BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|62530388 mitochondrial ribosomal protein L22 isoform b [Homo sapiens] (126 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|62530388 mitochondrial ribosomal protein L22 isoform b [Homo ... 259 5e-70 gi|21265040 mitochondrial ribosomal protein L22 isoform a [Homo ... 259 5e-70 gi|239753114 PREDICTED: hypothetical protein [Homo sapiens] 31 0.22 gi|38683840 CD96 antigen isoform 1 precursor [Homo sapiens] 29 0.83 gi|5032141 CD96 antigen isoform 2 precursor [Homo sapiens] 29 0.83 gi|29558099 protein phosphatase 1B isoform 3 [Homo sapiens] 29 0.83 gi|4505995 protein phosphatase 1B isoform 1 [Homo sapiens] 29 0.83 gi|31377595 zinc finger CCCH-type containing 18 [Homo sapiens] 29 0.83 gi|239743040 PREDICTED: hypothetical protein LOC401287 [Homo sap... 29 1.1 gi|149363674 hypothetical protein LOC25758 [Homo sapiens] 29 1.1 gi|7657461 phospholipase A2, group IIE [Homo sapiens] 29 1.1 gi|88703045 proline rich 11 [Homo sapiens] 29 1.1 gi|18079216 CASK interacting protein 1 [Homo sapiens] 28 1.8 gi|110349719 titin isoform N2-A [Homo sapiens] 28 1.8 gi|239754466 PREDICTED: hypothetical protein LOC401287 [Homo sap... 28 1.8 gi|239749021 PREDICTED: hypothetical protein LOC401287 [Homo sap... 28 1.8 gi|117938310 sine oculis binding protein homolog [Homo sapiens] 28 1.8 gi|169207217 PREDICTED: zinc finger homeobox 2 [Homo sapiens] 28 2.4 gi|169207592 PREDICTED: zinc finger homeobox 2 [Homo sapiens] 28 2.4 gi|169207014 PREDICTED: zinc finger homeobox 2 [Homo sapiens] 28 2.4 gi|239754042 PREDICTED: similar to hCG1646049 [Homo sapiens] 27 3.2 gi|239748572 PREDICTED: similar to hCG1646049 [Homo sapiens] 27 3.2 gi|169167670 PREDICTED: similar to hCG1646049 [Homo sapiens] 27 3.2 gi|31543397 phosphoglycerate kinase 2 [Homo sapiens] 27 3.2 gi|14589876 embryonal Fyn-associated substrate isoform 2 [Homo s... 27 3.2 gi|5031681 embryonal Fyn-associated substrate isoform 1 [Homo sa... 27 3.2 gi|32698936 B-cell CLL/lymphoma 9-like [Homo sapiens] 27 3.2 gi|164698460 mannosidase, endo-alpha-like isoform 3 [Homo sapiens] 27 3.2 gi|72534766 mannosidase, endo-alpha-like isoform 1 [Homo sapiens] 27 3.2 gi|172072597 retinoblastoma-like 2 (p130) [Homo sapiens] 27 4.1 >gi|62530388 mitochondrial ribosomal protein L22 isoform b [Homo sapiens] Length = 126 Score = 259 bits (661), Expect = 5e-70 Identities = 126/126 (100%), Positives = 126/126 (100%) Query: 1 MWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAEST 60 MWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAEST Sbjct: 1 MWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAEST 60 Query: 61 SGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQLRSR 120 SGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQLRSR Sbjct: 61 SGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQLRSR 120 Query: 121 TIVHTL 126 TIVHTL Sbjct: 121 TIVHTL 126 >gi|21265040 mitochondrial ribosomal protein L22 isoform a [Homo sapiens] Length = 206 Score = 259 bits (661), Expect = 5e-70 Identities = 126/126 (100%), Positives = 126/126 (100%) Query: 1 MWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAEST 60 MWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAEST Sbjct: 81 MWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAEST 140 Query: 61 SGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQLRSR 120 SGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQLRSR Sbjct: 141 SGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQLRSR 200 Query: 121 TIVHTL 126 TIVHTL Sbjct: 201 TIVHTL 206 >gi|239753114 PREDICTED: hypothetical protein [Homo sapiens] Length = 322 Score = 31.2 bits (69), Expect = 0.22 Identities = 17/57 (29%), Positives = 24/57 (42%), Gaps = 3/57 (5%) Query: 55 YIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAK 111 Y+A G R+R G+ + CH + E PPPPP P T A ++ Sbjct: 142 YVAGDLGASGAVSARVRARASLALGL--PIQCHRHIS-TEPPPPPPAAPATGSAQSR 195 >gi|38683840 CD96 antigen isoform 1 precursor [Homo sapiens] Length = 585 Score = 29.3 bits (64), Expect = 0.83 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Query: 78 FGIMEKVYCHYFVKLVEGPPP--PPEPP 103 FG+ + +C Y +++E PPP PP PP Sbjct: 536 FGLGVRKWCQYQKEIMERPPPFKPPPPP 563 >gi|5032141 CD96 antigen isoform 2 precursor [Homo sapiens] Length = 569 Score = 29.3 bits (64), Expect = 0.83 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Query: 78 FGIMEKVYCHYFVKLVEGPPP--PPEPP 103 FG+ + +C Y +++E PPP PP PP Sbjct: 520 FGLGVRKWCQYQKEIMERPPPFKPPPPP 547 >gi|29558099 protein phosphatase 1B isoform 3 [Homo sapiens] Length = 192 Score = 29.3 bits (64), Expect = 0.83 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 4/56 (7%) Query: 57 AESTSGRG---QCLKRIRYHGRGRFG-IMEKVYCHYFVKLVEGPPPPPEPPKTAVA 108 AE + +G + L+++R + RG + ++E++ Y + VEG P EP TA + Sbjct: 96 AEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATS 151 >gi|4505995 protein phosphatase 1B isoform 1 [Homo sapiens] Length = 479 Score = 29.3 bits (64), Expect = 0.83 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 4/56 (7%) Query: 57 AESTSGRG---QCLKRIRYHGRGRFG-IMEKVYCHYFVKLVEGPPPPPEPPKTAVA 108 AE + +G + L+++R + RG + ++E++ Y + VEG P EP TA + Sbjct: 383 AEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATS 438 >gi|31377595 zinc finger CCCH-type containing 18 [Homo sapiens] Length = 953 Score = 29.3 bits (64), Expect = 0.83 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 5/30 (16%) Query: 96 PPPPPEPP-----KTAVAHAKEYIQQLRSR 120 PPPPPEPP + + HAKE +++ R Sbjct: 289 PPPPPEPPTESAWERGLRHAKEVLKKATIR 318 >gi|239743040 PREDICTED: hypothetical protein LOC401287 [Homo sapiens] Length = 573 Score = 28.9 bits (63), Expect = 1.1 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Query: 64 GQCLKRIRYHGRGRFGIMEKVYCHYFVKLVE--GPPPPPEPPKTAVAHAKE 112 G+ L RI G G FGI E V +F L + G PPP P K +K+ Sbjct: 259 GEGLLRIE-SGDGTFGISENVDAAFFCFLRDPSGASPPPLPLKACCERSKD 308 >gi|149363674 hypothetical protein LOC25758 [Homo sapiens] Length = 1855 Score = 28.9 bits (63), Expect = 1.1 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Query: 91 KLVEGPPPPPEPPKT---AVAHAKEYIQQLRSRT 121 ++V G PPPP PP+T AVA + + S+T Sbjct: 1638 EMVMGSPPPPVPPRTGPVAVASLRRSTSDIGSKT 1671 >gi|7657461 phospholipase A2, group IIE [Homo sapiens] Length = 142 Score = 28.9 bits (63), Expect = 1.1 Identities = 14/35 (40%), Positives = 16/35 (45%) Query: 65 QCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPP 99 +C KR R G + Y HY KL GP PP Sbjct: 107 ECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPP 141 >gi|88703045 proline rich 11 [Homo sapiens] Length = 360 Score = 28.9 bits (63), Expect = 1.1 Identities = 10/27 (37%), Positives = 16/27 (59%) Query: 82 EKVYCHYFVKLVEGPPPPPEPPKTAVA 108 +K H+ KL+ PPPPP P + ++ Sbjct: 21 KKEASHFQSKLITPPPPPPSPERVGIS 47 >gi|18079216 CASK interacting protein 1 [Homo sapiens] Length = 1431 Score = 28.1 bits (61), Expect = 1.8 Identities = 10/14 (71%), Positives = 11/14 (78%) Query: 96 PPPPPEPPKTAVAH 109 PPPP EPP T +AH Sbjct: 1194 PPPPAEPPPTDLAH 1207 >gi|110349719 titin isoform N2-A [Homo sapiens] Length = 33423 Score = 28.1 bits (61), Expect = 1.8 Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 3/24 (12%) Query: 96 PPPPPEPPKTAVAHAKEYIQQLRS 119 PPPPP PPK V KE I QL++ Sbjct: 10882 PPPPPAPPKEDV---KEKIFQLKA 10902 >gi|239754466 PREDICTED: hypothetical protein LOC401287 [Homo sapiens] Length = 573 Score = 28.1 bits (61), Expect = 1.8 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Query: 74 GRGRFGIMEKVYCHYFVKLVE--GPPPPPEPPKTAVAHAKE 112 G G FGI E V +F L + G PPP P K +K+ Sbjct: 268 GDGTFGISENVEAAFFCFLRDPSGASPPPLPLKACCERSKD 308 >gi|239749021 PREDICTED: hypothetical protein LOC401287 [Homo sapiens] Length = 573 Score = 28.1 bits (61), Expect = 1.8 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Query: 74 GRGRFGIMEKVYCHYFVKLVE--GPPPPPEPPKTAVAHAKE 112 G G FGI E V +F L + G PPP P K +K+ Sbjct: 268 GDGTFGISENVEAAFFCFLRDPSGASPPPLPLKACCERSKD 308 >gi|117938310 sine oculis binding protein homolog [Homo sapiens] Length = 873 Score = 28.1 bits (61), Expect = 1.8 Identities = 10/24 (41%), Positives = 15/24 (62%) Query: 96 PPPPPEPPKTAVAHAKEYIQQLRS 119 PPPPP PPK ++ + + +L S Sbjct: 747 PPPPPAPPKKLLSPEEPAVSELES 770 >gi|169207217 PREDICTED: zinc finger homeobox 2 [Homo sapiens] Length = 2790 Score = 27.7 bits (60), Expect = 2.4 Identities = 9/13 (69%), Positives = 11/13 (84%) Query: 96 PPPPPEPPKTAVA 108 PPPPP+PPK +A Sbjct: 1612 PPPPPQPPKAELA 1624 >gi|169207592 PREDICTED: zinc finger homeobox 2 [Homo sapiens] Length = 2706 Score = 27.7 bits (60), Expect = 2.4 Identities = 9/13 (69%), Positives = 11/13 (84%) Query: 96 PPPPPEPPKTAVA 108 PPPPP+PPK +A Sbjct: 1528 PPPPPQPPKAELA 1540 >gi|169207014 PREDICTED: zinc finger homeobox 2 [Homo sapiens] Length = 2706 Score = 27.7 bits (60), Expect = 2.4 Identities = 9/13 (69%), Positives = 11/13 (84%) Query: 96 PPPPPEPPKTAVA 108 PPPPP+PPK +A Sbjct: 1528 PPPPPQPPKAELA 1540 >gi|239754042 PREDICTED: similar to hCG1646049 [Homo sapiens] Length = 346 Score = 27.3 bits (59), Expect = 3.2 Identities = 13/28 (46%), Positives = 14/28 (50%) Query: 91 KLVEGPPPPPEPPKTAVAHAKEYIQQLR 118 KL +GPPP P PP T Q LR Sbjct: 162 KLGKGPPPRPAPPGTRCCPGARAAQLLR 189 >gi|239748572 PREDICTED: similar to hCG1646049 [Homo sapiens] Length = 346 Score = 27.3 bits (59), Expect = 3.2 Identities = 13/28 (46%), Positives = 14/28 (50%) Query: 91 KLVEGPPPPPEPPKTAVAHAKEYIQQLR 118 KL +GPPP P PP T Q LR Sbjct: 162 KLGKGPPPRPAPPGTRCCPGARAAQLLR 189 >gi|169167670 PREDICTED: similar to hCG1646049 [Homo sapiens] Length = 346 Score = 27.3 bits (59), Expect = 3.2 Identities = 13/28 (46%), Positives = 14/28 (50%) Query: 91 KLVEGPPPPPEPPKTAVAHAKEYIQQLR 118 KL +GPPP P PP T Q LR Sbjct: 162 KLGKGPPPRPAPPGTRCCPGARAAQLLR 189 >gi|31543397 phosphoglycerate kinase 2 [Homo sapiens] Length = 417 Score = 27.3 bits (59), Expect = 3.2 Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 5/39 (12%) Query: 6 KLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVR 44 K++ M I +L D++GAKI+K+++ +AQ VR Sbjct: 246 KVLNNMEIGASLF-----DEEGAKIVKDIMAKAQKNGVR 279 >gi|14589876 embryonal Fyn-associated substrate isoform 2 [Homo sapiens] Length = 468 Score = 27.3 bits (59), Expect = 3.2 Identities = 10/25 (40%), Positives = 16/25 (64%) Query: 97 PPPPEPPKTAVAHAKEYIQQLRSRT 121 PP PEPP +H ++ + QL +R+ Sbjct: 170 PPSPEPPGALASHDQDTLAQLLARS 194 >gi|5031681 embryonal Fyn-associated substrate isoform 1 [Homo sapiens] Length = 561 Score = 27.3 bits (59), Expect = 3.2 Identities = 10/25 (40%), Positives = 16/25 (64%) Query: 97 PPPPEPPKTAVAHAKEYIQQLRSRT 121 PP PEPP +H ++ + QL +R+ Sbjct: 263 PPSPEPPGALASHDQDTLAQLLARS 287 >gi|32698936 B-cell CLL/lymphoma 9-like [Homo sapiens] Length = 1499 Score = 27.3 bits (59), Expect = 3.2 Identities = 10/26 (38%), Positives = 16/26 (61%) Query: 94 EGPPPPPEPPKTAVAHAKEYIQQLRS 119 + PPPP +PP + K+Y + L+S Sbjct: 446 QAPPPPQQPPTAPPSGLKKYEEPLQS 471 >gi|164698460 mannosidase, endo-alpha-like isoform 3 [Homo sapiens] Length = 457 Score = 27.3 bits (59), Expect = 3.2 Identities = 9/11 (81%), Positives = 10/11 (90%) Query: 96 PPPPPEPPKTA 106 PPPPP PP+TA Sbjct: 68 PPPPPPPPRTA 78 >gi|72534766 mannosidase, endo-alpha-like isoform 1 [Homo sapiens] Length = 250 Score = 27.3 bits (59), Expect = 3.2 Identities = 9/11 (81%), Positives = 10/11 (90%) Query: 96 PPPPPEPPKTA 106 PPPPP PP+TA Sbjct: 68 PPPPPPPPRTA 78 >gi|172072597 retinoblastoma-like 2 (p130) [Homo sapiens] Length = 1139 Score = 26.9 bits (58), Expect = 4.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Query: 94 EGPPPPPEPPKTAVAHAKE 112 + PPPPP PP A + +E Sbjct: 7 QSPPPPPPPPAAAASDEEE 25 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.323 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,558,894 Number of Sequences: 37866 Number of extensions: 266936 Number of successful extensions: 4380 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 13 Number of HSP's that attempted gapping in prelim test: 4065 Number of HSP's gapped (non-prelim): 278 length of query: 126 length of database: 18,247,518 effective HSP length: 90 effective length of query: 36 effective length of database: 14,839,578 effective search space: 534224808 effective search space used: 534224808 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.