BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|62122851 small proline-rich protein 2G [Homo sapiens] (73 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|62122851 small proline-rich protein 2G [Homo sapiens] 187 2e-48 gi|83582817 small proline-rich protein 2E [Homo sapiens] 145 7e-36 gi|5174693 small proline-rich protein 2A [Homo sapiens] 145 9e-36 gi|62955831 small proline-rich protein 2B [Homo sapiens] 144 1e-35 gi|62945419 small proline-rich protein 2F [Homo sapiens] 140 2e-34 gi|56699492 small proline-rich protein 2D [Homo sapiens] 138 1e-33 gi|45827734 small proline-rich protein 1A [Homo sapiens] 63 4e-11 gi|83582815 small proline-rich protein 1B [Homo sapiens] 62 7e-11 gi|239752912 PREDICTED: hypothetical protein [Homo sapiens] 61 2e-10 gi|30387654 late cornified envelope 1A [Homo sapiens] 61 2e-10 gi|30387646 late cornified envelope 1F [Homo sapiens] 61 2e-10 gi|30387650 late cornified envelope 1E [Homo sapiens] 61 2e-10 gi|30387652 late cornified envelope 1C [Homo sapiens] 61 2e-10 gi|30410035 late cornified envelope 5A [Homo sapiens] 60 5e-10 gi|30410043 late cornified envelope 2D [Homo sapiens] 57 3e-09 gi|58082087 late cornified envelope-like proline-rich 1 [Homo sa... 57 4e-09 gi|30410047 late cornified envelope 2C [Homo sapiens] 56 7e-09 gi|30410045 late cornified envelope 2A [Homo sapiens] 55 2e-08 gi|27436869 small proline-rich protein 4 [Homo sapiens] 55 2e-08 gi|153792074 proline rich 12 [Homo sapiens] 55 2e-08 gi|30387656 late cornified envelope 1B [Homo sapiens] 53 4e-08 gi|7657685 late cornified envelope 2B [Homo sapiens] 52 1e-07 gi|30387648 late cornified envelope 1D [Homo sapiens] 52 1e-07 gi|119120861 formin-like 3 isoform 2 [Homo sapiens] 52 1e-07 gi|119120874 formin-like 3 isoform 1 [Homo sapiens] 52 1e-07 gi|90903231 huntingtin [Homo sapiens] 50 3e-07 gi|33356148 formin-like 1 [Homo sapiens] 50 3e-07 gi|7662046 myeloid/lymphoid or mixed-lineage leukemia 4 [Homo sa... 50 4e-07 gi|146134388 YLP motif containing 1 [Homo sapiens] 49 8e-07 gi|30410037 late cornified envelope 3C [Homo sapiens] 49 1e-06 >gi|62122851 small proline-rich protein 2G [Homo sapiens] Length = 73 Score = 187 bits (474), Expect = 2e-48 Identities = 73/73 (100%), Positives = 73/73 (100%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQP 60 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQP Sbjct: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQP 60 Query: 61 YPPCQQKYPPKSK 73 YPPCQQKYPPKSK Sbjct: 61 YPPCQQKYPPKSK 73 >gi|83582817 small proline-rich protein 2E [Homo sapiens] Length = 72 Score = 145 bits (366), Expect = 7e-36 Identities = 60/73 (82%), Positives = 61/73 (83%), Gaps = 1/73 (1%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQP 60 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEP PP C P+ CPP CQ KCPPV P Sbjct: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKC-PQPCPPQQCQQKCPPVTP 59 Query: 61 YPPCQQKYPPKSK 73 PPCQ K PPKSK Sbjct: 60 SPPCQPKCPPKSK 72 >gi|5174693 small proline-rich protein 2A [Homo sapiens] Length = 72 Score = 145 bits (365), Expect = 9e-36 Identities = 60/73 (82%), Positives = 61/73 (83%), Gaps = 1/73 (1%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQP 60 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEP PP C P+ CPP CQ K PPV P Sbjct: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKC-PQPCPPQQCQQKYPPVTP 59 Query: 61 YPPCQQKYPPKSK 73 PPCQ KYPPKSK Sbjct: 60 SPPCQSKYPPKSK 72 >gi|62955831 small proline-rich protein 2B [Homo sapiens] Length = 72 Score = 144 bits (364), Expect = 1e-35 Identities = 60/73 (82%), Positives = 61/73 (83%), Gaps = 1/73 (1%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQP 60 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEP PP C P+ CPP CQ K PPV P Sbjct: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKC-PQPCPPQQCQQKYPPVTP 59 Query: 61 YPPCQQKYPPKSK 73 PPCQ KYPPKSK Sbjct: 60 SPPCQPKYPPKSK 72 >gi|62945419 small proline-rich protein 2F [Homo sapiens] Length = 72 Score = 140 bits (354), Expect = 2e-34 Identities = 58/73 (79%), Positives = 59/73 (80%), Gaps = 1/73 (1%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQP 60 MSYQQQQCKQPCQPPPVCP PKCPEPCPPPKCPEP P C P+ CPP CQ KCPPV P Sbjct: 1 MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKC-PQSCPPQQCQQKCPPVTP 59 Query: 61 YPPCQQKYPPKSK 73 PPCQ K PPKSK Sbjct: 60 SPPCQPKCPPKSK 72 >gi|56699492 small proline-rich protein 2D [Homo sapiens] Length = 72 Score = 138 bits (347), Expect = 1e-33 Identities = 58/73 (79%), Positives = 59/73 (80%), Gaps = 1/73 (1%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQP 60 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEP P C P+ CPP CQ K PPV P Sbjct: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKC-PQPCPPQQCQQKYPPVTP 59 Query: 61 YPPCQQKYPPKSK 73 PPCQ K PPKSK Sbjct: 60 SPPCQPKCPPKSK 72 >gi|45827734 small proline-rich protein 1A [Homo sapiens] Length = 89 Score = 63.2 bits (152), Expect = 4e-11 Identities = 39/76 (51%), Positives = 41/76 (53%), Gaps = 11/76 (14%) Query: 4 QQQQCKQPCQPPPVCP-TPKCPEPCPPPKCPE---PYLPPPCPPEHCPPPPCQDK----C 55 QQQQ KQPCQPPP P PK EPC PK PE P +P PC P+ P PCQ K C Sbjct: 17 QQQQVKQPCQPPPQEPCIPKTKEPC-HPKVPEPCHPKVPEPCQPK--VPEPCQPKVPEPC 73 Query: 56 PPVQPYPPCQQKYPPK 71 P P QQK K Sbjct: 74 PSTVTPAPAQQKTKQK 89 Score = 52.8 bits (125), Expect = 6e-08 Identities = 32/70 (45%), Positives = 36/70 (51%), Gaps = 9/70 (12%) Query: 6 QQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPP---PCPPEHCPPPPCQDKCP-PVQPY 61 QQ KQPC PPP + +PC PP EP +P PC P+ P PC K P P QP Sbjct: 4 QQQKQPCTPPPQPQQQQVKQPCQPPP-QEPCIPKTKEPCHPK--VPEPCHPKVPEPCQPK 60 Query: 62 --PPCQQKYP 69 PCQ K P Sbjct: 61 VPEPCQPKVP 70 >gi|83582815 small proline-rich protein 1B [Homo sapiens] Length = 89 Score = 62.4 bits (150), Expect = 7e-11 Identities = 38/76 (50%), Positives = 41/76 (53%), Gaps = 11/76 (14%) Query: 4 QQQQCKQPCQPPPVCPT-PKCPEPCPPPKCPE---PYLPPPCPPEHCPPPPCQDK----C 55 QQQQ KQPCQPPP P PK EPC PK PE P +P PC P+ P PC K C Sbjct: 17 QQQQVKQPCQPPPQEPCIPKTKEPC-HPKVPEPCHPKVPEPCQPK--VPEPCHPKVPEPC 73 Query: 56 PPVQPYPPCQQKYPPK 71 P + P QQK K Sbjct: 74 PSIVTPAPAQQKTKQK 89 Score = 52.4 bits (124), Expect = 8e-08 Identities = 33/79 (41%), Positives = 38/79 (48%), Gaps = 19/79 (24%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPC-PPPKCP---------EPYLPPPCPPEHCPPPP 50 MS QQQ KQPC PPP + +PC PPP+ P P +P PC P+ P P Sbjct: 1 MSSQQQ--KQPCTPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPK--VPEP 56 Query: 51 CQDKCPPVQPYPPCQQKYP 69 CQ K P PC K P Sbjct: 57 CQPKVP-----EPCHPKVP 70 >gi|239752912 PREDICTED: hypothetical protein [Homo sapiens] Length = 118 Score = 60.8 bits (146), Expect = 2e-10 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 2/38 (5%) Query: 6 QQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPP 43 QQ +Q CQPPP C TPKCP CP PKCP P PP CPP Sbjct: 4 QQSQQQCQPPPKC-TPKCPPKCPTPKCP-PKCPPKCPP 39 Score = 39.3 bits (90), Expect = 7e-04 Identities = 15/25 (60%), Positives = 15/25 (60%) Query: 47 PPPPCQDKCPPVQPYPPCQQKYPPK 71 PPP C KCPP P P C K PPK Sbjct: 12 PPPKCTPKCPPKCPTPKCPPKCPPK 36 >gi|30387654 late cornified envelope 1A [Homo sapiens] Length = 110 Score = 60.8 bits (146), Expect = 2e-10 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 2/38 (5%) Query: 6 QQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPP 43 QQ +Q CQPPP C TPKCP CP PKCP P PP CPP Sbjct: 4 QQSQQQCQPPPKC-TPKCPPKCPTPKCP-PKCPPKCPP 39 Score = 39.3 bits (90), Expect = 7e-04 Identities = 15/25 (60%), Positives = 15/25 (60%) Query: 47 PPPPCQDKCPPVQPYPPCQQKYPPK 71 PPP C KCPP P P C K PPK Sbjct: 12 PPPKCTPKCPPKCPTPKCPPKCPPK 36 >gi|30387646 late cornified envelope 1F [Homo sapiens] Length = 118 Score = 60.8 bits (146), Expect = 2e-10 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 2/38 (5%) Query: 6 QQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPP 43 QQ +Q CQPPP C TPKCP CP PKCP P PP CPP Sbjct: 4 QQSQQQCQPPPKC-TPKCPPKCPTPKCP-PKCPPKCPP 39 Score = 39.3 bits (90), Expect = 7e-04 Identities = 15/25 (60%), Positives = 15/25 (60%) Query: 47 PPPPCQDKCPPVQPYPPCQQKYPPK 71 PPP C KCPP P P C K PPK Sbjct: 12 PPPKCTPKCPPKCPTPKCPPKCPPK 36 >gi|30387650 late cornified envelope 1E [Homo sapiens] Length = 118 Score = 60.8 bits (146), Expect = 2e-10 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 2/38 (5%) Query: 6 QQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPP 43 QQ +Q CQPPP C TPKCP CP PKCP P PP CPP Sbjct: 4 QQSQQQCQPPPKC-TPKCPPKCPTPKCP-PKCPPKCPP 39 Score = 39.3 bits (90), Expect = 7e-04 Identities = 15/25 (60%), Positives = 15/25 (60%) Query: 47 PPPPCQDKCPPVQPYPPCQQKYPPK 71 PPP C KCPP P P C K PPK Sbjct: 12 PPPKCTPKCPPKCPTPKCPPKCPPK 36 >gi|30387652 late cornified envelope 1C [Homo sapiens] Length = 118 Score = 60.8 bits (146), Expect = 2e-10 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 2/38 (5%) Query: 6 QQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPP 43 QQ +Q CQPPP C TPKCP CP PKCP P PP CPP Sbjct: 4 QQSQQQCQPPPKC-TPKCPPKCPTPKCP-PKCPPKCPP 39 Score = 39.3 bits (90), Expect = 7e-04 Identities = 15/25 (60%), Positives = 15/25 (60%) Query: 47 PPPPCQDKCPPVQPYPPCQQKYPPK 71 PPP C KCPP P P C K PPK Sbjct: 12 PPPKCTPKCPPKCPTPKCPPKCPPK 36 >gi|30410035 late cornified envelope 5A [Homo sapiens] Length = 118 Score = 59.7 bits (143), Expect = 5e-10 Identities = 29/47 (61%), Positives = 31/47 (65%), Gaps = 6/47 (12%) Query: 6 QQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPE---HCPPP 49 QQ +Q CQPPP C TPKCP C PKCP P PP CPP+ CPPP Sbjct: 4 QQSQQQCQPPPKC-TPKCPPKC-TPKCP-PKCPPKCPPQCSAPCPPP 47 >gi|30410043 late cornified envelope 2D [Homo sapiens] Length = 110 Score = 57.0 bits (136), Expect = 3e-09 Identities = 33/62 (53%), Positives = 33/62 (53%), Gaps = 9/62 (14%) Query: 1 MSYQQQQCKQPCQPPPVCP---TPKCPEPCPPPKCPEPYLPPPCPP--EHCPPPPCQDKC 55 MS QQ Q Q CQPPP CP TPKCP C PPKCP P P PC P C P C Sbjct: 1 MSCQQNQ--QQCQPPPKCPPKCTPKCPPKC-PPKCP-PQCPAPCSPAVSSCCGPSSGSCC 56 Query: 56 PP 57 P Sbjct: 57 GP 58 Score = 26.6 bits (57), Expect = 4.5 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 8/28 (28%) Query: 44 EHCPPPPCQDKCPPVQPYPPCQQKYPPK 71 + C PPP KCPP C K PPK Sbjct: 8 QQCQPPP---KCPP-----KCTPKCPPK 27 >gi|58082087 late cornified envelope-like proline-rich 1 [Homo sapiens] Length = 98 Score = 56.6 bits (135), Expect = 4e-09 Identities = 29/70 (41%), Positives = 34/70 (48%), Gaps = 5/70 (7%) Query: 5 QQQCKQPCQPPPVCPT-PKCPEPCPPPKCPEPYLPPPCP---PEHCPPPPCQDKCPPVQP 60 +Q+C+ CQP + +C E CP KCP P PCP P CPP PC CPP P Sbjct: 24 EQKCESKCQPSCLKKLLQRCFEKCPWEKCPAPPKCLPCPSQSPSSCPPQPCTKPCPPKCP 83 Query: 61 YPPCQQKYPP 70 C PP Sbjct: 84 -SSCPHACPP 92 Score = 45.1 bits (105), Expect = 1e-05 Identities = 21/39 (53%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Query: 11 PCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPP 49 P Q P CP C +PCPP KCP P CPP CPPP Sbjct: 62 PSQSPSSCPPQPCTKPCPP-KCPSS-CPHACPPP-CPPP 97 Score = 36.2 bits (82), Expect = 0.006 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 5/29 (17%) Query: 6 QQCKQPCQPPPVCPTP---KCPEPCPPPK 31 Q C +PC PP CP+ CP PCPPP+ Sbjct: 72 QPCTKPC--PPKCPSSCPHACPPPCPPPE 98 Score = 35.8 bits (81), Expect = 0.007 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 6/29 (20%) Query: 10 QPCQPPPVCPTPKCPEPCP---PPKCPEP 35 QPC P CP PKCP CP PP CP P Sbjct: 72 QPCTKP--CP-PKCPSSCPHACPPPCPPP 97 >gi|30410047 late cornified envelope 2C [Homo sapiens] Length = 110 Score = 55.8 bits (133), Expect = 7e-09 Identities = 33/62 (53%), Positives = 33/62 (53%), Gaps = 9/62 (14%) Query: 1 MSYQQQQCKQPCQPPPVCP---TPKCPEPCPPPKCPEPYLPPPCPP--EHCPPPPCQDKC 55 MS QQ Q Q CQPPP CP TPKCP C PPKCP P P PC P C P C Sbjct: 1 MSCQQNQ--QQCQPPPKCPPKCTPKCPPKC-PPKCP-PQCPAPCFPAVSSCCGPSSGSCC 56 Query: 56 PP 57 P Sbjct: 57 GP 58 Score = 26.6 bits (57), Expect = 4.5 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 8/28 (28%) Query: 44 EHCPPPPCQDKCPPVQPYPPCQQKYPPK 71 + C PPP KCPP C K PPK Sbjct: 8 QQCQPPP---KCPP-----KCTPKCPPK 27 >gi|30410045 late cornified envelope 2A [Homo sapiens] Length = 106 Score = 54.7 bits (130), Expect = 2e-08 Identities = 28/43 (65%), Positives = 28/43 (65%), Gaps = 5/43 (11%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPP 43 MS QQ Q Q CQPPP CP PKCP C PPKC P P PCPP Sbjct: 1 MSCQQNQ--QQCQPPPKCP-PKCPPKC-PPKC-RPQCPAPCPP 38 Score = 32.3 bits (72), Expect = 0.082 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 5/38 (13%) Query: 38 PPPCPPEHCP---PPPCQDKCPPVQPYPPCQQKYPPKS 72 PP CPP+ CP PP C+ +CP P PP P S Sbjct: 13 PPKCPPK-CPPKCPPKCRPQCPAPCP-PPVSSCCGPSS 48 Score = 30.0 bits (66), Expect = 0.41 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Query: 47 PPPPCQDKCPPVQPYPPCQQKYP 69 PPP C KCPP P P C+ + P Sbjct: 12 PPPKCPPKCPPKCP-PKCRPQCP 33 >gi|27436869 small proline-rich protein 4 [Homo sapiens] Length = 79 Score = 54.7 bits (130), Expect = 2e-08 Identities = 32/71 (45%), Positives = 34/71 (47%), Gaps = 17/71 (23%) Query: 4 QQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPE---HCPPP----PCQDKCP 56 QQQQ KQPCQPPPV KC E C P PC P+ CPP P Q KCP Sbjct: 19 QQQQVKQPCQPPPV----KCQETCAPK------TKDPCAPQVKKQCPPKGTIIPAQQKCP 68 Query: 57 PVQPYPPCQQK 67 Q +QK Sbjct: 69 SAQQASKSKQK 79 >gi|153792074 proline rich 12 [Homo sapiens] Length = 2036 Score = 54.7 bits (130), Expect = 2e-08 Identities = 27/60 (45%), Positives = 32/60 (53%), Gaps = 6/60 (10%) Query: 9 KQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCP-----PEHCPPPPCQDKCPPVQPYPP 63 ++P PP PTP+ P+P PPP P+P LP P P P PPPP PP P PP Sbjct: 1455 EKPPPTPPPAPTPQ-PQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPP 1513 Score = 50.4 bits (119), Expect = 3e-07 Identities = 30/75 (40%), Positives = 34/75 (45%), Gaps = 14/75 (18%) Query: 9 KQPCQPPPVCPTPKCPEPCPPPKCPEPYLP------------PPCPPEHCPPPPCQDKCP 56 K P PPP PTP+ P+P PPP P+P LP PP PP PPPP P Sbjct: 1456 KPPPTPPPA-PTPQ-PQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPP 1513 Query: 57 PVQPYPPCQQKYPPK 71 P P PP+ Sbjct: 1514 PPPPPAAAPLAAPPE 1528 Score = 42.4 bits (98), Expect = 8e-05 Identities = 23/54 (42%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Query: 11 PCQPPPVCPTPKCPEPCPPPKCPEPYLP-PPCPPEHCPPPPCQDKCPPVQPYPP 63 P PP V PTP P P P P P P +P PP PP P PP +P P Sbjct: 1483 PSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPPPAAAPLA---APPEEPAAP 1533 Score = 35.8 bits (81), Expect = 0.007 Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Query: 14 PPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEH-CPPPPCQDKCPPVQP 60 PPP+ P P P PPP P P PPE P P + P +P Sbjct: 1498 PPPLPPPPPPAMPSPPPPPPPAAAPLAAPPEEPAAPSPEDPELPDTRP 1545 Score = 35.0 bits (79), Expect = 0.013 Identities = 25/68 (36%), Positives = 27/68 (39%), Gaps = 15/68 (22%) Query: 15 PPVCPTPKCPEPCPPPKCP--------EPYL----PPPCPPEHCPPPPCQDKCPPVQPYP 62 PP+ P P P P P P EP L PPP PP P P Q + PP P P Sbjct: 1422 PPLAPAAAVPGPPPLPGLPSANSNGTPEPPLLEEKPPPTPP---PAPTPQPQPPPPPPPP 1478 Query: 63 PCQQKYPP 70 PP Sbjct: 1479 QPALPSPP 1486 Score = 34.7 bits (78), Expect = 0.016 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 11/61 (18%) Query: 19 PTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCP---------PVQPYPPCQQKYP 69 P P E PPP P P P PP PPPP Q P P P PP P Sbjct: 1448 PEPPLLEEKPPPTPPPAPTPQPQPPP--PPPPPQPALPSPPPLVAPTPSSPPPPPLPPPP 1505 Query: 70 P 70 P Sbjct: 1506 P 1506 Score = 32.0 bits (71), Expect = 0.11 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Query: 19 PTPKCPEPCPPPKCPEPYL---PPPCPPEHC-PPPPCQDKCPPVQPYPPCQQK 67 P PK P P P P+ PE PP PE P PP +K ++P ++K Sbjct: 1692 PPPKAPAPPPKPETPEKTTSEKPPEQTPETAMPEPPAPEKPSLLRPVEKEKEK 1744 Score = 29.3 bits (64), Expect = 0.69 Identities = 19/74 (25%), Positives = 25/74 (33%), Gaps = 9/74 (12%) Query: 3 YQQQQCKQPCQPPPVC---------PTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQD 53 Y + ++P PPV P PPPK P P P P + P + Sbjct: 1658 YVRVCARKPWHRPPVPVRRSGQAKNPVSAGGSSAPPPKAPAPPPKPETPEKTTSEKPPEQ 1717 Query: 54 KCPPVQPYPPCQQK 67 P PP +K Sbjct: 1718 TPETAMPEPPAPEK 1731 Score = 27.3 bits (59), Expect = 2.6 Identities = 18/58 (31%), Positives = 21/58 (36%), Gaps = 19/58 (32%) Query: 11 PCQPPPVCPTPKCPEPCPPPKC----------------PEPYLPPPCPPEHCPPPPCQ 52 P PP + P+ P P P P+P PPP PP PP P Q Sbjct: 795 PPPPPQLLPSVLSHAPSPSPSASKVGVHLLEPATRDGAPQPPPPPPPPP---PPMPLQ 849 Score = 26.2 bits (56), Expect = 5.9 Identities = 11/21 (52%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Query: 11 PCQPPPVCPTPKCPEPCPPPK 31 P Q PP P P P+P PPP+ Sbjct: 221 PAQTPPYRPGP--PDPPPPPR 239 >gi|30387656 late cornified envelope 1B [Homo sapiens] Length = 118 Score = 53.1 bits (126), Expect = 4e-08 Identities = 26/43 (60%), Positives = 27/43 (62%), Gaps = 4/43 (9%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPP 43 MS QQ Q Q CQPPP C PKCP C P+CP P PP CPP Sbjct: 1 MSCQQNQ--QQCQPPPKC-IPKCPPKCLTPRCP-PKCPPKCPP 39 Score = 34.3 bits (77), Expect = 0.022 Identities = 14/25 (56%), Positives = 14/25 (56%) Query: 47 PPPPCQDKCPPVQPYPPCQQKYPPK 71 PPP C KCPP P C K PPK Sbjct: 12 PPPKCIPKCPPKCLTPRCPPKCPPK 36 >gi|7657685 late cornified envelope 2B [Homo sapiens] Length = 110 Score = 52.0 bits (123), Expect = 1e-07 Identities = 32/62 (51%), Positives = 32/62 (51%), Gaps = 9/62 (14%) Query: 1 MSYQQQQCKQPCQPPPVCP---TPKCPEPCPPPKCPEPYLPPPCPP--EHCPPPPCQDKC 55 MS QQ Q Q CQPPP CP TPKCP C PPKC P P PC P C P C Sbjct: 1 MSCQQNQ--QQCQPPPKCPPKCTPKCPPKC-PPKC-LPQCPAPCSPAVSSCCGPISGGCC 56 Query: 56 PP 57 P Sbjct: 57 GP 58 Score = 26.6 bits (57), Expect = 4.5 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 8/28 (28%) Query: 44 EHCPPPPCQDKCPPVQPYPPCQQKYPPK 71 + C PPP KCPP C K PPK Sbjct: 8 QQCQPPP---KCPP-----KCTPKCPPK 27 >gi|30387648 late cornified envelope 1D [Homo sapiens] Length = 114 Score = 52.0 bits (123), Expect = 1e-07 Identities = 23/38 (60%), Positives = 24/38 (63%), Gaps = 6/38 (15%) Query: 6 QQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPP 43 QQ +Q CQPPP C TPKC CP PKC PP CPP Sbjct: 4 QQSQQQCQPPPKC-TPKCTPKCPAPKC-----PPKCPP 35 Score = 35.0 bits (79), Expect = 0.013 Identities = 14/26 (53%), Positives = 14/26 (53%) Query: 47 PPPPCQDKCPPVQPYPPCQQKYPPKS 72 PPP C KC P P P C K PP S Sbjct: 12 PPPKCTPKCTPKCPAPKCPPKCPPVS 37 >gi|119120861 formin-like 3 isoform 2 [Homo sapiens] Length = 976 Score = 51.6 bits (122), Expect = 1e-07 Identities = 21/37 (56%), Positives = 22/37 (59%) Query: 26 PCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQPYP 62 P PPP+ P PPP PP PPPP DKCPP P P Sbjct: 457 PAPPPEEVLPLPPPPAPPLPPPPPPLPDKCPPAPPLP 493 Score = 35.8 bits (81), Expect = 0.007 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Query: 14 PPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPP 50 PPP P P P PP P P LP CPP PP P Sbjct: 459 PPPEEVLPLPPPPAPPLPPPPPPLPDKCPP--APPLP 493 >gi|119120874 formin-like 3 isoform 1 [Homo sapiens] Length = 1027 Score = 51.6 bits (122), Expect = 1e-07 Identities = 21/37 (56%), Positives = 22/37 (59%) Query: 26 PCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQPYP 62 P PPP+ P PPP PP PPPP DKCPP P P Sbjct: 508 PAPPPEEVLPLPPPPAPPLPPPPPPLPDKCPPAPPLP 544 Score = 35.8 bits (81), Expect = 0.007 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Query: 14 PPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPP 50 PPP P P P PP P P LP CPP PP P Sbjct: 510 PPPEEVLPLPPPPAPPLPPPPPPLPDKCPP--APPLP 544 >gi|90903231 huntingtin [Homo sapiens] Length = 3144 Score = 50.4 bits (119), Expect = 3e-07 Identities = 25/47 (53%), Positives = 30/47 (63%), Gaps = 3/47 (6%) Query: 4 QQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPP 50 QQQQ +QP PPP P P+ P+ PPP+ +P LP P PP PPPP Sbjct: 34 QQQQQQQPPPPPPPPPPPQLPQ--PPPQA-QPLLPQPQPPPPPPPPP 77 Score = 42.0 bits (97), Expect = 1e-04 Identities = 26/60 (43%), Positives = 28/60 (46%), Gaps = 12/60 (20%) Query: 4 QQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQPYPP 63 QQQQ +Q QPPP PPP P P LP P PP+ P P PP P PP Sbjct: 31 QQQQQQQQQQPPP-----------PPPPPPPPQLPQP-PPQAQPLLPQPQPPPPPPPPPP 78 Score = 37.0 bits (84), Expect = 0.003 Identities = 24/61 (39%), Positives = 28/61 (45%), Gaps = 8/61 (13%) Query: 4 QQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPE-HCPPPPCQDKCPPVQPYP 62 QQQQ +Q Q + +P PPP PPP PP+ PPP Q P QP P Sbjct: 19 QQQQQQQQQQQQQQQQQQQQQQPPPPP-------PPPPPPQLPQPPPQAQPLLPQPQPPP 71 Query: 63 P 63 P Sbjct: 72 P 72 >gi|33356148 formin-like 1 [Homo sapiens] Length = 1100 Score = 50.4 bits (119), Expect = 3e-07 Identities = 28/61 (45%), Positives = 28/61 (45%), Gaps = 4/61 (6%) Query: 11 PCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQD-KCPPVQPYPPCQQKYP 69 P PP P P PEP P P P PPP PP PPPP D PP P PP P Sbjct: 559 PSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPP---PPPPGTDGPVPPPPPPPPPPPGGP 615 Query: 70 P 70 P Sbjct: 616 P 616 Score = 39.7 bits (91), Expect = 5e-04 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Query: 14 PPPVCPTPKCPEPCPPPKCPEPYLPP-PCPPEHCPPPPCQ-DKCPPVQPYPP 63 PPP P P P P P P PP P PE P PP D PP P PP Sbjct: 542 PPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPP 593 Score = 38.9 bits (89), Expect = 9e-04 Identities = 22/62 (35%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Query: 11 PCQPPPVCPTPKCPEPCPPPK--CPEPYLPPPCPPEHCPPPPCQDKCPPVQPYPPCQQKY 68 P P P P P PPP P P PP P PP P + PP P P Sbjct: 528 PDLAPAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPP 587 Query: 69 PP 70 PP Sbjct: 588 PP 589 Score = 32.3 bits (72), Expect = 0.082 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 11 PCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPE 44 P PPP P P P PPP P P PP PP+ Sbjct: 585 PPPPPPPPPPPGTDGPVPPPP-PPPPPPPGGPPD 617 Score = 29.6 bits (65), Expect = 0.53 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 6/62 (9%) Query: 15 PPVCPTPK---CPEPCPPPKCPEPYLPP---PCPPEHCPPPPCQDKCPPVQPYPPCQQKY 68 P TP P P P P P L P P P PPPP P Q PP Sbjct: 505 PVAVATPSGGDAPTPGVPTGSPSPDLAPAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQ 564 Query: 69 PP 70 P Sbjct: 565 AP 566 Score = 27.7 bits (60), Expect = 2.0 Identities = 19/65 (29%), Positives = 22/65 (33%), Gaps = 9/65 (13%) Query: 15 PPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCP---PPPCQDKCPPV------QPYPPCQ 65 P P+P P P PPP P P PP + PP+ P PP Sbjct: 522 PTGSPSPDLAPAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLP 581 Query: 66 QKYPP 70 PP Sbjct: 582 GDLPP 586 >gi|7662046 myeloid/lymphoid or mixed-lineage leukemia 4 [Homo sapiens] Length = 2715 Score = 50.1 bits (118), Expect = 4e-07 Identities = 29/70 (41%), Positives = 36/70 (51%), Gaps = 14/70 (20%) Query: 4 QQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQPYPP 63 ++++ K P PPP+ P P P PPP P P P PP CPPPP PPV P PP Sbjct: 395 EKEEAKLP--PPPLTP----PAPSPPPPLPPPSTSP--PPPLCPPPP-----PPVSP-PP 440 Query: 64 CQQKYPPKSK 73 PP ++ Sbjct: 441 LPSPPPPPAQ 450 Score = 42.0 bits (97), Expect = 1e-04 Identities = 28/63 (44%), Positives = 32/63 (50%), Gaps = 11/63 (17%) Query: 11 PCQPPPVCPTPKCPEP--CPPPKCPEPYLPPPCPPEHCPPPPCQDK----CPPVQPYPPC 64 P PPP+ P P P CPPP P P PPP P PPPP Q++ PPV P C Sbjct: 411 PSPPPPLPPPSTSPPPPLCPPP--PPPVSPPPLP-SP-PPPPAQEEQEESPPPVVP-ATC 465 Query: 65 QQK 67 +K Sbjct: 466 SRK 468 Score = 36.2 bits (82), Expect = 0.006 Identities = 22/56 (39%), Positives = 24/56 (42%), Gaps = 13/56 (23%) Query: 14 PPPVCPTPKCPEPCPPPKCPEPYLPPPCPP------EHCPPPPCQDKCPPVQPYPP 63 PPP+CP P P PPP LP P PP E PPP C + PP Sbjct: 425 PPPLCPPPP-PPVSPPP------LPSPPPPPAQEEQEESPPPVVPATCSRKRGRPP 473 Score = 33.9 bits (76), Expect = 0.028 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Query: 11 PCQPPPVCPTPKCPEPCPPP------KCPEPYLPPPCPPEHCPPP 49 P PPPV P P P P PPP + P P +P C + PP Sbjct: 430 PPPPPPVSP-PPLPSPPPPPAQEEQEESPPPVVPATCSRKRGRPP 473 Score = 31.6 bits (70), Expect = 0.14 Identities = 23/75 (30%), Positives = 25/75 (33%), Gaps = 22/75 (29%) Query: 11 PCQPPPVCPTPKCP-EPCPPPKCPEPYLPPPCP---PE------------------HCPP 48 P PP+ +P P EP P P P PP P PE PP Sbjct: 561 PVLRPPITTSPPVPQEPAPVPSPPRAPTPPSTPVPLPEKRRSILREPTFRWTSLTRELPP 620 Query: 49 PPCQDKCPPVQPYPP 63 PP PP PP Sbjct: 621 PPPAPPPPPAPSPPP 635 Score = 30.0 bits (66), Expect = 0.41 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPP 48 +S Q Q QP T P+ PPP +P L PP P+ PP Sbjct: 727 LSNGPQTQAQLLQPLQALQTQLLPQALPPP---QPQLQPPPSPQQMPP 771 Score = 28.9 bits (63), Expect = 0.90 Identities = 12/26 (46%), Positives = 13/26 (50%) Query: 15 PPVCPTPKCPEPCPPPKCPEPYLPPP 40 PP P+ PEP PPP P P P Sbjct: 668 PPPLGAPEAPEPEPPPADDSPAEPEP 693 Score = 28.1 bits (61), Expect = 1.5 Identities = 23/75 (30%), Positives = 26/75 (34%), Gaps = 28/75 (37%) Query: 14 PPPVCPTPKCPEPCPPP----------KCP-----EPYL--------PPPCPPEHCP--- 47 PPP P P P P P P + P E +L PPP P Sbjct: 621 PPPAPPPPPAPSPPPAPATSSRRPLLLRAPQFTPSEAHLKIYESVLTPPPLGAPEAPEPE 680 Query: 48 PPPCQDKCPPVQPYP 62 PPP D P +P P Sbjct: 681 PPPADDS--PAEPEP 693 Score = 26.6 bits (57), Expect = 4.5 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 7/46 (15%) Query: 9 KQPCQPPPVCPTPKCPEPCPPPK----CPEPYLPPPCPPEHCPPPP 50 KQP PP + PT PP P + P PP PPPP Sbjct: 2216 KQPPLPPTISPTAPTSWTLPPGPLLGVLPVVGVVRPAPP---PPPP 2258 >gi|146134388 YLP motif containing 1 [Homo sapiens] Length = 2146 Score = 48.9 bits (115), Expect = 8e-07 Identities = 30/74 (40%), Positives = 30/74 (40%), Gaps = 15/74 (20%) Query: 11 PCQPPPVCPTPKCPEPCPPPKC--------PEPYLPPPC-----PPEHCPPPPCQDKC-P 56 P PPPV P P P PPP P P LPPP PP PPP P Sbjct: 558 PGMPPPVMP-PSLPTSVPPPGMPPSLSSAGPPPVLPPPSLSSAGPPPVLPPPSLSSTAPP 616 Query: 57 PVQPYPPCQQKYPP 70 PV P PP PP Sbjct: 617 PVMPLPPLSSATPP 630 Score = 47.0 bits (110), Expect = 3e-06 Identities = 27/64 (42%), Positives = 28/64 (43%), Gaps = 5/64 (7%) Query: 11 PCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPP--PPCQDKC--PPVQPYPPCQQ 66 P PPPV P P P PPP P P +PP P PP PP PPV P P Sbjct: 540 PSLPPPVMP-PALPATVPPPGMPPPVMPPSLPTSVPPPGMPPSLSSAGPPPVLPPPSLSS 598 Query: 67 KYPP 70 PP Sbjct: 599 AGPP 602 Score = 45.8 bits (107), Expect = 7e-06 Identities = 24/59 (40%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Query: 14 PPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQ-PYPPCQQKYPPK 71 PPPV P P PPP P P L PP P PP PP P P Q PP+ Sbjct: 587 PPPVLPPPSLSSAGPPPVLPPPSLSSTAPPPVMPLPPLSSATPPPGIPPPGVPQGIPPQ 645 Score = 39.3 bits (90), Expect = 7e-04 Identities = 31/86 (36%), Positives = 37/86 (43%), Gaps = 18/86 (20%) Query: 1 MSYQQQQC-------KQPCQPPPVCP----TPKCPEPCPPPKCPEP---YLPPPCPP-EH 45 +SYQ+QQ Q PP + P +P P PP P Y+PPP PP + Sbjct: 115 LSYQKQQQYKHQMLHHQRDGPPGLVPMELESPPESPPVPPGSYMPPSQSYMPPPQPPPSY 174 Query: 46 CPPPPCQDKCPPVQPYP---PCQQKY 68 PP Q PP QP P P Q Y Sbjct: 175 YPPTSSQPYLPPAQPSPSQSPPSQSY 200 Score = 38.5 bits (88), Expect = 0.001 Identities = 23/67 (34%), Positives = 26/67 (38%), Gaps = 12/67 (17%) Query: 14 PPPVCPTPKCPEPCPPP---------KCPEPYLPPPCPPEHCPPPPCQDKCPPVQPYPPC 64 PPPV P P PPP P P +PPP P+ PP Q PV P Sbjct: 601 PPPVLPPPSLSSTAPPPVMPLPPLSSATPPPGIPPPGVPQGIPP---QLTAAPVPPASSS 657 Query: 65 QQKYPPK 71 Q P+ Sbjct: 658 QSSQVPE 664 Score = 38.5 bits (88), Expect = 0.001 Identities = 21/54 (38%), Positives = 24/54 (44%), Gaps = 5/54 (9%) Query: 14 PPPVCPTPKCPEPCPPPKCPEPYLPPPCPPE--HCPPPPC---QDKCPPVQPYP 62 PPPV P P PPP P P +P PP+ P PP Q P +P P Sbjct: 615 PPPVMPLPPLSSATPPPGIPPPGVPQGIPPQLTAAPVPPASSSQSSQVPEKPRP 668 Score = 38.1 bits (87), Expect = 0.001 Identities = 24/64 (37%), Positives = 26/64 (40%), Gaps = 12/64 (18%) Query: 14 PPPVCPTPKCPEPCP-------PPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQPYPPCQQ 66 PPP P + P P P PP P P +PP P PPP PPV P P Sbjct: 517 PPPFVPYSQMPPPLPTMPPPVLPPSLPPPVMPPALPAT-VPPPGMP---PPVMP-PSLPT 571 Query: 67 KYPP 70 PP Sbjct: 572 SVPP 575 Score = 37.7 bits (86), Expect = 0.002 Identities = 22/68 (32%), Positives = 24/68 (35%) Query: 6 QQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQPYPPCQ 65 Q P QPPP P +P PP P P PP P P Q Y Sbjct: 162 QSYMPPPQPPPSYYPPTSSQPYLPPAQPSPSQSPPSQSYLAPTPSYSSSSSSSQSYLSHS 221 Query: 66 QKYPPKSK 73 Q Y P S+ Sbjct: 222 QSYLPSSQ 229 Score = 33.9 bits (76), Expect = 0.028 Identities = 30/101 (29%), Positives = 33/101 (32%), Gaps = 31/101 (30%) Query: 1 MSYQQQQCK-QP--CQPPPVCPTPKCP-------EPCPPPKCPEPYL------------- 37 M +Q QC QP PPP+ P P P +P PPP P P Sbjct: 67 MHQKQMQCVLQPHHLPPPPLPPPPVMPGGGYGDWQPPPPPMPPPPGPALSYQKQQQYKHQ 126 Query: 38 --------PPPCPPEHCPPPPCQDKCPPVQPYPPCQQKYPP 70 PP P PP PP PP Q PP Sbjct: 127 MLHHQRDGPPGLVPMELESPPESPPVPPGSYMPPSQSYMPP 167 Score = 31.2 bits (69), Expect = 0.18 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 9/46 (19%) Query: 14 PPPVCPTP-KCPEPCPPP--------KCPEPYLPPPCPPEHCPPPP 50 PPP+ P P PP + P P PPP PP PPPP Sbjct: 1515 PPPMGKPPGSIVRPSAPPARSSVPVTRPPVPIPPPPPPPPLPPPPP 1560 Score = 29.3 bits (64), Expect = 0.69 Identities = 22/72 (30%), Positives = 27/72 (37%), Gaps = 15/72 (20%) Query: 4 QQQQCKQPCQPPPVCPTPKCPEPCPPPKCP-----EPYLPP-------PCPPEHCPPPPC 51 Q+ + + P + P P P PP P P PP PP PPPP Sbjct: 1492 QESRLQNTSSRPGMYPPPGSYRPPPPMGKPPGSIVRPSAPPARSSVPVTRPPVPIPPPP- 1550 Query: 52 QDKCPPVQPYPP 63 PP+ P PP Sbjct: 1551 --PPPPLPPPPP 1560 Score = 29.3 bits (64), Expect = 0.69 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 35 PYLPPPCPPEHCPPP-PCQDKCPPVQPYPPCQQ 66 P LPPP PPP P PP+ PP QQ Sbjct: 1606 PVLPPPPVHSSIPPPGPVPMGMPPMSKPPPVQQ 1638 Score = 27.3 bits (59), Expect = 2.6 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Query: 14 PPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQP 60 P PV P P+ P PP PP PPP PP +P Sbjct: 327 PEPVKEEVTVPATSQVPESPSSEEPPLPPPNEEVPPP----LPPEEP 369 Score = 26.2 bits (56), Expect = 5.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Query: 28 PPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQP 60 PPP P P PP PE P P P P Sbjct: 15 PPPPVPPP--PPVALPEASPGPGYSSSTTPAAP 45 Score = 25.8 bits (55), Expect = 7.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Query: 37 LPPPCPPEHCPPPPCQDKCPPVQP 60 +PPP P PPP PPV P Sbjct: 516 MPPPFVPYSQMPPPLPTMPPPVLP 539 >gi|30410037 late cornified envelope 3C [Homo sapiens] Length = 94 Score = 48.5 bits (114), Expect = 1e-06 Identities = 24/40 (60%), Positives = 25/40 (62%), Gaps = 7/40 (17%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPP 40 MS QQ Q Q CQPPP CP+PKC PPK P LPPP Sbjct: 1 MSCQQNQ--QQCQPPPSCPSPKC-----PPKSPAQCLPPP 33 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.317 0.145 0.568 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,753,988 Number of Sequences: 37866 Number of extensions: 701800 Number of successful extensions: 19136 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 924 Number of HSP's successfully gapped in prelim test: 604 Number of HSP's that attempted gapping in prelim test: 4468 Number of HSP's gapped (non-prelim): 7864 length of query: 73 length of database: 18,247,518 effective HSP length: 46 effective length of query: 27 effective length of database: 16,505,682 effective search space: 445653414 effective search space used: 445653414 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.