BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|5901910 CD160 antigen [Homo sapiens] (181 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|5901910 CD160 antigen [Homo sapiens] 366 e-102 gi|164663826 pregnancy specific beta-1-glycoprotein 11 isoform 2... 35 0.046 gi|164663824 pregnancy specific beta-1-glycoprotein 11 isoform 2... 35 0.046 gi|164663836 pregnancy specific beta-1-glycoprotein 11 isoform 1... 35 0.046 gi|169218213 PREDICTED: similar to complement component C3, part... 34 0.078 gi|239747104 PREDICTED: hypothetical protein XP_002344494 [Homo ... 33 0.10 gi|46488946 killer cell immunoglobulin-like receptor, three doma... 32 0.23 gi|115298678 complement component 3 precursor [Homo sapiens] 32 0.30 gi|4506805 sodium channel, voltage-gated, type I, beta isoform a... 32 0.39 gi|109240546 pregnancy specific beta-1-glycoprotein 3 [Homo sapi... 32 0.39 gi|4506175 pregnancy specific beta-1-glycoprotein 6 isoform a [H... 31 0.51 gi|194328712 pregnancy specific beta-1-glycoprotein 8 isoform c ... 31 0.51 gi|194328710 pregnancy specific beta-1-glycoprotein 8 isoform b ... 31 0.51 gi|51510887 pregnancy specific beta-1-glycoprotein 8 isoform a [... 31 0.51 gi|39930610 sodium channel, voltage-gated, type I, beta isoform ... 31 0.66 gi|73661174 pregnancy specific beta-1-glycoprotein 6 isoform b [... 31 0.66 gi|66267727 killer cell immunoglobulin-like receptor, two domain... 30 1.1 gi|11968154 killer cell immunoglobulin-like receptor, two domain... 30 1.1 gi|62632748 killer-cell Ig-like receptor [Homo sapiens] 30 1.1 gi|169203189 PREDICTED: hypothetical protein LOC338667 [Homo sap... 30 1.5 gi|169203683 PREDICTED: hypothetical protein LOC338667 [Homo sap... 30 1.5 gi|169202109 PREDICTED: hypothetical protein LOC338667 [Homo sap... 30 1.5 gi|122937241 SH3 and multiple ankyrin repeat domains 3 [Homo sap... 30 1.5 gi|124107604 killer cell immunoglobulin-like receptor, two domai... 29 1.9 gi|124107606 killer cell immunoglobulin-like receptor, two domai... 29 1.9 gi|124107610 killer cell immunoglobulin-like receptor, two domai... 29 1.9 gi|47419900 pregnancy specific beta-1-glycoprotein 4 isoform 2 [... 29 1.9 gi|42560235 pregnancy specific beta-1-glycoprotein 4 isoform 1 [... 29 1.9 gi|157805480 pregnancy specific beta-1-glycoprotein 7 precursor ... 29 1.9 gi|19557668 osteoclast-associated receptor isoform 4 [Homo sapiens] 29 2.5 >gi|5901910 CD160 antigen [Homo sapiens] Length = 181 Score = 366 bits (939), Expect = e-102 Identities = 181/181 (100%), Positives = 181/181 (100%) Query: 1 MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFL 60 MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFL Sbjct: 1 MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFL 60 Query: 61 CKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSG 120 CKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSG Sbjct: 61 CKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSG 120 Query: 121 IRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQA 180 IRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQA Sbjct: 121 IRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQA 180 Query: 181 L 181 L Sbjct: 181 L 181 >gi|164663826 pregnancy specific beta-1-glycoprotein 11 isoform 2 [Homo sapiens] Length = 213 Score = 34.7 bits (78), Expect = 0.046 Identities = 16/36 (44%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Query: 85 IDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSG 120 I+G ++S Q +F I Q+TP H+G Y C AR+ +G Sbjct: 153 INGKFQLSGQKLF-IPQITPKHNGLYACSARNSATG 187 >gi|164663824 pregnancy specific beta-1-glycoprotein 11 isoform 2 [Homo sapiens] Length = 213 Score = 34.7 bits (78), Expect = 0.046 Identities = 16/36 (44%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Query: 85 IDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSG 120 I+G ++S Q +F I Q+TP H+G Y C AR+ +G Sbjct: 153 INGKFQLSGQKLF-IPQITPKHNGLYACSARNSATG 187 >gi|164663836 pregnancy specific beta-1-glycoprotein 11 isoform 1 [Homo sapiens] Length = 335 Score = 34.7 bits (78), Expect = 0.046 Identities = 16/36 (44%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Query: 85 IDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSG 120 I+G ++S Q +F I Q+TP H+G Y C AR+ +G Sbjct: 275 INGKFQLSGQKLF-IPQITPKHNGLYACSARNSATG 309 >gi|169218213 PREDICTED: similar to complement component C3, partial [Homo sapiens] Length = 1295 Score = 33.9 bits (76), Expect = 0.078 Identities = 29/111 (26%), Positives = 52/111 (46%), Gaps = 15/111 (13%) Query: 46 VWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPG---------IDGVGEISSQLM 96 ++ KK E FV+F +D S SLK++ ++ G +DGV + ++ + Sbjct: 260 LYGKKVEGTAFVIFGIQDGEQRISLPESLKRIPIEDGSGEVVLSRKVLLDGVQNLRAEDL 319 Query: 97 ----FTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGL 143 +S LHSG+ ++++SGI + + I FT+T Y G+ Sbjct: 320 VGKSLYVSATVILHSGSDM--VQAERSGIPIVTSPYQIHFTKTPKYFKPGM 368 >gi|239747104 PREDICTED: hypothetical protein XP_002344494 [Homo sapiens] Length = 173 Score = 33.5 bits (75), Expect = 0.10 Identities = 29/114 (25%), Positives = 47/114 (41%), Gaps = 12/114 (10%) Query: 3 LEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEG-FVVFLC 61 L PG C +++ ++ + G S + G + C+ W +G V C Sbjct: 31 LRPGSRSCTMSMSPTVIILACLGFFLDQSVWAHVGGQDKPFCSAWPSAVVPQGGHVTLRC 90 Query: 62 KDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLM---FTISQVTPLHSGTYQC 112 R G L + G+ V E+ +++ F IS VTP H+GTY+C Sbjct: 91 HCRRG-------FNIFTLYKKDGVP-VPELYNRIFWNSFLISPVTPAHAGTYRC 136 >gi|46488946 killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 3 [Homo sapiens] Length = 410 Score = 32.3 bits (72), Expect = 0.23 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 4/50 (8%) Query: 68 CSPETSLKQLRLKRDPGIDGVGEISSQLM---FTISQVTPLHSGTYQCCA 114 C + L ++ G+ V E+ +++ F + VTP H+GTY+CC+ Sbjct: 49 CRSRLGFNEFSLSKEDGMP-VPELYNRIFRNSFLMGPVTPAHAGTYRCCS 97 >gi|115298678 complement component 3 precursor [Homo sapiens] Length = 1663 Score = 32.0 bits (71), Expect = 0.30 Identities = 29/111 (26%), Positives = 51/111 (45%), Gaps = 15/111 (13%) Query: 46 VWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPG---------IDGVGEISSQLM 96 ++ KK E FV+F +D S SLK++ ++ G +DGV ++ + Sbjct: 260 LYGKKVEGTAFVIFGIQDGEQRISLPESLKRIPIEDGSGEVVLSRKVLLDGVQNPRAEDL 319 Query: 97 ----FTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGL 143 +S LHSG+ ++++SGI + + I FT+T Y G+ Sbjct: 320 VGKSLYVSATVILHSGSDM--VQAERSGIPIVTSPYQIHFTKTPKYFKPGM 368 >gi|4506805 sodium channel, voltage-gated, type I, beta isoform a [Homo sapiens] Length = 218 Score = 31.6 bits (70), Expect = 0.39 Identities = 39/184 (21%), Positives = 70/184 (38%), Gaps = 38/184 (20%) Query: 11 ALAILLAIVDIQSGGCINITSSASQE-GTRLNLICTVWHKKEE--AEGFVVFLCKDRSGD 67 AL + A+V GGC+ + S G ++C ++ E AE F + + + Sbjct: 6 ALVVGAALVSSACGGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKG-- 63 Query: 68 CSPETSLKQLRLKRDP----------------GIDGVGEISSQLMFTISQVTPLHSGTYQ 111 E +K LR + + G G ++ +F I+ VT HSG Y+ Sbjct: 64 --TEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIF-ITNVTYNHSGDYE 120 Query: 112 CCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVML 171 C H + +LF E + T + ++ H+E + + E + +L Sbjct: 121 C-------------HVYRLLFFENYEHN-TSVVKKIHIEVVDKANRDMASIVSEIMMYVL 166 Query: 172 VTSL 175 + L Sbjct: 167 IVVL 170 >gi|109240546 pregnancy specific beta-1-glycoprotein 3 [Homo sapiens] Length = 428 Score = 31.6 bits (70), Expect = 0.39 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 85 IDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGI 121 I+G ++S Q +F I Q+T HSG Y C R+ +G+ Sbjct: 368 INGKFQLSGQKLF-IPQITTKHSGLYACSVRNSATGM 403 >gi|4506175 pregnancy specific beta-1-glycoprotein 6 isoform a [Homo sapiens] Length = 435 Score = 31.2 bits (69), Expect = 0.51 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Query: 85 IDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVT 141 I+G ++S Q +F I Q+T HSG Y C R+ +G + + +ET + VT Sbjct: 367 INGKFQLSGQKLF-IPQITTNHSGLYACSVRNSATGKEISKSMI-VKVSETASPQVT 421 >gi|194328712 pregnancy specific beta-1-glycoprotein 8 isoform c [Homo sapiens] Length = 297 Score = 31.2 bits (69), Expect = 0.51 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Query: 85 IDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSG 120 I+G ++S Q +F I Q+T HSG Y C R+ +G Sbjct: 246 INGKFQLSGQKLF-IPQITTKHSGLYACSVRNSATG 280 >gi|194328710 pregnancy specific beta-1-glycoprotein 8 isoform b [Homo sapiens] Length = 419 Score = 31.2 bits (69), Expect = 0.51 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Query: 85 IDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSG 120 I+G ++S Q +F I Q+T HSG Y C R+ +G Sbjct: 368 INGKFQLSGQKLF-IPQITTKHSGLYACSVRNSATG 402 >gi|51510887 pregnancy specific beta-1-glycoprotein 8 isoform a [Homo sapiens] Length = 426 Score = 31.2 bits (69), Expect = 0.51 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Query: 85 IDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSG 120 I+G ++S Q +F I Q+T HSG Y C R+ +G Sbjct: 368 INGKFQLSGQKLF-IPQITTKHSGLYACSVRNSATG 402 >gi|39930610 sodium channel, voltage-gated, type I, beta isoform b [Homo sapiens] Length = 268 Score = 30.8 bits (68), Expect = 0.66 Identities = 36/159 (22%), Positives = 62/159 (38%), Gaps = 38/159 (23%) Query: 11 ALAILLAIVDIQSGGCINITSSASQE-GTRLNLICTVWHKKEE--AEGFVVFLCKDRSGD 67 AL + A+V GGC+ + S G ++C ++ E AE F + + + Sbjct: 6 ALVVGAALVSSACGGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKG-- 63 Query: 68 CSPETSLKQLRLKRDP----------------GIDGVGEISSQLMFTISQVTPLHSGTYQ 111 E +K LR + + G G ++ +F I+ VT HSG Y+ Sbjct: 64 --TEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIF-ITNVTYNHSGDYE 120 Query: 112 CCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLE 150 C H + +LF E + T + ++ H+E Sbjct: 121 C-------------HVYRLLFFENYEHN-TSVVKKIHIE 145 >gi|73661174 pregnancy specific beta-1-glycoprotein 6 isoform b [Homo sapiens] Length = 424 Score = 30.8 bits (68), Expect = 0.66 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Query: 85 IDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSG 120 I+G ++S Q +F I Q+T HSG Y C R+ +G Sbjct: 367 INGKFQLSGQKLF-IPQITTNHSGLYACSVRNSATG 401 >gi|66267727 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 5B precursor [Homo sapiens] Length = 375 Score = 30.0 bits (66), Expect = 1.1 Identities = 27/125 (21%), Positives = 51/125 (40%), Gaps = 12/125 (9%) Query: 16 LAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEG-FVVFLCKDRSGDCSPETSL 74 L ++ + G + + + EG + + + W G V LC+ R G Sbjct: 3 LMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLG-------F 55 Query: 75 KQLRLKRDPGIDGVGEISSQLMFT---ISQVTPLHSGTYQCCARSQKSGIRLQGHFFSIL 131 L ++ G+ V E+ +++ + + VTP H+GTY+C +S I ++ Sbjct: 56 TIFSLYKEDGVP-VPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLV 114 Query: 132 FTETG 136 TG Sbjct: 115 IVVTG 119 >gi|11968154 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 5A [Homo sapiens] Length = 375 Score = 30.0 bits (66), Expect = 1.1 Identities = 27/125 (21%), Positives = 51/125 (40%), Gaps = 12/125 (9%) Query: 16 LAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEG-FVVFLCKDRSGDCSPETSL 74 L ++ + G + + + EG + + + W G V LC+ R G Sbjct: 3 LMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLG-------F 55 Query: 75 KQLRLKRDPGIDGVGEISSQLMFT---ISQVTPLHSGTYQCCARSQKSGIRLQGHFFSIL 131 L ++ G+ V E+ +++ + + VTP H+GTY+C +S I ++ Sbjct: 56 TIFSLYKEDGVP-VPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLV 114 Query: 132 FTETG 136 TG Sbjct: 115 IVVTG 119 >gi|62632748 killer-cell Ig-like receptor [Homo sapiens] Length = 328 Score = 30.0 bits (66), Expect = 1.1 Identities = 24/101 (23%), Positives = 44/101 (43%), Gaps = 12/101 (11%) Query: 16 LAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEG-FVVFLCKDRSGDCSPETSL 74 L ++ + G + + + EG + + W +EG V C+ R G Sbjct: 3 LMVISMACVGFFLLQGAWTHEGGQDKPFLSAWPSPVVSEGEHVALQCRSRLG-------F 55 Query: 75 KQLRLKRDPGIDGVGEISSQLMFT---ISQVTPLHSGTYQC 112 + L ++ G+ V E+ +++ I VTP H+GTY+C Sbjct: 56 NEFSLSKEDGMP-VPELYNRVFRNTVFIGPVTPAHAGTYRC 95 >gi|169203189 PREDICTED: hypothetical protein LOC338667 [Homo sapiens] Length = 859 Score = 29.6 bits (65), Expect = 1.5 Identities = 23/79 (29%), Positives = 33/79 (41%), Gaps = 3/79 (3%) Query: 57 VVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARS 116 VV C R G P T Q R R G VG ++ +F + V H G Y C A + Sbjct: 165 VVATCAVREGT-EPVTFAWQHRAPRGLGEALVGV--TEPLFQLDPVNRTHLGWYMCSASN 221 Query: 117 QKSGIRLQGHFFSILFTET 135 + + G F +++ T Sbjct: 222 SVNRLSSDGAFLDVIYLAT 240 Score = 27.3 bits (59), Expect = 7.3 Identities = 24/73 (32%), Positives = 32/73 (43%), Gaps = 5/73 (6%) Query: 80 KRDPGIDG--VGEISSQLMFTISQVTPLHS-GTYQCCARSQKSGIRLQGHFFSIL-FTET 135 K DPG G + +QL I P H GTYQC AR+ G Q +L + Sbjct: 597 KVDPGTSGFMLHPEGAQLRLGIYDADPAHHRGTYQCVARN-AVGNSSQSVLLEVLRYPAP 655 Query: 136 GNYTVTGLKQRQH 148 N T++ L +H Sbjct: 656 PNVTISRLTYGRH 668 >gi|169203683 PREDICTED: hypothetical protein LOC338667 [Homo sapiens] Length = 859 Score = 29.6 bits (65), Expect = 1.5 Identities = 23/79 (29%), Positives = 33/79 (41%), Gaps = 3/79 (3%) Query: 57 VVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARS 116 VV C R G P T Q R R G VG ++ +F + V H G Y C A + Sbjct: 165 VVATCAVREGT-EPVTFAWQHRAPRGLGEALVGV--TEPLFQLDPVNRTHLGWYMCSASN 221 Query: 117 QKSGIRLQGHFFSILFTET 135 + + G F +++ T Sbjct: 222 SVNRLSSDGAFLDVIYLAT 240 Score = 27.3 bits (59), Expect = 7.3 Identities = 24/73 (32%), Positives = 32/73 (43%), Gaps = 5/73 (6%) Query: 80 KRDPGIDG--VGEISSQLMFTISQVTPLHS-GTYQCCARSQKSGIRLQGHFFSIL-FTET 135 K DPG G + +QL I P H GTYQC AR+ G Q +L + Sbjct: 597 KVDPGTSGFMLHPEGAQLRLGIYDADPAHHRGTYQCVARN-AVGNSSQSVLLEVLRYPAP 655 Query: 136 GNYTVTGLKQRQH 148 N T++ L +H Sbjct: 656 PNVTISRLTYGRH 668 >gi|169202109 PREDICTED: hypothetical protein LOC338667 [Homo sapiens] Length = 859 Score = 29.6 bits (65), Expect = 1.5 Identities = 23/79 (29%), Positives = 33/79 (41%), Gaps = 3/79 (3%) Query: 57 VVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARS 116 VV C R G P T Q R R G VG ++ +F + V H G Y C A + Sbjct: 165 VVATCAVREGT-EPVTFAWQHRAPRGLGEALVGV--TEPLFQLDPVNRTHLGWYMCSASN 221 Query: 117 QKSGIRLQGHFFSILFTET 135 + + G F +++ T Sbjct: 222 SVNRLSSDGAFLDVIYLAT 240 Score = 27.3 bits (59), Expect = 7.3 Identities = 24/73 (32%), Positives = 32/73 (43%), Gaps = 5/73 (6%) Query: 80 KRDPGIDG--VGEISSQLMFTISQVTPLHS-GTYQCCARSQKSGIRLQGHFFSIL-FTET 135 K DPG G + +QL I P H GTYQC AR+ G Q +L + Sbjct: 597 KVDPGTSGFMLHPEGAQLRLGIYDADPAHHRGTYQCVARN-AVGNSSQSVLLEVLRYPAP 655 Query: 136 GNYTVTGLKQRQH 148 N T++ L +H Sbjct: 656 PNVTISRLTYGRH 668 >gi|122937241 SH3 and multiple ankyrin repeat domains 3 [Homo sapiens] Length = 1747 Score = 29.6 bits (65), Expect = 1.5 Identities = 17/73 (23%), Positives = 34/73 (46%), Gaps = 2/73 (2%) Query: 6 GRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFL--CKD 63 G G A+ + + I D+Q C+ + +A + ++C + H ++A + +F + Sbjct: 3 GPGASAVVVRVGIPDLQQTKCLRLDPAAPVWAAKQRVLCALNHSLQDALNYGLFQPPSRG 62 Query: 64 RSGDCSPETSLKQ 76 R+G E L Q Sbjct: 63 RAGKFLDEERLLQ 75 >gi|124107604 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 isoform b [Homo sapiens] Length = 273 Score = 29.3 bits (64), Expect = 1.9 Identities = 11/16 (68%), Positives = 13/16 (81%) Query: 97 FTISQVTPLHSGTYQC 112 F IS VTP H+GTY+C Sbjct: 82 FLISPVTPAHAGTYRC 97 >gi|124107606 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 isoform a [Homo sapiens] Length = 377 Score = 29.3 bits (64), Expect = 1.9 Identities = 11/16 (68%), Positives = 13/16 (81%) Query: 97 FTISQVTPLHSGTYQC 112 F IS VTP H+GTY+C Sbjct: 82 FLISPVTPAHAGTYRC 97 >gi|124107610 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 isoform c [Homo sapiens] Length = 342 Score = 29.3 bits (64), Expect = 1.9 Identities = 11/16 (68%), Positives = 13/16 (81%) Query: 97 FTISQVTPLHSGTYQC 112 F IS VTP H+GTY+C Sbjct: 82 FLISPVTPAHAGTYRC 97 >gi|47419900 pregnancy specific beta-1-glycoprotein 4 isoform 2 [Homo sapiens] Length = 326 Score = 29.3 bits (64), Expect = 1.9 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Query: 85 IDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSG 120 I+G ++S Q + +I Q+T HSG Y C R+ +G Sbjct: 275 INGKFQLSGQKL-SIPQITTKHSGLYACSVRNSATG 309 >gi|42560235 pregnancy specific beta-1-glycoprotein 4 isoform 1 [Homo sapiens] Length = 419 Score = 29.3 bits (64), Expect = 1.9 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Query: 85 IDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSG 120 I+G ++S Q + +I Q+T HSG Y C R+ +G Sbjct: 368 INGKFQLSGQKL-SIPQITTKHSGLYACSVRNSATG 402 >gi|157805480 pregnancy specific beta-1-glycoprotein 7 precursor [Homo sapiens] Length = 419 Score = 29.3 bits (64), Expect = 1.9 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Query: 85 IDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSG 120 I+G ++S Q + +I Q+T HSG Y C R+ +G Sbjct: 368 INGKFQLSGQKL-SIPQITTKHSGLYACSVRNSATG 402 >gi|19557668 osteoclast-associated receptor isoform 4 [Homo sapiens] Length = 263 Score = 28.9 bits (63), Expect = 2.5 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Query: 90 EISSQLM-FTISQVTPLHSGTYQCCAR 115 ++SS+L F + +VTP G Y+CC R Sbjct: 77 DVSSELAEFFLEEVTPAQGGIYRCCYR 103 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.321 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,686,007 Number of Sequences: 37866 Number of extensions: 269998 Number of successful extensions: 770 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 37 Number of HSP's that attempted gapping in prelim test: 711 Number of HSP's gapped (non-prelim): 100 length of query: 181 length of database: 18,247,518 effective HSP length: 96 effective length of query: 85 effective length of database: 14,612,382 effective search space: 1242052470 effective search space used: 1242052470 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 58 (26.9 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.