1234 EGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTL 1293
            E I         + E ++  W+H D  L+S  +    +      L + D    D+G+Y+ 
Sbjct: 2241 ECI--------VSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSF 2292

Query: 1294 EIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLC 1353
             I   K   +L                 + + +AI++        GL D   + E   + 
Sbjct: 2293 VIDGKKTTCKLK---------------MKPRPIAILQ--------GLSD-QKVCEGDIVQ 2328

Query: 1354 LTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKY 1413
            L   VS +    + W+K+ Q V   DR  + +      + IE +  ED+G Y   +    
Sbjct: 2329 LEVKVSLESVEGV-WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALG 2387

Query: 1414 GSETGQVTI 1422
             S +G+V++
Sbjct: 2388 LSTSGRVSV 2396



 Score = 39.3 bits (90), Expect = 0.028
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTE--VTITIEKVNSEDSGRYGVFVKNKYGS 1415
             + G P P I W+K DQ ++  +  R+E++ T+   +++++     DSG Y +  KN  G 
Sbjct: 16195 IYGKPIPTIQWIKGDQELS--NTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGE 16252

Query: 1416  ETGQVTISVFKHGDEPK 1432
              +  V + V      P+
Sbjct: 16253 RSVTVNVKVLDRPGPPE 16269



 Score = 39.3 bits (90), Expect = 0.028
 Identities = 21/76 (27%), Positives = 36/76 (47%)

Query: 1360  GDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQ 1419
             G P   ++W K+ Q +    R  +    T  +++I++ + ED G Y + V N  GS T  
Sbjct: 19048 GRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVP 19107

Query: 1420  VTISVFKHGDEPKELK 1435
             +TI V      P  ++
Sbjct: 19108 ITIIVLDRPGPPGPIR 19123



 Score = 38.9 bits (89), Expect = 0.036
 Identities = 96/487 (19%), Positives = 172/487 (35%), Gaps = 99/487 (20%)

Query: 964  EDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLIS------GWNIDIL 1017
            ED GTY+ + ++A   +S++  L+ E   K ++ +   +  V   +S      G     +
Sbjct: 3363 EDEGTYTFVASNAVGQVSSTANLSLEGFSKFEENTSNSQWHVSLSVSFKKEPLGQKPSFI 3422

Query: 1018 E--------RGE-VRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQ 1068
            +         GE VR    V  + P  E+    N + I  + +   +F+   G+  ++I 
Sbjct: 3423 QPLSSLRVHNGETVRFHARVSGI-PKPEIQWFHNQQLILPTKDVVFHFEESTGMALMLIV 3481

Query: 1069 NLSEEDKGSYTAQLQD--GKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFERPL 1126
            +   E  G Y+ +  +  G+A    TLT+     + +L +   +  + + K+        
Sbjct: 3482 DAYSEHAGQYSCKAANSAGEATCAATLTVTPKAPESILHERIEQEIEMEMKEFSSSFLSA 3541

Query: 1127 QWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQYDPET-GTGLLCIEELSKKDKG 1185
            + +     ++QL+ K+  T +          + +   ++D E  GTG + I+E+S  D  
Sbjct: 3542 EEEGLHSAELQLS-KINETLE------LLSESPVYPTKFDSEKEGTGPIFIKEVSNAD-- 3592

Query: 1186 IYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYY 1245
                                          +G +  LS T + I                
Sbjct: 3593 ----------------------------ISMGDVATLSVTVIGIPKP------------- 3611

Query: 1246 NVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAA--GKEV-- 1301
                 K  WF     L      +     D+  L IL  K  D+G+YT   +   GK +  
Sbjct: 3612 -----KIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICS 3666

Query: 1302 RQLSTDLSGQAFEDAMAEHQRLKTLAII----------EKNRAKVVRGLPDVATIMEDKT 1351
              L  +  G+  +D   E    K+L  +          E    +  +GLP +        
Sbjct: 3667 AYLKINSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAI-------- 3718

Query: 1352 LCLTCIVSGDPTPEISWLK-NDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVK 1410
                  V G+P P ++W K N Q  T +    +       T  +     EDSG Y    +
Sbjct: 3719 --FEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAE 3776

Query: 1411 NKYGSET 1417
            N  G  T
Sbjct: 3777 NMLGEST 3783



 Score = 38.9 bits (89), Expect = 0.036
 Identities = 18/74 (24%), Positives = 36/74 (48%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             +SG P P+++  ++  P+    R+  E+    +TI +++  + D+GRY +   N  G+  
Sbjct: 20128 ISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTK 20187

Query: 1418  GQVTISVFKHGDEP 1431
               + I V      P
Sbjct: 20188 AFINIVVLDRPGPP 20201



 Score = 38.9 bits (89), Expect = 0.036
 Identities = 46/199 (23%), Positives = 79/199 (39%), Gaps = 36/199 (18%)

Query: 184   QVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFA 243
             QVTWY    +++     + KY IT   G+  L ++     D  TY  +V N +G+ SS+A
Sbjct: 25227 QVTWYFGVRQLE----NSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYA 25282

Query: 244   KVLVRTYLGKDAGFD------SEIFKRST-----FGPSVEFTSVL--KPVFAREKEPFSL 290
             ++ V+   G    +D       +  KR T          EFT  L  K  +  E   F +
Sbjct: 25283 ELFVK---GVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGV 25339

Query: 291   SCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSP 350
             +      V     + W++ G  ++     K              T++ D+GLY + + S 
Sbjct: 25340 TI----TVHPEPHVTWYKSGQKIKPGDNDK------------KYTFESDKGLYQLTINSV 25383

Query: 351   FGPREQSTYVLVRDAEAEN 369
                 +    V+ R+   E+
Sbjct: 25384 TTDDDAEYTVVARNKYGED 25402



 Score = 38.5 bits (88), Expect = 0.047
 Identities = 24/105 (22%), Positives = 39/105 (37%), Gaps = 8/105 (7%)

Query: 1339 GLPDVATIMEDKTLCLTCIVSGDPTPEISW--------LKNDQPVTFLDRYRMEVRGTEV 1390
            G  D         + +  ++ G PTP+ SW           D      +  ++E      
Sbjct: 9443 GAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSS 9502

Query: 1391 TITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
             I I +     +G+Y +  KNK G +T    + V      PK+LK
Sbjct: 9503 VIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLK 9547



 Score = 38.5 bits (88), Expect = 0.047
 Identities = 22/76 (28%), Positives = 40/76 (52%), Gaps = 4/76 (5%)

Query: 1351  TLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGT--EVTITIEKVNSEDSGRYGVF 1408
             T+ L   V G P P+I+W K +  V   DR  ++++ T  +  +  E VN  D+G+Y + 
Sbjct: 13338 TMRLYVPVKGRPPPKITWSKPN--VNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILT 13395

Query: 1409  VKNKYGSETGQVTISV 1424
             ++N  G +   + + V
Sbjct: 13396 LENSCGKKEYTIVVKV 13411



 Score = 38.5 bits (88), Expect = 0.047
 Identities = 18/61 (29%), Positives = 29/61 (47%)

Query: 1354  LTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKY 1413
             L+C + G P P+I W +  + +    +Y+M   G   T+T+     ED G Y     N+ 
Sbjct: 24180 LSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEV 24239

Query: 1414  G 1414
             G
Sbjct: 24240 G 24240



 Score = 38.1 bits (87), Expect = 0.061
 Identities = 45/220 (20%), Positives = 86/220 (39%), Gaps = 28/220 (12%)

Query: 1220 GALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLH 1279
            G +  TPL    +EEG  +       N +  +  W+ ++K + S ++ +           
Sbjct: 4367 GPMIHTPLVDTVSEEGDIVHLTTSITNAK--EVNWYFENKLVPSDEKFKCL--------- 4415

Query: 1280 ILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLA--IIEKNRAKVV 1337
                   D+  YTL I      +  + D  G+   +A+ +  +  T A   + K  A V+
Sbjct: 4416 ------QDQNTYTLVID-----KVNTEDHQGEYVCEALNDSGKTATSAKLTVVKRAAPVI 4464

Query: 1338 RGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKV 1397
            +   +   +        TC +   P     W K  + +   D+    +R ++   ++E +
Sbjct: 4465 KRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDK--CSIRSSKYISSLEIL 4522

Query: 1398 NSE--DSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
             ++  D G Y     N+YGS +   T++V   G E K  K
Sbjct: 4523 RTQVVDCGEYTCKASNEYGSVSCTATLTVTVPGGEKKVRK 4562



 Score = 38.1 bits (87), Expect = 0.061
 Identities = 25/90 (27%), Positives = 40/90 (44%), Gaps = 5/90 (5%)

Query: 158  IPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEI 217
            +PL+   V E   V+  C V      +  W++N+  I    F + KY I     + +L I
Sbjct: 6272 VPLKDTRVKEQQEVVFNCEVNTEGA-KAKWFRNEEAI----FDSSKYIILQKDLVYTLRI 6326

Query: 218  RRCAIEDSATYTVRVKNAHGQASSFAKVLV 247
            R   ++D A Y V + N  G+    A  L+
Sbjct: 6327 RDAHLDDQANYNVSLTNHRGENVKSAANLI 6356



 Score = 38.1 bits (87), Expect = 0.061
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 4/92 (4%)

Query: 1342  DVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTE--VTITIEKVNS 1399
             DV  +   + L +   ++G P P ISW K+   +   +R R E+  T+    +T++    
Sbjct: 19425 DVIVVKAGEVLKINADIAGRPLPVISWAKDG--IEIEERARTEIISTDNHTLLTVKDCIR 19482

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEP 1431
              D+G+Y + +KN  G+ +  V   V      P
Sbjct: 19483 RDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPP 19514



 Score = 37.7 bits (86), Expect = 0.080
 Identities = 22/93 (23%), Positives = 45/93 (48%), Gaps = 3/93 (3%)

Query: 1342  DVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGT--EVTITIEKVNS 1399
             DV  +   +T  L   + G P P++ W K+ + +      RME++ T  + T+ ++    
Sbjct: 18343 DVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELE-ETAARMEIKSTIQKTTLVVKDCIR 18401

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPK 1432
              D G+Y + + N  G+++  +T+ V      P+
Sbjct: 18402 TDGGQYILKLSNVGGTKSIPITVKVLDRPGPPE 18434



 Score = 37.7 bits (86), Expect = 0.080
 Identities = 23/93 (24%), Positives = 39/93 (41%), Gaps = 2/93 (2%)

Query: 284   EKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
             E E    SC    D     ++ W R G +L +S R ++  T  +++ ++S     DEG Y
Sbjct: 26202 EGESARFSC--DTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNY 26259

Query: 344   MVRVPSPFGPREQSTYVLVRDAEAENPGAPGSP 376
              V V +  G +E    + ++ A          P
Sbjct: 26260 SVVVENSEGKQEAEFTLTIQKARVTEKAVTSPP 26292



 Score = 37.4 bits (85), Expect = 0.10
 Identities = 27/97 (27%), Positives = 42/97 (43%), Gaps = 4/97 (4%)

Query: 1335 KVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITI 1394
            K++ GL    T+     + L   V+G P P+I+W K D  +    R  +E    + T+TI
Sbjct: 7323 KLLAGL----TVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTI 7378

Query: 1395 EKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEP 1431
                  D+G Y +   N  G  T  V ++V      P
Sbjct: 7379 VDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPP 7415



 Score = 37.4 bits (85), Expect = 0.10
 Identities = 17/67 (25%), Positives = 37/67 (55%), Gaps = 2/67 (2%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             + G P PE++W K++  +   +R  +E   +   + I + N  D+G++ + ++N  G ++
Sbjct: 14428 IKGRPAPEVTWTKDN--INLKNRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKS 14485

Query: 1418  GQVTISV 1424
             G V + V
Sbjct: 14486 GFVNVRV 14492



 Score = 37.4 bits (85), Expect = 0.10
 Identities = 20/79 (25%), Positives = 36/79 (45%), Gaps = 2/79 (2%)

Query: 1354  LTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKY 1413
             LT  + G P P   W K  Q ++   R  +    T   + I++ +  DSG Y + ++NK 
Sbjct: 23784 LTIPIKGKPFPICKWTKEGQDIS--KRAMIATSETHTELVIKEADRGDSGTYDLVLENKC 23841

Query: 1414  GSETGQVTISVFKHGDEPK 1432
             G +   + + V    + P+
Sbjct: 23842 GKKAVYIKVRVIGSPNSPE 23860



 Score = 37.0 bits (84), Expect = 0.14
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 4/93 (4%)

Query: 1342  DVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTE--VTITIEKVNS 1399
             D   +   +T  L   V G P P I WL+ D+ +   +  R E++ T+    + ++    
Sbjct: 17261 DTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIE--ESARCEIKNTDFKALLIVKDAIR 17318

Query: 1400  EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPK 1432
              D G+Y +   N  GS++  V + V      P+
Sbjct: 17319 IDGGQYILRASNVAGSKSFPVNVKVLDRPGPPE 17351



 Score = 37.0 bits (84), Expect = 0.14
 Identities = 21/83 (25%), Positives = 36/83 (43%), Gaps = 2/83 (2%)

Query: 167   EHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSA 226
             E   + + C     P P+VTW     +I  +    G++ I N   L +L I     +D  
Sbjct: 26970 EGKVLTVACAFTGEPTPEVTWSCGGRKIHSQ--EQGRFHIENTDDLTTLIIMDVQKQDGG 27027

Query: 227   TYTVRVKNAHGQASSFAKVLVRT 249
              YT+ + N  G  S+   + +R+
Sbjct: 27028 LYTLSLGNEFGSDSATVNIHIRS 27050



 Score = 36.6 bits (83), Expect = 0.18
 Identities = 47/218 (21%), Positives = 87/218 (39%), Gaps = 30/218 (13%)

Query: 1220 GALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLH 1279
            GA+S  PL  Q   E      + +  N +  K  W    K L   + IR+ +   +  L 
Sbjct: 2574 GAISK-PLTDQTVAESQEAVFECEVANPD-SKGEWLRDGKHLPLTNNIRSESDGHKRRLI 2631

Query: 1280 ILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRG 1339
            I   K  D G+YT ++A  K   +L  +        A+   + LK L             
Sbjct: 2632 IAATKLDDIGEYTYKVATSKTSAKLKVE--------AVKIKKTLKNL------------- 2670

Query: 1340 LPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNS 1399
                 T+ E +    T  ++      + W+KN   +   ++Y + V+GT  ++ I+    
Sbjct: 2671 -----TVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAI 2725

Query: 1400 EDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELKSM 1437
             D   YG F   + G+ + ++ +   K   +PK++ ++
Sbjct: 2726 VDESVYG-FRLGRLGA-SARLHVETVKIIKKPKDVTAL 2761



 Score = 36.6 bits (83), Expect = 0.18
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 1359  SGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEK-VNSEDSGRYGVFVKNKYGSET 1417
             SG P P I+W K    +     Y++ V  +  ++     V  +D+G Y V  KN++G + 
Sbjct: 24680 SGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQ 24739

Query: 1418  GQVTISVFKHGDEPKELK 1435
               V + V    D P+ +K
Sbjct: 24740 KTVELDVADVPDPPRGVK 24757



 Score = 36.2 bits (82), Expect = 0.23
 Identities = 61/331 (18%), Positives = 136/331 (41%), Gaps = 49/331 (14%)

Query: 882  AGLGQPSMP---TDPVLLEDKPGAHEI---EVGVDEEGFIYLAFEAPEAPDSSEFQWSKD 935
            AG G+P+ P   T PV+ +   G   +   +VG + +  +Y  ++    P ++ +++   
Sbjct: 1028 AGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVY--WKKSGVPLTTGYRYKVS 1085

Query: 936  YKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTLTEE-ELEKL 994
            Y             +  + K+++     +D G Y+++V +   + SAS +L EE + E L
Sbjct: 1086 YN-----------KQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELL 1134

Query: 995  KKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKI 1054
             K   E               +L + +V  +++  K+   A   +    ++ +      I
Sbjct: 1135 MKSQQE---------------MLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALI 1179

Query: 1055 NFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLRKADAKR--- 1111
               R+K   + ++     ED+  + +  ++   K +I   ++    ++LL +   ++   
Sbjct: 1180 ---RKKMAKDTVVVRTYVEDQEFHISSFEERLIK-EIEYRIIKTTLEELLEEDGEEKMAV 1235

Query: 1112 --RDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDG---QYD 1166
               + +  +  +  R   +++ E   V   CK++      +  W+     +  G   Q D
Sbjct: 1236 DISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPL-PKIAWYKDGKRIKHGERYQMD 1294

Query: 1167 -PETGTGLLCIEELSKKDKGIYRAMVSDDRG 1196
              + G   L I  +  +D+GIY A  S+ +G
Sbjct: 1295 FLQDGRASLRIPVVLPEDEGIYTAFASNIKG 1325



 Score = 36.2 bits (82), Expect = 0.23
 Identities = 22/87 (25%), Positives = 36/87 (41%)

Query: 1345  TIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGR 1404
             T++  + L +     G PTP ++W K++ P+    R   E       +TI+    ED G 
Sbjct: 15786 TVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGH 15845

Query: 1405  YGVFVKNKYGSETGQVTISVFKHGDEP 1431
             Y V + N  G     + + V      P
Sbjct: 15846 YVVKLTNSAGEAIETLNVIVLDKPGPP 15872



 Score = 35.8 bits (81), Expect = 0.31
 Identities = 19/81 (23%), Positives = 36/81 (44%), Gaps = 2/81 (2%)

Query: 1354  LTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKY 1413
             +T    G P P + W K D  +    R  ++   +  ++TIE  N  DSG+Y + ++N  
Sbjct: 19834 MTVPFRGRPVPNVLWSKPDTDLR--TRAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVL 19891

Query: 1414  GSETGQVTISVFKHGDEPKEL 1434
              + +  + + V      P  +
Sbjct: 19892 SAASLTLVVKVLDTPGPPTNI 19912



 Score = 35.8 bits (81), Expect = 0.31
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 2/63 (3%)

Query: 1251  KTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKY--TLEIAAGKEVRQLSTDL 1308
             K TW  ++ RL+  DR+   TT D   L + D    D G+Y  TLE  AG +   ++  +
Sbjct: 22306 KVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVV 22365

Query: 1309  SGQ 1311
              G+
Sbjct: 22366 IGR 22368



 Score = 35.0 bits (79), Expect = 0.52
 Identities = 20/65 (30%), Positives = 30/65 (46%)

Query: 1360 GDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQ 1419
            GDPT  + WL + +P+   +R RM       ++      S DSG       NKYG++   
Sbjct: 1684 GDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTS 1743

Query: 1420 VTISV 1424
             T+ V
Sbjct: 1744 ATLIV 1748



 Score = 35.0 bits (79), Expect = 0.52
 Identities = 19/43 (44%), Positives = 25/43 (58%)

Query: 1253 TWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEI 1295
            TW   DK LE+GDR++  T      L I   + SDKG YTL++
Sbjct: 7055 TWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKL 7097



 Score = 34.7 bits (78), Expect = 0.68
 Identities = 32/148 (21%), Positives = 70/148 (47%), Gaps = 13/148 (8%)

Query: 955  KVILKEPGLEDLGTYSVI----VTDADEDISASHTLTEEELEKLK-----KLSHEIRNPV 1005
            K+++++PG    G   ++    + DAD+  + ++T+T E    L+     K+   IR+ +
Sbjct: 4877 KIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWL 4936

Query: 1006 IKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEV 1065
            +K I   ++    +G      ++ K +P  +    ++  EI + PN K    R+   + +
Sbjct: 4937 VKPIRDQHVK--PKGTAIFACDIAKDTPNIKWFKGYD--EIPAEPNDKTEILRDGNHLYL 4992

Query: 1066 IIQNLSEEDKGSYTAQLQDGKAKNQITL 1093
             I+N   ED   Y  +++  +   ++TL
Sbjct: 4993 KIKNAMPEDIAEYAVEIEGKRYPAKLTL 5020



 Score = 34.3 bits (77), Expect = 0.89
 Identities = 24/89 (26%), Positives = 37/89 (41%), Gaps = 5/89 (5%)

Query: 160  LRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRIT-NNYGLLSLEIR 218
            ++++ + E   V   C +   P P++ WYK+  RI        +Y++     G  SL I 
Sbjct: 1251 IKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIK----HGERYQMDFLQDGRASLRIP 1306

Query: 219  RCAIEDSATYTVRVKNAHGQASSFAKVLV 247
                ED   YT    N  G A    K+ V
Sbjct: 1307 VVLPEDEGIYTAFASNIKGNAICSGKLYV 1335



 Score = 34.3 bits (77), Expect = 0.89
 Identities = 35/184 (19%), Positives = 76/184 (41%), Gaps = 15/184 (8%)

Query: 1228 KIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSD 1287
            +++G +   R+F  V    +++M      +D+ ++ G+       L    +H++  K+  
Sbjct: 5185 EVEGKKTSARLF--VTGIRLKFMSPL---EDQTVKEGETATFVCELSHEKMHVVWFKNDA 5239

Query: 1288 KGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIM 1347
            K   +  +    E +    ++     +D      ++K L+     + KV+   P     +
Sbjct: 5240 KLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELS--STAQLKVLEADPYFTVKL 5297

Query: 1348 EDKT------LCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSED 1401
             DKT      + L C VS D    + W K+ + +    +Y ++  G    + I+K + +D
Sbjct: 5298 HDKTAVEKDEITLKCEVSKDVP--VKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKD 5355

Query: 1402 SGRY 1405
             G Y
Sbjct: 5356 KGEY 5359



 Score = 33.9 bits (76), Expect = 1.2
 Identities = 32/114 (28%), Positives = 50/114 (43%), Gaps = 7/114 (6%)

Query: 1299 KEVRQLSTDLSGQAFEDAM-----AEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLC 1353
            K+  + S  +   AFED       AE +      IIE  R K +  L DV T  E ++  
Sbjct: 5517 KDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDV-TAKEKESAV 5575

Query: 1354 LTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGV 1407
             T  +S D    + W KNDQ +       M+  G   +IT + ++ +D+ +  V
Sbjct: 5576 FTVELSHDNI-RVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRV 5628



 Score = 33.9 bits (76), Expect = 1.2
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 4/74 (5%)

Query: 1354  LTCIVSGDPTPEISWLKNDQPVTFLD--RYRM-EVRGTEVTITIEKVNSEDSGRYGVFVK 1410
             L C V+G P P + W +  + +   D  +YR+ E +G    + I  V  +D+  Y V   
Sbjct: 24575 LVCKVTGHPKPIVKWYRQGKEI-IADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRAT 24633

Query: 1411  NKYGSETGQVTISV 1424
             N+ GS +G  ++ V
Sbjct: 24634 NQGGSVSGTASLEV 24647



 Score = 33.5 bits (75), Expect = 1.5
 Identities = 21/86 (24%), Positives = 38/86 (44%), Gaps = 2/86 (2%)

Query: 1345 TIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGR 1404
            T+ +   + L   V+G PTP + + ++   +     +++   G   ++ I +   EDSG 
Sbjct: 114  TVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGT 173

Query: 1405 YGVFVKNKYGSETGQVTISVFKHGDE 1430
            Y V   N  G  T   T  +   G+E
Sbjct: 174  YSVNATNSVGRATS--TAELLVQGEE 197



 Score = 33.5 bits (75), Expect = 1.5
 Identities = 18/74 (24%), Positives = 34/74 (45%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             +SG P P I W K+D+ +       +E      +I I+  +  +SG Y + ++N  GS +
Sbjct: 20524 ISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSAS 20583

Query: 1418  GQVTISVFKHGDEP 1431
               + + +      P
Sbjct: 20584 ATIRVQILDKPGPP 20597



 Score = 33.1 bits (74), Expect = 2.0
 Identities = 51/224 (22%), Positives = 88/224 (39%), Gaps = 42/224 (18%)

Query: 304  IQWFRDGSLLRSSRRRKILYT-DRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLV 362
            I W++DG  ++   R ++ +  D +ASL++     EDEG+Y     +  G    S  + V
Sbjct: 1276 IAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYV 1335

Query: 363  RDAEAENPGAP-GSPLNVRCLD------------VNRDCLILTWAPPSDTRGNPITAYTI 409
                   P AP G+P  +  L+            V+R  + ++ A  S  R +P      
Sbjct: 1336 ------EPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPA 1389

Query: 410  ERCQGESGEWIACHEAPGGTCRCPIQGL-------VEGQSYRFRVRAISRVGSSVPSKAS 462
                G   E     E+       P+  L       +EGQ+ RF ++    VG  +P    
Sbjct: 1390 RMSPGRRLE--ETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKV---VGRPMPE--- 1441

Query: 463  ELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTN 506
                   HD      +I  D  +K+ I  D  +  + +P+ P++
Sbjct: 1442 ---TFWFHDG----QQIVNDYTHKVVIKEDGTQSLIIVPATPSD 1478



 Score = 33.1 bits (74), Expect = 2.0
 Identities = 37/166 (22%), Positives = 69/166 (41%), Gaps = 29/166 (17%)

Query: 179  ASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYT-VRVKNAHG 237
            + P  +V WYK+   +        KYR+ ++  +  L I      D+  Y+ V V++ + 
Sbjct: 2153 SEPFVKVKWYKDGMEVH----EGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENV 2208

Query: 238  QASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSED 297
            + +  AK++V                    G  VEF   L+ +   E     L C+ S +
Sbjct: 2209 KTT--AKLIVE-------------------GAVVEFVKELQDIEVPESYSGELECIVSPE 2247

Query: 298  VLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
             ++ +   W+ +   L+S+ +  I     + +L V    KED+G Y
Sbjct: 2248 NIEGK---WYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEY 2290



 Score = 32.3 bits (72), Expect = 3.4
 Identities = 38/177 (21%), Positives = 64/177 (36%), Gaps = 33/177 (18%)

Query: 167  EHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSA 226
            E+ TV    +V     P V W+     I P    + K+R+ +   +  L ++  +  D+ 
Sbjct: 2762 ENATVAFEVSVSHDTVP-VKWFHKSVEIKP----SDKHRLVSERKVHKLMLQNISPSDAG 2816

Query: 227  TYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKE 286
             YT  V    GQ    AK+ V T                     +  T  +K +   E +
Sbjct: 2817 EYTAVV----GQLECKAKLFVET---------------------LHITKTMKNIEVPETK 2851

Query: 287  PFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLY 343
              S  C  S   + +    W ++G  +  S + KI+   +   L +  T  ED   Y
Sbjct: 2852 TASFECEVSHFNVPS---MWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEY 2905



 Score = 32.3 bits (72), Expect = 3.4
 Identities = 28/120 (23%), Positives = 52/120 (43%), Gaps = 13/120 (10%)

Query: 227  TYTVRVKNAH-GQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREK 285
            T+++ ++N H G A+ +      T++   A   + ++  +     +EF   +K +   EK
Sbjct: 2976 THSLNIRNVHFGDAADY------TFVAGKATSTATLYVEARH---IEFRKHIKDIKVLEK 3026

Query: 286  EPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMV 345
            +     C  SE  +   ++QW +D   L+ + R KI        L +  T   D G Y V
Sbjct: 3027 KRAMFECEVSEPDI---TVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTV 3083



 Score = 32.3 bits (72), Expect = 3.4
 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 2/67 (2%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYG--S 1415
             ++G P P  SW      +   +R  +E       +TI +    D+G Y + +KN  G  S
Sbjct: 23390 IAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTS 23449

Query: 1416  ETGQVTI 1422
             ET +V I
Sbjct: 23450 ETIKVII 23456



 Score = 32.0 bits (71), Expect = 4.4
 Identities = 20/99 (20%), Positives = 39/99 (39%), Gaps = 7/99 (7%)

Query: 1340 LPDVATIMEDKTLCLTCIVSGDPTPEISWLK-------NDQPVTFLDRYRMEVRGTEVTI 1392
            L +   + E   + +   + G P P ++W K       N +PV +       V     T+
Sbjct: 9750 LKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTL 9809

Query: 1393 TIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEP 1431
             I +    D+G Y +   N  G+ + ++ ++V      P
Sbjct: 9810 VIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPP 9848



 Score = 31.6 bits (70), Expect = 5.8
 Identities = 22/73 (30%), Positives = 28/73 (38%), Gaps = 5/73 (6%)

Query: 165  VWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIED 224
            V E  T    C V   P P+V WY N      +L R  K       G+  L+I  C   D
Sbjct: 1806 VLEGETARFRCRVTGYPQPKVNWYLNG-----QLIRKSKRFRVRYDGIHYLDIVDCKSYD 1860

Query: 225  SATYTVRVKNAHG 237
            +    V  +N  G
Sbjct: 1861 TGEVKVTAENPEG 1873



 Score = 31.2 bits (69), Expect = 7.5
 Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 2/92 (2%)

Query: 275 SVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSC 334
           S LK V   E E  +L C  S     + ++ W+R+   + SS   +I +    A L +  
Sbjct: 901 SGLKNVTVIEGESVTLECHISG--YPSPTVTWYREDYQIESSIDFQITFQSGIARLMIRE 958

Query: 335 TYKEDEGLYMVRVPSPFGPREQSTYVLVRDAE 366
            + ED G +     +  G    S Y+ V+ +E
Sbjct: 959 AFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSE 990



 Score = 31.2 bits (69), Expect = 7.5
 Identities = 16/67 (23%), Positives = 28/67 (41%), Gaps = 2/67 (2%)

Query: 1358  VSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSET 1417
             VSG P P ++W  N++  T      +E      ++ I+       G Y +  KN+ G   
Sbjct: 10176 VSGKPPPTVTWNMNER--TLPQEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERK 10233

Query: 1418  GQVTISV 1424
               + + V
Sbjct: 10234 KTIIVDV 10240



 Score = 31.2 bits (69), Expect = 7.5
 Identities = 23/115 (20%), Positives = 48/115 (41%), Gaps = 1/115 (0%)

Query: 1321  QRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDR 1380
             + +K   I+E     +   +  +  +     + L  IV G P P+++W K       + +
Sbjct: 12221 EAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGID-NVVRK 12279

Query: 1381  YRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELK 1435
              ++++  T   + I     +DSG+Y + + N  G +   V + V        +LK
Sbjct: 12280 GQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLK 12334



 Score = 31.2 bits (69), Expect = 7.5
 Identities = 34/168 (20%), Positives = 66/168 (39%), Gaps = 31/168 (18%)

Query: 1253  TWFHKDKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQA 1312
             +W    + L+   R+    T     LHI +    D GKYT+           +T+ +G A
Sbjct: 17972 SWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTV----------TATNSAGTA 18021

Query: 1313  FEDAMAEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTP-----EIS 1367
              E+         ++ ++EK         P V  +  D+      ++S +P       +IS
Sbjct: 18022 TENL--------SVIVLEKPG-------PPVGPVRFDEVSADFVVISWEPPAYTGGCQIS 18066

Query: 1368  -WLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYG 1414
              ++   +  T    + +       TI I K+ +    ++ +F +N+YG
Sbjct: 18067 NYIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYG 18114



 Score = 30.8 bits (68), Expect = 9.8
 Identities = 15/38 (39%), Positives = 18/38 (47%)

Query: 159  PLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDP 196
            PL+   V E T  +L C V       V WY ND +I P
Sbjct: 2404 PLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKP 2441



 Score = 30.8 bits (68), Expect = 9.8
 Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 1051  NRKINFDREKGLVEVIIQNLSEEDKGSYTA----QLQDGKAKNQITLTLVDDDFDKLLR 1105
             ++K  F+ +KGL ++ I +++ +D   YT     +  +   K ++T+TL     D  LR
Sbjct: 25364 DKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLR 25422



 Score = 30.8 bits (68), Expect = 9.8
 Identities = 30/123 (24%), Positives = 55/123 (44%), Gaps = 6/123 (4%)

Query: 977   DEDISASHTLTEEELEKLK---KLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSP 1033
             DE I    + T+E + K +    LS E+ +    +    + +I E   V    E+    P
Sbjct: 26731 DEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISG-EP 26789

Query: 1034  AAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITL 1093
             + E+    NN  I  S N  ++  R + +  + I+N S  D G YT + ++ + +   T 
Sbjct: 26790 SPEIEWFKNNLPISISSN--VSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATA 26847

Query: 1094  TLV 1096
             +L+
Sbjct: 26848 SLM 26850


>gi|110349715 titin isoform N2-B [Homo sapiens]
          Length = 26926

 Score =  274 bits (701), Expect = 4e-73
 Identities = 215/831 (25%), Positives = 361/831 (43%), Gaps = 81/831 (9%)

Query: 169  TTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATY 228
            T + L  TV   P P++TW    T+ D  L +  +  I N     ++ I      D+ TY
Sbjct: 7209 TKIELPATVTGKPEPKITW----TKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTY 7264

Query: 229  TVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPF 288
             +   N  G+A++  +V V    G  A FD               T V            
Sbjct: 7265 IIEAVNVCGRATAVVEVNVLDKPGPPAAFD--------------ITDVTNE--------- 7301

Query: 289  SLSCLFS----EDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYM 344
              SCL +     D   ++   +  +     S    K+  T +  + K +      E ++ 
Sbjct: 7302 --SCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFR 7359

Query: 345  VRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPI 404
            V   + +G  E      +      +P  PG P  +   D+ +D + LTW  P D  G+PI
Sbjct: 7360 VAAENMYGVGEPVQASPITAKYQFDP--PGPPTRLEPSDITKDAVTLTWCEPDDDGGSPI 7417

Query: 405  TAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASEL 464
            T Y +ER   ++ +W+ C++ P       ++GL   + YRFRV A +  G   PSK++E 
Sbjct: 7418 TGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEP 7477

Query: 465  VVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEP 524
            +++                           +D +  P PP      ++ +  V L W +P
Sbjct: 7478 ILI---------------------------KDPIDPPWPPGKPTVKDVGKTSVRLNWTKP 7510

Query: 525  SPRDRAPL-TYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGL 583
                 A + +Y +E    G+  W  ++   P  + +  +  L + + Y FRVRA+N+ G 
Sbjct: 7511 EHDGGAKIESYVIEMLKTGTDEWVRVAEGVP--TTQHLLPGLMEGQEYSFRVRAVNKAGE 7568

Query: 584  SDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWD-PVKD--PELLGYYIYSRKV 640
            S+PSEPS+P+  R       PP  ++    T+ +  L W  P KD    +  Y +  R V
Sbjct: 7569 SEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDV 7628

Query: 641  GTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATP 700
                WQTV+   ++ T+ TV  L  G  Y F V + +  G  + +   + +  K    TP
Sbjct: 7629 RRKGWQTVDTT-VKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTP 7687

Query: 701  SAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCK 760
              PY  A+++  K  + + W+PPK  GG  I  Y +++ +     W    +   P    +
Sbjct: 7688 GPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFR 7747

Query: 761  VSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVL 820
            V+D+ EG   +F+ RA N AGVG  S P+ +   ++ T P P PP D+  ++     + +
Sbjct: 7748 VTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSP-PSPPLDLHVTDAGRKHIAI 7806

Query: 821  QWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSD-LQPGKSYVFQVQAM 879
             W+PP   G  P+ GYHV     G+E+W  V   PI     +V + + P K YV +V+A+
Sbjct: 7807 AWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAV 7866

Query: 880  NSAGLGQPSMPTDPVLLED---KP----GAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQW 932
            N+ G+ +PS  ++ V+ +D   KP      H+I V   E+  I + F A   P  S   W
Sbjct: 7867 NAIGVSEPSEISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVS---W 7923

Query: 933  SKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISAS 983
             KD K      R+ +++    + + + +    D G Y++ + +     +AS
Sbjct: 7924 HKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATAS 7974



 Score =  227 bits (579), Expect = 5e-59
 Identities = 173/602 (28%), Positives = 259/602 (43%), Gaps = 86/602 (14%)

Query: 373  PGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRC 432
            P  P NV+  D   + + LTW PP +  G+ I  Y +ERC   S +W+AC E P    + 
Sbjct: 7091 PDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGE-PVAETKM 7149

Query: 433  PIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARR----------------- 475
             + GL EG+ Y +RV+A++R G+S PS+ +E +   D   A                   
Sbjct: 7150 EVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGT 7209

Query: 476  KTEIPFDLGNK-------------------ITISTDAFEDTVTI---------------- 500
            K E+P  +  K                   ITI     + TVTI                
Sbjct: 7210 KIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAV 7269

Query: 501  -----------------PSPPTNVHASEIREAYVVLAWEEPSPRDRAPLT-YSLEKSVIG 542
                             P PP     +++     +L W  P     + +T Y +E+    
Sbjct: 7270 NVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATD 7329

Query: 543  SGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALR---GPP 599
            S  W  +S  S V+   F    L   K Y+FRV A N YG+ +P + S PI  +    PP
Sbjct: 7330 SEVWHKLS--STVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQAS-PITAKYQFDPP 7386

Query: 600  ATLPPPAQVQAFRDTQTSVSLTW-DPVKD--PELLGYYIYSRKVGTSEWQTVNNKPIQGT 656
                PP +++    T+ +V+LTW +P  D    + GY++      T +W   N  P++ T
Sbjct: 7387 G---PPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDT 7443

Query: 657  RFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEM 716
             + V GL   K+Y F V + + AG G+ S +TEPI +K  +  P  P    + + GK  +
Sbjct: 7444 TYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSV 7503

Query: 717  VIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARA 776
             + W  P+  GG KI  Y ++   +   +W  V  + +PT    +  L EG  Y FR RA
Sbjct: 7504 RLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRV-AEGVPTTQHLLPGLMEGQEYSFRVRA 7562

Query: 777  ANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGY 836
             N AG  E S PS    C+E   P P PP  +    +   +  L+W  P   G  P+T Y
Sbjct: 7563 VNKAGESEPSEPSDPVLCREKLYP-PSPPRWLEVINITKNTADLKWTVPEKDGGSPITNY 7621

Query: 837  HVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLL 896
             V  ++   + W+ V    +  T   V+ L  G  YVF+V A N+ G    +   D VL 
Sbjct: 7622 IVEKRDVRRKGWQTVDT-TVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLA 7680

Query: 897  ED 898
            +D
Sbjct: 7681 KD 7682



 Score =  221 bits (564), Expect = 3e-57
 Identities = 228/925 (24%), Positives = 366/925 (39%), Gaps = 96/925 (10%)

Query: 194   IDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVK--NAHGQASSFAKVLVRTYL 251
             ++ RL    K+    N  LLS +     +++  TY  RV   N  GQ             
Sbjct: 10256 LESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQ------------- 10302

Query: 252   GKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGS 311
             GK +     I  +    P          +  R  E F+L+  +S        + WF+D +
Sbjct: 10303 GKPSFCTKPITCKDELAPPTLHLDFRDKLTIRVGEAFALTGRYSGK--PKPKVSWFKDEA 10360

Query: 312   LLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPG 371
              +    R  I  T    +L+     + D G Y V V +  G R+    V V D     PG
Sbjct: 10361 DVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVD----RPG 10416

Query: 372   APGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCR 431
              P  P++    +V +D ++++W PP D  G+ IT Y IE+ +     W+    A   T  
Sbjct: 10417 PPVGPVSFD--EVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKT-T 10473

Query: 432   CPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITIST 491
             C +  L+EG+ Y FR+ A +  G S P  +  +                           
Sbjct: 10474 CKVSKLLEGKDYIFRIHAENLYGISDPLVSDSMKA------------------------- 10508

Query: 492   DAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISS 551
                +D   +P  P     +E+ +   ++ W +P    +    Y LEK    S  W  ++ 
Sbjct: 10509 ---KDRFRVPDAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKRETMSKRWARVTK 10565

Query: 552   ESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAF 611
             +      +F V DL +   Y FRV A N+ G+ DPS PS+P+  + P A   PP   +A 
Sbjct: 10566 DPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAI 10625

Query: 612   RDTQTSVSLTWDPVK---DPELLGYYIYSRKVGTSEWQTVNNKP--IQGTRFTVPGLRTG 666
               T  SV LTW P +     ++LGY +  +KVG  EW+  N+ P     T++ V GLR G
Sbjct: 10626 DTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDG 10685

Query: 667   KEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRR 726
             + Y+F V +V+ AG  + +   EP+ VK  L  P         N  + + +       + 
Sbjct: 10686 QTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPEL---ILDANMAREQHI-------KV 10735

Query: 727   GGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELS 786
             G    L   +      ++ W     +  PT+  ++     G   E R  A    G+  L+
Sbjct: 10736 GDTLRLSAIIKGVPFPKVTWKK-EDRDAPTK-ARIDVTPVGSKLEIRNAAHEDGGIYSLT 10793

Query: 787   ----APSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQE 842
                 A S     K   + +PGPP D+  SE+R  S  L W+ PL  G   +T Y V  ++
Sbjct: 10794 VENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRD 10853

Query: 843   EGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLG------QPSMPTDPVLL 896
               S QW P++      +H     L  G  Y+F+V A N  G G      +P    DP+  
Sbjct: 10854 VASAQWSPLSATSKKKSHF-AKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHP 10912

Query: 897   EDKP-GAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQ-WSKDYKGPLDPQRVKIEDKVNKS 954
                P   H ++V   E   + L +  P+    S    +  +Y+       +K +   N  
Sbjct: 10913 PGPPKDLHHVDVDKTE---VSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKTVTNLE 10969

Query: 955   KVILKEPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNI 1014
              V+    GL+   TY   V  A+  +      T   +E  +KL        +KLI G   
Sbjct: 10970 CVV---TGLQQGKTYRFRV-KAENIVGLGLPDTTIPIECQEKLVPPSVELDVKLIEGL-- 11023

Query: 1015  DILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEED 1074
              +++ G    +  + +  P        +  EI +  +  +  D    +  + I+N    D
Sbjct: 11024 -VVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSV--LTIKNCLRRD 11080

Query: 1075  KGSY--TAQLQDGKAKNQITLTLVD 1097
              G Y  T     G     + LT++D
Sbjct: 11081 TGEYQITVSNAAGSKTVAVHLTVLD 11105



 Score =  213 bits (542), Expect = 1e-54
 Identities = 170/663 (25%), Positives = 296/663 (44%), Gaps = 72/663 (10%)

Query: 338   EDEGLYMVRVPSPFG---PREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWA 394
             E +  + VR  + FG   P E       RD        P  P+ ++   + ++ + L+W 
Sbjct: 9481  EQQYFFRVRAENRFGIGPPVETIQRTTARDPIYP----PDPPIKLKIGLITKNTVHLSWK 9536

Query: 395   PPSDTRGNPITAYTIERCQGE-----SGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRA 449
             PP +  G+P+T Y +E    +        W  C++      +  ++ LVEG  Y FRV+A
Sbjct: 9537  PPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKA 9596

Query: 450   ISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHA 509
             ++  G S PS       +G  D  R       DL   + +     E+   +     N+ A
Sbjct: 9597  VNAAGVSKPS-----ATVGPCDCQRPDMPPSIDLKEFMEV-----EEGTNV-----NIVA 9641

Query: 510   SEIREAYVVLAWEEPSPR---DRAPLTYSLE-KSVIGSGTWEAISSESPVRSPRFAVLDL 565
                   +  L W +  P+   ++ P+ Y      ++   T   +  +S            
Sbjct: 9642  KIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQS------------ 9689

Query: 566   EKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPV 625
              +  + ++ + A+N  G +        +   GPP     P + ++    Q  ++L+W P 
Sbjct: 9690  RRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVG---PIKFESVSADQ--MTLSWFPP 9744

Query: 626   KDP---ELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVG 682
             KD    ++  Y I  R+     W  V+++P + T +T+P L  G EY F + + ++ G+G
Sbjct: 9745  KDDGGSKITNYVIEKREANRKTWVHVSSEPKECT-YTIPKLLEGHEYVFRIMAQNKYGIG 9803

Query: 683   ESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSE 742
             E    +EP   +   + P AP    + +  +N M + W+ P+  GG  + GY+L+  D+ 
Sbjct: 9804  EP-LDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTT 9862

Query: 743   ELDWHAVNQQPIPTRVC----KVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWT 798
                W  VN+ PI         KV+ L EG  Y+FR  A N AGVG  S PS     ++  
Sbjct: 9863  SKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPI 9922

Query: 799   MPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISG 858
              P PGPP+  + ++   +S  L+W PPL  G   VTGY V ++EEG E+W+      + G
Sbjct: 9923  AP-PGPPFP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRG 9980

Query: 859   THLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEVGVDEEGFI--- 915
             T L V+ L+ G  Y F+V+A+N AG+G+P   TD + ++D+  + ++++       I   
Sbjct: 9981  TKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVH 10040

Query: 916   ------YLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTY 969
                    +A+ + + P +    W+ + +    PQ   IE     S +++K       G Y
Sbjct: 10041 AGGVIRIIAYVSGKPPPT--VTWNMNER--TLPQEATIETTAISSSMVIKNCQRSHQGVY 10096

Query: 970   SVI 972
             S++
Sbjct: 10097 SLL 10099



 Score =  206 bits (524), Expect = 1e-52
 Identities = 222/873 (25%), Positives = 358/873 (41%), Gaps = 94/873 (10%)

Query: 139  VQEAKELRELCYGRGPWF--WIPLRSH--AVWEHTTVLLTCTVQASPPPQVTWYKNDTRI 194
            V E  E+ E    + P     I L +H   V E   + +    +A P P V+W+K+   +
Sbjct: 7871 VSEPSEISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEV 7930

Query: 195  DPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKD 254
                  + +  + N++    LE+ +    D+  YT+ ++N  G A++   V V    G  
Sbjct: 7931 KA----SDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPC 7986

Query: 255  AGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLR 314
                +    +S                         SC  + +  + +         L R
Sbjct: 7987 KDIKASDITKS-------------------------SCKLTWEPPEFDGGTPILHYVLER 8021

Query: 315  SSRRRKILYTDRQASLKVSCTYKE--DEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGA 372
                R+          K+S T K+    G Y  RV +           L     A++P  
Sbjct: 8022 REAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQ 8081

Query: 373  PGSP-LNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCR 431
            P  P ++V   +   + + +TW PP    G+ I  Y IE+       W  C+E       
Sbjct: 8082 PPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILT 8141

Query: 432  CPIQGLVEGQSYRFRVRAISRVGSSVPSKASE-----------LVVMGDHDAARRKTEIP 480
               +GL EG+ Y+FRVRA +  G S PS+A+             V++      +R  EI 
Sbjct: 8142 YTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIA 8201

Query: 481  FDL---GNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLE 537
             D    G+     T   ++ V +P       A  +R     +  EEP      PLT  L 
Sbjct: 8202 LDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFV---LPLTQRLS 8258

Query: 538  KSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRG 597
                  G       ES +R     V D  +    ++ ++  N +G++        +   G
Sbjct: 8259 IDNSKKG-------ESQLR-----VRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPG 8306

Query: 598  PPATLPPPAQVQAFRDTQ-TSVSLTWDPVKDP---ELLGYYIYSRKVGT--SEWQTVNNK 651
            PP           F D + TSV   W+P  D    E++ Y +  +      SEW  V + 
Sbjct: 8307 PPINF-------VFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTST 8359

Query: 652  PIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNC 711
             ++  +++V  L  GKEY F VR+ +  G G     ++P+  K     P AP    + + 
Sbjct: 8360 -LRHCKYSVTKLIEGKEYLFRVRAENRFGPGPP-CVSKPLVAKDPFGPPDAPDKPIVEDV 8417

Query: 712  GKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYE 771
              N M++ W  PK  G   ILGY+L++ +     W  VN+  +      V  L EG  Y 
Sbjct: 8418 TSNSMLVKWNEPKDNGS-PILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYV 8476

Query: 772  FRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAG 831
            FR  A N AG G+ S PS      +   P PGPP   R ++  +T++ L+WEPP + G G
Sbjct: 8477 FRVCAENAAGPGKFSPPSDPKTAHDPISP-PGPPIP-RVTDTSSTTIELEWEPPAFNGGG 8534

Query: 832  PVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPT 891
             + GY V  Q  G+ +W   T   I      V +++ G  Y  +V A+N+AG G P   T
Sbjct: 8535 EIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPG-ET 8593

Query: 892  DPVLLED--KPGAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQ------WSKDYKGPLDPQ 943
             PV + +  +P A E++V V + G   +A +    P     +      W+K+ +G LD  
Sbjct: 8594 QPVTVAEPQEPPAVELDVSV-KGGIQIMAGKTLRIPAVVTGRPVPTKVWTKE-EGELDKD 8651

Query: 944  RVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDA 976
            RV I++   KS++I+K+   +D G Y +  T++
Sbjct: 8652 RVVIDNVGTKSELIIKDALRKDHGRYVITATNS 8684



 Score =  201 bits (512), Expect = 3e-51
 Identities = 209/819 (25%), Positives = 323/819 (39%), Gaps = 106/819 (12%)

Query: 179  ASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQ 238
            A P  +  W+K +  +  +        I       S  I      D   Y + ++N HG+
Sbjct: 6528 AYPKAEAEWFKENEPLSTKT-------IDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGK 6580

Query: 239  ASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDV 298
            A  F  + V                       ++    ++ +   E     +S  + E +
Sbjct: 6581 AEGFINLKV-----------------------IDVPGPVRNLEVTETFDGEVSLAWEEPL 6617

Query: 299  LDAES--IQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGL-YMVRVPSPFGPRE 355
             D  S  I +  +   ++  R+  +L TDR  S + + T  +  G+ Y+ RV +      
Sbjct: 6618 TDGGSKIIGYVVERRDIK--RKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSA------ 6669

Query: 356  QSTYVLVRDAEAENP-------GAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYT 408
            ++        E +NP         PG PLNV   DVNR  + LTW PP    G  IT Y 
Sbjct: 6670 RNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYV 6729

Query: 409  IERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMG 468
            IE     S  W              +  +VEGQ Y FRVRA +R+G   PS A+  V + 
Sbjct: 6730 IELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVA 6789

Query: 469  DHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRD 528
            D                            +  PSPP N+ +S+  ++ V L WE P    
Sbjct: 6790 D---------------------------PIERPSPPVNLTSSDQTQSSVQLKWEPPLKDG 6822

Query: 529  RAP-LTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPS 587
             +P L Y +E+   G   W   + +  V    + V  LEK   Y++RV A N+ G+SDPS
Sbjct: 6823 GSPILGYIIERCEEGKDNWIRCNMKL-VPELTYKVTGLEKGNKYLYRVSAENKAGVSDPS 6881

Query: 588  EPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQT 647
            E   P  L    A + P   + AF+D    +      V +P  +          T+ W  
Sbjct: 6882 EILGP--LTADDAFVEPTMDLSAFKDGLEVI------VPNPITILVPSTGYPRPTATWCF 6933

Query: 648  VNNKPIQGTRFTVPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVK-----QALATPSA 702
             +     G R  +  L    E        S+ G+           +        +A PSA
Sbjct: 6934 GDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSA 6993

Query: 703  PYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVS 762
            P      +  K+ + + W+PP   GG  + GY +++ +     W  V    +      V 
Sbjct: 6994 PKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV-MDFVTDLEFTVP 7052

Query: 763  DLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQ--PGPPYDVRASEVRATSLVL 820
            DL +G  Y F+  A N  G GE   P+ + E    + P   P PP +V+  +  A S+ L
Sbjct: 7053 DLVQGKEYLFKVCARNKCGPGE---PAYVDEPVNMSTPATVPDPPENVKWRDRTANSIFL 7109

Query: 821  QWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPG-PISGTHLRVSDLQPGKSYVFQVQAM 879
             W+PP   G   + GY V     GS++W  V  G P++ T + V+ L+ GK Y ++V+A+
Sbjct: 7110 TWDPPKNDGGSRIKGYIVERCPRGSDKW--VACGEPVAETKMEVTGLEEGKWYAYRVKAL 7167

Query: 880  NSAGLGQPSMPTDPVLLEDKPGAHEIEVGVD-EEGFIYLAFEAPEAP------DSSEFQW 932
            N  G  +PS PT+ +   D   A EI + V    G    A    E P         +  W
Sbjct: 7168 NRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITW 7227

Query: 933  SKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSV 971
            +K        +R+ IE+   KS V + +    D GTY +
Sbjct: 7228 TKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYII 7266



 Score =  199 bits (506), Expect = 2e-50
 Identities = 177/674 (26%), Positives = 281/674 (41%), Gaps = 59/674 (8%)

Query: 376   PLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQ 435
             P NVR  D++++ + L+W  P+   G+ IT Y +ER     G W           +  I 
Sbjct: 20274 PRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIIS 20333

Query: 436   GLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFE 495
             GL +   Y FRV A + VGS   S  SE+V                     IT       
Sbjct: 20334 GLTQNSQYEFRVFARNAVGSI--SNPSEVV-------------------GPITCIDSYGG 20372

Query: 496   DTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSVIGSGTWEAISSESPV 555
               + +P   T V       +  + A     P   AP T    K      T   +  E+  
Sbjct: 20373 PVIDLPLEYTEVVKYRAGTSVKLRAGISGKP---AP-TIEWYKDDKELQTNALVCVENTT 20428

Query: 556   RSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQ 615
                   + D ++  S  + ++  N  G +  +   + +   GPP        ++    T 
Sbjct: 20429 DLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPG-----GPIEFKTVTA 20483

Query: 616   TSVSLTWDPVKDP---ELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTVPGLRTGKEYEFC 672
               ++L W P  D    ++  Y +  R+     W  V+   ++    T   +  G EY F 
Sbjct: 20484 EKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEH-LEECIITTTKIIKGNEYIFR 20542

Query: 673   VRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKIL 732
             VR+V++ G+GE    ++ +  K A  TP  P    +    KN M + W  P   GG  I 
Sbjct: 20543 VRAVNKYGIGEP-LESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDIS 20601

Query: 733   GYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLF 792
             GYFL++ D + L W  V ++ I     KV+ L E   Y++R  A N AG G  S PS  +
Sbjct: 20602 GYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFY 20661

Query: 793   ECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPV- 851
             +  +   P PGPP  +R ++   +S+ L W  P+Y G   VTGY V  ++   E+W  V 
Sbjct: 20662 KAADPIDP-PGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVS 20720

Query: 852   TPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEVGV-- 909
             T G +  T   VS+L+PG +Y F+V A+N AG G+P    +PV  +D   A EI++ V  
Sbjct: 20721 TKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVAL 20780

Query: 910   --------DEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEP 961
                      E+  + + F+    P  +   W KD K      R  IE+  + S + + + 
Sbjct: 20781 RTSVIAKAGEDVQVLIPFKGRPPPTVT---WRKDEKNLGSDARYSIENTDSSSLLTIPQV 20837

Query: 962   GLEDLGTYSVIVTDA-----DEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDI 1016
                D G Y + + +         +S     T    +KL ++ H  R  V  L   W+  +
Sbjct: 20838 TRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKL-QVKHVSRGTVTLL---WDPPL 20893

Query: 1017  LERGEVRLWLEVEK 1030
             ++ G   +   +EK
Sbjct: 20894 IDGGSPIINYVIEK 20907



 Score =  193 bits (491), Expect = 9e-49
 Identities = 171/677 (25%), Positives = 283/677 (41%), Gaps = 77/677 (11%)

Query: 238   QASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSED 297
             +A S + ++++    KD+G+ S   + S+   + +   V+       + PF +S + +  
Sbjct: 12452 KADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDA-- 12509

Query: 298   VLDAESIQW---FRDGS-------LLRSSRRRKILYTDRQASLKVSCTYKE----DEGLY 343
               DA S+ W     DG        + +    R    T   +  K SC   +     E ++
Sbjct: 12510 --DACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIF 12567

Query: 344   MVRVPSPFGPREQSTYVLVRDAEAENP-GAPGSPLNVRCLDVNRDCLILTWAPPSDTRGN 402
              VR  + FG  E  T   +    A+ P G P  P N R   VN+DC+ + W  P    G+
Sbjct: 12568 RVRAENRFGISEPLTSPKM---VAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGS 12624

Query: 403   PITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKAS 462
             PI  Y IER +  S  W+  ++    +   P  GLVEG  Y FR+ A+++ GSS PSK +
Sbjct: 12625 PIIGYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPT 12684

Query: 463   ELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWE 522
             E V             +P D                    PP      ++ ++ V L W 
Sbjct: 12685 EYVT----------ARMPVD--------------------PPGKPEVIDVTKSTVSLIWA 12714

Query: 523   EPSPRDRAPLT-YSLEKSVIGSGTWEAISSESPVRSPR--FAVLDLEKKKSYVFRVRAMN 579
              P     + +  Y +E   +    W   ++ +P + P+  +    LE+K  Y FR  A  
Sbjct: 12715 RPKHDGGSKIIGYFVEACKLPGDKWVRCNT-APHQIPQEEYTATGLEEKAQYQFRAIART 12773

Query: 580   QYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRK 639
                +S PSEPS+P+ +      +PP   +     +  +V    +   D  + G     + 
Sbjct: 12774 AVNISPPSEPSDPVTILA--ENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFG-----KP 12826

Query: 640   VGTSEWQTVNN--KPIQGTRFTVPGLRTGKEYEFCVRSVSEAG----VGESSAATEPIRV 693
             + T  W+      KP +G +  +   R     E    +  ++G      E+S+ ++   +
Sbjct: 12827 MPTVSWKKDGTLLKPAEGIKMAMQ--RNLCTLELFSVNRKDSGDYTITAENSSGSKSATI 12884

Query: 694   K-QALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQ 752
             K + L  P  P    +     +  ++ W+PP   GG +I  Y +D+ ++   +W  V+  
Sbjct: 12885 KLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVS-A 12943

Query: 753   PIPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMP-QPGPPYDVRAS 811
              +P   C V  L EGH Y+FR  A N  GVG+            +  P +  PP     S
Sbjct: 12944 TVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDPPV---IS 13000

Query: 812   EVRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKS 871
              +    + + W+PP   G  P+TGY +  +E  +  W  V   PI    L+ + LQ G  
Sbjct: 13001 NITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTE 13060

Query: 872   YVFQVQAMNSAGLGQPS 888
             Y F+V A+N AG G+PS
Sbjct: 13061 YEFRVTAINKAGPGKPS 13077



 Score =  192 bits (487), Expect = 3e-48
 Identities = 216/903 (23%), Positives = 365/903 (40%), Gaps = 121/903 (13%)

Query: 154   PWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLL 213
             P   +P  ++++     + +   V   P P ++W K+    +P L +  +  +       
Sbjct: 17815 PSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDG---EP-LKQTTRVNVEETATST 17870

Query: 214   SLEIRRCAIEDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAG---FDSEIFKRSTFGPS 270
              L I+    +D   YTV   N+ G A+    V+V    G   G   FD           S
Sbjct: 17871 VLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEV---------S 17921

Query: 271   VEFTSVLKPVFAREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASL 330
              +F      V + E   ++  C  S  +++       RD +   ++    +  T  + ++
Sbjct: 17922 ADFV-----VISWEPPAYTGGCQISNYIVEK------RDTT---TTTWHMVSATVARTTI 17967

Query: 331   KVSCTYKEDEGLYMVRVPSPFGPRE--QSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDC 388
             K++      E  + +   + +G      S  V+V+    E PG PG+P       +++D 
Sbjct: 17968 KITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKE-PGPPGTPF---VTSISKDQ 18023

Query: 389   LILTWAPPSDTRGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVR 448
             +++ W  P +  G  I  Y +E+ +  S  W+  ++ P    +    GL EG  Y F+V 
Sbjct: 18024 MLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVS 18083

Query: 449   AISRVGSSVPSKASELVVMGD---------------HDAARRKTEIPFDLGNKIT---IS 490
             A + VG   PSK SE  V  D               ++   +  +  +D G+KIT   + 
Sbjct: 18084 AENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVE 18143

Query: 491   TDAFEDTVTIPSPPTNVHA