Guide to the Human Genome
Home | Table of Contents | Search text | Search genes | Search sequences | Purchase | FAQ | Blog | Help

Search of human proteins with 133908641

BLASTP 2.2.11 [Jun-05-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|133908641 myosin binding protein C, fast type [Homo sapiens]
         (1141 letters)

Database: hs.faa 
           37,866 sequences; 18,247,518 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|133908641 myosin binding protein C, fast type [Homo sapiens]      2298   0.0  
gi|148596957 myosin binding protein C, cardiac [Homo sapiens]        1229   0.0  
gi|46049110 myosin binding protein C, slow type isoform 4 [Homo ...  1168   0.0  
gi|46049125 myosin binding protein C, slow type isoform 2 [Homo ...  1164   0.0  
gi|45976288 myosin binding protein C, slow type isoform 1 [Homo ...  1164   0.0  
gi|46049119 myosin binding protein C, slow type isoform 3 [Homo ...  1158   0.0  
gi|55956914 myosin binding protein H [Homo sapiens]                   457   e-128
gi|194018539 myosin binding protein H-like [Homo sapiens]             342   2e-93
gi|253970427 immunoglobulin superfamily, member 22 [Homo sapiens]     310   7e-84
gi|110349719 titin isoform N2-A [Homo sapiens]                        275   1e-73
gi|110349717 titin isoform novex-2 [Homo sapiens]                     275   1e-73
gi|110349713 titin isoform novex-1 [Homo sapiens]                     275   1e-73
gi|110349715 titin isoform N2-B [Homo sapiens]                        275   1e-73
gi|148839296 immunoglobulin-like and fibronectin type III domain...   266   8e-71
gi|156104903 myomesin 2 [Homo sapiens]                                132   1e-30
gi|140560917 myomesin 1 isoform b [Homo sapiens]                      127   6e-29
gi|58331253 obscurin, cytoskeletal calmodulin and titin-interact...   125   2e-28
gi|148833506 obscurin, cytoskeletal calmodulin and titin-interac...   125   2e-28
gi|144226847 obscurin-like 1 [Homo sapiens]                           125   3e-28
gi|110349721 titin isoform novex-3 [Homo sapiens]                     124   5e-28
gi|155969693 myomesin family, member 3 [Homo sapiens]                 112   3e-24
gi|140560919 myomesin 1 isoform a [Homo sapiens]                      110   8e-24
gi|19743806 roundabout 1 isoform b [Homo sapiens]                     102   2e-21
gi|4506569 roundabout 1 isoform a [Homo sapiens]                      102   2e-21
gi|119220552 sidekick 1 [Homo sapiens]                                102   3e-21
gi|224994173 roundabout 1 isoform d [Homo sapiens]                    100   8e-21
gi|224994171 roundabout 1 isoform c [Homo sapiens]                    100   8e-21
gi|239748173 PREDICTED: similar to roundabout 1 isoform 1 [Homo ...   100   8e-21
gi|239748171 PREDICTED: similar to roundabout 1 isoform 2 [Homo ...   100   8e-21
gi|20127422 Down syndrome cell adhesion molecule isoform CHD2-42...    99   2e-20

>gi|133908641 myosin binding protein C, fast type [Homo sapiens]
          Length = 1141

 Score = 2298 bits (5956), Expect = 0.0
 Identities = 1141/1141 (100%), Positives = 1141/1141 (100%)

Query: 1    MPEAKPAAKKAPKGKDAPKGAPKEAPPKEAPAEAPKEAPPEDQSPTAEEPTGVFLKKPDS 60
            MPEAKPAAKKAPKGKDAPKGAPKEAPPKEAPAEAPKEAPPEDQSPTAEEPTGVFLKKPDS
Sbjct: 1    MPEAKPAAKKAPKGKDAPKGAPKEAPPKEAPAEAPKEAPPEDQSPTAEEPTGVFLKKPDS 60

Query: 61   VSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFSFKESHNSASNVYTVE 120
            VSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFSFKESHNSASNVYTVE
Sbjct: 61   VSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFSFKESHNSASNVYTVE 120

Query: 121  LHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLESFKRTSEKKSDTAG 180
            LHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLESFKRTSEKKSDTAG
Sbjct: 121  LHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLESFKRTSEKKSDTAG 180

Query: 181  ELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGITDLRG 240
            ELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGITDLRG
Sbjct: 181  ELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGITDLRG 240

Query: 241  MLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSS 300
            MLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSS
Sbjct: 241  MLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSS 300

Query: 301  KYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVG 360
            KYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVG
Sbjct: 301  KYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVG 360

Query: 361  DRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQ 420
            DRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQ
Sbjct: 361  DRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQ 420

Query: 421  VITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRP 480
            VITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRP
Sbjct: 421  VITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRP 480

Query: 481  SKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPK 540
            SKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPK
Sbjct: 481  SKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPK 540

Query: 541  IHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDC 600
            IHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDC
Sbjct: 541  IHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDC 600

Query: 601  SSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWE 660
            SSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWE
Sbjct: 601  SSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWE 660

Query: 661  PPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIG 720
            PPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIG
Sbjct: 661  PPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIG 720

Query: 721  VSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGS 780
            VSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGS
Sbjct: 721  VSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGS 780

Query: 781  EEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKI 840
            EEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKI
Sbjct: 781  EEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKI 840

Query: 841  RLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVR 900
            RLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVR
Sbjct: 841  RLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVR 900

Query: 901  QAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDG 960
            QAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDG
Sbjct: 901  QAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDG 960

Query: 961  NSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGV 1020
            NSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGV
Sbjct: 961  NSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGV 1020

Query: 1021 SKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVV 1080
            SKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVV
Sbjct: 1021 SKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVV 1080

Query: 1081 WMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVRVP 1140
            WMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVRVP
Sbjct: 1081 WMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVRVP 1140

Query: 1141 Q 1141
            Q
Sbjct: 1141 Q 1141


>gi|148596957 myosin binding protein C, cardiac [Homo sapiens]
          Length = 1274

 Score = 1229 bits (3179), Expect = 0.0
 Identities = 632/1190 (53%), Positives = 804/1190 (67%), Gaps = 65/1190 (5%)

Query: 3    EAKPAAKKAPKGKDAPKGAPKEAPPKEAPAEAPKEAPPEDQSPTA-----------EEPT 51
            +A+P    AP   +A  GAP EAP   APA    E+ P  +  ++           ++P 
Sbjct: 99   KAEPMLAPAPAPAEAT-GAPGEAP---APAAELGESAPSPKGSSSAALNGPTPGAPDDPI 154

Query: 52   GVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFSFKESHN 111
            G+F+ +P    V  G      A+V G  L   P +KWFKGKW++L SK G      +S++
Sbjct: 155  GLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYD 214

Query: 112  SASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLESFKRT 171
             AS VY  ELHI        G YR EV  KD  D   FN+ V           L +F+RT
Sbjct: 215  RASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRT 274

Query: 172  S---------EKKSDTAGELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPE--IWELLKG 220
            S         +   DT G LDFS LLKKR+     +      D  L  P E  +WE+L+ 
Sbjct: 275  SLAGGGRRISDSHEDT-GILDFSSLLKKRDSFRTPR------DSKLEAPAEEDVWEILRQ 327

Query: 221  AKKSEYEKIAFQYGITDLRGMLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEI 280
            A  SEYE+IAFQYG+TDLRGMLKRLK  + + KKS AF KKL+PAYQV +G+KI+L VE+
Sbjct: 328  APPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVEL 387

Query: 281  SDPDLTLKWFKNGQEIKPS-SKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTEL 339
            +D D  +KW KNGQEI+ S SKY+FE++G KR LTI++C+LADDAAY+  V  EKC TEL
Sbjct: 388  ADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTEL 447

Query: 340  FVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKK 399
            FVKEPPVLI  PLEDQ V VG RVE   EVSEEGAQV W+KDGVELTRE++FK  YRFKK
Sbjct: 448  FVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFK--YRFKK 505

Query: 400  DGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFK 459
            DG+RH LI ++ + ED G Y + T+GGQ  AELIV+EK+LEV Q IADL V A +QAVFK
Sbjct: 506  DGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFK 565

Query: 460  CEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSL 519
            CEVSDE V G W KNG E+ P  RI +SH+GR HKL IDDV P DE DY+FVP+G+A +L
Sbjct: 566  CEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNL 625

Query: 520  SAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWL 579
            SAKL+F+E+K+++VP+QEPPKIHLDC G+  +  IVVVAGNKLRLDV I+G+P P   W 
Sbjct: 626  SAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDT-IVVVAGNKLRLDVPISGDPAPTVIWQ 684

Query: 580  K--------------------GD--------EVFTTTEGRTRIEKRVDCSSFVIESAQRE 611
            K                    GD        ++   TEGR R+E   D S F +E A++E
Sbjct: 685  KAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKE 744

Query: 612  DEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVT 671
            DEG YT+ V NPVGED  ++ ++V+DVPD P A +I++VGED   + WEPP YDGG+P+ 
Sbjct: 745  DEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPIL 804

Query: 672  GYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPF 731
            GY++ERKKK S RWM+LNF++  E ++E+ +MIEG++YEMRV+AVNAIG+S+PS  ++PF
Sbjct: 805  GYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPF 864

Query: 732  MPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPV 791
            MPI P SEP HL VEDV+DTT +LKWRPP R+GAGG+DGY VEYC EG  EWV A     
Sbjct: 865  MPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLT 924

Query: 792  ERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYI 851
            E     VK+LPTGAR+LFRV   N+AG   P T  +PVT++EI + P+++LPRHLRQT  
Sbjct: 925  EHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQ 984

Query: 852  RKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYE 911
            +KVGE +NL++PFQGKPRPQV WTK G PL    V +R S  DT+ F+R A R  SG Y+
Sbjct: 985  KKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQ 1044

Query: 912  LSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQK 971
            ++V+IENM+D AT+ ++VV+K  PP ++ V + WG N  +EW+ P+D GN+E+ GY VQK
Sbjct: 1045 VTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQK 1104

Query: 972  ADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTG 1031
            ADKKTMEWF V E  R T C V +LI+GN YYFRV+++N+ G SD    +K    I + G
Sbjct: 1105 ADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPG 1164

Query: 1032 ITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIRED 1091
            IT++P  YK  DF  AP F  PL++R V+AGY+A L CAVRG PKPK+ W KN +++ ED
Sbjct: 1165 ITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGED 1224

Query: 1092 PKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVRVPQ 1141
             +F + + QGVLTL IR+P PFD G Y CRA N  GEA  EC+LEVRVPQ
Sbjct: 1225 ARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEVRVPQ 1274



 Score = 43.1 bits (100), Expect = 0.001
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 7/89 (7%)

Query: 450 VKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYT 509
           V A   AVF+ E     V  +W + G ++  S +  ++  G  H L + +V P D+G Y 
Sbjct: 21  VAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYA 80

Query: 510 FVPDGYALSLSAKLNFLEIKVEYVPKQEP 538
            +        S+K+ F ++KV    K EP
Sbjct: 81  VIAG------SSKVKF-DLKVIEAEKAEP 102



 Score = 38.9 bits (89), Expect = 0.028
 Identities = 28/103 (27%), Positives = 45/103 (43%), Gaps = 5/103 (4%)

Query: 253 KKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRI 312
           K  +AF+KK   + +V  G+      E     + ++W + G +I  S+KY     G +  
Sbjct: 7   KPVSAFSKK-PRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHT 65

Query: 313 LTINKCTLADDAAYEVAVKDEKCFTELFV----KEPPVLIVTP 351
           LT+ +   AD  +Y V     K   +L V    K  P+L   P
Sbjct: 66  LTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAP 108



 Score = 37.7 bits (86), Expect = 0.063
 Identities = 21/83 (25%), Positives = 36/83 (43%), Gaps = 4/83 (4%)

Query: 356 QVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQED 415
           +V  G       E    G +V W + G +++  +    +Y    +G RH L   +V   D
Sbjct: 20  EVAAGSPAVFEAETERAGVKVRWQRGGSDISASN----KYGLATEGTRHTLTVREVGPAD 75

Query: 416 RGRYQVITNGGQCEAELIVEEKQ 438
           +G Y VI    + + +L V E +
Sbjct: 76  QGSYAVIAGSSKVKFDLKVIEAE 98


>gi|46049110 myosin binding protein C, slow type isoform 4 [Homo
            sapiens]
          Length = 1123

 Score = 1168 bits (3022), Expect = 0.0
 Identities = 571/1135 (50%), Positives = 782/1135 (68%), Gaps = 44/1135 (3%)

Query: 22   PKEAPPKEAPAEAPKEA---PPED----QSPTAEEPTG---------VFLKKPDSVSVET 65
            P  APP E P++  KEA   P +D    ++P  EE            +F++KP   +V+ 
Sbjct: 13   PAPAPPPEEPSKE-KEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKV 71

Query: 66   GKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFSFKESHNSASNVYTVELHIGK 125
            G+D   +AKV  ++L  KPTIKWFKGKW++L SK+G     KE+    S VYT E+ I K
Sbjct: 72   GEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIK 131

Query: 126  VVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLES-FKRTSEKKSDTAGELDF 184
                  G YR EV  KD  DSC F+++V           + S FKR+ E + D AGELDF
Sbjct: 132  AKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQED-AGELDF 190

Query: 185  SGLLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGITDLRGMLKR 244
            SGLLK+REV ++E++ +           ++WELLK AK SEYEKIAFQYGITDLRGMLKR
Sbjct: 191  SGLLKRREVKQQEEEPQV----------DVWELLKNAKPSEYEKIAFQYGITDLRGMLKR 240

Query: 245  LKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVF 304
            LK+ + E KKSAAF K LDPAYQVD+G +++ +VE++DP L +KW+KNGQEI+PS+KY+F
Sbjct: 241  LKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIF 300

Query: 305  ENVGKKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVE 364
            E+ G +RIL IN C + DD+ Y V   DEKC TELFV+EPP+++   LED   + G+RVE
Sbjct: 301  EHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVE 360

Query: 365  MAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITN 424
            +  EVSE+ A V W K+G E+      K+RYR + +GK+HILI     + D   Y V+T 
Sbjct: 361  LECEVSEDDANVKWFKNGEEIIPGP--KSRYRIRVEGKKHILIIEGATKADAAEYSVMTT 418

Query: 425  GGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRI 484
            GGQ  A+L V+ K L++L  + D TV   ++   KCE+S E + GKW KNG+ V+ S R+
Sbjct: 419  GGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRL 477

Query: 485  TISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLD 544
             + H GR HKLVI +   EDEGDY F PD Y ++L AK++ ++          PPKI LD
Sbjct: 478  KVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVID----------PPKIILD 527

Query: 545  CSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFV 604
              G  ++N + V+AGNKLRL++ I+GEPPP A W +GD+      GR R E   D S+ V
Sbjct: 528  --GLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLV 585

Query: 605  IESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMY 664
            I+ A+R+D G Y I + N  GE  ASI ++VVD PDPP A  +T VG+DW I+ WEPP Y
Sbjct: 586  IDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAY 645

Query: 665  DGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQP 724
            DGG P+ GY +ERKKK S RWM+LNF++  ETT+E  KMIEG+ YE+R+FAVNAIG+S+P
Sbjct: 646  DGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKP 705

Query: 725  SMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWV 784
            SM ++PF+P+A TS P  L V+ VTDTT T++WRPP+ IGA G+DGY++EYC EG+E+W+
Sbjct: 706  SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWI 765

Query: 785  PANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPR 844
             AN + +++  FT+  LPT A+I  RV  VN AG SEP   +QP+ ++EI EPPKIR+PR
Sbjct: 766  VANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPR 825

Query: 845  HLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAAR 904
            HL+QTYIR+VGE +NLV+PFQGKPRP++ W K GA +D +++++R S+ DT+ F+R+A R
Sbjct: 826  HLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAER 885

Query: 905  SDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEI 964
            S SG+Y+L V+++   +TA+I I+++++ GPP  V +++VWG N  + W  PKDDGN+ I
Sbjct: 886  SHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAI 945

Query: 965  MGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNT 1024
             GY +QKADKK+MEWF V E    TS T+++L++GNEYYFRV++EN+CGLS+   ++K +
Sbjct: 946  TGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKES 1005

Query: 1025 ARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKN 1084
            A I + G  +K   Y++ DF  AP F  PL++   +AGY+A LNC+VRG+PKPK+ WMKN
Sbjct: 1006 AVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKN 1065

Query: 1085 KMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVRV 1139
            K+ I +DP++ + + QGV TL IR+PSP+D GTY C+AVN+LG    ECKLEV+V
Sbjct: 1066 KVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1120


>gi|46049125 myosin binding protein C, slow type isoform 2 [Homo
            sapiens]
          Length = 1148

 Score = 1164 bits (3010), Expect = 0.0
 Identities = 573/1171 (48%), Positives = 783/1171 (66%), Gaps = 58/1171 (4%)

Query: 1    MPE-AKPAAKKAPKGKDAPKGAPKEAPPKEAPAEAPKEAPPEDQSP-------------- 45
            MPE  K    + P     P+   KE      PA+  +E  P    P              
Sbjct: 1    MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDEEEVSPPSALPPGLGSRALERKDSD 60

Query: 46   --TAEEPTG--------------VFLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWF 89
                E P G              +F++KP   +V+ G+D   +AKV  ++L  KPTIKWF
Sbjct: 61   WTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWF 120

Query: 90   KGKWLELGSKSGARFSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGF 149
            KGKW++L SK+G     KE+    S VYT E+ I K      G YR EV  KD  DSC F
Sbjct: 121  KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSF 180

Query: 150  NIDVEAPRQDASGQSLES-FKRTSEKKSDTAGELDFSGLLKKREVVEEEKKKKKKDDDDL 208
            +++V           + S FKR+ E + D AGELDFSGLLK+REV ++E++ +       
Sbjct: 181  DLEVHESTGTTPNIDIRSAFKRSGEGQED-AGELDFSGLLKRREVKQQEEEPQ------- 232

Query: 209  GIPPEIWELLKGAKKSEYEKIAFQYGITDLRGMLKRLKKAKVEVKKSAAFTKKLDPAYQV 268
                ++WELLK AK SEYEKIAFQYGITDLRGMLKRLK+ + E KKSAAF K LDPAYQV
Sbjct: 233  ---VDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQV 289

Query: 269  DRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEV 328
            D+G +++ +VE++DP L +KW+KNGQEI+PS+KY+FE+ G +RIL IN C + DD+ Y V
Sbjct: 290  DKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYV 349

Query: 329  AVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTRE 388
               DEKC TELFV+EPP+++   LED   + G+RVE+  EVSE+ A V W K+G E+   
Sbjct: 350  TAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEII-- 407

Query: 389  DSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADL 448
               K+RYR + +GK+HILI     + D   Y V+T GGQ  A+L V+ K L++L  + D 
Sbjct: 408  PGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQ 467

Query: 449  TVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDY 508
            TV   ++   KCE+S E + GKW KNG+ V+ S R+ + H GR HKLVI +   EDEGDY
Sbjct: 468  TVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 526

Query: 509  TFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSI 568
             F PD Y ++L AK++ +          +PPKI LD  G  ++N + V+AGNKLRL++ I
Sbjct: 527  VFAPDAYNVTLPAKVHVI----------DPPKIILD--GLDADNTVTVIAGNKLRLEIPI 574

Query: 569  TGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDV 628
            +GEPPP A W +GD+      GR R E   D S+ VI+ A+R+D G Y I + N  GE  
Sbjct: 575  SGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAH 634

Query: 629  ASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKL 688
            ASI ++VVD PDPP A  +T VG+DW I+ WEPP YDGG P+ GY +ERKKK S RWM+L
Sbjct: 635  ASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRL 694

Query: 689  NFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDV 748
            NF++  ETT+E  KMIEG+ YE+R+FAVNAIG+S+PSM ++PF+P+A TS P  L V+ V
Sbjct: 695  NFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSV 754

Query: 749  TDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARIL 808
            TDTT T++WRPP+ IGA G+DGY++EYC EG+E+W+ AN + +++  FT+  LPT A+I 
Sbjct: 755  TDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIF 814

Query: 809  FRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKP 868
             RV  VN AG SEP   +QP+ ++EI EPPKIR+PRHL+QTYIR+VGE +NLV+PFQGKP
Sbjct: 815  VRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKP 874

Query: 869  RPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIR 928
            RP++ W K GA +D +++++R S+ DT+ F+R+A RS SG+Y+L V+++   +TA+I I+
Sbjct: 875  RPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQ 934

Query: 929  VVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRH 988
            ++++ GPP  V +++VWG N  + W  PKDDGN+ I GY +QKADKK+MEWF V E    
Sbjct: 935  IIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHR 994

Query: 989  TSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAP 1048
            TS T+++L++GNEYYFRV++EN+CGLS+   ++K +A I + G  +K   Y++ DF  AP
Sbjct: 995  TSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAP 1054

Query: 1049 KFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIR 1108
             F  PL++   +AGY+A LNC+VRG+PKPK+ WMKNK+ I +DP++ + + QGV TL IR
Sbjct: 1055 MFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIR 1114

Query: 1109 RPSPFDAGTYTCRAVNELGEALAECKLEVRV 1139
            +PSP+D GTY C+AVN+LG    ECKLEV+V
Sbjct: 1115 KPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1145


>gi|45976288 myosin binding protein C, slow type isoform 1 [Homo
            sapiens]
          Length = 1171

 Score = 1164 bits (3010), Expect = 0.0
 Identities = 573/1171 (48%), Positives = 783/1171 (66%), Gaps = 58/1171 (4%)

Query: 1    MPE-AKPAAKKAPKGKDAPKGAPKEAPPKEAPAEAPKEAPPEDQSP-------------- 45
            MPE  K    + P     P+   KE      PA+  +E  P    P              
Sbjct: 1    MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDEEEVSPPSALPPGLGSRALERKDSD 60

Query: 46   --TAEEPTG--------------VFLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWF 89
                E P G              +F++KP   +V+ G+D   +AKV  ++L  KPTIKWF
Sbjct: 61   WTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWF 120

Query: 90   KGKWLELGSKSGARFSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGF 149
            KGKW++L SK+G     KE+    S VYT E+ I K      G YR EV  KD  DSC F
Sbjct: 121  KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSF 180

Query: 150  NIDVEAPRQDASGQSLES-FKRTSEKKSDTAGELDFSGLLKKREVVEEEKKKKKKDDDDL 208
            +++V           + S FKR+ E + D AGELDFSGLLK+REV ++E++ +       
Sbjct: 181  DLEVHESTGTTPNIDIRSAFKRSGEGQED-AGELDFSGLLKRREVKQQEEEPQ------- 232

Query: 209  GIPPEIWELLKGAKKSEYEKIAFQYGITDLRGMLKRLKKAKVEVKKSAAFTKKLDPAYQV 268
                ++WELLK AK SEYEKIAFQYGITDLRGMLKRLK+ + E KKSAAF K LDPAYQV
Sbjct: 233  ---VDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQV 289

Query: 269  DRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEV 328
            D+G +++ +VE++DP L +KW+KNGQEI+PS+KY+FE+ G +RIL IN C + DD+ Y V
Sbjct: 290  DKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYV 349

Query: 329  AVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTRE 388
               DEKC TELFV+EPP+++   LED   + G+RVE+  EVSE+ A V W K+G E+   
Sbjct: 350  TAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEII-- 407

Query: 389  DSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADL 448
               K+RYR + +GK+HILI     + D   Y V+T GGQ  A+L V+ K L++L  + D 
Sbjct: 408  PGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQ 467

Query: 449  TVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDY 508
            TV   ++   KCE+S E + GKW KNG+ V+ S R+ + H GR HKLVI +   EDEGDY
Sbjct: 468  TVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 526

Query: 509  TFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSI 568
             F PD Y ++L AK++ +          +PPKI LD  G  ++N + V+AGNKLRL++ I
Sbjct: 527  VFAPDAYNVTLPAKVHVI----------DPPKIILD--GLDADNTVTVIAGNKLRLEIPI 574

Query: 569  TGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDV 628
            +GEPPP A W +GD+      GR R E   D S+ VI+ A+R+D G Y I + N  GE  
Sbjct: 575  SGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAH 634

Query: 629  ASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKL 688
            ASI ++VVD PDPP A  +T VG+DW I+ WEPP YDGG P+ GY +ERKKK S RWM+L
Sbjct: 635  ASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRL 694

Query: 689  NFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDV 748
            NF++  ETT+E  KMIEG+ YE+R+FAVNAIG+S+PSM ++PF+P+A TS P  L V+ V
Sbjct: 695  NFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSV 754

Query: 749  TDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARIL 808
            TDTT T++WRPP+ IGA G+DGY++EYC EG+E+W+ AN + +++  FT+  LPT A+I 
Sbjct: 755  TDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIF 814

Query: 809  FRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKP 868
             RV  VN AG SEP   +QP+ ++EI EPPKIR+PRHL+QTYIR+VGE +NLV+PFQGKP
Sbjct: 815  VRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKP 874

Query: 869  RPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIR 928
            RP++ W K GA +D +++++R S+ DT+ F+R+A RS SG+Y+L V+++   +TA+I I+
Sbjct: 875  RPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQ 934

Query: 929  VVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRH 988
            ++++ GPP  V +++VWG N  + W  PKDDGN+ I GY +QKADKK+MEWF V E    
Sbjct: 935  IIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHR 994

Query: 989  TSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAP 1048
            TS T+++L++GNEYYFRV++EN+CGLS+   ++K +A I + G  +K   Y++ DF  AP
Sbjct: 995  TSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAP 1054

Query: 1049 KFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIR 1108
             F  PL++   +AGY+A LNC+VRG+PKPK+ WMKNK+ I +DP++ + + QGV TL IR
Sbjct: 1055 MFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIR 1114

Query: 1109 RPSPFDAGTYTCRAVNELGEALAECKLEVRV 1139
            +PSP+D GTY C+AVN+LG    ECKLEV+V
Sbjct: 1115 KPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1145


>gi|46049119 myosin binding protein C, slow type isoform 3 [Homo
            sapiens]
          Length = 1141

 Score = 1158 bits (2996), Expect = 0.0
 Identities = 572/1153 (49%), Positives = 782/1153 (67%), Gaps = 62/1153 (5%)

Query: 22   PKEAPPKEAPAEAPKEA---PPED----QSPTAEEPTG---------VFLKKPDSVSVET 65
            P  APP E P++  KEA   P +D    ++P  EE            +F++KP   +V+ 
Sbjct: 13   PAPAPPPEEPSKE-KEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKV 71

Query: 66   GKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFSFKESHNSASNVYTVELHIGK 125
            G+D   +AKV  ++L  KPTIKWFKGKW++L SK+G     KE+    S VYT E+ I K
Sbjct: 72   GEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIK 131

Query: 126  VVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLES-FKRTSEKKSDTAGELDF 184
                  G YR EV  KD  DSC F+++V           + S FKR+ E + D AGELDF
Sbjct: 132  AKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQED-AGELDF 190

Query: 185  SGLLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGITDLRGMLKR 244
            SGLLK+REV ++E++ +           ++WELLK AK SEYEKIAFQYGITDLRGMLKR
Sbjct: 191  SGLLKRREVKQQEEEPQV----------DVWELLKNAKPSEYEKIAFQYGITDLRGMLKR 240

Query: 245  LKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVF 304
            LK+ + E KKSAAF K LDPAYQVD+G +++ +VE++DP L +KW+KNGQEI+PS+KY+F
Sbjct: 241  LKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIF 300

Query: 305  ENVGKKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVE 364
            E+ G +RIL IN C + DD+ Y V   DEKC TELFV+EPP+++   LED   + G+RVE
Sbjct: 301  EHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVE 360

Query: 365  MAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITN 424
            +  EVSE+ A V W K+G E+      K+RYR + +GK+HILI     + D   Y V+T 
Sbjct: 361  LECEVSEDDANVKWFKNGEEIIPGP--KSRYRIRVEGKKHILIIEGATKADAAEYSVMTT 418

Query: 425  GGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRI 484
            GGQ  A+L V+ K L++L  + D TV   ++   KCE+S E + GKW KNG+ V+ S R+
Sbjct: 419  GGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRL 477

Query: 485  TISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLD 544
             + H GR HKLVI +   EDEGDY F PD Y ++L AK++ ++          PPKI LD
Sbjct: 478  KVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVID----------PPKIILD 527

Query: 545  CSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFV 604
              G  ++N + V+AGNKLRL++ I+GEPPP A W +GD+      GR R E   D S+ V
Sbjct: 528  --GLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLV 585

Query: 605  IESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMY 664
            I+ A+R+D G Y I + N  GE  ASI ++VVD PDPP A  +T VG+DW I+ WEPP Y
Sbjct: 586  IDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAY 645

Query: 665  DGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQP 724
            DGG P+ GY +ERKKK S RWM+LNF++  ETT+E  KMIEG+ YE+R+FAVNAIG+S+P
Sbjct: 646  DGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKP 705

Query: 725  SMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGS---- 780
            SM ++PF+P+A TS P  L V+ VTDTT T++WRPP+ IGA G+DGY++EYC EGS    
Sbjct: 706  SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAK 765

Query: 781  --------------EEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLA 826
                          E+W+ AN + +++  FT+  LPT A+I  RV  VN AG SEP   +
Sbjct: 766  QSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYS 825

Query: 827  QPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRV 886
            QP+ ++EI EPPKIR+PRHL+QTYIR+VGE +NLV+PFQGKPRP++ W K GA +D +++
Sbjct: 826  QPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQI 885

Query: 887  HVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWG 946
            ++R S+ DT+ F+R+A RS SG+Y+L V+++   +TA+I I+++++ GPP  V +++VWG
Sbjct: 886  NIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWG 945

Query: 947  TNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRV 1006
             N  + W  PKDDGN+ I GY +QKADKK+MEWF V E    TS T+++L++GNEYYFRV
Sbjct: 946  ENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRV 1005

Query: 1007 YTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAA 1066
            ++EN+CGLS+   ++K +A I + G  +K   Y++ DF  AP F  PL++   +AGY+A 
Sbjct: 1006 FSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNAT 1065

Query: 1067 LNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNEL 1126
            LNC+VRG+PKPK+ WMKNK+ I +DP++ + + QGV TL IR+PSP+D GTY C+AVN+L
Sbjct: 1066 LNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDL 1125

Query: 1127 GEALAECKLEVRV 1139
            G    ECKLEV+V
Sbjct: 1126 GTVEIECKLEVKV 1138


>gi|55956914 myosin binding protein H [Homo sapiens]
          Length = 477

 Score =  457 bits (1175), Expect = e-128
 Identities = 219/415 (52%), Positives = 286/415 (68%), Gaps = 1/415 (0%)

Query: 725  SMNTKPFMPIAPT-SEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEW 783
            S  TKP  P     S PL L ++DV+ ++ T+ W PP R+G  G+ GY++E C EG+ EW
Sbjct: 58   STATKPAPPSEDVPSAPLLLTLDDVSSSSVTVSWEPPERLGRLGLQGYVLELCREGASEW 117

Query: 784  VPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLP 843
            VP +  P+     TV+NL  G + L RV  V+ AG   PA L QP+ IRE  E PKIR+P
Sbjct: 118  VPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPPAMLDQPIHIRENIEAPKIRVP 177

Query: 844  RHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAA 903
            RHLRQTYIR+VGE +NL +PFQGKP+PQ  WT  G  LD+ RV +RT D D++ F+R A 
Sbjct: 178  RHLRQTYIRQVGETVNLQIPFQGKPKPQATWTHNGHALDSQRVSMRTGDQDSILFIRSAQ 237

Query: 904  RSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSE 963
            RSDSG YEL+V++E+++  A I I V+EK GPP ++ + +VWG NA ++W  P+D GN+E
Sbjct: 238  RSDSGRYELTVRVEDLEAKAVIDILVIEKPGPPSSIRLLDVWGCNAALQWTPPQDTGNTE 297

Query: 964  IMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKN 1023
            ++GY VQKADKKT +WF V ER   T+CT+SDLI+GN Y FRV++EN+CGLS S  V+K 
Sbjct: 298  LLGYMVQKADKKTGQWFTVLERYHPTTCTISDLIIGNSYSFRVFSENLCGLSTSATVTKE 357

Query: 1024 TARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMK 1083
             A I K  I  KP  + E DF  AP F  PL D     GYS  L C+VR  PKPK++WMK
Sbjct: 358  LAHIQKADIAAKPKGFIERDFSEAPSFTQPLADHTSTPGYSTQLFCSVRASPKPKIIWMK 417

Query: 1084 NKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVR 1138
            NKMEI+ +PK+   + QGV TL IR+PSPFD+G YTC+A+N LGEA  +C+LEV+
Sbjct: 418  NKMEIQGNPKYRALSEQGVCTLEIRKPSPFDSGVYTCKAINVLGEASVDCRLEVK 472



 Score = 84.0 bits (206), Expect = 8e-16
 Identities = 58/193 (30%), Positives = 86/193 (44%), Gaps = 6/193 (3%)

Query: 537 EPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEK 596
           E PKI +    +      +   G  + L +   G+P P ATW        +   R  +  
Sbjct: 170 EAPKIRVP---RHLRQTYIRQVGETVNLQIPFQGKPKPQATWTHNGHALDSQ--RVSMRT 224

Query: 597 RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAI 656
               S   I SAQR D GRY + V     E  A I + V++ P PP ++R+  V    A 
Sbjct: 225 GDQDSILFIRSAQRSDSGRYELTVRVEDLEAKAVIDILVIEKPGPPSSIRLLDVWGCNAA 284

Query: 657 LVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAV 716
           L W PP   G   + GY+V++  K + +W  +  E +  TT   + +I G  Y  RVF+ 
Sbjct: 285 LQWTPPQDTGNTELLGYMVQKADKKTGQWFTV-LERYHPTTCTISDLIIGNSYSFRVFSE 343

Query: 717 NAIGVSQPSMNTK 729
           N  G+S  +  TK
Sbjct: 344 NLCGLSTSATVTK 356



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 25/94 (26%), Positives = 44/94 (46%)

Query: 637 DVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTET 696
           DVP  P  + +  V      + WEPP   G   + GY++E  ++G+  W+ ++      T
Sbjct: 69  DVPSAPLLLTLDDVSSSSVTVSWEPPERLGRLGLQGYVLELCREGASEWVPVSARPMMVT 128

Query: 697 TYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKP 730
                 +  G  + +RV AV++ G   P+M  +P
Sbjct: 129 QQTVRNLALGDKFLLRVSAVSSAGAGPPAMLDQP 162


>gi|194018539 myosin binding protein H-like [Homo sapiens]
          Length = 354

 Score =  342 bits (876), Expect = 2e-93
 Identities = 157/313 (50%), Positives = 216/313 (69%)

Query: 828  PVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVH 887
            P  +  I E PKI LPR LRQTYIRKVG+ +NL++PFQGKP+PQ +WT  G  LDT RV 
Sbjct: 41   PQLLPPIEEHPKIWLPRALRQTYIRKVGDTVNLLIPFQGKPKPQAIWTHDGCALDTRRVS 100

Query: 888  VRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGT 947
            VR  + D++ F+R+A R+DSG Y+L VQ+  ++ TATI I V+E+ GPP ++ + +VWG 
Sbjct: 101  VRNGEQDSILFIREAQRADSGRYQLRVQLGGLEATATIDILVIERPGPPQSIKLVDVWGF 160

Query: 948  NALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVY 1007
            +A +EW  P+D GN+ ++GY VQKAD K+  WF V E    TSC VSDLI+GN Y FRV+
Sbjct: 161  SATLEWTPPQDTGNTALLGYTVQKADTKSGLWFTVLEHYHRTSCIVSDLIIGNSYAFRVF 220

Query: 1008 TENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAAL 1067
             EN CGLS++  ++ + A I K    +K   + + DF  APKF  PL D   V GY+  L
Sbjct: 221  AENQCGLSETAPITTDLAHIQKAATVYKTKGFAQRDFSEAPKFTQPLADCTTVTGYNTQL 280

Query: 1068 NCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELG 1127
             C VR  P+PK++W+KNKM+I+ +PK+    + G+ +L IR+P PFD G YTC+AVN LG
Sbjct: 281  FCCVRASPRPKIIWLKNKMDIQGNPKYRALTHLGICSLEIRKPGPFDGGIYTCKAVNPLG 340

Query: 1128 EALAECKLEVRVP 1140
            EA  +C+++V+VP
Sbjct: 341  EASVDCRVDVKVP 353



 Score = 79.7 bits (195), Expect = 1e-14
 Identities = 56/190 (29%), Positives = 85/190 (44%), Gaps = 6/190 (3%)

Query: 534 PKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTR 593
           P +E PKI L    +      +   G+ + L +   G+P P A W        T   R  
Sbjct: 46  PIEEHPKIWLP---RALRQTYIRKVGDTVNLLIPFQGKPKPQAIWTHDGCALDTR--RVS 100

Query: 594 IEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGED 653
           +      S   I  AQR D GRY ++V     E  A+I + V++ P PP+++++  V   
Sbjct: 101 VRNGEQDSILFIREAQRADSGRYQLRVQLGGLEATATIDILVIERPGPPQSIKLVDVWGF 160

Query: 654 WAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRV 713
            A L W PP   G   + GY V++    S  W  +  E +  T+   + +I G  Y  RV
Sbjct: 161 SATLEWTPPQDTGNTALLGYTVQKADTKSGLWFTV-LEHYHRTSCIVSDLIIGNSYAFRV 219

Query: 714 FAVNAIGVSQ 723
           FA N  G+S+
Sbjct: 220 FAENQCGLSE 229



 Score = 44.7 bits (104), Expect = 5e-04
 Identities = 41/152 (26%), Positives = 57/152 (37%), Gaps = 19/152 (12%)

Query: 740 PLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVK 799
           P  + + DV   + TL+W PP   G   + GY V+     S  W     E   R    V 
Sbjct: 149 PQSIKLVDVWGFSATLEWTPPQDTGNTALLGYTVQKADTKSGLWFTV-LEHYHRTSCIVS 207

Query: 800 NLPTGARILFRVVGVNIAGRSEPATLA-------QPVTI--------REIAEPPKIRLPR 844
           +L  G    FRV   N  G SE A +        +  T+        R+ +E PK   P 
Sbjct: 208 DLIIGNSYAFRVFAENQCGLSETAPITTDLAHIQKAATVYKTKGFAQRDFSEAPKFTQPL 267

Query: 845 HLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTK 876
               T     G    L    +  PRP+++W K
Sbjct: 268 ADCTTV---TGYNTQLFCCVRASPRPKIIWLK 296


>gi|253970427 immunoglobulin superfamily, member 22 [Homo sapiens]
          Length = 1326

 Score =  310 bits (793), Expect = 7e-84
 Identities = 254/903 (28%), Positives = 390/903 (43%), Gaps = 61/903 (6%)

Query: 267  QVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
            +V   ++  L  E++  D+TL+W K+GQ +   +KY   + GK+  L I    L+D   Y
Sbjct: 429  RVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEY 488

Query: 327  EVAVKDEKCFTELF------VKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMK 380
             V    +   TE +      V+E    + + + D     G   E+ V +++E  + +W+K
Sbjct: 489  TVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDEKVEGVWLK 548

Query: 381  DGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQL- 439
            DG E+T     +      K G  H LIF  +  E  G+Y     G + EA + + +    
Sbjct: 549  DGKEITDLPGMQ----IVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTI 604

Query: 440  --EVLQDIAD--LTVKASEQAVFKCEVSDE---KVTGKWYKNGVEVRPSKRITISHVGRF 492
               VL+ +A   +TVK    A  K     +   KVT  WYK+G+EV   +R+++      
Sbjct: 605  DPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVT--WYKDGMEVTEEERVSMERGEDQ 662

Query: 493  HKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIH---LDCSGKT 549
              L I +   ED G           S +A L+     +  + + +PP+     L+ SG  
Sbjct: 663  ALLTISNCVREDSGLILLKLKNDHGSATATLH-----LSVLDRPKPPQGRVEFLELSGSC 717

Query: 550  SENAIVVVAGNKLRLDVSITGEPPPVA--TWLKGDEVFTTTEGRTRIEKRVDCSSFVIES 607
                      N  R       E   V   +W+K  EV    +G+         ++F    
Sbjct: 718  VHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEV----DGKV--------TNFSTNK 765

Query: 608  AQREDEGRYTIKVTNPVGE----DVASIFL-QVVDVPDPPEAVRITSVGEDWAILVWEPP 662
             +     ++ I   N  G     +   +F    ++ P      ++T V ++   + W  P
Sbjct: 766  VEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAP 825

Query: 663  MYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVS 722
              DGG PV GY+VER+KKGS  W+ +N +    T      ++E   YE RV AVN  G  
Sbjct: 826  TQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPG 885

Query: 723  QPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEG 779
            QPS+ +   +   P+ P      L V D ++++ +L WR P         GY++E   E 
Sbjct: 886  QPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAED 943

Query: 780  SEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPK 839
            ++EW      P+    +TV  L    +  FR+  VN AG  EP  L + V        PK
Sbjct: 944  TKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPK 1003

Query: 840  IRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFV 899
              L   L+   + + G  L +   F G P P V+W K G P    R  +  S   + F +
Sbjct: 1004 FDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVP-TKGRETITKSKNHSQFLI 1062

Query: 900  RQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDD 959
                RSDSG Y + +Q E  +    I +RV +   PP N+ + E       + W    D 
Sbjct: 1063 NSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDV 1122

Query: 960  GNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPG 1019
                   Y + K D  T  W+   ER      TV+ L+ G +YYFRV   N  G S+ P 
Sbjct: 1123 QEDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSE-PL 1181

Query: 1020 VSKNTARILKTGI-----TFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGH 1074
             S++T  I K  I       KP+E K  D+R AP+F+TPL    V+ G    + CA  G+
Sbjct: 1182 DSRDTWLINKDQIQDLSAKLKPYEKK--DWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGN 1239

Query: 1075 PKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECK 1134
            P+P V   K  + I  + KF   +  GV TL I   +  D+G Y+    NELG+  + C 
Sbjct: 1240 PRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCT 1299

Query: 1135 LEV 1137
            L V
Sbjct: 1300 LTV 1302



 Score =  244 bits (624), Expect = 3e-64
 Identities = 254/1000 (25%), Positives = 398/1000 (39%), Gaps = 131/1000 (13%)

Query: 54   FLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLE------------------ 95
            F++KP  V+   G  AV  A+V G     KP I W +   +                   
Sbjct: 69   FVEKPQPVTAPEGDKAVFRARVQGNA---KPHISWKRESGIPIKESAKIFYDSINKEHVL 125

Query: 96   ----LGSKSGARFSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKA--KDTCDSCGF 149
                L S     +    S++ A  +YTV L      L   G  +++ K   K        
Sbjct: 126  KLEPLTSDDSDNYKCIASNDHADAIYTVSL------LVTEGQEKMDFKKMLKKRAPPAPK 179

Query: 150  NIDVEAPRQDASGQSLESF-KRTSEKKSDTAGELDFSGLLKKREVVEEEKKK-------- 200
                +   +    + L    K+  EK     G  DF GLL+K   ++E KKK        
Sbjct: 180  KKQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRK---LKEMKKKVEVEAIRI 236

Query: 201  -KKKDDDDLGIPPE-----IWEL---------LKGAK---------KSEYEKIAFQY--- 233
             K  +D +  +        I EL         +KG +         K + +++  +Y   
Sbjct: 237  LKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLV 296

Query: 234  ---------GITDLRGMLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPD 284
                     GI  L    KR+      + +   F  ++ P    +R   +   + +S  +
Sbjct: 297  ISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAV-FEIRLSKKE 355

Query: 285  LTLKWFKNGQEIKPSSKY--VFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTELFVK 342
                W  NG+E+K   KY       G    L I    L+D   +     +     +L + 
Sbjct: 356  PNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTID 415

Query: 343  EPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGK 402
              P+  V+ L++ +V    R  +  E++ +   + W KDG  L        +Y    +GK
Sbjct: 416  RIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHG----TKYSMNHEGK 471

Query: 403  RHILIFSDVVQEDRGRYQVIT--NGGQCE----AELIVEEKQLEVLQDIADLTVKASEQA 456
            R  LI  D    D G Y V+   +G   E    A + VEE+   V   ++D+       A
Sbjct: 472  RAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPA 531

Query: 457  VFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYA 516
                 ++DEKV G W K+G E+     + I   G  HKL+   + PE EG YTF   G  
Sbjct: 532  ELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTE 591

Query: 517  LSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVA 576
               S  +             +PP I        + +AI V  G+   + V   G+P P  
Sbjct: 592  SEASVFI------------ADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKV 639

Query: 577  TWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVV 636
            TW K D +  T E R  +E+  D +   I +  RED G   +K+ N  G   A++ L V+
Sbjct: 640  TWYK-DGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVL 698

Query: 637  DVPDPPEA-VRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTE 695
            D P PP+  V    +      + W+ P  +GG+PVT ++VER+  G + W+K+       
Sbjct: 699  DRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKV 758

Query: 696  TTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM--PIAPTSEPLHLIVEDVTDTTT 753
            T + + K+ EG  Y+ R+ AVN+ GVS P    + F   PI P        V DVT    
Sbjct: 759  TNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAV 818

Query: 754  TLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVG 813
            T+ W  P + G   + GY+VE   +GS  WVP N +P++    TV  L       FRV+ 
Sbjct: 819  TITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIA 878

Query: 814  VNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVV 873
            VN AG  +P+  +  V  ++  +PP +    H+  +    +   L    P +G P    +
Sbjct: 879  VNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSI--SLAWREPAEGDPPSGYI 936

Query: 874  WTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGE-YELSVQIENMKDTATIRIRVVEK 932
                        + +R    DT  + +      SG  Y +   IE  K     RIR V +
Sbjct: 937  ------------LEMRAE--DTKEWSKCTKIPISGTCYTVGGLIERQK--YFFRIRAVNE 980

Query: 933  AGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKA 972
            AG  +   V+   G  A+    APK D ++ +  + V +A
Sbjct: 981  AG--VGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRA 1018



 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 70/300 (23%), Positives = 107/300 (35%), Gaps = 47/300 (15%)

Query: 376  VMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVE 435
            V+W KDGV        K R    K       + +   + D G Y+++      EA   + 
Sbjct: 1036 VIWQKDGVPT------KGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIH 1089

Query: 436  EK---------QLEVLQDIADLT---------VKASEQAVFKCEVSDEKVTGKWYKNGVE 477
             +          L + +++ +           V+   +A +     D   T  WY     
Sbjct: 1090 VRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDAS-TATWYTAAER 1148

Query: 478  VRPSK-RITISHVGR--FHKLV----IDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKV 530
            V  +K  +T    GR  + ++V    I D  P D  D   +       LSAKL   E K 
Sbjct: 1149 VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKD 1208

Query: 531  -EYVPKQEPP-KIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTT 588
              + P+   P K H             V+ G    +  +  G P P  T  KGD V  T 
Sbjct: 1209 WRHAPRFVTPLKPH------------TVLRGQDCTMTCAFLGNPRPTVTLYKGD-VNITA 1255

Query: 589  EGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRIT 648
              +          + VI +   +D G Y++ V N +G+D +S  L V D  D      IT
Sbjct: 1256 NSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASIT 1315



 Score = 33.5 bits (75), Expect = 1.2
 Identities = 32/129 (24%), Positives = 54/129 (41%), Gaps = 10/129 (7%)

Query: 235  ITDLRGMLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVE-ISDPDLTLKWFKNG 293
            I DL   LK  +K   + + +  F   L P + V RG    +    + +P  T+  +K  
Sbjct: 1194 IQDLSAKLKPYEKK--DWRHAPRFVTPLKP-HTVLRGQDCTMTCAFLGNPRPTVTLYKGD 1250

Query: 294  QEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDE------KCFTELFVKEPPVL 347
              I  +SK+ + +      L I  CTL D   Y V V++E       C   ++ K+   +
Sbjct: 1251 VNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSV 1310

Query: 348  IVTPLEDQQ 356
            + +  E  Q
Sbjct: 1311 VASITESLQ 1319


>gi|110349719 titin isoform N2-A [Homo sapiens]
          Length = 33423

 Score =  275 bits (704), Expect = 1e-73
 Identities = 222/790 (28%), Positives = 337/790 (42%), Gaps = 43/790 (5%)

Query: 279   EISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTE 338
             ++S     +KW++NG+EIK   KY FE  G    L I  C L D+  Y   V+D K    
Sbjct: 12845 QLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRAR 12904

Query: 339   LFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFK 398
             LFV+E PV I+ P +D     G  V    E++++  +V W+++ + + + D    +++  
Sbjct: 12905 LFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGD----KHQMM 12960

Query: 399   KDGKRHILIFSDVVQEDRGRYQVITNGGQCEA--ELIVEEKQLEVLQDIA-----DLTVK 451
              +GK H L   D+   D+G Y+ I    +  A  EL    K     QD+       LT+ 
Sbjct: 12961 SEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAPKIKTADQDLVVDVGKPLTMV 13020

Query: 452   ASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFV 511
                 A  K E        +W+K   E  P    TI          I + +  D+G Y  V
Sbjct: 13021 VPYDAYPKAEA-------EWFK---ENEPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIV 13070

Query: 512   PDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGE 571
                        +N   I V    +        D     +    +   G+K+ +   +   
Sbjct: 13071 LQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKI-IGYVVERR 13129

Query: 572   PPPVATWLKGDEVFTTTEGR-TRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVAS 630
                  TW+   +   + E   T ++K      F + +  R   G   ++  NPV  +  S
Sbjct: 13130 DIKRKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGE-PVETDNPV--EARS 13186

Query: 631   IFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRW---MK 687
              +    DVP PP  V IT V      L WEPP YDGG  +T Y++E + K S RW   M 
Sbjct: 13187 KY----DVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMT 13242

Query: 688   LNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM----PIAPTSEPLHL 743
             +  E  + T    T ++EG  Y  RV A N IGV +PS  T PF+    PI   S P++L
Sbjct: 13243 VRAEDLSATV---TDVVEGQEYSFRVRAQNRIGVGKPSAAT-PFVKVADPIERPSPPVNL 13298

Query: 744   IVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPT 803
                D T ++  LKW PP + G   I GY++E C EG + W+  N + V    + V  L  
Sbjct: 13299 TSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEK 13358

Query: 804   GARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVP 863
             G + L+RV   N AG S+P+ +  P+T  +    P + L        +  V   + ++VP
Sbjct: 13359 GNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVI-VPNPITILVP 13417

Query: 864   FQGKPRPQVVWTKGGAPLDTS-RVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDT 922
               G PRP   W  G   L+T  RV ++T        +  + RSD G Y L ++      +
Sbjct: 13418 STGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTIS 13477

Query: 923   ATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNV 982
               I + V+ +   P  +   ++   +  + W+ P DDG S + GY V+K +     W  V
Sbjct: 13478 GEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV 13537

Query: 983   YERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEH 1042
              +       TV DL+ G EY F+V   N CG  +   V +         +   P   K  
Sbjct: 13538 MDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWR 13597

Query: 1043  DFRMAPKFLT 1052
             D      FLT
Sbjct: 13598 DRTANSIFLT 13607



 Score =  274 bits (701), Expect = 3e-73
 Identities = 167/480 (34%), Positives = 243/480 (50%), Gaps = 13/480 (2%)

Query: 537   EPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEK 596
             EPP+I LD   +     +V+ A   LRL V+I G P P   W K + + T    R +IE 
Sbjct: 25103 EPPEIELDADLR---KVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILTD---RAQIEV 25156

Query: 597   RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAI 656
                 +  VI++  R D GRY + + N  G   A + ++V+D P  P  + I  V +D   
Sbjct: 25157 TSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVT 25216

Query: 657   LVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAV 716
             L WEPP+ DGG  +T Y+VE+++   + +  +     T+TT+    + EG  Y  RV A 
Sbjct: 25217 LSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNC-TKTTFRIENLQEGCSYYFRVLAS 25275

Query: 717   NAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
             N  G+  P+  T+P     P   P  + + DVT  T T+KW  P   G   I GY+VE  
Sbjct: 25276 NEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQ 25335

Query: 777   LEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAE 836
              +GSE+W  +    V+    T+  L  G   +FRV  VN  GRS+P  L  PV  R+I  
Sbjct: 25336 TKGSEKW--STCTQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEI 25393

Query: 837   PPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVRTSDFDT 895
              P + LP H   T+  K  EQL + VPF+G+P+  V W K G  L +T+RV+V +S   T
Sbjct: 25394 KPSVELPFH---TFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVT 25450

Query: 896   VFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQA 955
                +++A++ D G YEL V       T  I I V+++ GPP  + + EV   +  + W  
Sbjct: 25451 SLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPPGPIRIDEVSCDSITISWNP 25510

Query: 956   PKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLS 1015
             P+ DG  +I  Y V+K +  +  W  V +    TS  +  L  G+EY FRV  EN  G S
Sbjct: 25511 PEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKS 25570



 Score =  265 bits (678), Expect = 1e-70
 Identities = 169/568 (29%), Positives = 272/568 (47%), Gaps = 23/568 (4%)

Query: 535   KQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRI 594
             K E P++ LD   +     IVV AG   R+ +   G P P  TW + +  FT    + +I
Sbjct: 24018 KLEAPELDLDSELR---KGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTD---KVQI 24071

Query: 595   EKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDW 654
             EK V+ +   I++  R D G+Y +K+ N  G   A + ++V+D P PP+ + +  V +D 
Sbjct: 24072 EKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDS 24131

Query: 655   AILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVF 714
             A LVWEPP+ DGG  V  Y++++++   + +  ++ +  ++T+++   + EG +Y  RV 
Sbjct: 24132 AFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKC-SKTSFKVENLTEGAIYYFRVM 24190

Query: 715   AVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
             A N  GV  P           P S P  + + DV+ T+ +L W  P   G   + GY+VE
Sbjct: 24191 AENEFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVE 24250

Query: 775   YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREI 834
                +G+E+W       V  C   V  L +G    FRV   N  G+S+P  L  PV  +++
Sbjct: 24251 MQPKGTEKWSIVAESKV--CNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDL 24308

Query: 835   AEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVRTSDF 893
                P ++LP +   TY  + GE L + +P  G+PRP + W K G PL  T+RV+V  +  
Sbjct: 24309 TIQPSLKLPFN---TYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETAT 24365

Query: 894   DTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTNALVE 952
              TV  +++  + D G+Y ++        T  + + V+EK GPP+  V   EV     ++ 
Sbjct: 24366 STVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVSADFVVIS 24425

Query: 953   WQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENIC 1012
             W+ P   G  +I  Y V+K D  T  W  V      T+  ++ L  G EY FR++ EN  
Sbjct: 24426 WEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRY 24485

Query: 1013  GLS---DSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNC 1069
             G S   DS  V        + G    PF       +M  ++  P+ D     G +  +  
Sbjct: 24486 GKSAPLDSKAVIVQYP-FKEPGPPGTPFVTSISKDQMLVQWHEPVND-----GGTKIIGY 24539

Query: 1070  AVRGHPKPKVVWMKNKMEIREDPKFLIT 1097
              +    K  ++W+K      +D KF  T
Sbjct: 24540 HLEQKEKNSILWVKLNKTPIQDTKFKTT 24567



 Score =  261 bits (668), Expect = 2e-69
 Identities = 175/561 (31%), Positives = 269/561 (47%), Gaps = 37/561 (6%)

Query: 471   WYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKV 530
             W+  G ++R S+R+T+    +  KL I +    D G+YT        + S       IKV
Sbjct: 29772 WFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSET-----IKV 29826

Query: 531   EYVPKQEPPK--IHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPV--ATWLKG---DE 583
               + K  PP   I +D    TS               ++I+ EPP +     L G   ++
Sbjct: 29827 IILDKPGPPTGPIKIDEIDATS---------------ITISWEPPELDGGAPLSGYVVEQ 29871

Query: 584   VFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNP--VGEDVASIFLQV---VDV 638
                   G   + + V  S+F        +E  + +  TN   +G  + S  ++    + +
Sbjct: 29872 RDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIECRSSIRI 29931

Query: 639   PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTY 698
             P PPE ++I  V  D   L W PP  DGG  VTGY+VERK+  + RW+++N    T T Y
Sbjct: 29932 PGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRY 29991

Query: 699   ESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTL 755
              ST + EG+ YE RV A+NA G  +PS  +KP +   PIAP  +P +  V D T T+ +L
Sbjct: 29992 RSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSL 30051

Query: 756   KWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVN 815
              W  P   G   + GYL+E       EW   NT P +   +T+ +LP GA   FRV+  N
Sbjct: 30052 AWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACN 30111

Query: 816   IAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWT 875
               G  EPA +   V + E+ E P   L    ++    + G  + L +P +GKP P   WT
Sbjct: 30112 AGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWT 30171

Query: 876   KGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGP 935
             K G  + + R  + TS+  T   +++A R DSG Y+L ++ +  K    I++RV+     
Sbjct: 30172 KEGQDI-SKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIGSPNS 30230

Query: 936   PINVM-VKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVS 994
             P   +   ++   +  V W+ P DDG ++I+GY +++ +     W+ +  R R TS  V 
Sbjct: 30231 PEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVK 30290

Query: 995   DLIVGNEYYFRVYTENICGLS 1015
              L    EY+FRV  EN  G+S
Sbjct: 30291 GLKENVEYHFRVSAENQFGIS 30311



 Score =  252 bits (644), Expect = 1e-66
 Identities = 177/599 (29%), Positives = 286/599 (47%), Gaps = 32/599 (5%)

Query: 448   LTVKASEQAVFKCEVSDEKVTG-KWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG 506
             + VKA E      +++   +    W K+G+E+    R  I        L + D    D G
Sbjct: 25799 IVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTG 25858

Query: 507   DYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDV 566
              Y       A + S  +N      + + K  PP   L+ +G T+E   +  +  + + D 
Sbjct: 25859 QYVLTLKNVAGTRSVAVN-----CKVLDKPGPPAGPLEINGLTAEKCSL--SWGRPQEDG 25911

Query: 567   SITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNP--V 624
                 +   V         +T  EG  ++      +S  +    + +E  + +   N   V
Sbjct: 25912 GADIDYYIVEKRETSHLAWTICEGELQM------TSCKVTKLLKGNEYIFRVTGVNKYGV 25965

Query: 625   GEDVASIFLQVVD---VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKG 681
             GE + S+ ++ +D   VP PP ++ ITSV ++   L W  P  DGG  ++GY++ER++K 
Sbjct: 25966 GEPLESVAIKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSEISGYIIERREKN 26025

Query: 682   SQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM----PIAPT 737
             S RW+++N +   +   +ST + EG  YE RV+A NA G+S PS  T P +    P+   
Sbjct: 26026 SLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPS-ETSPLIRAEDPVFLP 26084

Query: 738   SEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFT 797
             S P    + D   TT T+ W  P   G   I GY VEY      +W   + + +    +T
Sbjct: 26085 SPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDW-KTSIQSLRGTEYT 26143

Query: 798   VKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQ 857
             +  L TGA  +FRV  VN  G S+P+  + P   +E  E P   +   +R+T I K G  
Sbjct: 26144 ISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGAS 26203

Query: 858   LNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIE 917
               + VPF+G+P P V+W+K    L T R +V T+D  T   +  A R+DSG+Y L++Q  
Sbjct: 26204 FTMTVPFRGRPVPNVLWSKPDTDLRT-RAYVDTTDSRTSLTIENANRNDSGKYTLTIQNV 26262

Query: 918   NMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTM 977
                 + T+ ++V++  GPP N+ V++V   +A++ W  P++DG + +  Y ++K +    
Sbjct: 26263 LSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKREASKK 26322

Query: 978   EWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKP 1036
              W +V       S  V++L  G  YYFRV  EN  G+    G+   T   +K  IT KP
Sbjct: 26323 AWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGV----GIPAETKEGVK--ITEKP 26375



 Score =  249 bits (637), Expect = 8e-66
 Identities = 181/600 (30%), Positives = 287/600 (47%), Gaps = 38/600 (6%)

Query: 448   LTVKASEQAVFKCEVSDEKV-TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG 506
             LTVKA         V  + + T  W K+G  ++P++ I ++       L +  V  +D G
Sbjct: 19305 LTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSG 19364

Query: 507   DYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDV 566
             DYT   +  + S SA      IK++ + K  PP                 V  NK+  D 
Sbjct: 19365 DYTITAENSSGSKSAT-----IKLKVLDKPGPP---------------ASVKINKMYSDR 19404

Query: 567   SITGEPPPVA------TWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKV 620
             ++    PP+       T    D+  T+     ++   V  +S  +E      E ++ I  
Sbjct: 19405 AMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICA 19464

Query: 621   TNP--VGEDVASIFLQVVDVPDPP---EAVRITSVGEDWAILVWEPPMYDGGKPVTGYLV 675
              N   VG+ V +      +  DPP   +   I+++ +D   + W+PP  DGG P+TGYL+
Sbjct: 19465 ENKYGVGDPVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLL 19524

Query: 676   ERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM--- 732
             E+++  +  W K+N +   E T ++T + EG  YE RV A+N  G  +PS  +K      
Sbjct: 19525 EKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARD 19584

Query: 733   PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANT-EPV 791
             P  P   P    V D T ++ +L W  P   G   I GYLVE     S+ WV  N  + +
Sbjct: 19585 PQYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNL 19644

Query: 792   ERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYI 851
             ++  F V  L    +  FRV  VN  G S+P+ +      ++I  PP+  L   LR+T I
Sbjct: 19645 QKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLI 19704

Query: 852   RKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVRTSDFDTVFFVRQAARSDSGEY 910
              + G  + L VP +G+P P++ W+K    L D   + ++++DFDT        + D+G+Y
Sbjct: 19705 LRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKY 19764

Query: 911   ELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQ 970
              L+++    K   TI ++V++  GPP+NV VKE+   +A V W+ P  DG S I+ Y VQ
Sbjct: 19765 ILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQ 19824

Query: 971   KADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKT 1030
             K D +   W  V      TS  V++L  G  Y+FRV+ EN  G+ D PG +++  +  +T
Sbjct: 19825 KRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGD-PGETRDAVKASQT 19883



 Score =  246 bits (628), Expect = 9e-65
 Identities = 155/494 (31%), Positives = 245/494 (49%), Gaps = 17/494 (3%)

Query: 530   VEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTE 589
             +E   +   P + LD S +   + IVV AG  +R+   ++G+PPP  TW   +    T  
Sbjct: 16513 IEMKDRLVSPDLQLDASVR---DRIVVHAGGVIRIIAYVSGKPPPTVTWNMNER---TLP 16566

Query: 590   GRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRIT- 648
                 IE     SS VI++ QR  +G Y++   N  GE   +I + V+DVP P     +  
Sbjct: 16567 QEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAH 16626

Query: 649   SVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGIL 708
             ++  +   L W  P  DGG P+T Y++E+++   + W  + + V T        +I+G  
Sbjct: 16627 NLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTV-TRQNATVQGLIQGKA 16685

Query: 709   YEMRVFAVNAIGVSQPSMNTKPFM----PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIG 764
             Y  R+ A N+IG+  P + T   +    PI     P  L V++VT  T TL W PP   G
Sbjct: 16686 YFFRIAAENSIGMG-PFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDG 16744

Query: 765   AGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPAT 824
                I  Y++E  L G+E++     + +    +TVK L  G    +RV  VNI G+ +P+ 
Sbjct: 16745 GSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSF 16804

Query: 825   LAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAP-LDT 883
               +P+T ++   PP + L    R     +VGE   L   + GKP+P+V W K  A  L+ 
Sbjct: 16805 CTKPITCKDELAPPTLHL--DFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLED 16862

Query: 884   SRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVK 942
              R H++T+         +A RSDSG+Y + V+          ++ VV++ GPP+  V   
Sbjct: 16863 DRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFD 16922

Query: 943   EVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEY 1002
             EV     ++ W+ P DDG S+I  Y ++K +     W  V   +  T+C VS L+ G +Y
Sbjct: 16923 EVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDY 16982

Query: 1003  YFRVYTENICGLSD 1016
              FR++ EN+ G+SD
Sbjct: 16983 IFRIHAENLYGISD 16996



 Score =  246 bits (627), Expect = 1e-64
 Identities = 150/488 (30%), Positives = 235/488 (48%), Gaps = 9/488 (1%)

Query: 529   KVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTT 588
             ++E V + E P + L       +  + + AG  LRL VS++G PPPV TW K        
Sbjct: 29434 EIEPVERIEIPDLEL---ADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQG---IDL 29487

Query: 589   EGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRIT 648
               R  I+     S  +++   R D G+YTI+  N  G+  A++ ++V D P P  +V++ 
Sbjct: 29488 ASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVK 29547

Query: 649   SVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGIL 708
              V  D   + WE P  DGG PV  Y+VE K++ + R  K      ++T Y  + ++EG +
Sbjct: 29548 EVSRDSVTITWEIPTIDGGAPVNNYIVE-KREAAMRAFKTVTTKCSKTLYRISGLVEGTM 29606

Query: 709   YEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGI 768
             Y  RV   N  G+ +P   +   +       P  L V DVT +T TL W  P   G   +
Sbjct: 29607 YYFRVLPENIYGIGEPCETSDAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRL 29666

Query: 769   DGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQP 828
              GY++E C  G+E W+   T        TV +L  G + LFR+   N  G SEP      
Sbjct: 29667 TGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTA 29726

Query: 829   VTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVH 887
             VT++++   P I L    ++T     G  + LV+P  G+P P   W   G+ L ++ RV 
Sbjct: 29727 VTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVT 29786

Query: 888   VRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWG 946
             V T        +R+    D+GEY L ++      + TI++ +++K GPP   + + E+  
Sbjct: 29787 VETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDA 29846

Query: 947   TNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRV 1006
             T+  + W+ P+ DG + + GY V++ D     W  V E    ++   + L  GNEY FRV
Sbjct: 29847 TSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRV 29906

Query: 1007  YTENICGL 1014
                N  G+
Sbjct: 29907 AATNRFGI 29914



 Score =  243 bits (620), Expect = 8e-64
 Identities = 162/502 (32%), Positives = 240/502 (47%), Gaps = 27/502 (5%)

Query: 527   EIKVEYVPKQ--EPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEV 584
             E+K    PK+  EPP+I LD S +     ++V AG  +RL   + G P P  TW K    
Sbjct: 18590 ELKEAIKPKEILEPPEIDLDASMR---KLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGID 18646

Query: 585   FTTTEGRTRIEKRVDCSSF-VIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPE 643
                 +G+  +   VD  +F VI ++ R+D G+Y++ + NP GE    + ++V+D P P  
Sbjct: 18647 NVVRKGQVDL---VDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVS 18703

Query: 644   AVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKM 703
              ++++ V +    + W PP  DGG  VT Y+VE+++   + W  +  EV  +T++  T +
Sbjct: 18704 DLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEV-KKTSFHVTNL 18762

Query: 704   IEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSE---PLHLIVEDVTDTTTTLKWRPP 760
             + G  Y  RV AVN  G   P+   KP +   P SE   P  L V ++T  + TL W PP
Sbjct: 18763 VPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPP 18822

Query: 761   NRIGAGGIDGYLVEYCLEGSEEWVPANT----EPVERCGFTVKNLPTGARILFRVVGVNI 816
              R G   IDGY+  Y     EE  PA+       V+     V  L  G +  FRV   N 
Sbjct: 18823 LRDGGAKIDGYITSY----REEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNA 18878

Query: 817   AGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTK 876
              G S P         +E   PPKI +P  +      K G++L +     GKP P   W K
Sbjct: 18879 VGVSLPREAEGVYEAKEQLLPPKILMPEQI----TIKAGKKLRIEAHVYGKPHPTCKWKK 18934

Query: 877   GGAPLDT-SRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGP 935
             G   + T S + V  +D  ++  ++   R DSG Y L+ +  +  DT  I++ V++  GP
Sbjct: 18935 GEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGP 18994

Query: 936   PINVM-VKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVS 994
             P     + ++      + W  P +DG S I  Y V+K D    +W         TSC V 
Sbjct: 18995 PQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVG 19054

Query: 995   DLIVGNEYYFRVYTENICGLSD 1016
              LI G EY FRV  EN  G+S+
Sbjct: 19055 KLIPGQEYIFRVRAENRFGISE 19076



 Score =  239 bits (610), Expect = 1e-62
 Identities = 152/487 (31%), Positives = 236/487 (48%), Gaps = 22/487 (4%)

Query: 535   KQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRI 594
             K E P I LD   +   N   + AG  LRL V I G P P   W K D       G  R 
Sbjct: 22936 KLEAPDIDLDLELRKIIN---IRAGGSLRLFVPIKGRPTPEVKWGKVD-------GEIRD 22985

Query: 595   EKRVDCSS----FVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSV 650
                +D +S     V+++  R D G+YT+ + N  G   A + ++V+D P PP  +++T +
Sbjct: 22986 AAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEI 23045

Query: 651   GEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYE 710
              +D   + WEPP+ DGG  +  Y+VE+++   + +  +      + +++  ++ EG  Y 
Sbjct: 23046 TKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCH-KNSWKIDQLQEGCSYY 23104

Query: 711   MRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDG 770
              RV A N  G+  P+    P         P  + V+DVT  + +L W  P   G   I  
Sbjct: 23105 FRVTAENEYGIGLPAQTADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQ 23164

Query: 771   YLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVT 830
             Y+VE   + SE+W  +    V+     + NL  G   LFRVV VN  GRS+P +LA P+ 
Sbjct: 23165 YIVEMQAKHSEKW--SECARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIV 23222

Query: 831   IREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVR 889
              +++   P +   +    +Y  +VG+ L + VP  G+P+P + WTK G PL  T+R++V 
Sbjct: 23223 AKDLVIEPDV---KPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVT 23279

Query: 890   TSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTN 948
              S   T   +++  + D G+Y ++V     + TA+I I  ++K  PP   V   +V   +
Sbjct: 23280 DSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAES 23339

Query: 949   ALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYT 1008
               + W  P   G  +I  Y VQK D  T  W  V      T+  V+ L  G EY FR++ 
Sbjct: 23340 ITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFA 23399

Query: 1009  ENICGLS 1015
             EN  G S
Sbjct: 23400 ENRYGQS 23406



 Score =  238 bits (607), Expect = 2e-62
 Identities = 178/616 (28%), Positives = 277/616 (44%), Gaps = 39/616 (6%)

Query: 429   EAELIVEEKQLEVLQDIA---DLTVKASEQAVFKCEVSDEK-VTGKWYKNGVEVRPSKRI 484
             EAE + E K+  +   I     +T+KA ++   +  V  +   T KW K   EV  S  +
Sbjct: 18886 EAEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHL 18945

Query: 485   TISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLD 544
              +        L+I DV  +D G Y+   +      S+  +  +IKV  +    PP+   D
Sbjct: 18946 AVHKADSSSILIIKDVTRKDSGYYSLTAEN-----SSGTDTQKIKVVVMDAPGPPQPPFD 19000

Query: 545   CSGKTSENA-----IVVVAGNKLRLDVSITGEPPPVATWLKGDEVF---TTTEGRTRIEK 596
              S   ++       I +  G       +IT          +GD V    + T+   R+ K
Sbjct: 19001 ISDIDADACSLSWHIPLEDGGS-----NITNYIVEKCDVSRGDWVTALASVTKTSCRVGK 19055

Query: 597   RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAI 656
              +    ++        E R+ I       + VA        VP  P+  R+T V +D   
Sbjct: 19056 LIPGQEYIFRVRA---ENRFGISEPLTSPKMVAQF---PFGVPSEPKNARVTKVNKDCIF 19109

Query: 657   LVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAV 716
             + W+ P  DGG P+ GYL+ERK++ S  W+K N  +   T Y    ++EG+ Y  R++A+
Sbjct: 19110 VAWDRPDSDGGSPIIGYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYAL 19169

Query: 717   NAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
             N  G S PS  T+      P   P    V DVT +T +L W  P   G   I GY VE C
Sbjct: 19170 NKAGSSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEAC 19229

Query: 777   LEGSEEWVPANTEP--VERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREI 834
                 ++WV  NT P  + +  +T   L   A+  FR +       S P+  + PVTI   
Sbjct: 19230 KLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAE 19289

Query: 835   AEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGA---PLDTSRVHVRTS 891
               PP+I L   ++     K G  + L     GKP P V W K G    P +  ++ ++ +
Sbjct: 19290 NVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRN 19349

Query: 892   DFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALV 951
                   F     R DSG+Y ++ +  +   +ATI+++V++K GPP +V + +++   A++
Sbjct: 19350 LCTLELF--SVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAML 19407

Query: 952   EWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENI 1011
              W+ P +DG SEI  Y V K +     W  V      TSC+V  LI G+EY FR+  EN 
Sbjct: 19408 SWEPPLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENK 19467

Query: 1012  CGLSD----SPGVSKN 1023
              G+ D     P ++KN
Sbjct: 19468 YGVGDPVFTEPAIAKN 19483



 Score =  238 bits (606), Expect = 3e-62
 Identities = 157/496 (31%), Positives = 232/496 (46%), Gaps = 19/496 (3%)

Query: 537   EPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEK 596
             EPP++ LD +    ++   +  G+ LRL   I G P P  TW K D    T   + RI+ 
Sbjct: 17214 EPPELILDANMAREQH---IKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPT---KARIDV 17267

Query: 597   RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAI 656
                 S   I +A  ED G Y++ V NP G    S+ + V+D P PP  + ++ + +D   
Sbjct: 17268 TPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCY 17327

Query: 657   LVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAV 716
             L W+ P+ DGG  +T Y+VER+   S +W  L+     + ++ +  + EG  Y  RV A 
Sbjct: 17328 LTWKEPLDDGGSVITNYVVERRDVASAQWSPLS-ATSKKKSHFAKHLNEGNQYLFRVAAE 17386

Query: 717   NAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLV 773
             N  G        KP     P+ P   P  L   DV  T  +L W  P+R G   I GYLV
Sbjct: 17387 NQYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLV 17446

Query: 774   EYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIRE 833
             EY  EG+++W+   T     C   V  L  G    FRV   NI G   P T   P+  +E
Sbjct: 17447 EYQEEGTQDWIKFKTVTNLEC--VVTGLQQGKTYRFRVKAENIVGLGLPDTTI-PIECQE 17503

Query: 834   IAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVH-VRTSD 892
                PP + L   L +  + K G  +      +G P P   WT  G+ + T   + V T +
Sbjct: 17504 KLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDN 17563

Query: 893   FDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTNALV 951
             F +V  ++   R D+GEY+++V       T  + + V++  GPP   + + +V   +  +
Sbjct: 17564 FSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTI 17623

Query: 952   EWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENI 1011
              WQ PKDDG S ++ Y V+K D +   W  V   +  T   +  L  G EY FRV  EN 
Sbjct: 17624 SWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENK 17683

Query: 1012  CG----LSDSPGVSKN 1023
              G    L  +P V+K+
Sbjct: 17684 IGVGPPLDSTPTVAKH 17699



 Score =  234 bits (598), Expect = 3e-61
 Identities = 149/496 (30%), Positives = 239/496 (48%), Gaps = 18/496 (3%)

Query: 530   VEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTE 589
             VE V ++  P   LD   + +   +VV AG  +R+ V I G P P  TW K +      +
Sbjct: 20765 VEIVEREMAPDFELDAELRRT---LVVRAGLSIRIFVPIKGRPAPEVTWTKDN---INLK 20818

Query: 590   GRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITS 649
              R  IE     +  +I    R D G++ + + NP G+    + ++V+D P P   +R T 
Sbjct: 20819 NRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTD 20878

Query: 650   VGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILY 709
             + +D   L W+ P+ DGG  +T Y+VE+++   + +     +   + TY+ T + EG  Y
Sbjct: 20879 ITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTKCH-KCTYKVTGLSEGCEY 20937

Query: 710   EMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGID 769
               RV A N  G+ +P+  T+P       S P  L + D+T +T +L W  P   G   I 
Sbjct: 20938 FFRVMAENEYGIGEPTETTEPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKIT 20997

Query: 770   GYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPV 829
             GY++E   +GS++W    T     C   V+NL  G    F+V+ VN AGRS P   ++PV
Sbjct: 20998 GYVIEAQRKGSDQWTHITTVKGLEC--VVRNLTEGEEYTFQVMAVNSAGRSAPRE-SRPV 21054

Query: 830   TIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHV 888
              ++E    P++ L    ++  I K G+ + + +P  G+P+P V W KG   L  T RV+ 
Sbjct: 21055 IVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNF 21114

Query: 889   RTSDFDTVFFVRQAARSDSGEYELSVQ--IENMKDTATIRIRVVEKAGPPIN-VMVKEVW 945
              T+   T+  + +  RSDSG Y L+ +  +  + D  TI++  +   GPP   +   EV 
Sbjct: 21115 ETTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDI--PGPPTGPIKFDEVS 21172

Query: 946   GTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFR 1005
                    W  P++DG   I  Y V+     +  W  +      T+   + L  G EY FR
Sbjct: 21173 SDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGLEYQFR 21232

Query: 1006  VYTENICGLSDSPGVS 1021
             V  +N  G+   PG++
Sbjct: 21233 VKAQNRYGV--GPGIT 21246



 Score =  232 bits (592), Expect = 1e-60
 Identities = 161/551 (29%), Positives = 248/551 (45%), Gaps = 28/551 (5%)

Query: 469   GKWYKNGVEVRPSKRITISHV--GRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFL 526
             G W+K   E     R T++ +  G  +K  +  +    +GD   V               
Sbjct: 28298 GDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTG------------- 28344

Query: 527   EIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFT 586
                ++ V +   P++ +D + K +    VV AG  +RL ++  G P P A W K D   +
Sbjct: 28345 --TIKAVDRLTAPELDIDANFKQTH---VVRAGASIRLFIAYQGRPTPTAVWSKPDSNLS 28399

Query: 587   TTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVR 646
                 R  I      S+  +E+  R D G+YT+ V N  G    +  ++V+D P PP  + 
Sbjct: 28400 L---RADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPIT 28456

Query: 647   ITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEG 706
                V    A L+W+ P+ DGG  +  Y+VE+++   + W  ++ E  T   ++   + EG
Sbjct: 28457 FKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVIS-EKCTRQIFKVNDLAEG 28515

Query: 707   ILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAG 766
             + Y  RV AVN  GV +P    +P +     + P  L V D + ++  L W  P+  G  
Sbjct: 28516 VPYYFRVSAVNEYGVGEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGS 28575

Query: 767   GIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLA 826
              I GYL+E   +GS+ WV A     ++  FTV+ L       FRV   N AG SEP    
Sbjct: 28576 RITGYLLEMRQKGSDFWVEAG--HTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAF 28633

Query: 827   QPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSR 885
               V I+E    P   L     Q    K G    + VP  G+P P+V W      L +T R
Sbjct: 28634 SSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDR 28693

Query: 886   VHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEV 944
             V + T+   T   V+ + R DSG Y L+++      T ++ + V+ + GP    + V  V
Sbjct: 28694 VSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSV 28753

Query: 945   WGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYF 1004
                + ++ W  PKD G +EI  Y V+K +  T  W  V    + T   V+ L    EY F
Sbjct: 28754 SAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSF 28813

Query: 1005  RVYTENICGLS 1015
             RV +EN  G+S
Sbjct: 28814 RVSSENRFGVS 28824



 Score =  231 bits (588), Expect = 4e-60
 Identities = 141/480 (29%), Positives = 230/480 (47%), Gaps = 7/480 (1%)

Query: 551   ENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQR 610
             ++ + V+  N + + V  TG P P ATW  GD+V  T + R +++     +  VI  ++R
Sbjct: 13401 KDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGD-RVKMKTLSAYAELVISPSER 13459

Query: 611   EDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPV 670
              D+G YT+K+ N V      I + V+  P  P+ ++   + +D   L WEPP  DGG P+
Sbjct: 13460 SDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPL 13519

Query: 671   TGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKP 730
             TGY+VE+++   + W K+  +  T+  +    +++G  Y  +V A N  G  +P+   +P
Sbjct: 13520 TGYVVEKREVSRKTWTKV-MDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEP 13578

Query: 731   FMPIAPTS---EPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPAN 787
                  P +    P ++   D T  +  L W PP   G   I GY+VE C  GS++WV   
Sbjct: 13579 VNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACG 13638

Query: 788   TEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLR 847
              EPV      V  L  G    +RV  +N  G S+P+   + +   +  E P+I L   L 
Sbjct: 13639 -EPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLL 13697

Query: 848   QTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVRTSDFDTVFFVRQAARSD 906
                  K G ++ L     GKP P++ WTK    L    R+ +      +   +  + RSD
Sbjct: 13698 AGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSD 13757

Query: 907   SGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMG 966
             +G Y +       + TA + + V++K GPP    + +V   + L+ W  P+DDG S+I  
Sbjct: 13758 TGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITN 13817

Query: 967   YFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTAR 1026
             Y V++    +  W  +    + T+   + LI   EY FRV  EN+ G+ +    S  TA+
Sbjct: 13818 YVVERRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQASPITAK 13877



 Score =  228 bits (581), Expect = 3e-59
 Identities = 138/484 (28%), Positives = 226/484 (46%), Gaps = 11/484 (2%)

Query: 535   KQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRI 594
             ++E P   +D   + +   ++V AG    + V   G P P   W K D   T    R  +
Sbjct: 26180 REEEPLFDIDSEMRKT---LIVKAGASFTMTVPFRGRPVPNVLWSKPD---TDLRTRAYV 26233

Query: 595   EKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDW 654
             +     +S  IE+A R D G+YT+ + N +     ++ ++V+D P PP  + +  V ++ 
Sbjct: 26234 DTTDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKES 26293

Query: 655   AILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVF 714
             A+L W+ P  DGG PV  Y +E+++   + W+ +        +Y+ T + EG +Y  RV 
Sbjct: 26294 AVLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNC-NRLSYKVTNLQEGAIYYFRVS 26352

Query: 715   AVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
               N  GV  P+   +        S P  L V  ++  + +L W  P   G   I  Y+VE
Sbjct: 26353 GENEFGVGIPAETKEGVKITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVE 26412

Query: 775   YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREI 834
                +G + WV       +     V  L   +   FRV   N AG S+P  L  PV I+E 
Sbjct: 26413 ALEKGQKNWVKCAV--AKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQ 26470

Query: 835   AEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLD-TSRVHVRTSDF 893
              EPP+I +      T   + G  L + +P  GKP P+V  ++ G PL  T R +   +  
Sbjct: 26471 LEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAE 26530

Query: 894   DTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTNALVE 952
             +    ++++  +D+G YE++    +    A I I V+++ GPP   V++ ++   +  ++
Sbjct: 26531 NLTINLKESVTADAGRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLK 26590

Query: 953   WQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENIC 1012
             W+ PK DG S++  Y + K +  T  W  V      T   V  L  G EY FR+  EN  
Sbjct: 26591 WEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRF 26650

Query: 1013  GLSD 1016
             G+SD
Sbjct: 26651 GISD 26654



 Score =  226 bits (577), Expect = 7e-59
 Identities = 133/383 (34%), Positives = 202/383 (52%), Gaps = 10/383 (2%)

Query: 638   VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFE-VFTET 696
             VPD P+   +T V +D A++ W  P +DGGKP+T Y++E+++  S+RW ++  + +   T
Sbjct: 17011 VPDAPDQPIVTEVTKDSALVTWNKP-HDGGKPITNYILEKRETMSKRWARVTKDPIHPYT 17069

Query: 697   TYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTT 753
              +    ++EG  YE RV A N IG+  PS  +KP     PIA  S P++    D T  + 
Sbjct: 17070 KFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSV 17129

Query: 754   TLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFT---VKNLPTGARILFR 810
              L W+PP   G   I GY+VEY   G EEW  AN  P E C  T   V  L  G    FR
Sbjct: 17130 DLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTP-ESCPETKYKVTGLRDGQTYKFR 17188

Query: 811   VVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRP 870
             V+ VN AG S+PA + +PV +++  EPP++ L  ++ +    KVG+ L L    +G P P
Sbjct: 17189 VLAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFP 17248

Query: 871   QVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVV 930
             +V W K      T +  +  +   +   +R AA  D G Y L+V+      T ++++ V+
Sbjct: 17249 KVTWKKEDRDAPT-KARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVL 17307

Query: 931   EKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTS 990
             +K GPP ++ V E+   +  + W+ P DDG S I  Y V++ D  + +W  +   ++  S
Sbjct: 17308 DKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKS 17367

Query: 991   CTVSDLIVGNEYYFRVYTENICG 1013
                  L  GN+Y FRV  EN  G
Sbjct: 17368 HFAKHLNEGNQYLFRVAAENQYG 17390



 Score =  225 bits (574), Expect = 2e-58
 Identities = 147/490 (30%), Positives = 230/490 (46%), Gaps = 22/490 (4%)

Query: 534   PKQE----PPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLK--GDEVFTT 587
             PK E    PP+I LD   +     + + A   LRL V I G P P   W +  G+ +   
Sbjct: 21849 PKAEDRMLPPEIELDADLR---KVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESL--- 21902

Query: 588   TEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRI 647
                +  IE     +  ++ +  R D G+Y + V N  G   A + ++V+D P PP+ +++
Sbjct: 21903 --DKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKV 21960

Query: 648   TSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGI 707
               V +    L W+PP+ DGG  +  Y+VE+++   + +  +      +T+++  ++ EG 
Sbjct: 21961 KEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCH-KTSWKVDQLQEGC 22019

Query: 708   LYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGG 767
              Y  RV A N  G+  P+   +          P  + + DVT  + +L W  P   G   
Sbjct: 22020 SYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITLMDVTRNSVSLSWEKPEHDGGSR 22079

Query: 768   IDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQ 827
             I GY+VE   +GS++W    T  V     T+  L  G    FRV   N  G S+P  L+ 
Sbjct: 22080 ILGYIVEMQTKGSDKWATCATVKVTEA--TITGLIQGEEYSFRVSAQNEKGISDPRQLSV 22137

Query: 828   PVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRV 886
             PV  +++  PP  +L   L  T+    GE L + VPF G+P P V W K   PL  T+RV
Sbjct: 22138 PVIAKDLVIPPAFKL---LFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRV 22194

Query: 887   HVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVW 945
             +  +++ +++  ++ A R D G Y + +     +   T+ + V++K GPP   V + EV 
Sbjct: 22195 NAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVT 22254

Query: 946   GTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFR 1005
               +  + W  PK DG S I  Y V+K D  T  W  V      T+     L  G EY FR
Sbjct: 22255 ADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFR 22314

Query: 1006  VYTENICGLS 1015
             +  EN  G S
Sbjct: 22315 IAAENRYGKS 22324



 Score =  219 bits (557), Expect = 2e-56
 Identities = 145/484 (29%), Positives = 237/484 (48%), Gaps = 18/484 (3%)

Query: 538   PPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIE-K 596
             PP+  LD   + +   +++ AG  +RL V + G PPP  TW K +        R  ++ K
Sbjct: 19690 PPEGELDADLRKT---LILRAGVTMRLYVPVKGRPPPKITWSKPN---VNLRDRIGLDIK 19743

Query: 597   RVDCSSFV-IESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWA 655
               D  +F+  E+  + D G+Y + + N  G+   +I ++V+D P PP  V +  + +D A
Sbjct: 19744 STDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSA 19803

Query: 656   ILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFA 715
              + WEPP+ DGG P+  Y+V+++    + W  +  E  ++T++    + EG  Y  RVFA
Sbjct: 19804 YVTWEPPIIDGGSPIINYVVQKRDAERKSWSTVTTEC-SKTSFRVANLEEGKSYFFRVFA 19862

Query: 716   VNAIGVSQPSMNTKPFMPIAPTSEPL-HLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
              N  G+  P   T+  +  + T  P+  L V  V+ ++ ++ W+ P+  G   I GY+V+
Sbjct: 19863 ENEYGIGDPG-ETRDAVKASQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVD 19921

Query: 775   YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREI 834
             +  E ++      +  ++   ++ K+L  G    FRV   N  G   P+ +   V  R+ 
Sbjct: 19922 FLTEENKWQRVMKSLSLQ---YSAKDLTEGKEYTFRVSAENENGEGTPSEIT--VVARDD 19976

Query: 835   AEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDT-SRVHVRTSDF 893
                P + L       Y+ K      L +P +GKP P V W KG  PL T +RV V +S  
Sbjct: 19977 VVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAV 20036

Query: 894   DTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTNALVE 952
             +T   V    +SD+G+Y ++++        TI I+VV K G P   +   EV      ++
Sbjct: 20037 NTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLK 20096

Query: 953   WQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENIC 1012
             W  PKDDG SEI  Y ++K D    +W       + T+  V+ L  G EY FRV  EN  
Sbjct: 20097 WAPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKY 20156

Query: 1013  GLSD 1016
             G+ +
Sbjct: 20157 GVGE 20160



 Score =  218 bits (556), Expect = 2e-56
 Identities = 158/516 (30%), Positives = 233/516 (45%), Gaps = 54/516 (10%)

Query: 529   KVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTT 588
             +++ V  QE P+I LD         + V AG K+ L  ++TG+P P  TW K D +    
Sbjct: 13678 EIQAVDTQEAPEIFLDVKLLAG---LTVKAGTKIELPATVTGKPEPKITWTKADMILKQD 13734

Query: 589   EGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRIT 648
             + R  IE     S+  I  ++R D G Y I+  N  G   A + + V+D P PP A  IT
Sbjct: 13735 K-RITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDIT 13793

Query: 649   SVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGIL 708
              V  +  +L W PP  DGG  +T Y+VER+   S+ W KL+  V  +T +++TK+I    
Sbjct: 13794 DVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTV-KDTNFKATKLIPNKE 13852

Query: 709   YEMRVFAVNAIGVSQPSMNTKPF---MPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGA 765
             Y  RV A N  GV +P +   P        P   P  L   D+T    TL W  P+  G 
Sbjct: 13853 YIFRVAAENMYGVGEP-VQASPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGG 13911

Query: 766   GGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATL 825
               I GY VE     +++WV  N  PV+   + VK L    +  FRV+  N+AG  +P+  
Sbjct: 13912 SPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKS 13971

Query: 826   AQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTK----GGAPL 881
              +P+ I++  +PP                       V   GK   ++ WTK    GGA +
Sbjct: 13972 TEPILIKDPIDPP----------------WPPGKPTVKDVGKTSVRLNWTKPEHDGGAKI 14015

Query: 882   DTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAG------- 934
             ++  + +  +  D   +VR A    + ++ L   +E  +   + R+R V KAG       
Sbjct: 14016 ESYVIEMLKTGTDE--WVRVAEGVPTTQHLLPGLMEGQE--YSFRVRAVNKAGESEPSEP 14071

Query: 935   --------------PPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWF 980
                           PP  + V  +    A ++W  P+ DG S I  Y V+K D +   W 
Sbjct: 14072 SDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQ 14131

Query: 981   NVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
              V    + T CTV+ L  G+ Y FRV  EN  G SD
Sbjct: 14132 TVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSD 14167



 Score =  218 bits (556), Expect = 2e-56
 Identities = 180/670 (26%), Positives = 295/670 (44%), Gaps = 50/670 (7%)

Query: 364   EMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVIT 423
             E  VE   +G Q  W   G+  T E          +  ++ +L F    + ++G    +T
Sbjct: 27496 EYVVERKGKGEQT-WSHAGISKTCE------IEVSQLKEQSVLEFRVFAKNEKGLSDPVT 27548

Query: 424   NGGQCEAELIVEEKQLEVLQDI--ADLTVKASEQAVFKCEVSDE-KVTGKWYKNGVEVRP 480
              G     ELI+  +    L DI  A +TV+       +     + K +  W K+G+ ++ 
Sbjct: 27549 IGPITVKELIITPEV--DLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKE 27606

Query: 481   SKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPK 540
             S+ +  S       L I + + E  G YT + D     ++  +  + +     PK     
Sbjct: 27607 SEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKGP--- 27663

Query: 541   IHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGR--TRIEKRV 598
                             +  ++++ D  I     P      G+    + E R  ++   ++
Sbjct: 27664 ----------------IRFDEIKADSVILSWDVPEDNG-GGEITCYSIEKRETSQTNWKM 27706

Query: 599   DCSS-----FVIESAQREDEGRYTIKVTNPVGED---VASIFL--QVVDVPDPPEAVRIT 648
              CSS     F + +  ++ E ++ ++  N  G     V+SI +      +P PP    I 
Sbjct: 27707 VCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIY 27766

Query: 649   SVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGIL 708
             +V  D   L W+ P+YDGG  VTG+ VE+K++ S  W K+N    +   Y +T ++EG+ 
Sbjct: 27767 NVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLD 27826

Query: 709   YEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGI 768
             Y+ RV+A N+ G+S PS  +K  + ++P   P      DVT  T TLKW PP R G   I
Sbjct: 27827 YQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKI 27886

Query: 769   DGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGR-SEPATLAQ 827
              GY +E   +G+E WV  N   V  C +TV  L  G R  FR++  N  G  S P+  + 
Sbjct: 27887 VGYSIEK-RQGNERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSG 27945

Query: 828   PVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVH 887
              +  R+   PP +          I K GE L +    QG+P P+V W K G  ++  R++
Sbjct: 27946 IIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIE-KRMN 28004

Query: 888   VRTSDF--DTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEV 944
             +  +D    T  FVR A R   G Y +  +  +    A I+++V +  G  +  +    +
Sbjct: 28005 MEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNI 28064

Query: 945   WGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYF 1004
              G    + W AP +DG + I  Y ++K +   + W  + ++    S T   LI GNEY F
Sbjct: 28065 TGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQF 28124

Query: 1005  RVYTENICGL 1014
             RV   N  G+
Sbjct: 28125 RVSAVNKFGV 28134



 Score =  218 bits (555), Expect = 3e-56
 Identities = 160/568 (28%), Positives = 254/568 (44%), Gaps = 31/568 (5%)

Query: 471   WYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKV 530
             W+K+ V ++ + R+          L I D   ED G Y        L+ SA      + V
Sbjct: 22181 WHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVV-----KLTNSAGEAIETLNV 22235

Query: 531   EYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITG-----EPPPVATWLKGDEVF 585
               + K  PP   +     T+++  +     K     SI             TW    ++ 
Sbjct: 22236 IVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTW----QIV 22291

Query: 586   TTTEGRTRIEK---RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPP 642
             + T  RT I+    +  C  +    A     G+ T   + P      ++      VP PP
Sbjct: 22292 SATVARTTIKACRLKTGCE-YQFRIAAENRYGKSTYLNSEP------TVAQYPFKVPGPP 22344

Query: 643   EAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTK 702
                 +T    D   + W  P+ DGG  V GY +ERK++ S  W+KLN     +T +++T 
Sbjct: 22345 GTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTG 22404

Query: 703   MIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNR 762
             + EG+ YE RV A N +G+ +PS  ++ ++   P   P       VT  + TL+W+ P  
Sbjct: 22405 LEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQWKKPTY 22464

Query: 763   IGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAG-RSE 821
              G   I GY+VE        W+ A+   +    F V  L    R  FRV+  N AG  SE
Sbjct: 22465 DGGSKITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSE 22524

Query: 822   PATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL 881
             P+     +T R+  +PP+I +    + T +   GE   +     GKP P + W KG   L
Sbjct: 22525 PSESTGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL 22584

Query: 882   -DTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-V 939
              +T+R+ ++++DF T   V+ A R DSG Y L  +    + + T+ ++V+++ GPP   V
Sbjct: 22585 SNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPV 22644

Query: 940   MVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVG 999
             ++  V      + W+ P  DG S+I+ Y V++ +   + W  V    +  SC V+ L+ G
Sbjct: 22645 VISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEG 22704

Query: 1000  NEYYFRVYTENICG----LSDSPGVSKN 1023
             NEY FR+   N  G    L   P V+KN
Sbjct: 22705 NEYTFRIMAVNKYGVGEPLESEPVVAKN 22732



 Score =  218 bits (554), Expect = 3e-56
 Identities = 167/650 (25%), Positives = 284/650 (43%), Gaps = 55/650 (8%)

Query: 427   QCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKV-TGKWYKNGVEVRPSKRIT 485
             +C+ +L+    +L+V + I  L VKA     F   +    V T KW  +G E++  +  T
Sbjct: 17500 ECQEKLVPPSVELDV-KLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYT 17558

Query: 486   ISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDC 545
             +        L I +    D G+Y       A S +  ++   + V       PP   ++ 
Sbjct: 17559 VETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVP-----GPPTGPINI 17613

Query: 546   SGKTSENAIVVVAGNKLRLDVSITGEPP------PVATWLKGDEVFTTTEGRTRIEKRVD 599
                T E+             ++I+ +PP      PV  ++  ++  T  +    +     
Sbjct: 17614 LDVTPEH-------------MTISWQPPKDDGGSPVINYIV-EKQDTRKDTWGVVSSGSS 17659

Query: 600   CSSFVIESAQREDEGRYTIKVTNPVG-----EDVASIFLQVVDVPDPPEAVRITSVGEDW 654
              +   I   Q+  E  + ++  N +G     +   ++       P PP    +T + E+ 
Sbjct: 17660 KTKLKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENA 17719

Query: 655   AILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVF 714
             A + W  P  DGG P+TGY +ER++  + +W+++N     +  +  T + EG  YE RVF
Sbjct: 17720 ATVSWTLPKSDGGSPITGYYMERREV-TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVF 17778

Query: 715   AVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGY 771
             A N  G+S+PS ++ P     PI P   P++  ++D +  T  L W  P   G   I GY
Sbjct: 17779 AENLAGLSKPSPSSDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGY 17838

Query: 772   LVEYCLEGSEEWVPANT-EPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVT 830
             +VE    G+ +W   N  E + +C F V  L  G    FR+   NI G  EP  LA+ V 
Sbjct: 17839 VVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVI 17898

Query: 831   IREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRT 890
              ++I  PP++ L    R     +VG+ + ++   +G+P P + WTK G  L   +     
Sbjct: 17899 AKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLI 17958

Query: 891   SDFDTV-FFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNA 949
              D   V   +++A R+D G+Y +S +  +     +  + V+++ GP  N+ V  V   N 
Sbjct: 17959 QDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENC 18018

Query: 950   LVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTE 1009
              + W+ P D+G SEI  + V+        W ++   +       ++L+  NEYYFRV  E
Sbjct: 18019 TISWENPLDNGGSEITNFIVEYRKPNQKGW-SIVASDVTKRLIKANLLANNEYYFRVCAE 18077

Query: 1010  NICGLS---------------DSPGVSKNTARILKTGITFKPFEYKEHDF 1044
             N  G+                D PG  +N   I   G TF   +++  D+
Sbjct: 18078 NKVGVGPTIETKTPILAINPIDRPGEPEN-LHIADKGKTFVYLKWRRPDY 18126



 Score =  217 bits (553), Expect = 4e-56
 Identities = 125/382 (32%), Positives = 192/382 (50%), Gaps = 3/382 (0%)

Query: 638   VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETT 697
             VP PP   ++T+V +D   + W  P+ DGG P+ GY VERK++    W  ++  +     
Sbjct: 21258 VPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNI 21317

Query: 698   YESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKW 757
             ++S+ + +GI YE RV A N  G S+PS  ++P + + P   P   +  ++T  T TLKW
Sbjct: 21318 FKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKW 21377

Query: 758   RPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIA 817
               P   G   I  Y+VE     +  W+ AN   +    FTV  L   A   FRV+  N A
Sbjct: 21378 AKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAA 21437

Query: 818   GR-SEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTK 876
             G  S P+  +  +T R+  E PKI++    + T I K GE   L     G+P P + W+K
Sbjct: 21438 GAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSK 21497

Query: 877   GGAPLD-TSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGP 935
              G  L+ T+++ ++ +DF T    + + R DSG Y L+             ++V+++ GP
Sbjct: 21498 DGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGP 21557

Query: 936   PIN-VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVS 994
             P   + V EV     ++ W  P DDG ++I  Y VQK +   + W NV    + T   V+
Sbjct: 21558 PEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVT 21617

Query: 995   DLIVGNEYYFRVYTENICGLSD 1016
              L+ GNEY FRV   N  G+ +
Sbjct: 21618 KLLKGNEYIFRVMAVNKYGVGE 21639



 Score =  217 bits (552), Expect = 6e-56
 Identities = 155/560 (27%), Positives = 257/560 (45%), Gaps = 34/560 (6%)

Query: 537   EPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEK 596
             E P+I LD + +TS   ++  AG  +++ +   G PPP  TW K DE    ++ R  IE 
Sbjct: 27267 EAPEIDLDVALRTS---VIAKAGEDVQVLIPFKGRPPPTVTWRK-DEKNLGSDARYSIEN 27322

Query: 597   RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVAS-IFLQVVDVPDPPEAVRITSVGEDWA 655
                 S   I    R D G+Y + + N VGE  +S + ++V+D P   + +++  V     
Sbjct: 27323 TDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTV 27382

Query: 656   ILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFA 715
              L+W+PP+ DGG P+  Y++E++    + W  ++ +  + T+++   + E   +  RV A
Sbjct: 27383 TLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKC-SSTSFKLIDLSEKTPFFFRVLA 27441

Query: 716   VNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEY 775
              N IG+ +P   T+P       +    L ++D T T+  L W  P+  G   I  Y+VE 
Sbjct: 27442 ENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVER 27501

Query: 776   CLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIA 835
               +G + W  A     + C   V  L   + + FRV   N  G S+P T+  P+T++E+ 
Sbjct: 27502 KGKGEQTWSHAGIS--KTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIG-PITVKELI 27558

Query: 836   EPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSR-VHVRTSDFD 894
               P++ L          ++G  ++L +P++GKP+P + W K G PL  S  V    ++  
Sbjct: 27559 ITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENK 27618

Query: 895   TVFFVRQAARSDSGEYELSVQIENMKDTATIRIRV---VEKAGPPIN----VMVKEVWGT 947
                 ++ A +   G+Y +      + D A  RI V   V   GPP      +   E+   
Sbjct: 27619 ITLSIKNAKKEHGGKYTV------ILDNAVCRIAVPITVITLGPPSKPKGPIRFDEIKAD 27672

Query: 948   NALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVY 1007
             + ++ W  P+D+G  EI  Y ++K +     W  V      T+  V +L+   EY FRV 
Sbjct: 27673 SVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCSSVARTTFKVPNLVKDAEYQFRVR 27732

Query: 1008  TENICGLS----DSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGY 1063
              EN  G+S     S  V+K+  RI   G   KP  Y      M+  +  P+ D     G 
Sbjct: 27733 AENRYGVSQPLVSSIIVAKHQFRI--PGPPGKPVIYNVTSDGMSLTWDAPVYD-----GG 27785

Query: 1064  SAALNCAVRGHPKPKVVWMK 1083
             S      V    +  ++W K
Sbjct: 27786 SEVTGFHVEKKERNSILWQK 27805



 Score =  216 bits (551), Expect = 8e-56
 Identities = 174/617 (28%), Positives = 273/617 (44%), Gaps = 49/617 (7%)

Query: 434   VEEKQLEVLQDIADLTV-KASEQAVFKCEVSDEKV-TGKWYKNGVEVRPSKRITISHVGR 491
             VE  +++V     D  + KA E    + +VS     T +W K+G E+  + ++ I     
Sbjct: 21456 VEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADF 21515

Query: 492   FHKLVIDDVRPEDEGDYTFV---PDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGK 548
                LV  D    D G YT     P G+A  +          V+ + +  PP+  L  +  
Sbjct: 21516 STNLVNKDSTRRDSGAYTLTATNPGGFAKHI--------FNVKVLDRPGPPEGPLAVTEV 21567

Query: 549   TSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVF-----TTTEGRTRIEKRVDCSSF 603
             TSE  +             ++  PP      K D        T+    T +   V  +  
Sbjct: 21568 TSEKCV-------------LSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKL 21614

Query: 604   VIESAQREDEGRYTIKVTNP--VGEDVASIFLQVVDV---PDPPEAVRITSVGEDWAILV 658
              +    + +E  + +   N   VGE + S  +  V+    PDPP+   +T++ +D  ++ 
Sbjct: 21615 KVTKLLKGNEYIFRVMAVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVC 21674

Query: 659   WEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNA 718
             W  P  DGG  +  Y+VER+ K  QRW+K N +  T+  Y+ + + EG  YE R+ A NA
Sbjct: 21675 WGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENA 21734

Query: 719   IGVSQPSMNTKPFMPIAPT----SEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
              G+S PS  T PF     T      P +  V D + ++ ++ W  P   G   I GY+VE
Sbjct: 21735 AGISAPS-PTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVE 21793

Query: 775   YCLEGSEEW-VPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIRE 833
               L   +EW +      ++   +T+  L        R+  +N  G  EPA +       +
Sbjct: 21794 IALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAED 21853

Query: 834   IAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKG-GAPLDTSRVHVRTSD 892
                PP+I L   LR+    +    L L VP +G+P P+V W +  G  LD + +   TS 
Sbjct: 21854 RMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIE-STSS 21912

Query: 893   FDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVE 952
             + T+  V    R DSG+Y L+V+  +   +A + +RV++  GPP ++ VKEV  T+  + 
Sbjct: 21913 Y-TLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLT 21971

Query: 953   WQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENIC 1012
             W  P  DG S+I  Y V+K +     +  V      TS  V  L  G  YYFRV  EN  
Sbjct: 21972 WDPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEY 22031

Query: 1013  GLSDSPGVSKNTARILK 1029
             G+    G+   TA  +K
Sbjct: 22032 GI----GLPAETAESVK 22044



 Score =  215 bits (548), Expect = 2e-55
 Identities = 150/495 (30%), Positives = 223/495 (45%), Gaps = 24/495 (4%)

Query: 536   QEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIE 595
             QEPP + LD S K     I ++AG  LR+   +TG P P   W K  E     + R  I+
Sbjct: 15099 QEPPAVELDVSVK---GGIQIMAGKTLRIPAVVTGRPVPTKVWTK--EEGELDKDRVVID 15153

Query: 596   KRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWA 655
                  S  +I+ A R+D GRY I  TN  G   A+  ++V DVP P   ++         
Sbjct: 15154 NVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMC 15213

Query: 656   ILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTE-TTYESTKMIEGILYEMRVF 714
             +L W  P  DGG  +TG+++ERK      W +    + TE +  + T ++EG  Y+ RV 
Sbjct: 15214 LLNWSDPEDDGGSEITGFIIERKDAKMHTWRQ---PIETERSKCDITGLLEGQEYKFRVI 15270

Query: 715   AVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGY 771
             A N  G   P +   P +   P+ P + P  L   + T +T TL W+ P   G   I GY
Sbjct: 15271 AKNKFGCG-PPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGY 15329

Query: 772   LVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTI 831
             ++E       ++   N        F V+NL       FRV  VN  G SEP +L   V I
Sbjct: 15330 IIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEP-SLPLNVVI 15388

Query: 832   REIAEPPKIRLPRHLRQTYIR-KVGEQLNLVVPFQGKPRPQVVWTKGGA-------PLDT 883
             ++   PP I+L   +R   I+ K GE +++     G P P++ W+K           L  
Sbjct: 15389 QDDEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQI 15448

Query: 884   SRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKE 943
             ++  V  S+  T   + +A R D G Y ++           + + V ++  PP N+ V +
Sbjct: 15449 TKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTD 15508

Query: 944   VWGTNALVEWQAPKDDGNSEIMGYFVQKAD--KKTMEWFNVYERNRHTSCTVSDLIVGNE 1001
             +   +  + W AP D+G SEI  Y + K D  +K  EW  V          +  LI   +
Sbjct: 15509 IKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKRYGIWKLIPNGQ 15568

Query: 1002  YYFRVYTENICGLSD 1016
             Y FRV   N  G+SD
Sbjct: 15569 YEFRVRAVNKYGISD 15583



 Score =  213 bits (543), Expect = 6e-55
 Identities = 157/584 (26%), Positives = 263/584 (45%), Gaps = 34/584 (5%)

Query: 448   LTVKASEQAVFKCEVSDEKVTG-KWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG 506
             L +K+ E    K  V    V    W+K+GVE+     + I+ V     L + D   +  G
Sbjct: 27968 LIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRG 28027

Query: 507   DYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRL-- 564
              YT      + S  A++   ++KV+  P +    I               + G K+ L  
Sbjct: 28028 VYTVEAKNASGSAKAEI---KVKVQDTPGKVVGPIRF-----------TNITGEKMTLWW 28073

Query: 565   DVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTN-- 622
             D  +     P+  ++  ++  T+      IE + +  S+        +E ++ +   N  
Sbjct: 28074 DAPLNDGCAPITHYII-EKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNKF 28132

Query: 623   ----PVGED--VASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVE 676
                 P+  D  VA I   V D P  PE   IT    +   L W  P  DGG  +  Y++E
Sbjct: 28133 GVGRPLDSDPVVAQIQYTVPDAPGIPEPSNITG---NSITLTWARPESDGGSEIQQYILE 28189

Query: 677   RKKKGSQRWMK-LNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM--- 732
             R++K S RW+K ++    +ET ++ T + EG  YE  V A NA GV   S  ++      
Sbjct: 28190 RREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCRE 28249

Query: 733   PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVE 792
             P+ P   P  + V D + TT +L+W  P   G   I GY++E C     +W   N E   
Sbjct: 28250 PVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACV 28309

Query: 793   RCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIR 852
             +  +TV +L  G    FRV  +N AG+ +   +   +   +    P++ +  + +QT++ 
Sbjct: 28310 KTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVV 28369

Query: 853   KVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYEL 912
             + G  + L + +QG+P P  VW+K  + L + R  + T+D  +   V    R+D+G+Y L
Sbjct: 28370 RAGASIRLFIAYQGRPTPTAVWSKPDSNL-SLRADIHTTDSFSTLTVENCNRNDAGKYTL 28428

Query: 913   SVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKA 972
             +V+  +   + T  ++V++  GPP  +  K+V   +A + W AP  DG + I  Y V+K 
Sbjct: 28429 TVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKR 28488

Query: 973   DKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
             +     W  + E+       V+DL  G  YYFRV   N  G+ +
Sbjct: 28489 EASRRSWQVISEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGE 28532



 Score =  213 bits (542), Expect = 8e-55
 Identities = 131/391 (33%), Positives = 192/391 (49%), Gaps = 16/391 (4%)

Query: 639   PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTY 698
             PDPPE   +T V ++   +VW PP YDGGK +TGY +E+K+K S RW+ +N     E   
Sbjct: 18399 PDPPE---VTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRM 18455

Query: 699   ESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTL 755
             +   ++    Y+ RV A N IG+ +PS+ ++P +   PI P   P +  V D T  + TL
Sbjct: 18456 KVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTKHSITL 18515

Query: 756   KWRPPNRIGAGGIDGYLVEY-----CLEGSEEWVPAN-TEPVERCGFTVKNLPTGARILF 809
              W  P   G   I GY+VE           E W   N    + R  FTV +L       F
Sbjct: 18516 GWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEF 18575

Query: 810   RVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPR 869
             RV   N  G   PA L + +  +EI EPP+I L   +R+  I + G  + L    +G+P 
Sbjct: 18576 RVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPA 18635

Query: 870   PQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRV 929
             P+V W K G      +  V   D      +  + R DSG+Y L++     +    + +RV
Sbjct: 18636 PKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRV 18695

Query: 930   VEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHT 989
             ++  GP  ++ V +V  T+  V W  P++DG S++  Y V+K +     W  V    + T
Sbjct: 18696 LDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVKKT 18755

Query: 990   SCTVSDLIVGNEYYFRVYTENICGLSDSPGV 1020
             S  V++L+ GNEYYFRV   N  G    PGV
Sbjct: 18756 SFHVTNLVPGNEYYFRVTAVNEYG----PGV 18782



 Score =  211 bits (538), Expect = 2e-54
 Identities = 145/521 (27%), Positives = 236/521 (45%), Gaps = 40/521 (7%)

Query: 536   QEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATW--------LKGDEVFTT 587
             QE P++ +D     +++ +V  AG+++R+   I G P P ++W           D V   
Sbjct: 15805 QEEPEVFIDIG---AQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDI 15861

Query: 588   TEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRI 647
              E   ++E   + S  +I   +R   G+Y+I   N  G+  A+  ++V+DVP PP+ +++
Sbjct: 15862 PED-AQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKV 15920

Query: 648   TSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGI 707
             + +      L W+ P  DGG  + GY++E++    + W K+N +    TT+    ++   
Sbjct: 15921 SDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDC-GSTTFVVPDLLSEQ 15979

Query: 708   LYEMRVFAVNAIGVSQP---SMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIG 764
              Y  RV A N  G+  P      T    PI P   P+ L +  +T  T  L W+PP   G
Sbjct: 15980 QYFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDG 16039

Query: 765   AGGIDGYLVEYCL------EGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAG 818
                +  Y+VE CL         E W   N   VE   FTV++L  G    FRV  VN AG
Sbjct: 16040 GSPVTHYIVE-CLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAG 16098

Query: 819   RSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGG 878
              S+P+    P   +    PP I L   +      + G  +N+V   +G P P + W K  
Sbjct: 16099 VSKPSATVGPCDCQRPDMPPSIDLKEFMEV----EEGTNVNIVAKIKGVPFPTLTWFK-- 16152

Query: 879   AP----------LDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIR 928
             AP          L  + V+    D      + Q+ RSD+G Y ++        +  +R+ 
Sbjct: 16153 APPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLN 16212

Query: 929   VVEKAGPPIN-VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNR 987
             V+ + GPP+  +  + V      + W  PKDDG S+I  Y ++K +     W +V    +
Sbjct: 16213 VLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPK 16272

Query: 988   HTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARIL 1028
               + T+  L+ G+EY FR+  +N  G+ +       TAR L
Sbjct: 16273 ECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNL 16313



 Score =  211 bits (536), Expect = 4e-54
 Identities = 160/614 (26%), Positives = 270/614 (43%), Gaps = 45/614 (7%)

Query: 431   ELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDE-KVTGKWYKNGVEVRPSKRITISHV 489
             +L++E    +V    +  +V+  +    +  +S   K T  W K+G+ ++ + RI ++  
Sbjct: 23225 DLVIEP---DVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDS 23281

Query: 490   GRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKT 549
                  L I +   +D G Y     G  ++         I++  + K +PPK  +     +
Sbjct: 23282 LDLTTLSIKETHKDDGGQY-----GITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVS 23336

Query: 550   SENAIV-----VVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFV 604
             +E+  +     +  G     +  +         W    +V + T  RT ++         
Sbjct: 23337 AESITLSWNPPLYTGGCQITNYIVQKRDTTTTVW----DVVSATVARTTLK--------- 23383

Query: 605   IESAQREDEGRYTIKVTNPVGEDVASIFLQVV-----DVPDPPEAVRITSVGEDWAILVW 659
             +   +   E ++ I   N  G+  A     +V       P PP     T++ +D  ++ W
Sbjct: 23384 VTKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQW 23443

Query: 660   EPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAI 719
               P+ +GG PV GY +ERK++ S  W K+N  +  +T +++  + EGI YE RV+A N +
Sbjct: 23444 HEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIV 23503

Query: 720   GVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
             GV + S N++ ++   P  P   P  ++V+       TL+W  P   G   I GY+VE  
Sbjct: 23504 GVGKASKNSECYVARDPCDPPGTPEPIMVK---RNEITLQWTKPVYDGGSMITGYIVEKR 23560

Query: 777   LEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGR-SEPATLAQPVTIREIA 835
                   W+ A+   V    FTV  L    R  FRV+  N AG  S+P+    P+T ++  
Sbjct: 23561 DLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEV 23620

Query: 836   EPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTS-RVHVRTSDFD 894
             E P+I +    R T +   GE   L     GKP P + W +G   ++ S R  ++ +DF 
Sbjct: 23621 ELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFK 23680

Query: 895   TVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTNALVEW 953
              +  V+ A R D G+Y L         +  + ++V+++ GPP   V V  V      + W
Sbjct: 23681 ALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTW 23740

Query: 954   QAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICG 1013
               P  DG S+I  Y V+K +   + W  V       S  V+ L+ GNEY FR+   N  G
Sbjct: 23741 SPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYG 23800

Query: 1014  ----LSDSPGVSKN 1023
                 L  +P + KN
Sbjct: 23801 VGEPLESAPVLMKN 23814



 Score =  210 bits (535), Expect = 5e-54
 Identities = 152/568 (26%), Positives = 255/568 (44%), Gaps = 40/568 (7%)

Query: 468   TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLE 527
             T +WYK+  E++ +  + + +      ++I D    + G Y         S SA      
Sbjct: 26903 TIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASAT----- 26957

Query: 528   IKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTT 587
             I+V+ + K  PP   ++    T+E              +++   PP      K       
Sbjct: 26958 IRVQILDKPGPPGGPIEFKTVTAEK-------------ITLLWRPPADDGGAKITHYIVE 27004

Query: 588   TEGRTRI------EKRVDCSSFVIESAQ--REDEGRYTIKVTNPVG-----EDVASIFLQ 634
                 +R+      E   +C   +I + +  + +E  + ++  N  G     E  + +   
Sbjct: 27005 KRETSRVVWSMVSEHLEEC---IITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKN 27061

Query: 635   VVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFT 694
                 P PP    +T + ++   +VW  P+ DGG  ++GY +E++ K S  W K+  E   
Sbjct: 27062 AFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIR 27121

Query: 695   ETTYESTKMIEGILYEMRVFAVNAIG---VSQPSMNTKPFMPIAPTSEPLHLIVEDVTDT 751
             +T  + T + E   Y+ RV AVNA G    S+PS   K   PI P   P  + + D T +
Sbjct: 27122 DTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKS 27181

Query: 752   TTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTE-PVERCGFTVKNLPTGARILFR 810
             + TL W  P   G   + GY+VE      EEW   +T+  V    + V NL  G    FR
Sbjct: 27182 SITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFR 27241

Query: 811   VVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRP 870
             V  VN AG+ EP  + +PV  ++I E P+I L   LR + I K GE + +++PF+G+P P
Sbjct: 27242 VSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPP 27301

Query: 871   QVVWTKGGAPLDT-SRVHVRTSDFDTVFFVRQAARSDSGEYELSVQI-ENMKDTATIRIR 928
              V W K    L + +R  +  +D  ++  + Q  R+D+G+Y L+++       ++T+ ++
Sbjct: 27302 TVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVK 27361

Query: 929   VVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRH 988
             V++       + VK V      + W  P  DG S I+ Y ++K D     W  V  +   
Sbjct: 27362 VLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSS 27421

Query: 989   TSCTVSDLIVGNEYYFRVYTENICGLSD 1016
             TS  + DL     ++FRV  EN  G+ +
Sbjct: 27422 TSFKLIDLSEKTPFFFRVLAENEIGIGE 27449



 Score =  209 bits (532), Expect = 1e-53
 Identities = 154/579 (26%), Positives = 261/579 (45%), Gaps = 27/579 (4%)

Query: 448   LTVKASEQAVFKCEVSDEKVTGK-WYKNGVEVRPSK-RITISHVGRFHKLVIDDVRPEDE 505
             + V A E  V + ++  + +    W K+G E+  +  R+ I    +   LV+ D    D 
Sbjct: 24717 IVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDG 24776

Query: 506   GDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLD 565
             G Y        LS       + I V+ + +  PP+  L  +G T+E   +  A N    D
Sbjct: 24777 GQYIL-----KLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYL--AWNPPLQD 24829

Query: 566   VSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNP-- 623
                      ++ ++  ++  T+    T++   V   ++ +      +E  + +   N   
Sbjct: 24830 GGAN-----ISHYII-EKRETSRLSWTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNKYG 24883

Query: 624   VGEDVASIFLQVVDV---PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKK 680
             +GE + S  +   +    P PP    ++++ +D  ++ W  P+ DGG  + GY++E++ K
Sbjct: 24884 IGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDK 24943

Query: 681   GSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGV---SQPSMNTKPFMPIAPT 737
                RW K N +  T+     T + EG  YE RV A NA GV   S+PS+  +    + P 
Sbjct: 24944 EGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPP 25003

Query: 738   SEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCG-- 795
               P +  V D + ++ +L W  P   G   + GY+VE     ++EW    T P    G  
Sbjct: 25004 GPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTC-TPPTGLQGKQ 25062

Query: 796   FTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVG 855
             FTV  L       FR+  +N  G  EPATL   V  +E  EPP+I L   LR+  + +  
Sbjct: 25063 FTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRAS 25122

Query: 856   EQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQ 915
               L L V  +G+P P+V W K    L T R  +  +   T+  +    R DSG Y L+++
Sbjct: 25123 ATLRLFVTIKGRPEPEVKWEKAEGIL-TDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLE 25181

Query: 916   IENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKK 975
               +   TA + +RV++    P+N+ ++EV   +  + W+ P  DG ++I  Y V+K +  
Sbjct: 25182 NNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETT 25241

Query: 976   TMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGL 1014
                +  +      T+  + +L  G  YYFRV   N  G+
Sbjct: 25242 RKAYATITNNCTKTTFRIENLQEGCSYYFRVLASNEYGI 25280



 Score =  208 bits (529), Expect = 3e-53
 Identities = 149/504 (29%), Positives = 229/504 (45%), Gaps = 42/504 (8%)

Query: 554   IVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDE 613
             I+V+ G KL + V     P P  +W K  +    ++  T     +     V +S  R D 
Sbjct: 14396 IIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSV-RADA 14454

Query: 614   GRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGY 673
             G YTI + N +G   ASI ++V+ +P P + ++ + + +    L WEPP +DGG P+  Y
Sbjct: 14455 GIYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHY 14514

Query: 674   LVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM- 732
             ++ER++ G + ++ +      + ++    +I    Y  RV AVN +G  +      P + 
Sbjct: 14515 VLERREAGRRTYIPV-MSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIA 14573

Query: 733   --PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEP 790
               P  P   P+ + V + T    T+ W+PP   G   I GY++E   +G E W   N   
Sbjct: 14574 QDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHL 14633

Query: 791   VERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTY 850
             V    +T K L  G    FRV   N AG SEP+    P    +  + PK+     LR + 
Sbjct: 14634 VPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKV----ILRTSL 14689

Query: 851   IRKVGEQLNLVVPFQGKPRPQVVWTKG------------GAPLD---------------- 882
               K G+++ L     G P P + W K              APL                 
Sbjct: 14690 EVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLP 14749

Query: 883   -TSRVHVRTS-DFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVM 940
              T R+ +  S   ++   VR + R D G Y + V+ ++    A   + V++  GPPIN +
Sbjct: 14750 LTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFV 14809

Query: 941   VKEVWGTNALVEWQAPKDDGNSEIMGYFVQKAD--KKTMEWFNVYERNRHTSCTVSDLIV 998
              +++  T+ L +W+ P DDG SEI+ Y ++K D  K   EW  V    RH   +V+ LI 
Sbjct: 14810 FEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIE 14869

Query: 999   GNEYYFRVYTENICGLSDSPGVSK 1022
             G EY FRV  EN  G    P VSK
Sbjct: 14870 GKEYLFRVRAENRFG-PGPPCVSK 14892



 Score =  205 bits (522), Expect = 2e-52
 Identities = 154/585 (26%), Positives = 255/585 (43%), Gaps = 40/585 (6%)

Query: 448   LTVKASEQAVFKCEVSDEKV-TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG 506
             + V A E    + +V  + + T +W +   E+  S R  I +      L++ D    D G
Sbjct: 23635 IVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGG 23694

Query: 507   DYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDV 566
              Y       A S S  +N     V+ + +  PP+  +  +G TSE               
Sbjct: 23695 QYILRASNVAGSKSFPVN-----VKVLDRPGPPEGPVQVTGVTSEKC------------- 23736

Query: 567   SITGEPP------PVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKV 620
             S+T  PP       ++ ++  ++  T+    T +   V  +S  +      +E  + I  
Sbjct: 23737 SLTWSPPLQDGGSDISHYVV-EKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMA 23795

Query: 621   TNPVG-----EDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLV 675
              N  G     E    +      +P PP+++ +T++ +D   + W  P  DGG  + GY+V
Sbjct: 23796 VNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIV 23855

Query: 676   ERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNT---KPFM 732
             E++ +   RW+K N    T+     T + E   YE RV A NA GV +PS  T   K   
Sbjct: 23856 EKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACD 23915

Query: 733   PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEW---VPANTE 789
             P+     P +  + D T  + TL W  P   G   I GY+VE C    EEW    P    
Sbjct: 23916 PVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGL 23975

Query: 790   PVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQT 849
              V R  F +  L        RV  +N  G  E  ++   V   +  E P++ L   LR+ 
Sbjct: 23976 RVTR--FEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKG 24033

Query: 850   YIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGE 909
              + + G    + +PF+G+P P++ W++      T +V +      T   +    R+D+G+
Sbjct: 24034 IVVRAGGSARIHIPFKGRPTPEITWSREEGEF-TDKVQIEKGVNYTQLSIDNCDRNDAGK 24092

Query: 910   YELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFV 969
             Y L ++  +   +A + ++V++  GPP N+ VKEV   +A + W+ P  DG +++  Y +
Sbjct: 24093 YILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVI 24152

Query: 970   QKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGL 1014
              K +     + NV  +   TS  V +L  G  YYFRV  EN  G+
Sbjct: 24153 DKRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGV 24197



 Score =  205 bits (521), Expect = 2e-52
 Identities = 150/561 (26%), Positives = 249/561 (44%), Gaps = 34/561 (6%)

Query: 471   WYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKV 530
             W K+G  ++ + R+ +        L I +   +D G YT      A + +  L+ + ++ 
Sbjct: 24345 WVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLE- 24403

Query: 531   EYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLD-VSITGEPPPVATWLKGDEVF---- 585
                 K  PP              +  V  +++  D V I+ EPP      +         
Sbjct: 24404 ----KPGPP--------------VGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKR 24445

Query: 586   -TTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGE----DVASIFLQV-VDVP 639
              TTT     +   V  ++  I   +   E ++ I   N  G+    D  ++ +Q     P
Sbjct: 24446 DTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEP 24505

Query: 640   DPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYE 699
              PP    +TS+ +D  ++ W  P+ DGG  + GY +E+K+K S  W+KLN     +T ++
Sbjct: 24506 GPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFK 24565

Query: 700   STKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRP 759
             +T + EG+ YE +V A N +G+ +PS  ++ F+   P   P       +T    TLKW+ 
Sbjct: 24566 TTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKK 24625

Query: 760   PNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGR 819
             P   G   I GY+VE        W+ A+   V    FTV  L    R  FRV+  N AG 
Sbjct: 24626 PAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGN 24685

Query: 820   -SEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGG 878
              SEP+  +  +T R+  + P   L    +   +   GE   L    +GKP P VVW+K G
Sbjct: 24686 FSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDG 24745

Query: 879   APLD--TSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPP 936
               L+   +R+ ++++   T   V+   R+D G+Y L +       +  I ++V+++ GPP
Sbjct: 24746 KELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPP 24805

Query: 937   IN-VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSD 995
                + V  V      + W  P  DG + I  Y ++K +   + W  V    +  +  V+ 
Sbjct: 24806 EGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTK 24865

Query: 996   LIVGNEYYFRVYTENICGLSD 1016
             L+ GNEY FRV   N  G+ +
Sbjct: 24866 LLPGNEYIFRVMAVNKYGIGE 24886



 Score =  204 bits (519), Expect = 4e-52
 Identities = 159/589 (26%), Positives = 267/589 (45%), Gaps = 45/589 (7%)

Query: 448   LTVKASEQAVFKCEVSDEKVTGK--WYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDE 505
             LT+KA +  V        K   K  W K G ++RPS    I+       L I     +D 
Sbjct: 20388 LTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDA 20447

Query: 506   GDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLD 565
             G+YT            K+  +++ V  VP    P   ++ S  ++E A            
Sbjct: 20448 GEYTITATN---PFGTKVEHVKVTVLDVPGPPGP---VEISNVSAEKA------------ 20489

Query: 566   VSITGEPP------PVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIK 619
              ++T  PP      P+ +++  ++  T+    T + + +     V     + +E  + + 
Sbjct: 20490 -TLTWTPPLEDGGSPIKSYIL-EKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFRVS 20547

Query: 620   VTNPVG--EDVASIFLQVVD---VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYL 674
               N  G  E V S  +++VD    P PPE   +++V ++ A + W+ P+ DGG  +TGY 
Sbjct: 20548 AVNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYH 20607

Query: 675   VERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM-- 732
             VER++K S RW++      ++   + T + EG  YE RV A N  G+  PS  +   +  
Sbjct: 20608 VERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMK 20667

Query: 733   ----PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANT 788
                 P  P S P    V D T  + +L W  P+  G   I GY+VE+   G E W+   T
Sbjct: 20668 DAAYPPGPPSNPH---VTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTT 20724

Query: 789   EPVERCG-FTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLR 847
                 R   F V +L T  +  FR+  +N AG  EPA +   V I E    P   L   LR
Sbjct: 20725 GTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPD-VEIVEREMAPDFELDAELR 20783

Query: 848   QTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDS 907
             +T + + G  + + VP +G+P P+V WTK    L  +R ++  ++  T+  + +  R D+
Sbjct: 20784 RTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLK-NRANIENTESFTLLIIPECNRYDT 20842

Query: 908   GEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGY 967
             G++ ++++    K +  + +RV++  GP +N+   ++   +  + W  P  DG S I  Y
Sbjct: 20843 GKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNY 20902

Query: 968   FVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
              V+K +     +     +    +  V+ L  G EY+FRV  EN  G+ +
Sbjct: 20903 IVEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGE 20951



 Score =  203 bits (517), Expect = 7e-52
 Identities = 166/605 (27%), Positives = 260/605 (42%), Gaps = 40/605 (6%)

Query: 448   LTVKASEQAVFKCEVSDEKV-TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG 506
             + V A E      ++  + + T +W K   E+  + R+ I        L + D    D G
Sbjct: 22553 IVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSG 22612

Query: 507   DYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIV-----VVAGNK 561
             +Y       A   S  +N     V+ + +  PP+  +  SG T+E   +     +  G  
Sbjct: 22613 NYILKAKNVAGERSVTVN-----VKVLDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGS 22667

Query: 562   LRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVT 621
               ++  +         W             T ++  V   S  +      +E  + I   
Sbjct: 22668 DIINYIVERRETSRLVW-------------TVVDANVQTLSCKVTKLLEGNEYTFRIMAV 22714

Query: 622   NP--VGEDVAS---IFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVE 676
             N   VGE + S   +      VPD P+A  +T+V +D  I+VWE P  DGG  + GY++E
Sbjct: 22715 NKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVLE 22774

Query: 677   RKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNT---KPFMP 733
             ++ K   RW + +  +  E     T +IE   YE RV A NA G+S+PS  +   K   P
Sbjct: 22775 KRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACDP 22834

Query: 734   IAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEP--V 791
             I     P +  V D+T ++  L W  P   G   I GY+VE C     EW    T P  +
Sbjct: 22835 IYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMC-TPPTGI 22893

Query: 792   ERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYI 851
              +    V+ L       FR+  +N AG  E A +  P+ + E  E P I L   LR+   
Sbjct: 22894 NKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKIIN 22953

Query: 852   RKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYE 911
              + G  L L VP +G+P P+V W K    +  + +   TS F T   +    R DSG+Y 
Sbjct: 22954 IRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSF-TSLVLDNVNRYDSGKYT 23012

Query: 912   LSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQK 971
             L+++  +   +A + +RV++   PP+N+ V E+   +  + W+ P  DG S+I  Y V+K
Sbjct: 23013 LTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEK 23072

Query: 972   ADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTG 1031
              +     +  V       S  +  L  G  YYFRV  EN  G+    G+   TA  +K  
Sbjct: 23073 REATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGI----GLPAQTADPIKVA 23128

Query: 1032  ITFKP 1036
                +P
Sbjct: 23129 EVPQP 23133



 Score =  203 bits (516), Expect = 9e-52
 Identities = 157/575 (27%), Positives = 257/575 (44%), Gaps = 39/575 (6%)

Query: 462   VSDEKVTGK------WYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGY 515
             V D  V GK      W K   E+   +++++ + G+    VI      D G YT      
Sbjct: 29066 VLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNA 29125

Query: 516   ALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPV 575
             +     K   + +KV            LD  G   +  +  V   K  L  S+  E    
Sbjct: 29126 S---GTKAVSVMVKV------------LDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGA 29170

Query: 576   A-TWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQ 634
               T    +   T+      +E      S+V+    + +E  + ++  N  G  V      
Sbjct: 29171 EITHYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEP 29230

Query: 635   VV-----DVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLN 689
             +V      +P PP        G++  I+ W  P  DGG  ++ YLV++++K S RW ++N
Sbjct: 29231 IVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVN 29290

Query: 690   FE-VFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNT------KPFMPIAPTSEPLH 742
              + V  +T  + T ++EG  Y+ RV AVNA G S+PS  +      +P     P S P  
Sbjct: 29291 KDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPR- 29349

Query: 743   LIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEP-VERCGFTVKNL 801
               V D T  + +L W  P   G   I GY++E   + +++W   +T   +    FTV +L
Sbjct: 29350 --VVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDL 29407

Query: 802   PTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLV 861
               G +  FRV  VN+ G SE +     +   E  E P + L   L++T   + G  L L+
Sbjct: 29408 KMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGASLRLM 29467

Query: 862   VPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKD 921
             V   G+P P + W+K G  L  SR  + T++  ++  V +  R D+G+Y +  + ++ K 
Sbjct: 29468 VSVSGRPPPVITWSKQGIDL-ASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKK 29526

Query: 922   TATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFN 981
             +AT+ ++V +  GP  +V VKEV   +  + W+ P  DG + +  Y V+K +     +  
Sbjct: 29527 SATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREAAMRAFKT 29586

Query: 982   VYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
             V  +   T   +S L+ G  YYFRV  ENI G+ +
Sbjct: 29587 VTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGE 29621



 Score =  202 bits (515), Expect = 1e-51
 Identities = 126/404 (31%), Positives = 190/404 (47%), Gaps = 12/404 (2%)

Query: 638   VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETT 697
             VP  P+   ++SV  +   + WE P YDGG PVTGY +E K   S+RW ++N +     T
Sbjct: 16316 VPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMT 16375

Query: 698   ----YESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTD 750
                 Y+ T +IEG  Y+ RV+A+NA GV   S+ + P     PIAP   P   +  D T 
Sbjct: 16376 LGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPGPPFPKVT-DWTK 16434

Query: 751   TTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFR 810
             ++  L+W PP + G   + GY+VEY  EG EEW     + V      V  L  GA   FR
Sbjct: 16435 SSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFR 16494

Query: 811   VVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRP 870
             V  VNIAG  EP  +   + +++    P ++L   +R   +   G  + ++    GKP P
Sbjct: 16495 VRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPP 16554

Query: 871   QVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVV 930
              V W      L      + T+   +   ++   RS  G Y L  + E  +   TI + V+
Sbjct: 16555 TVTWNMNERTL-PQEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVL 16613

Query: 931   EKAGP-PINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHT 989
             +  GP     +   +   +  + W +P+DDG S I  Y ++K +     W  V       
Sbjct: 16614 DVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQ 16673

Query: 990   SCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGIT 1033
             + TV  LI G  Y+FR+  EN  G+   P V  + A +++  IT
Sbjct: 16674 NATVQGLIQGKAYFFRIAAENSIGM--GPFVETSEALVIREPIT 16715



 Score =  201 bits (510), Expect = 4e-51
 Identities = 227/907 (25%), Positives = 363/907 (40%), Gaps = 108/907 (11%)

Query: 267   QVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
             +V    ++    E++      KWF+N + I  SSKY+         L I    L D A Y
Sbjct: 12650 RVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANY 12709

Query: 327   EVAVKDE-----KCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKD 381
              V++ +      K    L V+E  + IV PL+D +      V    +V+     + W K+
Sbjct: 12710 NVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKN 12769

Query: 382   GVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEV 441
             G E+     F  R  ++ D  +H+L   D    D G Y V     +  AEL++ E   E 
Sbjct: 12770 GEEVP----FDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEF 12825

Query: 442   LQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVR 501
             ++ + D TV   + AVF C++S EK   KWY+NG E++  K+      G  H+L+I D R
Sbjct: 12826 VEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCR 12885

Query: 502   PEDEGDYTF-VPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGN 560
              +DE +Y   V D  +    A+L   EI VE +    PP+  L+  G    + + +   N
Sbjct: 12886 LDDECEYACGVEDRKS---RARLFVEEIPVEII---RPPQDILEAPG---ADVVFLAELN 12936

Query: 561   KLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKV 620
             K +++V        V   ++GD+    +EG  +I +   C        +  D+G Y    
Sbjct: 12937 KDKVEVQWLRNNMVV---VQGDKHQMMSEG--KIHRLQIC------DIKPRDQGEYRFIA 12985

Query: 621   TNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYL-VERKK 679
                  +  A   L++   P      +I +  +D  +        D GKP+T  +  +   
Sbjct: 12986 K----DKEARAKLELAAAP------KIKTADQDLVV--------DVGKPLTMVVPYDAYP 13027

Query: 680   KGSQRWMKLNFEVFT---ETTYEST--KMIE---GILYEMRVFAVNAIGVSQPSMNTKPF 731
             K    W K N  + T   +TT E T  +++E   G     ++   N  G ++  +N K  
Sbjct: 13028 KAEAEWFKENEPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVI 13087

Query: 732   MPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPV 791
                 P     +L V +  D   +L W  P   G   I GY+VE      + WV A T+  
Sbjct: 13088 DVPGPVR---NLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLA-TDRA 13143

Query: 792   ERCGFTVKNLPT-GARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTY 850
             E C FTV  L   G   LFRV   N  G  EP     PV  R   + P    P ++  T 
Sbjct: 13144 ESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVP--GPPLNVTITD 13201

Query: 851   IRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSD---FDTVFFVRQAARS-- 905
             + + G  L    P             GGA +    + +R      +DT   VR    S  
Sbjct: 13202 VNRFGVSLTWEPPEY----------DGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSAT 13251

Query: 906   -----DSGEYELSVQIEN-----MKDTATIRIRV---VEKAGPPINVMVKEVWGTNALVE 952
                  +  EY   V+ +N         AT  ++V   +E+  PP+N+   +   ++  ++
Sbjct: 13252 VTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLK 13311

Query: 953   WQAPKDDGNSEIMGYFVQKADKKTMEWFNV-YERNRHTSCTVSDLIVGNEYYFRVYTENI 1011
             W+ P  DG S I+GY +++ ++    W     +     +  V+ L  GN+Y +RV  EN 
Sbjct: 13312 WEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENK 13371

Query: 1012  CGLSD-SPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCA 1070
              G+SD S  +   TA       T     +K+    + P  +T L+               
Sbjct: 13372 AGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPST------------ 13419

Query: 1071  VRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEAL 1130
               G+P+P   W      +    +  +        L I      D G YT +  N +    
Sbjct: 13420 --GYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTIS 13477

Query: 1131  AECKLEV 1137
              E  + V
Sbjct: 13478 GEIDVNV 13484



 Score =  201 bits (510), Expect = 4e-51
 Identities = 147/489 (30%), Positives = 221/489 (45%), Gaps = 29/489 (5%)

Query: 538   PPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKR 597
             PP++ LD    T  + I V  G  +R+   + G P P  TW K  +V          EKR
Sbjct: 17905 PPEVELDV---TCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVR-------EKR 17954

Query: 598   VDCSSFV------IESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVG 651
             VD    +      I+ A R D G+Y I   N  G    S  + V+D P P + +++T+V 
Sbjct: 17955 VDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVT 18014

Query: 652   EDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEM 711
             ++   + WE P+ +GG  +T ++VE +K   + W  +  +V          ++    Y  
Sbjct: 18015 KENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLI--KANLLANNEYYF 18072

Query: 712   RVFAVNAIGVSQPSMNTK-PFMPIAPTS---EPLHLIVEDVTDTTTTLKWRPPNRIGAGG 767
             RV A N +GV  P++ TK P + I P     EP +L + D   T   LKWR P+  G   
Sbjct: 18073 RVCAENKVGVG-PTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSP 18131

Query: 768   IDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQ 827
                Y VE  L+GS++W   +   ++   + V          FRV   N  G S+     +
Sbjct: 18132 NLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDWVK-TE 18190

Query: 828   PVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSR-- 885
              V ++E  + P + L   L      K G+ + L    +GKP P+V WTK     D +R  
Sbjct: 18191 EVVVKEDLQKPVLDLK--LSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSP 18248

Query: 886   -VHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEV 944
              V + T    + F + +A RSD G+Y ++         A   + V++K GP  N+ + +V
Sbjct: 18249 RVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKIVDV 18308

Query: 945   WGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYF 1004
                   V W  P+DDG  EI  Y ++K + K M W            TV+ LI GNEY F
Sbjct: 18309 SSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIEGNEYIF 18368

Query: 1005  RVYTENICG 1013
             RV  EN  G
Sbjct: 18369 RVRAENKIG 18377



 Score =  200 bits (508), Expect = 7e-51
 Identities = 148/582 (25%), Positives = 254/582 (43%), Gaps = 35/582 (6%)

Query: 450   VKASEQAVFKCEVSDE-KVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDY 508
             VKA EQ           + T  W K+G  ++ + R+ +S       L I +   ED G Y
Sbjct: 25406 VKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTY 25465

Query: 509   TFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSI 568
                    A S++  +                 I LD  G      I  V+ +     ++I
Sbjct: 25466 ELCVSNSAGSITVPITI---------------IVLDRPGPPGPIRIDEVSCDS----ITI 25506

Query: 569   TGEPPP------VATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTN 622
             +  PP       ++ ++   +  T+T     + + V  +S  I       E ++ +   N
Sbjct: 25507 SWNPPEYDGGCQISNYIVEKKETTSTTWHI-VSQAVARTSIKIVRLTTGSEYQFRVCAEN 25565

Query: 623   PVGEDVASIFLQVV-----DVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVER 677
               G+   S    VV       P PP   ++    +   ++ W+ P+ DGG  V GY +E 
Sbjct: 25566 RYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEY 25625

Query: 678   KKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPT 737
             K++ S  W K N  +  +T  + + + EG++YE RV+A N  G+ + S + +P     P 
Sbjct: 25626 KERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPC 25685

Query: 738   SEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFT 797
               P    V ++T  + +LKW  P+  G   I GY+VE        W+  N   ++   F 
Sbjct: 25686 DPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQETYFE 25745

Query: 798   VKNLPTGARILFRVVGVNIAGR-SEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGE 856
             V  L    R  FRV   N A   SEP+    P+ +++  EPP++ +    R   + K GE
Sbjct: 25746 VTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGE 25805

Query: 857   QLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQ 915
              L +     G+P P + W K G  + + +R  + ++D  T+  V+   R D+G+Y L+++
Sbjct: 25806 VLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLK 25865

Query: 916   IENMKDTATIRIRVVEKAGPPINVM-VKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADK 974
                   +  +  +V++K GPP   + +  +      + W  P++DG ++I  Y V+K + 
Sbjct: 25866 NVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRET 25925

Query: 975   KTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
               + W       + TSC V+ L+ GNEY FRV   N  G+ +
Sbjct: 25926 SHLAWTICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGE 25967



 Score =  198 bits (504), Expect = 2e-50
 Identities = 117/410 (28%), Positives = 204/410 (49%), Gaps = 22/410 (5%)

Query: 638   VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTET- 696
             +P PP   ++ +  +   ++ W PP+ +GG P+TGY +E++++GS  W +++    T+  
Sbjct: 15598 LPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVG 15657

Query: 697   ----TYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVT 749
                  +   +++EG+ Y+ R  A+NA G+  PS  + P +   PI P   P    V+D T
Sbjct: 15658 LKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPPGPPSCPEVKDKT 15717

Query: 750   DTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEP---VERCGFTVKNLPTGAR 806
              ++ +L W+PP + G   I GY+VE   EG+ +W   N EP   +  C   V NL    +
Sbjct: 15718 KSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVN-EPDKLITTCECVVPNLKELRK 15776

Query: 807   ILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQG 866
               FRV  VN AG SEP+     +   +I E P++ +    +   + K G Q+ +    +G
Sbjct: 15777 YRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKG 15836

Query: 867   KPRPQVVWTKGGAPLDTSR--VH-------VRTSDFDTVFFVRQAARSDSGEYELSVQIE 917
             +P P+  W   G      +  VH       + T++  +V  + +  RS +G+Y ++ + +
Sbjct: 15837 RPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHTGKYSITAKNK 15896

Query: 918   NMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTM 977
               + TA  R++V++  GPP ++ V ++   +  + W+ P DDG   I GY ++K      
Sbjct: 15897 AGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGK 15956

Query: 978   EWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDS-PGVSKNTAR 1026
              W  V      T+  V DL+   +Y+FRV  EN  G+      + + TAR
Sbjct: 15957 AWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQRTTAR 16006



 Score =  198 bits (503), Expect = 3e-50
 Identities = 169/622 (27%), Positives = 268/622 (43%), Gaps = 40/622 (6%)

Query: 430   AELIVEEKQLEVLQDIADLT-----VKASEQAVFKCEVSDE---KVTGKWYKNGVEVRPS 481
             + +I++E Q+E   D+  +T      KA         +S     KVT  W    + ++ +
Sbjct: 28634 SSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVT--WKLEEMRLKET 28691

Query: 482   KRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKI 541
              R++I+       L + D    D G Y        L  +A +    + V  + +  P   
Sbjct: 28692 DRVSITTTKDRTTLTVKDSMRGDSGRYFLT-----LENTAGVKTFSVTVVVIGRPGPVTG 28746

Query: 542   HLDCSGKTSENAIVVVAGNKLRLDVSITG------EPPPVATWLKGDEVFTTTEGRTRIE 595
              ++ S  ++E+ ++     K      IT       E    A  L    V  T    T + 
Sbjct: 28747 PIEVSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLT 28806

Query: 596   KRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWA 655
             K ++ S F + S  R         V+ P+ E    I       P  P    +  V  +  
Sbjct: 28807 KYMEYS-FRVSSENR-------FGVSKPL-ESAPIIAEHPFVPPSAPTRPEVYHVSANAM 28857

Query: 656   ILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFA 715
              + WE P +DGG  + GY VE+K++ +  W+K N     E  Y+ T ++EG+ Y+ R +A
Sbjct: 28858 SIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYA 28917

Query: 716   VNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE- 774
             +NA GVS+ S  ++P M   P   P    V DVT +T +L W  P   G   + GY++E 
Sbjct: 28918 LNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRSTVSLIWSAPAYDGGSKVVGYIIER 28977

Query: 775   --YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAG-RSEPATLAQPVTI 831
                   G   W+  N   V    FTV  L  G    FRV+  N AG  S+ +    PVT 
Sbjct: 28978 KPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTC 29037

Query: 832   REIAEPPKIRLPRHLRQTYIR-KVGEQLNLVVPFQGKPRPQVVWTKGGAPLD-TSRVHVR 889
             R+   PPK  L   L    +  + G  L L     GKP P+++WTKG   LD   +V ++
Sbjct: 29038 RDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQ 29097

Query: 890   TSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNA 949
              +       ++   RSDSG+Y L+V+  +     ++ ++V++  GP   + V  V     
Sbjct: 29098 YTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKC 29157

Query: 950   LVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTE 1009
              + W  P++DG +EI  Y V++ +   + W  V       S  V+ LI  NEY FRV   
Sbjct: 29158 TLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAV 29217

Query: 1010  NICG----LSDSPGVSKNTARI 1027
             N  G    +   P V++N+  I
Sbjct: 29218 NKYGPGVPVESEPIVARNSFTI 29239



 Score =  197 bits (501), Expect = 5e-50
 Identities = 164/594 (27%), Positives = 258/594 (43%), Gaps = 46/594 (7%)

Query: 442   LQDIADLTVKASEQAVFKCEVSDEKVTGK------WYKNGVEVRPSKRITISHVGRFHKL 495
             L+ + DL   A E + F+ ++    + GK      W K    +    R+++        L
Sbjct: 19984 LKGLPDLCYLAKENSNFRLKIP---IKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTL 20040

Query: 496   VIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIV 555
             ++ D +  D G YT      A     K   + IKV  V K   P   +     T+E    
Sbjct: 20041 IVYDCQKSDAGKYTITLKNVA---GTKEGTISIKV--VGKPGIPTGPIKFDEVTAEA--- 20092

Query: 556   VVAGNKLRLDVSITGEPPPVATWLKGDEVFT-TTEGRTRIEKR-VDCSSFVIESA---QR 610
                       +++   PP       G E+     E R  +  + V C+S V ++     R
Sbjct: 20093 ----------MTLKWAPPKDDG---GSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTR 20139

Query: 611   EDEG-RYTIKVTNP----VGEDVAS---IFLQVVDVPDPPEAVRITSVGEDWAILVWEPP 662
               EG  YT +V+      VGE + S   +     DVPD P    I  V  D   L W  P
Sbjct: 20140 LHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDP 20199

Query: 663   MYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVS 722
                GG P+TGY +E K++ S  W + N        ++ T + EG+ YE RV A+N  GV 
Sbjct: 20200 KKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVG 20259

Query: 723   QPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEE 782
             +PS+ ++P + + P   P    V ++T  + TL W  P   G   + GY+VE     S+ 
Sbjct: 20260 KPSLPSEPVVALDPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKS 20319

Query: 783   WVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGR-SEPATLAQPVTIREIAEPPKIR 841
             W+ AN   V  C FTV +L  G +  FR+   N AG  S P+   + +  ++  E P I 
Sbjct: 20320 WMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIV 20379

Query: 842   LPRHLRQTYIRKVGEQLNL-VVPFQGKPRPQVVWTKGGAPLDTSRV-HVRTSDFDTVFFV 899
             L   ++     K G+ + L  +   GKP P+  W+K G  +  S +  + ++   ++  +
Sbjct: 20380 LDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTI 20439

Query: 900   RQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDD 959
             + A R D+GEY ++           +++ V++  GPP  V +  V    A + W  P +D
Sbjct: 20440 KYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLED 20499

Query: 960   GNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICG 1013
             G S I  Y ++K +   + W  V E  +      + LI GNEY FRV   N  G
Sbjct: 20500 GGSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYG 20553



 Score =  192 bits (489), Expect = 1e-48
 Identities = 116/380 (30%), Positives = 190/380 (50%), Gaps = 8/380 (2%)

Query: 639   PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTY 698
             P PP A+ +  V +    L WEPP  DGG+P+  Y++E+K++   RW+K       +  +
Sbjct: 14184 PGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNF 14243

Query: 699   ESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTL 755
               T +IEG   + +V A N  GV  PS  T+      P +P S PL L V D       +
Sbjct: 14244 RVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAI 14303

Query: 756   KWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTV-KNLPTGARILFRVVGV 814
              W+PP + G   I GY VE C  G+E+W+  N+ P++   F V + +      + RV  V
Sbjct: 14304 AWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAV 14363

Query: 815   NIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVW 874
             N  G SEP+ +++ V  ++    P I L  H     I   GE+L++ VPF+  P P V W
Sbjct: 14364 NAIGVSEPSEISENVVAKDPDCKPTIDLETH---DIIVIEGEKLSIPVPFRAVPVPTVSW 14420

Query: 875   TKGGAPLDTS-RVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKA 933
              K G  +  S R+ ++         V ++ R+D+G Y ++++ +    TA+I ++V+   
Sbjct: 14421 HKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLP 14480

Query: 934   GPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTV 993
             GP  ++   ++  ++  + W+ P+ DG + I+ Y +++ +     +  V       S TV
Sbjct: 14481 GPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTV 14540

Query: 994   SDLIVGNEYYFRVYTENICG 1013
              DLI   EY+FRV   N  G
Sbjct: 14541 KDLIPNGEYFFRVKAVNKVG 14560



 Score =  191 bits (485), Expect = 3e-48
 Identities = 127/440 (28%), Positives = 205/440 (46%), Gaps = 10/440 (2%)

Query: 586   TTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGE----DVASIFLQV-VDVPD 640
             T+T   T +   V  +   +      +E ++ IK  N  G     D A + +++    P 
Sbjct: 26612 TSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPG 26671

Query: 641   PPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYES 700
             PP    +T+V  +   + W  P+ +GG  V GY +E K + S  W K N  V   T ++ 
Sbjct: 26672 PPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKV 26731

Query: 701   TKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPP 760
             T +  G++YE RV+A NA GV +PS  ++P + I     P ++ + D++  + +L W+ P
Sbjct: 26732 TTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQP 26791

Query: 761   NRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGR- 819
                G   I GY+VE        W  A+   V    F +  L   ++  FRV   N  G  
Sbjct: 26792 AFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSI 26851

Query: 820   SEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGA 879
             S P+ +  P+T  +    P I LP    +    + G  + L     GKP P + W K   
Sbjct: 26852 SNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDK 26911

Query: 880   PLDTSRVHV--RTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPI 937
              L T+ +     T+D  ++  ++ A R +SG YEL ++      +ATIR+++++K GPP 
Sbjct: 26912 ELQTNALVCVENTTDLASI-LIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPG 26970

Query: 938   N-VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDL 996
               +  K V      + W+ P DDG ++I  Y V+K +   + W  V E       T + +
Sbjct: 26971 GPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECIITTTKI 27030

Query: 997   IVGNEYYFRVYTENICGLSD 1016
             I GNEY FRV   N  G+ +
Sbjct: 27031 IKGNEYIFRVRAVNKYGIGE 27050



 Score =  189 bits (480), Expect = 1e-47
 Identities = 117/378 (30%), Positives = 174/378 (46%), Gaps = 7/378 (1%)

Query: 639   PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTY 698
             PD P+   +  V  +  ++ W  P  D G P+ GY +E+++  S  W ++N  +      
Sbjct: 14903 PDAPDKPIVEDVTSNSMLVKWNEPK-DNGSPILGYWLEKREVNSTHWSRVNKSLLNALKA 14961

Query: 699   ESTKMIEGILYEMRVFAVNAIG---VSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTL 755
                 ++EG+ Y  RV A NA G    S PS       PI+P   P+  +  D + TT  L
Sbjct: 14962 NVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIPRVT-DTSSTTIEL 15020

Query: 756   KWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVN 815
             +W PP   G G I GY V+  L G+ EW     + ++   +TVK +  GA    RV  VN
Sbjct: 15021 EWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVN 15080

Query: 816   IAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWT 875
              AG   P    QPVT+ E  EPP + L   ++       G+ L +     G+P P  VWT
Sbjct: 15081 AAGEGPPGE-TQPVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWT 15139

Query: 876   KGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGP 935
             K    LD  RV +      +   ++ A R D G Y ++         A  R+ V +  GP
Sbjct: 15140 KEEGELDKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGP 15199

Query: 936   PINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSD 995
              +++          L+ W  P+DDG SEI G+ +++ D K   W    E  R + C ++ 
Sbjct: 15200 VLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETER-SKCDITG 15258

Query: 996   LIVGNEYYFRVYTENICG 1013
             L+ G EY FRV  +N  G
Sbjct: 15259 LLEGQEYKFRVIAKNKFG 15276



 Score =  171 bits (432), Expect = 5e-42
 Identities = 168/618 (27%), Positives = 263/618 (42%), Gaps = 61/618 (9%)

Query: 429   EAELIVEEKQLEVLQDI---ADLTVKASEQAVFKCEVS---DEKVTGKWYKNGVEVRPSK 482
             E + +  ++  E+  D+   A LTVKA  +      V+   + K+T  W K  + ++  K
Sbjct: 13678 EIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKIT--WTKADMILKQDK 13735

Query: 483   RITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIH 542
             RITI +V +   + I D +  D G Y       A+++  +   + ++V  + K  PP   
Sbjct: 13736 RITIENVPKKSTVTIVDSKRSDTGTYII----EAVNVCGRATAV-VEVNVLDKPGPPAA- 13789

Query: 543   LDCSGKTSENAIVV------VAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEK 596
              D +  T+E+ ++         G+K+  +  +         W K     T  +   +  K
Sbjct: 13790 FDITDVTNESCLLTWNPPRDDGGSKI-TNYVVERRATDSEVWHKLSS--TVKDTNFKATK 13846

Query: 597   RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAI 656
              +    ++   A     G     V  PV     +   Q  D P PP  +  + + +D   
Sbjct: 13847 LIPNKEYIFRVAAENMYG-----VGEPVQASPITAKYQ-FDPPGPPTRLEPSDITKDAVT 13900

Query: 657   LVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAV 716
             L W  P  DGG P+TGY VER    + +W++ N     +TTY    +     Y  RV A 
Sbjct: 13901 LTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAE 13960

Query: 717   NAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLV 773
             N  G  +PS +T+P +   PI P   P    V+DV  T+  L W  P   G   I+ Y++
Sbjct: 13961 NLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVI 14020

Query: 774   EYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIRE 833
             E    G++EWV    E V      +  L  G    FRV  VN AG SEP+  + PV  RE
Sbjct: 14021 EMLKTGTDEWVRV-AEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCRE 14079

Query: 834   IAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQ--GKP------RPQVVWTKGGAPLDT-- 883
                PP    PR L    I K    L   VP +  G P        + V  KG   +DT  
Sbjct: 14080 KLYPPS--PPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTV 14137

Query: 884   --SRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIEN---MKDTATIRIRVVEKAGPPIN 938
               ++  V      +++  R AA +  G+ + + +IE+    KDT T         GPP  
Sbjct: 14138 KDTKCTVTPLTEGSLYVFRVAAENAIGQSDYT-EIEDSVLAKDTFT-------TPGPPYA 14189

Query: 939   VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCT--VSDL 996
             + V +V   +  ++W+ PK+DG   I  Y ++K ++    W     +     C   V+D+
Sbjct: 14190 LAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKA-GKTAGPDCNFRVTDV 14248

Query: 997   IVGNEYYFRVYTENICGL 1014
             I G E  F+V  EN  G+
Sbjct: 14249 IEGTEVQFQVRAENEAGV 14266



 Score =  169 bits (427), Expect = 2e-41
 Identities = 134/515 (26%), Positives = 221/515 (42%), Gaps = 40/515 (7%)

Query: 441   VLQDIADLTVKASEQAVFKCEVSDEKVTG-KWYKNGVEVRPSKRITISHVGRFHKLVIDD 499
             + +++ D+T K  E A   C++    +   KWY+ G E+  S++  +S  GR H L +  
Sbjct: 30535 IRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMT 30594

Query: 500   VRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAG 559
                EDEG YT +       +      L         Q  P+ H    G   +       G
Sbjct: 30595 EEQEDEGVYTCIATNEVGEVETSSKLL--------LQATPQFH---PGYPLKEKYYGAVG 30643

Query: 560   NKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDE-GRYTI 618
             + LRL V   G P P  TW  G ++   +E  T IE     +  V+++ QR+   G+Y +
Sbjct: 30644 STLRLHVMYIGRPVPAMTWFHGQKLLQNSENIT-IENTEHYTHLVMKNVQRKTHAGKYKV 30702

Query: 619   KVTNPVGEDVASIFLQVVDVPDPPEA-VRITSVGEDWAILVWEPPMYDGGKPVTGYLVER 677
             +++N  G   A + +++ D PD P   + I ++ ++ A++ W+PP  DGG  +T Y+VE+
Sbjct: 30703 QLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEK 30762

Query: 678   -KKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQP----------SM 726
              + K    W  ++  + + TT     + E   Y  RV A N  G+S P          S 
Sbjct: 30763 CEAKEGAEWQLVSSAI-SVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSP 30821

Query: 727   NTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPA 786
               KP  P  PT       +  VT  +  + W+PP   G   I  Y +E   +   +W+  
Sbjct: 30822 FEKPGAPGKPT-------ITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISV 30874

Query: 787   NTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHL 846
              TE +    F+VKNL  G    FRV   N+ G SE + +++P+T +             L
Sbjct: 30875 TTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEEL 30934

Query: 847   RQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVF---FVRQAA 903
             R   +R       LV    G P+P V W + G  +    +  R  +F   +    +    
Sbjct: 30935 RNLNVR-YQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVT 30993

Query: 904   RSDSGEYELSV--QIENMKDTATIRIRVVEKAGPP 936
               D+  Y++    Q  ++  TA++ + V  K   P
Sbjct: 30994 DDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLP 31028



 Score =  157 bits (396), Expect = 7e-38
 Identities = 142/552 (25%), Positives = 234/552 (42%), Gaps = 90/552 (16%)

Query: 28   KEAPAEAPKEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIK 87
            K+ PA AP           A +    F+ +P S+ V     A  +AKV G  +P+   +K
Sbjct: 8436 KDKPAVAPAT------KKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPN---VK 8486

Query: 88   WFKGKWLELGSKSGARFSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSC 147
            W KGKW +L    G R    +  + A      +L I      D G YR        C + 
Sbjct: 8487 WTKGKWRQLNQ--GGRVFIHQKGDEA------KLEIRDTTKTDSGLYR--------CVAF 8530

Query: 148  GFNIDVEAPRQDASGQSLESFKRTSEKKSDTAGELDFSGLLKKREVVEEEKKKKKKDDDD 207
              + ++E      S  +L+  +R  ++K     E D   +LKK  ++    KK   ++++
Sbjct: 8531 NEHGEIE------SNVNLQVDERKKQEKI----EGDLRAMLKKTPIL----KKGAGEEEE 8576

Query: 208  LGIPPEIWELLKGAKKSEYEKIAFQYGITDLRGMLKRLKKAKV------------EVKKS 255
            +    +I ELLK     EYEK A  YGITD RG+L+  +  K             E+++S
Sbjct: 8577 I----DIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRLEIEEIERS 8632

Query: 256  AAFTKKLDPAYQV------------------------DRGNKIKLMVEISDPDLTLKWFK 291
                K+ +                             D     ++ ++I+ P++ L W+K
Sbjct: 8633 ERDEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDAVFEIDIKINYPEIKLSWYK 8692

Query: 292  NGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTP 351
              ++++PS K+     G +  L +  C L D   Y +         +L V EP       
Sbjct: 8693 GTEKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLVCGPHIASAKLTVIEPAW--ERH 8750

Query: 352  LEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDV 411
            L+D  +  G    M  + S    +  W ++G  L  +     R++ + + K H L  +DV
Sbjct: 8751 LQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQ----GRHKTEVEHKVHKLTIADV 8806

Query: 412  VQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKW 471
              ED+G+Y       +  AEL +E + ++  + I ++ V   + A F+CEVS +     W
Sbjct: 8807 RAEDQGQYTCKYEDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIVTW 8866

Query: 472  YKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFV----PDGYALSLS-AKLNFL 526
            YK   E+  S++    + GR H + I +V P+DEG Y+ +    P G A S +   L   
Sbjct: 8867 YKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELYLTTK 8926

Query: 527  EIKVEYVPKQEP 538
            EIK+E  P   P
Sbjct: 8927 EIKLELKPPDIP 8938



 Score =  156 bits (395), Expect = 9e-38
 Identities = 95/314 (30%), Positives = 153/314 (48%), Gaps = 13/314 (4%)

Query: 530   VEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTE 589
             V  + +  PP+I L  + K+    + V AG  + LD ++ G+P P  +W K   +    E
Sbjct: 19284 VTILAENVPPRIDLSVAMKS---LLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAE 19340

Query: 590   GRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITS 649
             G     +R  C +  + S  R+D G YTI   N  G   A+I L+V+D P PP +V+I  
Sbjct: 19341 GIKMAMQRNLC-TLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINK 19399

Query: 650   VGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILY 709
             +  D A+L WEPP+ DGG  +T Y+V++++     W +++  V   T+    K+IEG  Y
Sbjct: 19400 MYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVSATV-PITSCSVEKLIEGHEY 19458

Query: 710   EMRVFAVNAIGV-----SQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIG 764
             + R+ A N  GV     ++P++   P+ P      P   ++ ++T    T+ W+PP   G
Sbjct: 19459 QFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDPP---VISNITKDHMTVSWKPPADDG 19515

Query: 765   AGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPAT 824
                I GYL+E     +  W   N +P+         L  G    FRV  +N AG  +P+ 
Sbjct: 19516 GSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSD 19575

Query: 825   LAQPVTIREIAEPP 838
              ++    R+   PP
Sbjct: 19576 ASKAAYARDPQYPP 19589



 Score =  154 bits (388), Expect = 6e-37
 Identities = 199/903 (22%), Positives = 340/903 (37%), Gaps = 94/903 (10%)

Query: 274  IKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDE 333
            I   V ++   ++ KW KNG EIK + K           L I      D A Y       
Sbjct: 2986 ITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKA 3045

Query: 334  KCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKA 393
                 L+V+   +     ++D +V    R     EVSE    V WMKD  EL   D    
Sbjct: 3046 TSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITD---- 3101

Query: 394  RYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKAS 453
            R + +K+   H L+       D G+Y V+  G    A+L VE + + +     ++ V   
Sbjct: 3102 RIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEK 3161

Query: 454  EQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHV--GRFHKLVIDDVRPEDEGDYTFV 511
            ++AV + EV+++ V   WYK+G+E+    +    +V   R H++ I + R  D G+YTFV
Sbjct: 3162 QRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFV 3221

Query: 512  PDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGE 571
                  S++           YV   EPP++  +         + V +G   R    I+G 
Sbjct: 3222 AGRNRSSVTL----------YVNAPEPPQVLQEL------QPVTVQSGKPARFCAVISGR 3265

Query: 572  PPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASI 631
            P P  +W K +++ +T      +    + +  +IE A  ED   YT +  N  G    S 
Sbjct: 3266 PQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIE-AFPEDAAVYTCEAKNDYGVATTSA 3324

Query: 632  FLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKP-------------VTGYLVERK 678
             L  V+VP+     +   V     I   +  +   G+P             V+ Y  ++K
Sbjct: 3325 SLS-VEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKK 3383

Query: 679  KKGSQRWMKLNFE-VFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPT 737
             K S+ +    FE  +     E+    EG        A NA+G    + N     P +  
Sbjct: 3384 IKPSRFFRMTQFEDTYQLEIAEAYPEDEG---TYTFVASNAVGQVSSTANLSLEAPESIL 3440

Query: 738  SEPLHLIVEDVTDTTTTLKWR-PPNRIGAGGIDGYLVEYCLEGSE--EWVPANTEPVE-- 792
             E +   +E        +K +  P  +  G +  +  E     +   +W  A  E  E  
Sbjct: 3441 HERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESD 3500

Query: 793  RCGFTVKNLPTGARILFRVV------GVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHL 846
            +C        +   IL   V          +      +    +T+ E   P  +  P+ L
Sbjct: 3501 KCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSL 3560

Query: 847  RQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDT--VFFVRQAAR 904
                   VG+    +    G P  + +W K GA L  S  + R SD +   +  +     
Sbjct: 3561 TTF----VGKAAKFICTVTGTPVIETIWQKDGAALSPS-PNWRISDAENKHILELSNLTI 3615

Query: 905  SDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEI 964
             D G Y      +   D     + +++K        +KE+    + +         N ++
Sbjct: 3616 QDRGVYSCKASNKFGADICQAELIIIDKPH-----FIKELEPVQSAI---------NKKV 3661

Query: 965  -MGYFVQKADKKTMEWFNVYER---NRHTSCTVSDLIVGNEYYFRVYTEN---ICGLSDS 1017
             +   V +  K T+ W    ++    +       D I   E       ++   +C  S+ 
Sbjct: 3662 HLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNE 3721

Query: 1018 PGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKP 1077
             G S  +A +    +   P   K+ D    P +L       ++ G SA L+C ++G P  
Sbjct: 3722 AGSSSCSATVT---VREPPSFVKKVD----PSYL-------MLPGESARLHCKLKGSPVI 3767

Query: 1078 KVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
            +V W KN  E+ E     +        L+I      D+G+Y+C AVN++G      ++ +
Sbjct: 3768 QVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVI 3827

Query: 1138 RVP 1140
            + P
Sbjct: 3828 KEP 3830



 Score =  154 bits (388), Expect = 6e-37
 Identities = 221/934 (23%), Positives = 348/934 (37%), Gaps = 146/934 (15%)

Query: 271   GNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAV 330
             G  +  + E++   + ++W +N   +    K+   + GK   L I      D   Y    
Sbjct: 12926 GADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIA 12985

Query: 331   KDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSE-EGAQVMWMKDGVELTRE- 388
             KD++   +L +   P  I T  +D  V VG  + M V       A+  W K+   L+ + 
Sbjct: 12986 KDKEARAKLELAAAPK-IKTADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKT 13044

Query: 389   -DSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIAD 447
              D+   +  F+           +  + D+GRY+++      +AE  +  K ++V   + +
Sbjct: 13045 IDTTAEQTSFR---------ILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRN 13095

Query: 448   LTVKASEQAVFKCEVS---DEKVT---GKWYKNGVEVRPSKRITISHVGRFHKLVIDDVR 501
             L V  +    F  EVS   +E +T    K     VE R  KR T         ++  D  
Sbjct: 13096 LEVTET----FDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTW--------VLATDRA 13143

Query: 502   PEDEGDYTFVPDG---YALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVA 558
                E   T +  G   Y   +SA+      +          +   D  G      I  V 
Sbjct: 13144 ESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVN 13203

Query: 559   GNKLRLDVSITGEPPP------VATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQRED 612
                 R  VS+T EPP       +  ++      T+    T +  R +  S  +       
Sbjct: 13204 ----RFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQ 13259

Query: 613   EGRYTIKVTNPVG---EDVASIFLQVVDV---PDPPEAVRITSVGEDWAILVWEPPMYDG 666
             E  + ++  N +G      A+ F++V D    P PP  +  +   +    L WEPP+ DG
Sbjct: 13260 EYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDG 13319

Query: 667   GKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSM 726
             G P+ GY++ER ++G   W++ N ++  E TY+ T + +G  Y  RV A N  GVS PS 
Sbjct: 13320 GSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSE 13379

Query: 727   NTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPA 786
                P        EP      D++     L+   PN I                    VP+
Sbjct: 13380 ILGPLTADDAFVEP----TMDLSAFKDGLEVIVPNPITI-----------------LVPS 13418

Query: 787   N--TEPVERCGFTVKNLPTGARILFRVVG------VNIAGRSEPA-----------TLAQ 827
                  P     F  K L TG R+  + +       ++ + RS+             T++ 
Sbjct: 13419 TGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISG 13478

Query: 828   PVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLD----- 882
              + +  IA P     P+ L+   I K    L    P             GG+PL      
Sbjct: 13479 EIDVNVIARPSA---PKELKFGDITKDSVHLTWEPPDDD----------GGSPLTGYVVE 13525

Query: 883   ----TSRVHVRTSDFDT-------------VFFVRQAARSDSGEYELSVQIE--NMKDTA 923
                 + +   +  DF T              +  +  AR+  G  E +   E  NM   A
Sbjct: 13526 KREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPA 13585

Query: 924   TIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVY 983
             T+         PP NV  ++    +  + W  PK+DG S I GY V++  + + +W    
Sbjct: 13586 TV-------PDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACG 13638

Query: 984   ERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHD 1043
             E    T   V+ L  G  Y +RV   N  G S     S+ T  I        P      +
Sbjct: 13639 EPVAETKMEVTGLEEGKWYAYRVKALNRQGASKP---SRPTEEIQAVDTQEAP------E 13689

Query: 1044  FRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVL 1103
               +  K L  L    V AG    L   V G P+PK+ W K  M +++D +  I N     
Sbjct: 13690 IFLDVKLLAGL---TVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKS 13746

Query: 1104  TLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
             T+ I      D GTY   AVN  G A A  ++ V
Sbjct: 13747 TVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 13780



 Score =  152 bits (385), Expect = 1e-36
 Identities = 103/305 (33%), Positives = 150/305 (49%), Gaps = 8/305 (2%)

Query: 537   EPPKIHLDCSGKTSENAIVVVAGNKLRLD-VSITGEPPPVATWLKGDEVFTTTEGRTRIE 595
             E P I LD    T ++ + + AG+ + L+ +SI G+P P ++W K  +    ++  T+I 
Sbjct: 20374 EAPTIVLD---PTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSD-ITQIT 20429

Query: 596   KRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWA 655
                  S   I+ A R+D G YTI  TNP G  V  + + V+DVP PP  V I++V  + A
Sbjct: 20430 STPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPPGPVEISNVSAEKA 20489

Query: 656   ILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFA 715
              L W PP+ DGG P+  Y++E+++     W  ++ E      + +TK+I+G  Y  RV A
Sbjct: 20490 TLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVS-EDIQSCRHVATKLIQGNEYIFRVSA 20548

Query: 716   VNAIGVSQP--SMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLV 773
             VN  G  +P  S   K      P   P    V +VT  T T+ W+ P   G   I GY V
Sbjct: 20549 VNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHV 20608

Query: 774   EYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIRE 833
             E   + S  WV A   PV      V  L  G+   FRV   N AG   P+  +  V +++
Sbjct: 20609 ERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKD 20668

Query: 834   IAEPP 838
              A PP
Sbjct: 20669 AAYPP 20673



 Score =  150 bits (378), Expect = 9e-36
 Identities = 188/818 (22%), Positives = 320/818 (39%), Gaps = 114/818 (13%)

Query: 277   MVEISDPDLTLKWFK----NGQEI-------KPSSKYVFENVGKKRI----LTINKCTLA 321
             ++ IS   +TL+W K     G+EI       + S    ++   K+RI     TI     A
Sbjct: 30439 ILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEA 30498

Query: 322   DDAAYEVAVKDEKCF-----------TELFVKEPPVLIVTPLEDQQVFVGDRVEMAVE-V 369
              +  + V  ++E              T+L   E P  I   ++D    +G+  +++ + V
Sbjct: 30499 TEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPG-IRKEMKDVTTKLGEAAQLSCQIV 30557

Query: 370   SEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCE 429
                   + W + G EL +      +Y+   DG+ H L      QED G Y  I      E
Sbjct: 30558 GRPLPDIKWYRFGKELIQS----RKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGE 30613

Query: 430   AE-----LIVEEKQLEVLQDIADLTVKA--SEQAVFKCEVSDEKVTGKWYKNGVEVRPSK 482
              E     L+    Q      + +    A  S   +    +        W+     ++ S+
Sbjct: 30614 VETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSE 30673

Query: 483   RITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIH 542
              ITI +   +  LV+ +V+ +           Y + LS     ++  ++   + +P K  
Sbjct: 30674 NITIENTEHYTHLVMKNVQRKTHAGK------YKVQLSNVFGTVDAILDVEIQDKPDK-- 30725

Query: 543   LDCSGKTSENAIVVVAGNKLRLDVSITGEPPPV--ATWLKGDEVFTTTEGRTRIEKRVDC 600
                        IV+ A   L+    I+ +PP     +W+  + V    E +   E ++  
Sbjct: 30726 -------PTGPIVIEA--LLKNSAVISWKPPADDGGSWIT-NYVVEKCEAKEGAEWQLVS 30775

Query: 601   SSFVIESAQ----REDEGRY-------TIKVTNPVGEDVASIFLQVVDVPDPPEAVRITS 649
             S+  + + +     E+ G Y       T  +++P+      I     + P  P    IT+
Sbjct: 30776 SAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITA 30835

Query: 650   VGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILY 709
             V +D  ++ W+PP  DGG  +  Y +E+++K   +W+ +  E   ET +    +IEG+ Y
Sbjct: 30836 VTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEY 30895

Query: 710   EMRVFAVNAIGVSQPSMNTKPFMPIAPT--------SEPLHLIVEDVTDTTTTLK----- 756
             E RV   N  G S+ S  ++P  P +           E  +L V   ++ T   K     
Sbjct: 30896 EFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHP 30955

Query: 757   ------WRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFR 810
                   +R    I A G+  Y ++    G  + + A+    +   + V+    G  +   
Sbjct: 30956 KPIVKWYRQGKEIIADGLK-YRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSV--- 31011

Query: 811   VVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKV--GEQLNLVVPFQGKP 868
                      S  A+L       E+  P KI LP+ L          GE +++ +PF GKP
Sbjct: 31012 ---------SGTASL-------EVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKP 31055

Query: 869   RPQVVWTKGGAPLDTSRVH--VRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIR 926
              P + W KG   +D +  +  + T  F ++ F     R D+G Y +  +     D  T+ 
Sbjct: 31056 DPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVE 31115

Query: 927   IRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN 986
             + V +   PP  V V +V   +  + W  P  DG S+I  Y V+K       W  V +  
Sbjct: 31116 LDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQA- 31174

Query: 987   RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNT 1024
             R T  TV +L     Y FRV  EN  GLS     S+ T
Sbjct: 31175 RETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPT 31212



 Score =  149 bits (375), Expect = 2e-35
 Identities = 110/360 (30%), Positives = 159/360 (44%), Gaps = 37/360 (10%)

Query: 268   VDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYE 327
             V  G       E+S  D+ ++W+  G++++PS K V  + GK   LT+    L D    +
Sbjct: 12207 VTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQ 12266

Query: 328   VAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTR 387
             +  KD K    LFVKEPPV    PLEDQ V  G    +  EVS E A+V W K+G E+ +
Sbjct: 12267 LTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILK 12326

Query: 388   EDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIAD 447
                   +Y    DG+   L+  D   ED   Y       +    L V    +E L+ + D
Sbjct: 12327 ----SKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTD 12382

Query: 448   LTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGD 507
             L V+  E A F+CE+S E    KW+K+G E++  K+  I   G    LVI+    +DE +
Sbjct: 12383 LQVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAE 12442

Query: 508   YTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVS 567
             Y+   +      S  L  LE +  +             + + SE   +     KL  +VS
Sbjct: 12443 YSC--EVRTARTSGMLTVLEEEAVFTKNL--------ANIEVSETDTI-----KLVCEVS 12487

Query: 568   ITGEPPPVATWLKGDEVF-------TTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKV 620
                +P     W KGDE           TEGR RI         VI++A  ED G Y  ++
Sbjct: 12488 ---KPGAEVIWYKGDEEIIETGRYEILTEGRKRI--------LVIQNAHLEDAGNYNCRL 12536



 Score =  149 bits (375), Expect = 2e-35
 Identities = 101/318 (31%), Positives = 146/318 (45%), Gaps = 14/318 (4%)

Query: 528   IKVEYVPKQEP---PKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKG-DE 583
             +K E V  +E    P + L  SG      + V AG+ +RL+  + G+P P   W K  D 
Sbjct: 18187 VKTEEVVVKEDLQKPVLDLKLSG-----VLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDA 18241

Query: 584   VFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPE 643
                T   R +I+ R D S F +  A+R D G+Y +  TN  G  VA   + V+D P P  
Sbjct: 18242 TDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVR 18301

Query: 644   AVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKM 703
              ++I  V  D   + W+PP  DGG  +  Y++E+ +     W   +  V T  T   T++
Sbjct: 18302 NLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGT-TVTRL 18360

Query: 704   IEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTT---TTLKWRPP 760
             IEG  Y  RV A N IG   P+  +KP +      +P      +VT  +    T+ W PP
Sbjct: 18361 IEGNEYIFRVRAENKIGTGPPT-ESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPP 18419

Query: 761   NRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRS 820
                G   I GY +E   + S  WVP N   +      V+NL       FRV   N  G  
Sbjct: 18420 EYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIG 18479

Query: 821   EPATLAQPVTIREIAEPP 838
             EP+  ++PV  ++  EPP
Sbjct: 18480 EPSLPSRPVVAKDPIEPP 18497



 Score =  145 bits (366), Expect = 2e-34
 Identities = 135/522 (25%), Positives = 214/522 (40%), Gaps = 46/522 (8%)

Query: 636   VDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTE 695
             +D P PP    +  VG+    L W  P +DGG  +  Y++E  K G+  W+++   V T 
Sbjct: 13981 IDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPT- 14039

Query: 696   TTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTT 752
             T +    ++EG  Y  RV AVN  G S+PS  + P +    + P S P  L V ++T  T
Sbjct: 14040 TQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNT 14099

Query: 753   TTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVV 812
               LKW  P + G   I  Y+VE      + W   +T  V+    TV  L  G+  +FRV 
Sbjct: 14100 ADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTT-VKDTKCTVTPLTEGSLYVFRVA 14158

Query: 813   GVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQ--GKPRP 870
               N  G+S+   +   V  ++    P    P  L    + K    L    P    G+P  
Sbjct: 14159 AENAIGQSDYTEIEDSVLAKDTFTTPGP--PYALAVVDVTKRHVDLKWEPPKNDGGRPIQ 14216

Query: 871   QVV----------WTKGG---APLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIE 917
             + V          W K G    P    RV       +  F VR    +  G      +I 
Sbjct: 14217 RYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEIL 14276

Query: 918   NMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTM 977
             +++D  +          PP+++ V +    +  + W+ P+ +G S I+GY V+     T 
Sbjct: 14277 SIEDPTS-------PPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTE 14329

Query: 978   EWFNVYERN-RHTSCTVSDLIVGN-EYYFRVYTENICGLSDSPGVSKNTARILKTGITFK 1035
             +W  V  R  +     V + +V + EY  RV   N  G+S+   +S+N   + K      
Sbjct: 14330 KWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENV--VAKDPDCKP 14387

Query: 1036  PFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFL 1095
               + + HD              +V+ G   ++    R  P P V W K+  E++   +  
Sbjct: 14388 TIDLETHDI-------------IVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLT 14434

Query: 1096  ITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
             + N      L + +    DAG YT    N+LG A A   ++V
Sbjct: 14435 MKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKV 14476



 Score =  144 bits (363), Expect = 5e-34
 Identities = 255/1152 (22%), Positives = 411/1152 (35%), Gaps = 191/1152 (16%)

Query: 54   FLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFSFKESH--N 111
            FL +P S++   GK A  +  V G      P I+        +  K GA  S   +   +
Sbjct: 3553 FLSRPKSLTTFVGKAAKFICTVTGT-----PVIE-------TIWQKDGAALSPSPNWRIS 3600

Query: 112  SASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFN-IDVEAPRQDASGQSLESFKR 170
             A N + +EL    + + DRG Y  +   K   D C    I ++ P      + LE  + 
Sbjct: 3601 DAENKHILEL--SNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFI---KELEPVQS 3655

Query: 171  TSEKKSDTAGELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIA 230
               KK     ++D           E+ K       D   +PP            +Y KI 
Sbjct: 3656 AINKKVHLECQVD-----------EDRKVTVTWSKDGQKLPPG----------KDY-KIC 3693

Query: 231  FQYGITDLRGMLKRLK------------------KAKVEVKKSAAFTKKLDPAYQVDRGN 272
            F+  I  L   L +LK                   A V V++  +F KK+DP+Y +  G 
Sbjct: 3694 FEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGE 3753

Query: 273  KIKLMVEI-SDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEV-AV 330
              +L  ++   P + + WFKN +E+  S+      V  + IL I    + D  +Y   AV
Sbjct: 3754 SARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAV 3813

Query: 331  KD---EKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGA-QVMWMKDGVELT 386
             D   + C TE+ +KEPP  I T LE   +  G    +  EVS  G  ++ W KD  ++ 
Sbjct: 3814 NDVGSDSCSTEIVIKEPPSFIKT-LEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIR 3872

Query: 387  REDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGG----QCEAELIVEEKQLEVL 442
                ++    F +     + IFS     D G Y+ +         C A  +++E    V 
Sbjct: 3873 SSKKYRL---FSQKSLVCLEIFS-FNSADVGEYECVVANEVGKCGCMATHLLKEPPTFV- 3927

Query: 443  QDIADLTVKASEQAVFKCEV-SDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVR 501
            + + DL     +    +  V   E ++  W K    +R   +I +S       L+I DV+
Sbjct: 3928 KKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQ 3987

Query: 502  PEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNK 561
                G YT + +  A S        +  V  +  +EP KI            I V AG+ 
Sbjct: 3988 ISFGGKYTCLAENEAGS--------QTSVGELIVKEPAKI------IERAELIQVTAGDP 4033

Query: 562  LRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVT 621
              L+ ++ G P     W K       ++ + RI  + + +     SA+  D G+YT +++
Sbjct: 4034 ATLEYTVAGTPELKPKWYKDGRPLVASK-KYRISFKNNVAQLKFYSAELHDSGQYTFEIS 4092

Query: 622  NPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYL-VERKKK 680
            N VG         V+D    P                +  P+ +    V G   ++ K  
Sbjct: 4093 NEVGSSSCETTFTVLDRDIAP---------------FFTKPLRNVDSVVNGTCRLDCKIA 4137

Query: 681  GS----QRWMKLNFEVFTETTY-----ESTKMIEGILYEMR------VFAVNAIGVSQ-- 723
            GS      W K   E+     Y     E T  +E I  +M         A N++G     
Sbjct: 4138 GSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSS 4197

Query: 724  --------PSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEY 775
                    PS  TKP          + L       T  T++W   N+    G   Y+ + 
Sbjct: 4198 GALIVQEPPSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKE 4257

Query: 776  CLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIA 835
             LE S E     T         V N+  G               S    + +P T  E  
Sbjct: 4258 ALESSLELYLVKTSDSGTYTCKVSNVAGGVEC------------SANLFVKEPATFVEKL 4305

Query: 836  EPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDT 895
            EP           + + K G+   L     G P  ++ W      +  S  H R S  ++
Sbjct: 4306 EP-----------SQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKH-RMSFVES 4353

Query: 896  VFFVR--QAARSDSGEYELSVQIENMKDTATIRIRVVE-----KAGPPINVMVKEVWGTN 948
               +R       DSGEY    Q E   D  +  + V E     K   PI V+ +      
Sbjct: 4354 TAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKPIEVLKEYDVMLL 4413

Query: 949  ALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYT 1008
            A V    P +      + +F      ++   +  + ++   S  +   +  +   ++   
Sbjct: 4414 AEVAGTPPFE------ITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQ--- 4464

Query: 1009 ENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALN 1068
               C +++  G S  +AR+                 R  P F+  +     + G +AA  
Sbjct: 4465 ---CRVTNEVGSSICSARV---------------TLREPPSFIKKIESTSSLRGGTAAFQ 4506

Query: 1069 CAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGE 1128
              ++G     V W+K+  EI ED    +T    V +L +        G Y C+A N+ G 
Sbjct: 4507 ATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGI 4566

Query: 1129 ALAECKLEVRVP 1140
                  L V+ P
Sbjct: 4567 QRCSALLSVKEP 4578



 Score =  139 bits (351), Expect = 1e-32
 Identities = 217/918 (23%), Positives = 355/918 (38%), Gaps = 100/918 (10%)

Query: 248  AKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEIS-DPDLTLKWFKNGQEIKPSSKYVFEN 306
            A++ V++   F KKL+P+  V +    +   +I   P++ + W+K+  EI+ SSK+    
Sbjct: 7297 AQLGVQEPPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSF 7356

Query: 307  VGKKRILTINKCTLADDAAYEV----AVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDR 362
            V    +L ++  ++ D   Y      A       T L VKEPP+    P    +   G  
Sbjct: 7357 VDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKP-HPIETLKGAD 7415

Query: 363  VEMAVEVSEEGA-QVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQV 421
            V +  E+       V W KD  EL        +Y+   +     +   +V   D G YQ 
Sbjct: 7416 VHLECELQGTPPFHVSWYKDKRELRSGK----KYKIMSENFLTSIHILNVDAADIGEYQC 7471

Query: 422  -ITN--GGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSD-EKVTGKWYKN-GV 476
              TN  G       I  +     ++ ++D++    ++   +  +   E ++  W+K+ G 
Sbjct: 7472 KATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGE 7531

Query: 477  EVRPSKRITISHVGRFHKLVIDDVRPEDEGDYT--FVPDGYALSLSAKLNFLEIKVEYVP 534
             VR S  I IS+      L    V P + G YT     D       A L+ LE     V 
Sbjct: 7532 IVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLE-PATIVE 7590

Query: 535  KQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRI 594
            K E               +I V  G+   L+ ++ G P     W K D    T++ + +I
Sbjct: 7591 KPE---------------SIKVTTGDTCTLECTVAGTPELSTKWFK-DGKELTSDNKYKI 7634

Query: 595  EKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSV--GE 652
                  S   I +    D G Y+ +V NPVG+D  +  LQV D   PP   R      G 
Sbjct: 7635 SFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGL 7694

Query: 653  DWAILVWEPPMYDGGKPVT-GYLVERKKKGSQRWMKLNFEVFTETTYESTKMIE-GILYE 710
              + +V E  +Y G  P++  +  E  +  S R  K    +   T   +  M+E     +
Sbjct: 7695 SGSSVVMECKVY-GSPPISVSWFHEGNEISSGR--KYQTTLTDNTCALTVNMLEESDSGD 7751

Query: 711  MRVFAVNAIGVSQPS--MNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGI 768
                A N  G  + S  +  +         +P+ ++       T+ +K  PP  +     
Sbjct: 7752 YTCIATNMAGSDECSAPLTVREPPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVS---- 7807

Query: 769  DGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGR-----SEPA 823
                     +GS E VP      +RC  ++++  + A +    V  + +G      S  A
Sbjct: 7808 -------WFKGSSELVPG-----DRCNVSLED--SVAELELFDVDTSQSGEYTCIVSNEA 7853

Query: 824  TLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDT 883
              A   T   I  P K    + L    I K G+ L L   F G P   V W K G  +  
Sbjct: 7854 GKASCTTHLYIKAPAKF--VKRLNDYSIEK-GKPLILEGTFTGTPPISVTWKKNGINVTP 7910

Query: 884  S-RVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVM-- 940
            S R ++ T++   +  +  +   D+G+Y   ++  + KD+ + +I ++E   PP  V   
Sbjct: 7911 SQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILE---PPYFVKQL 7967

Query: 941  --VKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIV 998
              VK   G +A ++ Q     G  EI G    K D K           R+   T    +V
Sbjct: 7968 EPVKVSVGDSASLQCQLA---GTPEI-GVSWYKGDTKLRPTTTYKMHFRNNVAT----LV 8019

Query: 999  GNEYYFRVYTENICGLSDSPG-VSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDR 1057
             N+       E IC   +S G VS +T   ++             + ++ P F   L D 
Sbjct: 8020 FNQVDINDSGEYICKAENSVGEVSASTFLTVQ-------------EQKLPPSFSRQLRDV 8066

Query: 1058 VVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGT 1117
                G     +CA+ G     V W K+   +++ P    +      TLNI +     AG 
Sbjct: 8067 QETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQ 8126

Query: 1118 YTCRAVNELGEALAECKL 1135
            Y+C A N +G A +  +L
Sbjct: 8127 YSCTATNPIGSASSSARL 8144



 Score =  137 bits (345), Expect = 6e-32
 Identities = 141/569 (24%), Positives = 234/569 (41%), Gaps = 50/569 (8%)

Query: 68    DAVVVAKVNGKELPDKPTIKWFKGKWL----ELGSKSG--ARFSFKESHNSASNVY---T 118
             + V  A+V GK+   +  +   + K++    +   K G  A F  + SH     V+    
Sbjct: 11551 EGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKND 11610

Query: 119   VELHIGKVVL--GDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLESFKRTSEKKS 176
              +LH  + VL   +   ++LE+K     D       V+     A  + LE+    + K  
Sbjct: 11611 AKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLH 11670

Query: 177   D-TAGELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGI 235
             D TA E D   L  K EV ++   K  KD +++   P+      G ++    K A     
Sbjct: 11671 DKTAVEKDEITL--KCEVSKDVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKA----- 11723

Query: 236   TDLRGMLKRL-----KKAKVEVKKSAAFTKKLDPAYQVDR--GNKIKLMVEISDPDLTLK 288
              DL+   + +      K K  V   A   K   P Y V+   G      +E+S+PD+  +
Sbjct: 11724 -DLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEPDVHGQ 11782

Query: 289   WFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLI 348
             W   GQ +  S        GKK IL ++ C L           + K    L VKE P++ 
Sbjct: 11783 WKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLIF 11842

Query: 349   VTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIF 408
             +TPL D +VF  D  +   EVS E     W+K   E+T +D    R+   KDG +H ++ 
Sbjct: 11843 ITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDD----RFELIKDGTKHSMVI 11898

Query: 409   SDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVT 468
                  ED  +Y           +LI+E  +L+ L  + D+T K  E AVF  E+S + + 
Sbjct: 11899 KSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIR 11958

Query: 469   GKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEI 528
              KW+KN   +  ++ +++   G+ H +   D+  +D        +   +S  AKL  LE 
Sbjct: 11959 VKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRV--EAMGMSSEAKLTVLEG 12016

Query: 529   KVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTT 588
                +  K +      D +G   +  I         L   I+    PV  +  G E+  + 
Sbjct: 12017 DPYFTGKLQ------DYTGVEKDEVI---------LQCEISKADAPVKWFKDGKEIKPSK 12061

Query: 589   EGRTRIEKRVDCSSFVIESAQREDEGRYT 617
                 + + +      +++ A + D G+YT
Sbjct: 12062 NAVIKADGKK--RMLILKKALKSDIGQYT 12088



 Score =  136 bits (342), Expect = 1e-31
 Identities = 97/354 (27%), Positives = 155/354 (43%), Gaps = 30/354 (8%)

Query: 551   ENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQR 610
             ++ IVV AG    L+  I G+P P   W K  +    T  R  I+  +  ++ V++   R
Sbjct: 24714 KDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIR 24773

Query: 611   EDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEA-VRITSVGEDWAILVWEPPMYDGGKP 669
              D G+Y +K++N  G     I ++V+D P PPE  +++T V  +   L W PP+ DGG  
Sbjct: 24774 TDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGAN 24833

Query: 670   VTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMN-- 727
             ++ Y++E+++     W +++ EV     Y+ TK++ G  Y  RV AVN  G+ +P  +  
Sbjct: 24834 ISHYIIEKRETSRLSWTQVSTEV-QALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESGP 24892

Query: 728   ---TKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWV 784
                  P+ P  P S P    V  +T  +  + W  P   G   I+GY++E   +    W 
Sbjct: 24893 VTACNPYKPPGPPSTPE---VSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWT 24949

Query: 785   PANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPR 844
               N + +      V  L  G    FRV   N AG  EP+  +      +   PP      
Sbjct: 24950 KCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPP------ 25003

Query: 845   HLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTK----GGAPLDTSRVHVRTSDFD 894
                       G   N  V    +    + W+K    GGAP+    V V+ +  D
Sbjct: 25004 ----------GPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAAD 25047



 Score =  134 bits (338), Expect = 4e-31
 Identities = 206/946 (21%), Positives = 358/946 (37%), Gaps = 124/946 (13%)

Query: 232  QYGITDLRGMLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEIS-DPDLTLKWF 290
            QY       + K +  A++ VK+   F KKL+ +    +G  I+L  +IS  P++ + WF
Sbjct: 6340 QYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWF 6399

Query: 291  KNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY----EVAVKDEKCFTELFVKEPPV 346
            +N  E+  S KY    +    +LTIN+ +  D   Y       V D  C T L VK PPV
Sbjct: 6400 RNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPV 6459

Query: 347  LIVTPLEDQQVFVGDRVEMAVEVS-EEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHI 405
                P        G  V +  E+S     +V+W+KD  ++     FK   +   D   HI
Sbjct: 6460 FTQKP-SPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSK-HFDTSLHI 6517

Query: 406  LIFSDVVQEDRGRY------QVITNGGQCEAELIVEEKQLEVLQDIADLTVKASE-QAVF 458
            L   ++   D G Y      +V ++   C  +     + ++ L D + L   A E +A+ 
Sbjct: 6518 L---NLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLIGDAVELRAIV 6574

Query: 459  KCEVSDEKVTGKWYKN-GVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDY--TFVPDGY 515
            +     + ++  W K+ G  +R S+   IS +     L +      + G Y      D  
Sbjct: 6575 E---GFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAG 6631

Query: 516  ALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPV 575
                SA L  LE     + K EP               + V  GN   L+  +TG P   
Sbjct: 6632 MRECSAVLTVLE-PARIIEKPEP---------------MTVTTGNPFALECVVTGTPELS 6675

Query: 576  ATWLK-GDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQ 634
            A W K G E+   ++       +V  +S  I  A+  D+G Y+ +V N VG+   ++ + 
Sbjct: 6676 AKWFKDGRELSADSKHHITFINKV--ASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVH 6733

Query: 635  VVDVPDPPEAVR-ITSVGEDWAILVWEPPMYDGGKPVT-GYLVERKK--KGSQRWMKLNF 690
            V D   PP  +R +  V       V       G  P++ G+  +  +   G +     + 
Sbjct: 6734 VSDRIVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSE 6793

Query: 691  EVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPS--MNTKPFMPIAPTSEPLHLIVEDV 748
             V T           GI       A N  G  + S  +  +       T + + ++    
Sbjct: 6794 NVCTLNLSLLEPSDTGI---YTCVAANVAGSDECSAVLTVQEPPSFEQTPDSVEVLPGMS 6850

Query: 749  TDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARIL 808
               T+ ++  PP ++              +GS E VP      E C  ++++  T   + 
Sbjct: 6851 LTFTSVIRGTPPFKV-----------KWFKGSRELVPG-----ESCNISLEDFVTELELF 6894

Query: 809  ---------FRVVGVNIAGRSEPAT---LAQPVT-IREIAEPPKIRLPRHLRQTYIRKVG 855
                     +  +  N AG +   T   + +P T ++ +A+             +  + G
Sbjct: 6895 EVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLAD-------------FSVETG 6941

Query: 856  EQLNLVVPFQGKPRPQVVWTKGGAPLDTS-RVHVRTSDFDTVFFVRQAARSDSGEYELSV 914
              + L   + G P   V W K    +  S R  +  ++  T+  + ++   D  +Y   +
Sbjct: 6942 SPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLI 7001

Query: 915  QIENMKDTATIRIRVVEKAGPPINV----MVKEVWGTNALVEWQAPKDDGNSEI-MGYFV 969
            + E  +D     + V+E   PP  +     V+ V G  A ++    K DG  EI + ++ 
Sbjct: 7002 ENEAGQDICEALVSVLE---PPYFIEPLEHVEAVIGEPATLQC---KVDGTPEIRISWYK 7055

Query: 970  QKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILK 1029
            +    ++   + +  +N   S  ++ +   +   +    +N  G   S  V    AR   
Sbjct: 7056 EHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKAR--- 7112

Query: 1030 TGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIR 1089
                           ++ P F   L D     G+  A  C + G    +V W K+ + ++
Sbjct: 7113 ---------------KLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLK 7157

Query: 1090 EDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKL 1135
            +D     +    V TL I +      G Y C A N LG A +  KL
Sbjct: 7158 DDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKL 7203



 Score =  134 bits (338), Expect = 4e-31
 Identities = 118/428 (27%), Positives = 186/428 (43%), Gaps = 39/428 (9%)

Query: 430   AELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKW----YKNGVEV-RPSKRI 484
             +E +V  + + V +   DL VK         EV+   VT  W    Y  G E+       
Sbjct: 16705 SEALVIREPITVPERPEDLEVK---------EVTKNTVTLTWNPPKYDGGSEIINYVLES 16755

Query: 485   TISHVGRFHKLVIDD-------VRPEDEGD-YTFVPDGYALSLSAKLNFLEIKVEYVPKQ 536
              +    +FHK+  D+       V+   EGD Y +      +    K +F    +    + 
Sbjct: 16756 RLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDEL 16815

Query: 537   EPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEK 596
              PP +HLD   K     + +  G    L    +G+P P  +W K DE     + RT I+ 
Sbjct: 16816 APPTLHLDFRDK-----LTIRVGEAFALTGRYSGKPKPKVSWFK-DEADVLEDDRTHIKT 16869

Query: 597   RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEA-VRITSVGEDWA 655
                  +     A+R D G+Y + V N  G       + VVD P PP   V    V +D+ 
Sbjct: 16870 TPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYM 16929

Query: 656   ILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFA 715
             ++ W+PP+ DGG  +T Y++E+K+ G   WM +      +TT + +K++EG  Y  R+ A
Sbjct: 16930 VISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVT-SASAKTTCKVSKLLEGKDYIFRIHA 16988

Query: 716   VNAIGVSQP----SMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGY 771
              N  G+S P    SM  K    +     P   IV +VT  +  + W  P+  G   I  Y
Sbjct: 16989 ENLYGISDPLVSDSMKAKDRFRV--PDAPDQPIVTEVTKDSALVTWNKPHD-GGKPITNY 17045

Query: 772   LVEYCLEGSEEWVPANTEPVE-RCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVT 830
             ++E     S+ W     +P+     F V +L  G +  FRV   N  G  +P+  ++PV 
Sbjct: 17046 ILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVF 17105

Query: 831   IRE-IAEP 837
              ++ IA+P
Sbjct: 17106 AKDPIAKP 17113



 Score =  134 bits (336), Expect = 6e-31
 Identities = 205/931 (22%), Positives = 351/931 (37%), Gaps = 127/931 (13%)

Query: 249  KVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISD-PDLTLKWFKNGQEIKPSSKYVFENV 307
            +++VK+   F ++L P  +V + + ++L  E++  P   + W KN +EI+ S KY   + 
Sbjct: 4948 ELKVKEPPTFIRELKPV-EVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDR 5006

Query: 308  GKKRILTINKCTLADDAAYEVAVKDE----KCFTELFVKEPPVLIVTPLEDQQVFVGDRV 363
                 L I KC  +D   Y+  V +E     C T + +KEPP  I        V      
Sbjct: 5007 VSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKIENTTTVLKSSAT 5066

Query: 364  EMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRY--QV 421
              +         + W+KD   L  +D+    +    D    + I S V     GRY  Q 
Sbjct: 5067 FQSTVAGSPPISITWLKDDQILDEDDNVYISF---VDSVATLQIRS-VDNGHSGRYTCQA 5122

Query: 422  ITNGG--QCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDE-KVTGKWYKNGVEV 478
                G  +C A L+V+E   ++++    + V   +    +C V+   ++  KW K+G ++
Sbjct: 5123 KNESGVERCYAFLLVQEPA-QIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQI 5181

Query: 479  RPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEP 538
             PS+  ++S         I  V  +D G YTF  +    S S    +L +  + +P    
Sbjct: 5182 VPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDA-YLRVLDQNIPPSFT 5240

Query: 539  PKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLK-GDEVFTTTEGRTRIEKR 597
             K+            +  V G+ + ++  ++G  P  A W K G E+ T+ + R    +R
Sbjct: 5241 KKL----------TKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHER 5290

Query: 598  VDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPD----PPEAVRI-TSVGE 652
                S  + + + ED   YT KV+N  G+D  S  L V + P     P     I  S  E
Sbjct: 5291 --SVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLVKPGRQQAIPDSTVE 5348

Query: 653  DWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMR 712
              AIL   PP                     +W K + E+ +    +    +EG    + 
Sbjct: 5349 FKAILKGTPPF------------------KIKWFKDDVELVSGP--KCFIGLEGSTSFLN 5388

Query: 713  VFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYL 772
            +++V+A    Q + +      +   S    L+   VT+    +K    ++I   G D   
Sbjct: 5389 LYSVDASKTGQYTCHVT--NDVGSDSCTTMLL---VTEPPKFVKKLEASKIVKAG-DSSR 5442

Query: 773  VEYCLEGSEE----WVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAG-----RSEPA 823
            +E  + GS E    W     E      + +  + + A I    +    +G        PA
Sbjct: 5443 LECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPA 5502

Query: 824  TLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDT 883
                  T   + EPP       + +T       +++L     G P  +VVW K    L +
Sbjct: 5503 GSTSCSTKVIVKEPPVFSSFPPIVETL---KNAEVSLECELSGTPPFEVVWYKDKRQLRS 5559

Query: 884  SRVH-VRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEK---------- 932
            S+ + + + +F T   +     SD GEY    Q E   DT    +++ E           
Sbjct: 5560 SKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLNSL 5619

Query: 933  ---AGPPINVMVKEVWGTNALVEWQAPKDD---GNSEIMGYFVQKADKKTMEWFNVYERN 986
               AG P  +           V+W   K++    +  I   FV+     T+++      N
Sbjct: 5620 TVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENV--ATLQFAKAEPAN 5677

Query: 987  RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRM 1046
                          +Y        IC + +  G+ +N A ++      +P    E    M
Sbjct: 5678 ------------AGKY--------ICQIKNDGGMRENMATLM----VLEPAVIVEKAGPM 5713

Query: 1047 APKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLN 1106
                        V  G +  L C V G P+  V W K+   +    K   + Y  + +L 
Sbjct: 5714 -----------TVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLR 5762

Query: 1107 IRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
            I      DAGTYT +  N +G++     ++V
Sbjct: 5763 ILSVERQDAGTYTFQVQNNVGKSSCTAVVDV 5793



 Score =  133 bits (335), Expect = 8e-31
 Identities = 218/947 (23%), Positives = 367/947 (38%), Gaps = 154/947 (16%)

Query: 250  VEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISD-PDLTLKWFKNGQEIKPSSKYVFENVG 308
            ++VK+   F KK  P   + +G  + L  E+   P   + W+K+ +E++   KY   +  
Sbjct: 7393 LKVKEPPIFRKKPHPIETL-KGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSEN 7451

Query: 309  KKRILTINKCTLADDAAYEVA----VKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVE 364
                + I     AD   Y+      V  + C   + +K PP   V  L D    VG  V+
Sbjct: 7452 FLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPP-RFVKKLSDISTVVGKEVQ 7510

Query: 365  MAVEVSEEGAQ---VMWMKDGVELTRE-DSFKARYRFKKDGKRHILIFSDVVQEDRGRY- 419
            +   +  EGA+   V+W KD  E+ RE D+    Y          L FS V   + G+Y 
Sbjct: 7511 LQTTI--EGAEPISVVWFKDKGEIVRESDNIWISY----SENIATLQFSRVEPANAGKYT 7564

Query: 420  -QVITNGG--QCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDE-KVTGKWYKNG 475
             Q+  + G  +C A L V E    +++    + V   +    +C V+   +++ KW+K+G
Sbjct: 7565 CQIKNDAGMQECFATLSVLEPAT-IVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDG 7623

Query: 476  VEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPK 535
             E+    +  IS   +   L I +V P D G Y+F         S   + L++    VP 
Sbjct: 7624 KELTSDNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTAS-LQVSDRTVPP 7682

Query: 536  QEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWL-KGDEVFTTTEGRTRI 594
                K+  + +G         ++G+ + ++  + G PP   +W  +G+E+ +  + +T +
Sbjct: 7683 SFTRKLK-ETNG---------LSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTL 7732

Query: 595  EKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQV------VDVPDPPEAVRIT 648
                   +  +   +  D G YT   TN  G D  S  L V      V  PDP +   +T
Sbjct: 7733 TDNT--CALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPDPMDV--LT 7788

Query: 649  SVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGIL 708
                 +  +V   P +                 S  W K + E+        +  +E  +
Sbjct: 7789 GTNVTFTSIVKGTPPF-----------------SVSWFKGSSELVPGDRCNVS--LEDSV 7829

Query: 709  YEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDV--TDTTTTLKWRPPNRIGAG 766
             E+ +F V+                 + + E   ++  +      TT L  + P +    
Sbjct: 7830 AELELFDVDT----------------SQSGEYTCIVSNEAGKASCTTHLYIKAPAKF-VK 7872

Query: 767  GIDGYLVE----YCLEGSEEWVPA----------NTEPVERCGFTVKNLPTGARILFRVV 812
             ++ Y +E      LEG+    P           N  P +RC  T         I    V
Sbjct: 7873 RLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTV 7932

Query: 813  G---------VNIAGRSEPAT----LAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLN 859
                       N +G+   +     L  P  ++++ EP K+             VG+  +
Sbjct: 7933 EDAGQYNCYIENASGKDSCSAQILILEPPYFVKQL-EPVKV------------SVGDSAS 7979

Query: 860  LVVPFQGKPRPQVVWTKGGA---PLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQI 916
            L     G P   V W KG     P  T ++H R +    VF   Q   +DSGEY    + 
Sbjct: 7980 LQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVF--NQVDINDSGEYICKAEN 8037

Query: 917  ENMKDTATIRIRVVEKAGPP-INVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKK 975
               + +A+  + V E+  PP  +  +++V  T  L         G SE +     K  K 
Sbjct: 8038 SVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISG-SEPISVSWYKDGKP 8096

Query: 976  TMEWFNVYERNRHTSCTVS----DLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTG 1031
              +  NV       + T++    D  +  +Y         C  ++  G + ++AR++ T 
Sbjct: 8097 LKDSPNVQTSFLDNTATLNIFKTDRSLAGQYS--------CTATNPIGSASSSARLILTE 8148

Query: 1032 ITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIRED 1091
                PF     D R+AP      +D VV  G SA   C V G    KV W K+  EIR  
Sbjct: 8149 GKNPPF----FDIRLAP------VDAVV--GESADFECHVTGTQPIKVSWAKDSREIRSG 8196

Query: 1092 PKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVR 1138
             K+ I+  +    L + +    D+G YTC AVNE+G+     +L ++
Sbjct: 8197 GKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIK 8243



 Score =  130 bits (328), Expect = 5e-30
 Identities = 235/1144 (20%), Positives = 415/1144 (36%), Gaps = 170/1144 (14%)

Query: 54   FLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFSFKESHNSA 113
            F KK   +    G    +  KV+G  LP   + +WFK          G   S    +   
Sbjct: 5239 FTKKLTKMDKVLGSSIHMECKVSGS-LPI--SAQWFK---------DGKEISTSAKYRLV 5286

Query: 114  SNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLESFKRTSE 173
             +  +V L +  + L D   Y  +V      D+C   + V+ P             +   
Sbjct: 5287 CHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPS--------FLVKPGR 5338

Query: 174  KKSDTAGELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKK-----SEYEK 228
            +++     ++F  +LK        K K  KDD +L   P+ +  L+G+       S    
Sbjct: 5339 QQAIPDSTVEFKAILKGTPPF---KIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDAS 5395

Query: 229  IAFQYGITDLRGMLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEIS-DPDLTL 287
               QY       +        + V +   F KKL+ +  V  G+  +L  +I+  P++ +
Sbjct: 5396 KTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRV 5455

Query: 288  KWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDE----KCFTELFVKE 343
             WF+N  E+  S KY    +    ++ +N  +  D   +    ++      C T++ VKE
Sbjct: 5456 VWFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKE 5515

Query: 344  PPVLIVTPLEDQQVFVGDRVEMAVEVSEEGA---QVMWMKDGVELTREDSFKARYRFKKD 400
            PPV    P   + +      E+++E    G    +V+W KD  +L     +K   +    
Sbjct: 5516 PPVFSSFPPIVETL---KNAEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKIASKNFHT 5572

Query: 401  GKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKC 460
                + + +  + E   + Q       C   + ++E     +  +  LTV A E A  + 
Sbjct: 5573 SIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPP-RFVSKLNSLTVVAGEPAELQA 5631

Query: 461  EVSD-EKVTGKWYKNGVEV-RPSKRITISHVGRFHKLVIDDVRPEDEGDYT--FVPDGYA 516
             +   + +  +W K   EV R S+ I I+ V     L      P + G Y      DG  
Sbjct: 5632 SIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGM 5691

Query: 517  LSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVA 576
                A L  LE           P + ++ +G      + V  G    L+  + G P    
Sbjct: 5692 RENMATLMVLE-----------PAVIVEKAGP-----MTVTVGETCTLECKVAGTPELSV 5735

Query: 577  TWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVV 636
             W K  ++ T+++ + +       SS  I S +R+D G YT +V N VG+   +  + V 
Sbjct: 5736 EWYKDGKLLTSSQ-KHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVS 5794

Query: 637  DVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTET 696
            D   PP   R                   GG      ++E K  GS         +    
Sbjct: 5795 DRAVPPSFTRRLK--------------NTGGVLGASCILECKVAGSS-------PISVAW 5833

Query: 697  TYESTKMIEGILYE------MRVFAVNAIGVSQPSMNTKPFMPIAPTS------------ 738
             +E TK++ G  Y+      +    +N++  S     T     +A +             
Sbjct: 5834 FHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPP 5893

Query: 739  ------EPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVE 792
                  EPL ++       T+ ++  PP ++               G+ E V       +
Sbjct: 5894 SFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVN-----------WFRGARELVKG-----D 5937

Query: 793  RCGFTVKNLPTGARILFRVVGVNIAGR-----SEPATLAQPVTIREIAEPPKI--RLPRH 845
            RC    ++  T A +    + ++ +G      S  A  A   T   + EP     RL  H
Sbjct: 5938 RCNIYFED--TVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDH 5995

Query: 846  LRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTS-RVHVRTSDFDTVFFVRQAAR 904
              +      G+ + L   + G     V W K G  + TS + ++ T++   +  +  + +
Sbjct: 5996 SVEP-----GKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTK 6050

Query: 905  SDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEI 964
             D+G+Y   ++ E  +D     +  +E   PP    V E+    A V        G+S  
Sbjct: 6051 RDAGQYSCEIENEAGRDVCGALVSTLE---PP--YFVTELEPLEAAV--------GDSVS 6097

Query: 965  MGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENIC-------GLSDS 1017
            +   V    + T+ W+    + R T             Y   +T N+         ++DS
Sbjct: 6098 LQCQVAGTPEITVSWYKGDTKLRPT-----------PEYRTYFTNNVATLVFNKVNINDS 6146

Query: 1018 PGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKP 1077
               +      + T  +   F  +E   ++ P F   L D     G    L C + G    
Sbjct: 6147 GEYTCKAENSIGTASSKTVFRIQER--QLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPI 6204

Query: 1078 KVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
            +V W ++ + +R+D     +    V TL I +     +G Y+C A N LG A +  +L  
Sbjct: 6205 QVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTA 6264

Query: 1138 RVPQ 1141
            R P+
Sbjct: 6265 REPK 6268



 Score =  130 bits (326), Expect = 9e-30
 Identities = 119/457 (26%), Positives = 183/457 (40%), Gaps = 38/457 (8%)

Query: 470   KWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIK 529
             KW K G ++  SKR  I+      +LVI +    D G Y  V +        K  +++++
Sbjct: 30169 KWTKEGQDI--SKRAMIATSETHTELVIKEADRGDSGTYDLVLEN---KCGKKAVYIKVR 30223

Query: 530   VEYVPKQEPPKIHLDC----SGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVF 585
             V   P      +  D     S + S        G  + L   +     P A W       
Sbjct: 30224 VIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADI-LGYILERREVPKAAWYT----- 30277

Query: 586   TTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTN------PVGEDVASIFLQVVDVP 639
                     I+ RV  +S V++  +   E  + +   N      P+  +        ++ P
Sbjct: 30278 --------IDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPP 30329

Query: 640   DPPE-AVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTY 698
             +PP     +  V +    L W  P  DGG  VTGY +ERK+  + +W++ N    T T Y
Sbjct: 30330 EPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMY 30389

Query: 699   ESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTL 755
               T ++    Y+ R+ A N +G+S+ S  ++P +   P    S+P  L +  ++  + TL
Sbjct: 30390 TVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTL 30449

Query: 756   KWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVN 815
             +W  P   G   I GY VEY   G   W  +N E ++   FT+  L       FRV   N
Sbjct: 30450 QWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAEN 30509

Query: 816   IAGRSEPATLAQPV-TIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVW 874
               G S P   A  + T     E P IR      +    K+GE   L     G+P P + W
Sbjct: 30510 ETGLSRPRRTAMSIKTKLTSGEAPGIRKE---MKDVTTKLGEAAQLSCQIVGRPLPDIKW 30566

Query: 875   TKGGAPLDTSRVHVRTSDFDT-VFFVRQAARSDSGEY 910
              + G  L  SR +  +SD  T    V    + D G Y
Sbjct: 30567 YRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVY 30603



 Score =  129 bits (324), Expect = 2e-29
 Identities = 234/1084 (21%), Positives = 390/1084 (35%), Gaps = 139/1084 (12%)

Query: 85   TIKWFKGKWLELGSKSGARFSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAKDTC 144
            +I+WFK    E+ +    +FSF ++        T  L I ++   D G Y      K   
Sbjct: 4705 SIQWFKDDQ-EISASEKYKFSFHDN--------TAFLEISQLEGTDSGTYTCSATNKAGH 4755

Query: 145  DSCGFNIDVEAPR---QDASGQSLESFKRTSEKKS-DTAGELDFSGLLKKREVVEEEKKK 200
            + C  ++ V+ P    +    Q +    R   K        +        +E+     + 
Sbjct: 4756 NQCSGHLTVKEPPYFVEKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARS 4815

Query: 201  KKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGITDLRGMLKRLKKAKVEVKKSAAFTK 260
              KDD    +       L  AK ++      Q        +     KA + VK+   F K
Sbjct: 4816 VWKDDTSTSLE------LFAAKATDSGTYICQLS----NDVGTATSKATLFVKEPPQFIK 4865

Query: 261  KLDPAYQVDRGNKIKLMVEISD-PDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCT 319
            K  P   +  G       +I+  P + + W+ +G EI    K+    +       I+   
Sbjct: 4866 KPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGAR 4925

Query: 320  LADDAAYEVAVKDE----KCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGA- 374
            + +   Y    +++     C  EL VKEPP  I   L+  +V     VE+  EV+     
Sbjct: 4926 VENSGTYVCEARNDAGTASCSIELKVKEPPTFI-RELKPVEVVKYSDVELECEVTGTPPF 4984

Query: 375  QVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITN--GGQCEAEL 432
            +V W+K+  E+     +    R         L  +     D G YQ I +  GG C    
Sbjct: 4985 EVTWLKNNREIRSSKKYTLTDRVSVFN----LHITKCDPSDTGEYQCIVSNEGGSCSCST 5040

Query: 433  IVEEKQL-EVLQDIADLTVKASEQAVFKCEVSDEK-VTGKWYKNGVEVRPSKRITISHVG 490
             V  K+    ++ I + T      A F+  V+    ++  W K+   +     + IS V 
Sbjct: 5041 RVALKEPPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVD 5100

Query: 491  RFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTS 550
                L I  V     G YT          +   + +E    ++  QEP +I         
Sbjct: 5101 SVATLQIRSVDNGHSGRYT--------CQAKNESGVERCYAFLLVQEPAQI------VEK 5146

Query: 551  ENAIVVVAGNKLRLDVSITGEPPPVATWLK-GDEVFTTTEGRTRIEKRVDCSSFVIESAQ 609
              ++ V   + + L+  + G P     WLK G ++  +       E  V  +SF I+S  
Sbjct: 5147 AKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNV--ASFRIQSVM 5204

Query: 610  REDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPE-AVRITSVGEDWAILVWEPPMYDGGK 668
            ++D G+YT KV N  G      +L+V+D   PP    ++T + +     +       G  
Sbjct: 5205 KQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSL 5264

Query: 669  PVTGYLVERKKKGSQRWMKLNFEVFTETTY-----ESTKMIEGILYEMRVFAVNAIGVSQ 723
            P+           S +W K   E+ T   Y     E +  +E    E+   A     VS 
Sbjct: 5265 PI-----------SAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSN 5313

Query: 724  PSMNTKPFMPIAPTSEPLHLIV-----EDVTDTT----TTLKWRPPNRIGAGGIDGYLVE 774
             +        I    EP   +V     + + D+T      LK  PP +I     D  LV 
Sbjct: 5314 VA-GDDACSGILTVKEPPSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVS 5372

Query: 775  -----YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPV 829
                   LEGS  ++   +    + G    ++             N  G S+  T     
Sbjct: 5373 GPKCFIGLEGSTSFLNLYSVDASKTGQYTCHV------------TNDVG-SDSCT----- 5414

Query: 830  TIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTS-RVHV 888
            T+  + EPPK    + L  + I K G+   L     G P  +VVW +    L  S +  +
Sbjct: 5415 TMLLVTEPPK--FVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRM 5472

Query: 889  RTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVE----KAGPPINVMVKEV 944
               D   V  +   +  DSG++    Q      + + ++ V E     + PPI   +K  
Sbjct: 5473 TFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLK-- 5530

Query: 945  WGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYF 1004
               NA V  +          + ++  K   ++ + + +  +N HTS  + ++   +   +
Sbjct: 5531 ---NAEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEY 5587

Query: 1005 RVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYS 1064
                +N  G        K                      +  P+F++ L    VVAG  
Sbjct: 5588 HCKAQNEVGSDTCVCTVK---------------------LKEPPRFVSKLNSLTVVAGEP 5626

Query: 1065 AALNCAVRGHPKPKVVWMKNKME-IREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAV 1123
            A L  ++ G     V W+K K E IRE     IT  + V TL   +  P +AG Y C+  
Sbjct: 5627 AELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIK 5686

Query: 1124 NELG 1127
            N+ G
Sbjct: 5687 NDGG 5690



 Score =  126 bits (316), Expect = 1e-28
 Identities = 97/360 (26%), Positives = 157/360 (43%), Gaps = 24/360 (6%)

Query: 258   FTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINK 317
             FT KL     V++ +++ L  EIS  D  +KWFK+G+EIKPS   V +  GKKR+L + K
Sbjct: 12020 FTGKLQDYTGVEK-DEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKK 12078

Query: 318   CTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVM 377
                +D   Y      +K   +L +++  + +V PL   +V   +      E+SE+     
Sbjct: 12079 ALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLHSVEVMETETARFETEISEDDIHAN 12138

Query: 378   WMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEK 437
             W   G  L +    +     K++GK H L+  +   +  G         +  A L V+ +
Sbjct: 12139 WKLKGEALLQTPDCE----IKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPR 12194

Query: 438   QLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVI 497
              + +L+ + D+TV A E A F CE+S E +  +WY  G ++ PS ++     G+ H L +
Sbjct: 12195 VIGLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTL 12254

Query: 498   DDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVV 557
              DV+ ED G+       +     A L   E  VE+    E   +         E A  V 
Sbjct: 12255 RDVKLEDAGEVQLTAKDF--KTHANLFVKEPPVEFTKPLEDQTV--------EEGATAV- 12303

Query: 558   AGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYT 617
                   L+  ++ E   V  +  G E+  + +     + RV     VI     ED   YT
Sbjct: 12304 ------LECEVSRENAKVKWFKNGTEILKSKKYEIVADGRV--RKLVIHDCTPEDIKTYT 12355



 Score =  126 bits (316), Expect = 1e-28
 Identities = 95/335 (28%), Positives = 146/335 (43%), Gaps = 33/335 (9%)

Query: 526   LEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVF 585
             L + V     + PP I L  S +   + I V AG  + +   +TG P P   W K + V 
Sbjct: 15382 LPLNVVIQDDEVPPTIKLRLSVRG--DTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVI 15439

Query: 586   T--------TTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVD 637
                      T E  +R E + + S   I  A RED+G YT+  +N +G    ++ ++V D
Sbjct: 15440 EKPTDALQITKEEVSRSEAKTELS---IPKAVREDKGTYTVTASNRLGSVFRNVHVEVYD 15496

Query: 638   VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETT 697
              P PP  + +T +  +   L W+ P+ +GG  +T Y+++++    +   K  +E  T T 
Sbjct: 15497 RPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRK---KAEWEEVTNTA 15553

Query: 698   YEST----KMIEGILYEMRVFAVNAIGVSQPSMNTK-----PFMPIAPTSEPLHLIVEDV 748
              E      K+I    YE RV AVN  G+S    + K     P+    P  +P  L     
Sbjct: 15554 VEKRYGIWKLIPNGQYEFRVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLA---R 15610

Query: 749   TDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCG-----FTVKNLPT 803
             T  +  + W PP   G   I GY +E   EGS  W   +  P+ + G     F V  L  
Sbjct: 15611 TKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLE 15670

Query: 804   GARILFRVVGVNIAGRSEPATLAQPVTIREIAEPP 838
             G +  FR + +N AG   P+  + P    +   PP
Sbjct: 15671 GVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPP 15705



 Score =  124 bits (310), Expect = 7e-28
 Identities = 245/1141 (21%), Positives = 401/1141 (35%), Gaps = 147/1141 (12%)

Query: 54   FLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFSFKESHNSA 113
            F+KK   +S   GK+  +   + G E     ++ WFK K   +        S+ E     
Sbjct: 7494 FVKKLSDISTVVGKEVQLQTTIEGAE---PISVVWFKDKGEIVRESDNIWISYSE----- 7545

Query: 114  SNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLESFKRTSE 173
             N+ T  L   +V   + G Y  ++K       C   + V  P      +  ES K T+ 
Sbjct: 7546 -NIAT--LQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIV--EKPESIKVTTG 7600

Query: 174  K----KSDTAG--ELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYE 227
                 +   AG  EL        +E+  + K K    +   G        LK    +  +
Sbjct: 7601 DTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVSG--------LKIINVAPSD 7652

Query: 228  KIAFQYGITDLRGMLKRLKKAKVEVKKSA---AFTKKLDPAYQVDRGNKIKLMVEISDPD 284
               + + + +  G  K    A ++V       +FT+KL     +   + +        P 
Sbjct: 7653 SGVYSFEVQNPVG--KDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPP 7710

Query: 285  LTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKD----EKCFTELF 340
            +++ WF  G EI    KY          LT+N    +D   Y     +    ++C   L 
Sbjct: 7711 ISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLT 7770

Query: 341  VKEPPVLIVTPLEDQQVFVGDRVEM-AVEVSEEGAQVMWMKDGVELTREDSFKARYRFKK 399
            V+EPP  +  P +   V  G  V   ++        V W K   EL   D         +
Sbjct: 7771 VREPPSFVQKP-DPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSL---E 7826

Query: 400  DGKRHILIFSDVVQEDRGRYQVITNG----GQCEAELIVEEKQLEVLQDIADLTVKASEQ 455
            D    + +F DV     G Y  I +       C   L ++    + ++ + D +++  + 
Sbjct: 7827 DSVAELELF-DVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPA-KFVKRLNDYSIEKGKP 7884

Query: 456  AVFKCEVSDEK-VTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDG 514
             + +   +    ++  W KNG+ V PS+R  I+   +   L I     ED G Y    + 
Sbjct: 7885 LILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIEN 7944

Query: 515  YALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPP 574
             +   S     L ++  Y  KQ  P              + V  G+   L   + G P  
Sbjct: 7945 ASGKDSCSAQILILEPPYFVKQLEP--------------VKVSVGDSASLQCQLAGTPEI 7990

Query: 575  VATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQ 634
              +W KGD     T    ++  R + ++ V       D G Y  K  N VGE  AS FL 
Sbjct: 7991 GVSWYKGDTKLRPTT-TYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLT 8049

Query: 635  VVDVPDPPEAVR-ITSVGEDWAILVWEPPMYDGGKPVT-GYLVERKKKGSQRWMKLNFEV 692
            V +   PP   R +  V E   + V       G +P++  +  + K       ++ +F  
Sbjct: 8050 VQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLD 8109

Query: 693  FTETT--YESTKMIEGILYEMRVFAVNAIGVSQPSMN-------TKPFMPIAPTSEPLHL 743
             T T   +++ + + G   +    A N IG +  S           PF  I     P+  
Sbjct: 8110 NTATLNIFKTDRSLAG---QYSCTATNPIGSASSSARLILTEGKNPPFFDIRLA--PVDA 8164

Query: 744  IVEDVTD----TTTT----LKWRPPNR-IGAGGIDGYLVEYCLEGSEEWVPANTEPVERC 794
            +V +  D     T T    + W   +R I +GG   Y + Y LE S              
Sbjct: 8165 VVGESADFECHVTGTQPIKVSWAKDSREIRSGG--KYQISY-LENSAH------------ 8209

Query: 795  GFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKV 854
              TV  +  G    +    VN  G+    +    + I+E   PP     + L +T     
Sbjct: 8210 -LTVLKVDKGDSGQYTCYAVNEVGKD---SCTAQLNIKERLIPPSFT--KRLSETVEETE 8263

Query: 855  GEQLNLVVPFQGKPRPQVVWTKGGAPLD-TSRVHVRTSDFDTVFFVRQAARSDSGEYELS 913
            G    L     G     V W K    +  TS   +   +   V  VR+A  +D+G Y   
Sbjct: 8264 GNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCK 8323

Query: 914  VQIENMKDTATIRIRVVEKAGPPI------NVMVKE---------VWGTNAL-VEWQAPK 957
            V  +      T  I + E   PP+       V V E         V G+  + ++W    
Sbjct: 8324 VSNDAGSALCTSSIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAG 8383

Query: 958  DDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDS 1017
             +        F   +    +E  +V + +       +  + G++      T++   + D 
Sbjct: 8384 REIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDT-----TKSKVTIKDK 8438

Query: 1018 PGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKP 1077
            P V+  T +    G  F         F   P+ +       VV   +A     V G P P
Sbjct: 8439 PAVAPATKKAAVDGRLF---------FVSEPQSIR------VVEKTTATFIAKVGGDPIP 8483

Query: 1078 KVVWMKNKM-EIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLE 1136
             V W K K  ++ +  +  I        L IR  +  D+G Y C A NE GE  +   L+
Sbjct: 8484 NVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQ 8543

Query: 1137 V 1137
            V
Sbjct: 8544 V 8544



 Score =  124 bits (310), Expect = 7e-28
 Identities = 96/374 (25%), Positives = 160/374 (42%), Gaps = 24/374 (6%)

Query: 267   QVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
             QV      +   E+S  +  +KWFK+G EIK   KY   + G  RIL INKC L D+A Y
Sbjct: 12384 QVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEY 12443

Query: 327   EVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELT 386
                V+  +    L V E   +    L + +V   D +++  EVS+ GA+V+W K   E+ 
Sbjct: 12444 SCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEII 12503

Query: 387   REDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIA 446
                    RY    +G++ IL+  +   ED G Y       + + ++ V E   E +    
Sbjct: 12504 E----TGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQ 12559

Query: 447   DLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG 506
             +L +   E+A F C +S E    +W ++   +    +  +   G+   LV+ D   +D G
Sbjct: 12560 NLEILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMG 12619

Query: 507   DYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDV 566
              Y  +    A   +A L  +E     VP ++          +  E   VV        +V
Sbjct: 12620 TYVVMVG--AARAAAHLTVIEKLRIVVPLKDT---------RVKEQQEVV-----FNCEV 12663

Query: 567   SITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGE 626
             +  G     A W + +E    +     ++K +   +  I  A  +D+  Y + +TN  GE
Sbjct: 12664 NTEGAK---AKWFRNEEAIFDSSKYIILQKDL-VYTLRIRDAHLDDQANYNVSLTNHRGE 12719

Query: 627   DVASIFLQVVDVPD 640
             +V S    +V+  D
Sbjct: 12720 NVKSAANLIVEEED 12733



 Score =  123 bits (309), Expect = 9e-28
 Identities = 99/374 (26%), Positives = 159/374 (42%), Gaps = 25/374 (6%)

Query: 250  VEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGK 309
            V+ K+   FT++L      ++        E S+P + +KW+K+G E+    KY   +  K
Sbjct: 2168 VQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRK 2227

Query: 310  KRILTINKCTLADDAAYE-VAVKDE--KCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMA 366
               L+I     +D   Y  V V+DE  K   +L V+   V  V  L+D +V      E+ 
Sbjct: 2228 VHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELE 2287

Query: 367  VEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGG 426
              VS E  +  W  + VEL        +Y       R  L   DV +ED+G Y  + +G 
Sbjct: 2288 CIVSPENIEGKWYHNDVELKSN----GKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGK 2343

Query: 427  QCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITI 486
            +   +L ++ + + +LQ ++D  V   +    + +VS E V G W K+G EV+PS R+ I
Sbjct: 2344 KTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHI 2403

Query: 487  SHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCS 546
                + H L+I+D+  ED G+Y+F      LS S +++   + V                
Sbjct: 2404 VIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDV---------------- 2447

Query: 547  GKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIE 606
              T    + V+ G K  L+  ++        W   DE     +    I K       VI 
Sbjct: 2448 -ITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTK-QRLVIN 2505

Query: 607  SAQREDEGRYTIKV 620
                 DEG Y + V
Sbjct: 2506 RTHASDEGPYKLIV 2519



 Score =  121 bits (303), Expect = 4e-27
 Identities = 99/330 (30%), Positives = 138/330 (41%), Gaps = 46/330 (13%)

Query: 553   AIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTR------------------- 593
             ++ V  G+++ LD SI+G P P  TW+K + V    E + R                   
Sbjct: 14688 SLEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFV 14747

Query: 594   --IEKRVDC-------SSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPP-- 642
               + +R+         S   +  + R D G Y IKV N  G   A   + V+D P PP  
Sbjct: 14748 LPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPIN 14807

Query: 643   ---EAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVER--KKKGSQRWMKLNFEVFTETT 697
                E +R TSV     +  WEPP+ DGG  +  Y +E+  K K    W+ +         
Sbjct: 14808 FVFEDIRKTSV-----LCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVT-STLRHCK 14861

Query: 698   YESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTT 754
             Y  TK+IEG  Y  RV A N  G   P + +KP +   P  P   P   IVEDVT  +  
Sbjct: 14862 YSVTKLIEGKEYLFRVRAENRFGPGPPCV-SKPLVAKDPFGPPDAPDKPIVEDVTSNSML 14920

Query: 755   LKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGV 814
             +KW  P   G+  I GY +E     S  W   N   +      V  L  G   +FRV   
Sbjct: 14921 VKWNEPKDNGS-PILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAE 14979

Query: 815   NIAGRSEPATLAQPVTIREIAEPPKIRLPR 844
             N AG  + +  + P T  +   PP   +PR
Sbjct: 14980 NAAGPGKFSPPSDPKTAHDPISPPGPPIPR 15009



 Score =  120 bits (302), Expect = 6e-27
 Identities = 88/295 (29%), Positives = 136/295 (46%), Gaps = 15/295 (5%)

Query: 558   AGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYT 617
             AG  ++L   I+G+P P   W K D+   T      +E   D +S +I+ A R + G Y 
Sbjct: 26886 AGTSVKLRAGISGKPAPTIEWYKDDKELQTN-ALVCVENTTDLASILIKDADRLNSGCYE 26944

Query: 618   IKVTNPVGEDVASIFLQVVDVPDPPEA-VRITSVGEDWAILVWEPPMYDGGKPVTGYLVE 676
             +K+ N +G   A+I +Q++D P PP   +   +V  +   L+W PP  DGG  +T Y+VE
Sbjct: 26945 LKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVE 27004

Query: 677   RKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQP-----SMNTKPF 731
             +++     W  ++ E   E    +TK+I+G  Y  RV AVN  G+ +P      +    F
Sbjct: 27005 KRETSRVVWSMVS-EHLEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAF 27063

Query: 732   MPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPV 791
             +   P   P    V  +T  + T+ W  P   G   I GY +E   + S  W     E +
Sbjct: 27064 VTPGPPGIP---EVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETI 27120

Query: 792   ERCGFTVKNLPTGARILFRVVGVNIAGR---SEPATLAQPVTIREIAEPP-KIRL 842
                   V  L   +   +RV  VN AG+   SEP+   +     +   PP KIR+
Sbjct: 27121 RDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRI 27175



 Score =  120 bits (300), Expect = 1e-26
 Identities = 87/326 (26%), Positives = 140/326 (42%), Gaps = 29/326 (8%)

Query: 523   LNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGD 582
             L+ +  K  +VP   P ++ +  +G+    A    AG+KLR    +T             
Sbjct: 29740 LSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVT------------- 29786

Query: 583   EVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPP 642
                        +E     +   I      D G YT+++ N  G    +I + ++D P PP
Sbjct: 29787 -----------VETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPP 29835

Query: 643   EA-VRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYEST 701
                ++I  +      + WEPP  DGG P++GY+VE++      W+ ++ E  T +T++ T
Sbjct: 29836 TGPIKIDEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVS-ESVTRSTFKFT 29894

Query: 702   KMIEGILYEMRVFAVNAIGVSQ--PSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRP 759
             ++ EG  Y  RV A N  G+     S   +    I     P  L + DV+    TL W P
Sbjct: 29895 RLTEGNEYVFRVAATNRFGIGSYLQSEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYP 29954

Query: 760   PNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGR 819
             P   G   + GY+VE     ++ WV  N  PV    +    L  G     RV  +N  G 
Sbjct: 29955 PEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGS 30014

Query: 820   SEPATLAQPVTIRE-IAEPPKIRLPR 844
              +P+  ++P+   + IA P K + PR
Sbjct: 30015 GKPSRPSKPIVAMDPIAPPGKPQNPR 30040



 Score =  119 bits (298), Expect = 2e-26
 Identities = 167/744 (22%), Positives = 290/744 (38%), Gaps = 123/744 (16%)

Query: 252  VKKSAAFTKKLDPAYQVDRGNKIKLMVEISD-PDLTLKWFKNGQEIKPSSKYVFENVGKK 310
            +K  A F K+L+  Y +++G  + L    +  P +++ W KNG  + PS +       K 
Sbjct: 7864 IKAPAKFVKRLND-YSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKS 7922

Query: 311  RILTINKCTLADDAAYEVAVKD----EKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMA 366
             IL I   T+ D   Y   +++    + C  ++ + EPP   V  LE  +V VGD   + 
Sbjct: 7923 AILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYF-VKQLEPVKVSVGDSASLQ 7981

Query: 367  VEVS---EEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRY--QV 421
             +++   E G  V W K   +L    ++K  +R         L+F+ V   D G Y  + 
Sbjct: 7982 CQLAGTPEIG--VSWYKGDTKLRPTTTYKMHFR----NNVATLVFNQVDINDSGEYICKA 8035

Query: 422  ITNGGQCEAE--LIVEEKQL--EVLQDIADLTVKASEQAVFKCEVS-DEKVTGKWYKNGV 476
              + G+  A   L V+E++L     + + D+        VF C +S  E ++  WYK+G 
Sbjct: 8036 ENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGK 8095

Query: 477  EVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFV---PDGYALSLSAKLNFLEIKVEYV 533
             ++ S  +  S +     L I        G Y+     P G A S SA+L   E K    
Sbjct: 8096 PLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASS-SARLILTEGK---- 8150

Query: 534  PKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTR 593
                PP   +  +       +  V G     +  +TG  P   +W K D     + G+ +
Sbjct: 8151 ---NPPFFDIRLA------PVDAVVGESADFECHVTGTQPIKVSWAK-DSREIRSGGKYQ 8200

Query: 594  IEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPE-AVRITSVGE 652
            I    + +   +    + D G+YT    N VG+D  +  L + +   PP    R++   E
Sbjct: 8201 ISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKRLSETVE 8260

Query: 653  DWAILVWEPPMYDGGKPVTGYLVERKKKGSQ----RWMKLNFEVFTETTYESTKMIEGIL 708
            +                   + +E +  GSQ     W K N E+   +  E T     ++
Sbjct: 8261 E--------------TEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLV 8306

Query: 709  YEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGI 768
             ++R   +N  G+    ++      +  +S    +++++        +   P  +  G  
Sbjct: 8307 LQVRKAGMNDAGLYTCKVSNDAGSALCTSS----IVIKEPKKPPVFDQHLTPVTVSEG-- 8360

Query: 769  DGYLVEYC-LEGSE----EWVPANTE--PVERCGFTVKNLPTGARIL------------F 809
              Y+   C ++GSE    +W+ A  E  P +RC F   +  +G  +L            +
Sbjct: 8361 -EYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSF---SFASGTAVLELRDVAKADSGDY 8416

Query: 810  RVVGVNIAGRSEPATLAQPVTIRE-------------------IAEPPKIRLPRHLRQTY 850
                 N+AG     T    VTI++                   ++EP  IR+      T+
Sbjct: 8417 VCKASNVAGSD---TTKSKVTIKDKPAVAPATKKAAVDGRLFFVSEPQSIRVVEKTTATF 8473

Query: 851  IRKVGEQLNLVVPFQGKPRPQVVWTKG--GAPLDTSRVHVRTSDFDTVFFVRQAARSDSG 908
            I KVG          G P P V WTKG         RV +     +    +R   ++DSG
Sbjct: 8474 IAKVG----------GDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSG 8523

Query: 909  EYELSVQIENMKDTATIRIRVVEK 932
             Y      E+ +  + + ++V E+
Sbjct: 8524 LYRCVAFNEHGEIESNVNLQVDER 8547



 Score =  117 bits (294), Expect = 5e-26
 Identities = 129/529 (24%), Positives = 197/529 (37%), Gaps = 82/529 (15%)

Query: 636   VDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTE 695
             V +P PP   +I   G+    + W  P++DGG P+TGY VE KK     W K + +    
Sbjct: 26081 VFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDW-KTSIQSLRG 26139

Query: 696   TTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLH---------LIVE 746
             T Y  + +  G  Y  RV +VN +G S PS ++ P +      EPL          LIV+
Sbjct: 26140 TEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVK 26199

Query: 747   DVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGAR 806
                  T T+ +R           G  V   L     W   +T+   R      +  T   
Sbjct: 26200 AGASFTMTVPFR-----------GRPVPNVL-----WSKPDTDLRTRAYVDTTDSRTSLT 26243

Query: 807   ILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQG 866
             I         A R++       +TI+ +     + L   +  T     G   N+ V    
Sbjct: 26244 I-------ENANRNDSGKYT--LTIQNVLSAASLTLVVKVLDT----PGPPTNITVQDVT 26290

Query: 867   KPRPQVVW----TKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDT 922
             K    + W      GGAP+    +  R +       V            LS ++ N+++ 
Sbjct: 26291 KESAVLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCN------RLSYKVTNLQEG 26344

Query: 923   ATIRIRV--------------------VEKAGPPINVMVKEVWGTNALVEWQAPKDDGNS 962
             A    RV                     EK  PP  + V  +   +  + W  P+ DG S
Sbjct: 26345 AIYYFRVSGENEFGVGIPAETKEGVKITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGS 26404

Query: 963   EIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSK 1022
              I+ Y V+  +K    W       + T   VS L   +EY+FRV+ EN  GLSD      
Sbjct: 26405 RIVHYVVEALEKGQKNWVKCAVA-KSTHHVVSGLRENSEYFFRVFAENQAGLSDP----- 26458

Query: 1023  NTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWM 1082
                 +L   +  +  E  E D +  P          V AG +  ++  + G P PKV   
Sbjct: 26459 --RELLLPVLIKEQLEPPEIDMKNFPSHTV-----YVRAGSNLKVDIPISGKPLPKVTLS 26511

Query: 1083  KNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALA 1131
             ++ + ++   +F        LT+N++     DAG Y   A N  G   A
Sbjct: 26512 RDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKA 26560



 Score =  117 bits (293), Expect = 6e-26
 Identities = 120/486 (24%), Positives = 203/486 (41%), Gaps = 48/486 (9%)

Query: 279  EISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTE 338
            E+S  ++   W KNG EI+ S K+     GK   L I   +  D A Y     +++    
Sbjct: 2904 EVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSAT 2963

Query: 339  LFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFK 398
            L V   P++I + L+D      D +   V V+ EG    W+K+GVE+   D  K + R K
Sbjct: 2964 LTVT--PIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTD--KCQMRTK 3019

Query: 399  KDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVF 458
            K    H L   +V   D   Y  +       A L VE + +E  + I D+ V   ++A+F
Sbjct: 3020 K--LTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMF 3077

Query: 459  KCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALS 518
            +CEVS+  +T +W K+  E++ + RI I      H+L+I   R  D G YT V  G   +
Sbjct: 3078 ECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVST 3137

Query: 519  LSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATW 578
                +   ++++  + K+E   I         + A+V    N+  +D          A W
Sbjct: 3138 AKLFVEGRDVRIRSI-KKEVQVIE-------KQRAVVEFEVNEDDVD----------AHW 3179

Query: 579  LK-GDEVFTTTEGRTR--IEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQV 635
             K G E+    + R +  +E+R+      I   ++ D G YT       G + +S+ L  
Sbjct: 3180 YKDGIEINFQVQERHKYVVERRI--HRMFISETRQSDAGEYTF----VAGRNRSSVTL-Y 3232

Query: 636  VDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVT-GYLVERKKKGSQRWMKLNFEVFT 694
            V+ P+PP+ ++             +P     GKP     ++  + +    W K   E   
Sbjct: 3233 VNAPEPPQVLQ-----------ELQPVTVQSGKPARFCAVISGRPQPKISWYK--EEQLL 3279

Query: 695  ETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTT 754
             T ++   + +G  Y + +        +  +   K    +A TS  L + V +V      
Sbjct: 3280 STGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQE 3339

Query: 755  LKWRPP 760
            +   PP
Sbjct: 3340 MPVYPP 3345



 Score =  117 bits (293), Expect = 6e-26
 Identities = 130/526 (24%), Positives = 205/526 (38%), Gaps = 68/526 (12%)

Query: 639   PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNF--EVFTET 696
             P  PEA+  T    D   L W+PP +DGG  + GY+VE +K G + W + N   E   ET
Sbjct: 17116 PVNPEAIDTTCNSVD---LTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPET 17172

Query: 697   TYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLK 756
              Y+ T + +G  Y+ RV AVNA G S P+   +P + +    EP  LI++        +K
Sbjct: 17173 KYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVL-VKDRLEPPELILDANMAREQHIK 17231

Query: 757   WRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFR------ 810
                  R+ A      +++        W   + +   +    V   P G+++  R      
Sbjct: 17232 VGDTLRLSA------IIKGVPFPKVTWKKEDRDAPTKARIDVT--PVGSKLEIRNAAHED 17283

Query: 811   --VVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPF---- 864
               +  + +   +   T++  V + +   PP     R L  + IRK    L    P     
Sbjct: 17284 GGIYSLTVENPAGSKTVSVKVLVLDKPGPP-----RDLEVSEIRKDSCYLTWKEPLDDGG 17338

Query: 865   --------QGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQI 916
                     + +      W+   A         +  +    +  R AA +  G       +
Sbjct: 17339 SVITNYVVERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPF---V 17395

Query: 917   ENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKT 976
             E  K    +    +   GPP ++   +V  T   + W  P  DG S I GY V+  ++ T
Sbjct: 17396 ETPKPIKALD--PLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGT 17453

Query: 977   MEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKP 1036
              +W   ++   +  C V+ L  G  Y FRV  ENI GL    G+   T           P
Sbjct: 17454 QDWIK-FKTVTNLECVVTGLQQGKTYRFRVKAENIVGL----GLPDTTI----------P 17498

Query: 1037  FEYKEHDFRMAPKFLTPLIDRVVV-AGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFL 1095
              E +E     + +    LI+ +VV AG +      +RG P P   W  +  EI+ D  + 
Sbjct: 17499 IECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYT 17558

Query: 1096  I--TNYQGVLTLN--IRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
             +   N+  VLT+   +RR    D G Y     N  G       L V
Sbjct: 17559 VETDNFSSVLTIKNCLRR----DTGEYQITVSNAAGSKTVAVHLTV 17600



 Score =  117 bits (293), Expect = 6e-26
 Identities = 82/297 (27%), Positives = 135/297 (45%), Gaps = 18/297 (6%)

Query: 552   NAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQRE 611
             + +++ +G  LR+   + G P P  TW K D V         I   +  +S  +  A R+
Sbjct: 27966 DGLIIKSGESLRIKALVQGRPVPRVTWFK-DGVEIEKRMNMEITDVLGSTSLFVRDATRD 28024

Query: 612   DEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEA-VRITSVGEDWAILVWEPPMYDGGKPV 670
               G YT++  N  G   A I ++V D P      +R T++  +   L W+ P+ DG  P+
Sbjct: 28025 HRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPI 28084

Query: 671   TGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKP 730
             T Y++E+++     W  +  +   + +Y + K+I G  Y+ RV AVN  GV +P +++ P
Sbjct: 28085 THYIIEKRETSRLAWALIEDKCEAQ-SYTAIKLINGNEYQFRVSAVNKFGVGRP-LDSDP 28142

Query: 731   F-------MPIAP-TSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEE 782
                     +P AP   EP      ++T  + TL W  P   G   I  Y++E   + S  
Sbjct: 28143 VVAQIQYTVPDAPGIPEP-----SNITGNSITLTWARPESDGGSEIQQYILERREKKSTR 28197

Query: 783   WVPA-NTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPP 838
             WV   +  P+    F V  L  G    F V+  N AG    + +++ +  RE   PP
Sbjct: 28198 WVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPP 28254



 Score =  117 bits (292), Expect = 8e-26
 Identities = 112/425 (26%), Positives = 166/425 (39%), Gaps = 46/425 (10%)

Query: 729   KPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANT 788
             KP +P  P         ++VT    TLKW PP   G   I  Y++E     + +WV    
Sbjct: 20075 KPGIPTGPIK------FDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTC-A 20127

Query: 789   EPVERCGFTVKNLPTGARILFRVVGVNIAG-----RSEPATLAQPVTIREIAEPPKIRLP 843
               V++  F V  L  G    FRV   N  G     +SEP     P  + +   PP I   
Sbjct: 20128 SAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIVDV 20187

Query: 844   RH----LRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFV 899
             RH    L  T  +K G         + K R  ++W +       ++  +R  DF      
Sbjct: 20188 RHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRA------NKTPIRMRDF------ 20235

Query: 900   RQAARSDSGEYELSVQIENMKDTA-----TIRIRVVEKAGPPINVMVKEVWGTNALVEWQ 954
             +    ++  EYE  V   N+         +  +  ++   PP    V  +   +  + W 
Sbjct: 20236 KVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITRNSVTLIWT 20295

Query: 955   APKDDGNSEIMGYFVQKADKKTMEWFNVYERN-RHTSCTVSDLIVGNEYYFRVYTENICG 1013
              PK DG  ++ GY V+K D  +  W      N    + TV+DL+ G +Y FR+  +N  G
Sbjct: 20296 EPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAG 20355

Query: 1014  LSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNC-AVR 1072
                +P  S  T  I K        EY+     + P     L    + AG +  LN  ++ 
Sbjct: 20356 AISAPSESTETI-ICKD-------EYEAPTIVLDPTIKDGL---TIKAGDTIVLNAISIL 20404

Query: 1073  GHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAE 1132
             G P PK  W K   +IR      IT+      L I+  +  DAG YT  A N  G  +  
Sbjct: 20405 GKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEH 20464

Query: 1133  CKLEV 1137
              K+ V
Sbjct: 20465 VKVTV 20469



 Score =  115 bits (287), Expect = 3e-25
 Identities = 132/509 (25%), Positives = 215/509 (42%), Gaps = 64/509 (12%)

Query: 159  DASGQSLESFKRTSEK---KSDTAGELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPEIW 215
            + S +    FKR +E+   ++ TA EL      +K++   EE  +K KD        E+ 
Sbjct: 1992 EESEELRSKFKRRTEEGYYEAITAVELKS----RKKDESYEELLRKTKD--------ELL 2039

Query: 216  ELLKGAKKSEYEKIAFQYGITDLRGMLKRLKKAKVEVKKSAAFTKKLD--PAYQVDRGNK 273
               K   + E + +A +  IT     +   K  K+E+  S    K  +   +  V +G+ 
Sbjct: 2040 HWTKELTEEEKKALAEEGKIT-----IPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSD 2094

Query: 274  IKLMVEI-SDPDLTLKWFKNGQEIKPSSKYVF----ENVGKKRILTINKCTLADDAAYEV 328
                V +   PD   +W+KNG +I+ S +  +    +NV +   L I   T  D A+  V
Sbjct: 2095 AHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCE---LVIRDVTAEDSASIMV 2151

Query: 329  A---VKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAV---EVSEEGAQVMWMKDG 382
                +  E       + +   LI    E Q V   ++  MA    E SE   +V W KDG
Sbjct: 2152 KAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDG 2211

Query: 383  VELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVI---TNGGQCEAELIVEEKQL 439
            +E+   D    +YR   D K H L    +   D   Y  +       +  A+LIVE   +
Sbjct: 2212 MEVHEGD----KYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVV 2267

Query: 440  EVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDD 499
            E ++++ D+ V  S     +C VS E + GKWY N VE++ + + TI+       L + D
Sbjct: 2268 EFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKD 2327

Query: 500  VRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAG 559
            V  ED+G+Y+FV DG   +   K+           K  P  I    S +       V  G
Sbjct: 2328 VTKEDQGEYSFVIDGKKTTCKLKM-----------KPRPIAILQGLSDQK------VCEG 2370

Query: 560  NKLRLDVSITGEPPPVATWLK-GDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTI 618
            + ++L+V ++ E      W+K G EV  +      I+K+      +IE   +ED G Y+ 
Sbjct: 2371 DIVQLEVKVSLESVE-GVWMKDGQEVQPSDRVHIVIDKQ--SHMLLIEDMTKEDAGNYSF 2427

Query: 619  KVTNPVGEDVASIFLQVVDVPDPPEAVRI 647
             +          + +  VDV  P + V +
Sbjct: 2428 TIPALGLSTSGRVSVYSVDVITPLKDVNV 2456



 Score =  114 bits (286), Expect = 4e-25
 Identities = 253/1142 (22%), Positives = 419/1142 (36%), Gaps = 150/1142 (13%)

Query: 46   TAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFS 105
            T +EP   F + PDSV V  G      + + G   P K  +KWFKG              
Sbjct: 6829 TVQEPPS-FEQTPDSVEVLPGMSLTFTSVIRGTP-PFK--VKWFKGS---------RELV 6875

Query: 106  FKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSL 165
              ES N +   +  EL + +V   + G Y   V       SC  ++ V+ P      + L
Sbjct: 6876 PGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFV--KRL 6933

Query: 166  ESFKRTSEKKSDTAGELDFSGL-------LKKREVVEEEKKKKKKDDDDLGIPPEIWELL 218
              F  + E  S    E  ++G        +K   ++ + ++      +       I E+L
Sbjct: 6934 ADF--SVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEK----STILEIL 6987

Query: 219  KGAKKSEYEKIAFQYGITDLRGMLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMV 278
            +    S  E  A QY         + + +A V V +   F + L+    V  G    L  
Sbjct: 6988 E----STIEDYA-QYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAVI-GEPATLQC 7041

Query: 279  EISD-PDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY------EVAVK 331
            ++   P++ + W+K   +++ +  Y  +       L INK   +D   Y       V   
Sbjct: 7042 KVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAV 7101

Query: 332  DEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVS-EEGAQVMWMKDGVELTREDS 390
                   +  ++ P      L+D    +G  V     ++  E  QV W KDGV L  + +
Sbjct: 7102 ASSAVLVIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDAN 7161

Query: 391  FKARYRFKKDGKRHILIFSDVVQEDR---GRYQVITNG----GQCEAELIVEEKQLEVLQ 443
             +  +        H +    ++Q D+   G+Y    +         A+LI+ E ++    
Sbjct: 7162 LQTSF-------VHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFF 7214

Query: 444  DIADLTVKAS--EQAVFKCEVSDE---KVTGKWYKNGVEVRPSKRITISHVGRFHKLVID 498
            D+  ++V  +  E   FKC V+     K+T  W K+  E+RP     ++ V     L + 
Sbjct: 7215 DLKPVSVDLALGESGTFKCHVTGTAPIKIT--WAKDNREIRPGGNYKMTLVENTATLTVL 7272

Query: 499  DVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVA 558
             V   D G YT     YA +++ K    +     +  QEPP+       K  E + +V  
Sbjct: 7273 KVGKGDAGQYTC----YASNIAGK----DSCSAQLGVQEPPRFI-----KKLEPSRIVKQ 7319

Query: 559  GNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTI 618
                R +  I G P     W K DE       + R+      +   + +   ED G YT 
Sbjct: 7320 DEFTRYECKIGGSPEIKVLWYK-DETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTC 7378

Query: 619  KVTNPVGEDVASIFLQVVD------VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTG 672
            +  N  G   +S  L+V +       P P E ++   V  +   L   PP +     V+ 
Sbjct: 7379 EAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLE-CELQGTPPFH-----VSW 7432

Query: 673  YLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIG--VSQPSMNTKP 730
            Y  +R+ +  +++ K+  E F  T+     +    + E +  A N +G      S+  K 
Sbjct: 7433 YKDKRELRSGKKY-KIMSENFL-TSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKA 7490

Query: 731  FMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEP 790
                      +  +V       TT++   P  +      G +V    E    W+ + +E 
Sbjct: 7491 PPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVR---ESDNIWI-SYSEN 7546

Query: 791  VERCGFTVKNLPTGARILFRVVGVNIAGRSEP-ATLA--QPVTIREIAEPPKIRLPRHLR 847
            +    F+        +   ++   N AG  E  ATL+  +P TI E  E  K+       
Sbjct: 7547 IATLQFSRVEPANAGKYTCQI--KNDAGMQECFATLSVLEPATIVEKPESIKV------- 7597

Query: 848  QTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVR--QAARS 905
                   G+   L     G P     W K G  L TS    + S F+ V  ++    A S
Sbjct: 7598 -----TTGDTCTLECTVAGTPELSTKWFKDGKEL-TSDNKYKISFFNKVSGLKIINVAPS 7651

Query: 906  DSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIM 965
            DSG Y   VQ    KD+ T  ++V ++  PP     +++  TN L         G+S +M
Sbjct: 7652 DSGVYSFEVQNPVGKDSCTASLQVSDRTVPP--SFTRKLKETNGL--------SGSSVVM 7701

Query: 966  GYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGL-------SDSP 1018
               V  +   ++ WF  +E N          I     Y    T+N C L       SDS 
Sbjct: 7702 ECKVYGSPPISVSWF--HEGNE---------ISSGRKYQTTLTDNTCALTVNMLEESDSG 7750

Query: 1019 GVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPK 1078
              +     +  +     P   +E      P F+       V+ G +      V+G P   
Sbjct: 7751 DYTCIATNMAGSDECSAPLTVRE-----PPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFS 7805

Query: 1079 VVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVR 1138
            V W K   E+    +  ++    V  L +       +G YTC   NE G+A     L ++
Sbjct: 7806 VSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIK 7865

Query: 1139 VP 1140
             P
Sbjct: 7866 AP 7867



 Score =  114 bits (286), Expect = 4e-25
 Identities = 137/562 (24%), Positives = 213/562 (37%), Gaps = 62/562 (11%)

Query: 586   TTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGE-DVASIFLQVVDV---PDP 641
             T T+ R R+    +  S+    A     G         VGE    S+F +  D    P P
Sbjct: 24955 TLTDLRLRVTGLTEGHSYEFRVAAENAAG---------VGEPSEPSVFYRACDALYPPGP 25005

Query: 642   PEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTE-TTYES 700
             P   ++T        L W  P+YDGG PV GY+VE K+  +  W         +   +  
Sbjct: 25006 PSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTV 25065

Query: 701   TKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTS-EP--------LHLIVEDVTDT 751
             TK+ E   Y  R+ A+N+ GV +P+  T P   +A    EP        L  +V      
Sbjct: 25066 TKLKENTEYNFRICAINSEGVGEPA--TLPGSVVAQERIEPPEIELDADLRKVVVLRASA 25123

Query: 752   T----TTLKWRPPNRIGAGGIDGYLVEYC-LEGSEEWVPANTEPVERCGFTVKNLPTGAR 806
             T     T+K RP   +     +G L +   +E +  +     + V R      NL     
Sbjct: 25124 TLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENN 25183

Query: 807   ILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQG 866
                +   VN+     P+     +TIRE+    K  +        I    +  N +V  + 
Sbjct: 25184 SGSKTAFVNVRVLDSPSAPVN-LTIREVK---KDSVTLSWEPPLIDGGAKITNYIVEKRE 25239

Query: 867   KPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIR 926
               R             T R+          F V       S EY + +  E      T  
Sbjct: 25240 TTRKAYATITNNCTKTTFRIENLQEGCSYYFRVLA-----SNEYGIGLPAET-----TEP 25289

Query: 927   IRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN 986
             ++V E   PP  V + +V    A ++W+ P+ DG S+I GY V+   K + +W +   + 
Sbjct: 25290 VKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKW-STCTQV 25348

Query: 987   RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKP-FEYKEHDFR 1045
             +    T+S L  G EY FRV   N  G SD   +      ++   I  KP  E   H F 
Sbjct: 25349 KTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLG---VPVIARDIEIKPSVELPFHTFN 25405

Query: 1046  MAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTL 1105
                          V A     ++   +G P+  V W K+   ++E  +  +++ + V +L
Sbjct: 25406 -------------VKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSL 25452

Query: 1106  NIRRPSPFDAGTYTCRAVNELG 1127
             +I+  S  D GTY     N  G
Sbjct: 25453 SIKEASKEDVGTYELCVSNSAG 25474



 Score =  111 bits (277), Expect = 4e-24
 Identities = 74/266 (27%), Positives = 120/266 (45%), Gaps = 9/266 (3%)

Query: 247  KAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLT-LKWFKNGQEIKPSSKYVFE 305
            K   ++K  A   KK      V         VE++ P++  ++W KNG  ++ + KY   
Sbjct: 2697 KTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAIS 2756

Query: 306  NVGKKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEM 365
              G    L I  C + D++ Y   +        L V+   V I+   +D        V  
Sbjct: 2757 VKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVET--VKIIKKPKDVTALENATVAF 2814

Query: 366  AVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNG 425
             V VS +   V W    VE+   D    ++R   + K H L+  ++   D G Y  +   
Sbjct: 2815 EVSVSHDTVPVKWFHKSVEIKPSD----KHRLVSERKVHKLMLQNISPSDAGEYTAVVGQ 2870

Query: 426  GQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRIT 485
             +C+A+L VE   L + + + ++ V  ++ A F+CEVS   V   W KNGVE+  S++  
Sbjct: 2871 LECKAKLFVET--LHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFK 2928

Query: 486  ISHVGRFHKLVIDDVRPEDEGDYTFV 511
            I   G+ H+L+I +   ED  +YTFV
Sbjct: 2929 IVVQGKLHQLIIMNTSTEDSAEYTFV 2954



 Score =  110 bits (274), Expect = 1e-23
 Identities = 200/936 (21%), Positives = 339/936 (36%), Gaps = 122/936 (13%)

Query: 250  VEVKKSAAFTKKL-DPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVG 308
            + +K    F KKL D +  V +  +++  +E ++P +++ WFK+  EI   S  ++ +  
Sbjct: 7486 IALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEP-ISVVWFKDKGEIVRESDNIWISYS 7544

Query: 309  KK-RILTINKCTLADDAAYEVAVKDE----KCFTELFVKEPPVLIVTPLEDQQVFVGDRV 363
            +    L  ++   A+   Y   +K++    +CF  L V EP  ++  P E  +V  GD  
Sbjct: 7545 ENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKP-ESIKVTTGDTC 7603

Query: 364  EMAVEVS-EEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRY--- 419
             +   V+        W KDG ELT ++ +K  +  K  G + I    +V   D G Y   
Sbjct: 7604 TLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKII----NVAPSDSGVYSFE 7659

Query: 420  -QVITNGGQCEAELIVEEKQL--EVLQDIADLTVKASEQAVFKCEV-SDEKVTGKWYKNG 475
             Q       C A L V ++ +     + + +    +    V +C+V     ++  W+  G
Sbjct: 7660 VQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEG 7719

Query: 476  VEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALS--LSAKLNFLEIKVEYV 533
             E+   ++   +       L ++ +   D GDYT +    A S   SA L   E    +V
Sbjct: 7720 NEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVRE-PPSFV 7778

Query: 534  PKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTR 593
             K +P               + V+ G  +     + G PP   +W KG       + R  
Sbjct: 7779 QKPDP---------------MDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGD-RCN 7822

Query: 594  IEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGED 653
            +      +   +        G YT  V+N  G+   +  L +     P + V+  +   D
Sbjct: 7823 VSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYI---KAPAKFVKRLN---D 7876

Query: 654  WAILVWEPPMYDG---GKPVTGYLVERKKKG-----SQRWMKLNFEVFTETTYESTKMIE 705
            ++I   +P + +G   G P     V  KK G     SQR      E        S+ + +
Sbjct: 7877 YSIEKGKPLILEGTFTGTPPIS--VTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVED 7934

Query: 706  GILYEMRVFAVNAIGVSQPSMNTKPFMP--IAPTSEPLHLIVEDVTDTTTTLKWRPPNRI 763
               Y    +  NA G    S       P       EP+ + V D       L   P    
Sbjct: 7935 AGQYNC--YIENASGKDSCSAQILILEPPYFVKQLEPVKVSVGDSASLQCQLAGTP---- 7988

Query: 764  GAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAG----R 819
                          E    W   +T+      + +      A ++F  V +N +G    +
Sbjct: 7989 --------------EIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICK 8034

Query: 820  SEPA----TLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQ----GKPRPQ 871
            +E +    + +  +T++E   PP        RQ  +R V E + L V F     G     
Sbjct: 8035 AENSVGEVSASTFLTVQEQKLPPSFS-----RQ--LRDVQETVGLPVVFDCAISGSEPIS 8087

Query: 872  VVWTKGGAPL-DTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVV 930
            V W K G PL D+  V     D      + +  RS +G+Y  +        +++ R+ + 
Sbjct: 8088 VSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILT 8147

Query: 931  EKAGPPINVM----VKEVWGTNALVEWQAPKDDGNSEI-MGYFVQKADKKTMEWFNVYER 985
            E   PP   +    V  V G +A  E       G   I + +     + ++   + +   
Sbjct: 8148 EGKNPPFFDIRLAPVDAVVGESADFECHVT---GTQPIKVSWAKDSREIRSGGKYQISYL 8204

Query: 986  NRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFR 1045
                  TV  +  G+   +  Y  N  G            R++    T +  E  E    
Sbjct: 8205 ENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKRLSETVEE--- 8261

Query: 1046 MAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTL 1105
                            G S  L   V G     V W KN +EI+      IT     L L
Sbjct: 8262 --------------TEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVL 8307

Query: 1106 NIRRPSPFDAGTYTCRAVNELGEALAECKLEVRVPQ 1141
             +R+    DAG YTC+  N+ G AL    + ++ P+
Sbjct: 8308 QVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPK 8343



 Score =  108 bits (271), Expect = 2e-23
 Identities = 107/416 (25%), Positives = 166/416 (39%), Gaps = 37/416 (8%)

Query: 735   APTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERC 794
             +P S    L  +D+   +  + WRPP   G   I GY++E        W   ++  V   
Sbjct: 30227 SPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSR-VRGT 30285

Query: 795   GFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPK--IRLPRHLRQT--- 849
                VK L       FRV   N  G S+P    +PVT +    PP+     P  L  T   
Sbjct: 30286 SLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSS 30345

Query: 850   ----YIRKVGEQLNLVVPF--QGKPRPQVVWTKGGAPLDTSRVHVRTSDF-DTVFFVRQA 902
                 + R   +  + V  +  + K      W +      T+ ++  T    D  +  R  
Sbjct: 30346 VSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRII 30405

Query: 903   ARSDSGEYELSVQIENM--KDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDG 960
             A++D G  E S   E +  KD         +K   P  + +  +   +  ++W+ P+ DG
Sbjct: 30406 AQNDVGLSETSPASEPVVCKDP-------FDKPSQPGELEILSISKDSVTLQWEKPECDG 30458

Query: 961   NSEIMGYFVQKADKKTMEWFNVY-ERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPG 1019
               EI+GY+V+        W     ER +    T+  L+   EY FRV+ EN  GLS    
Sbjct: 30459 GKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRP-- 30516

Query: 1020  VSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKV 1079
               + TA  +KT +T             AP     + D     G +A L+C + G P P +
Sbjct: 30517 --RRTAMSIKTKLTSGE----------APGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDI 30564

Query: 1080  VWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKL 1135
              W +   E+ +  K+ +++     TL +      D G YTC A NE+GE     KL
Sbjct: 30565 KWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKL 30620



 Score =  108 bits (270), Expect = 3e-23
 Identities = 208/938 (22%), Positives = 345/938 (36%), Gaps = 133/938 (14%)

Query: 248  AKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISD-PDLTLKWFKNGQEIKPSSKYVFEN 306
            A + VK+ A F +KL+P+  + +G+  +L  +++  P + + WF N +EIK SSK+    
Sbjct: 4291 ANLFVKEPATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSF 4350

Query: 307  VGKKRILTINKCTLADDAAYEVAVKDE----KCFTELFVKEPPVLI--VTPLEDQQVFVG 360
            V    +L +    + D   Y    ++E     C + + VKE P       P+E  + +  
Sbjct: 4351 VESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKPIEVLKEY-- 4408

Query: 361  DRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQ 420
            D + +A        ++ W KD   L     +K    F +D    + I    V  D G YQ
Sbjct: 4409 DVMLLAEVAGTPPFEITWFKDNTILRSGRKYKT---FIQDHLVSLQILK-FVAADAGEYQ 4464

Query: 421  V-ITN---GGQCEAELIVEE-----KQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKW 471
              +TN      C A + + E     K++E    +   T  A+ QA  K  +    +T  W
Sbjct: 4465 CRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGGT--AAFQATLKGSL---PITVTW 4519

Query: 472  YKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVE 531
             K+  E+     I ++       L +  +  + +G Y       A  +      L +K  
Sbjct: 4520 LKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDA-GIQRCSALLSVK-- 4576

Query: 532  YVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLK-GDEVFTTTEG 590
                 EP  I  +        +I V  G+   L V  +G     A W K G E+  T   
Sbjct: 4577 -----EPATITEEAV------SIDVTQGDPATLQVKFSGTKEITAKWFKDGQEL--TLGS 4623

Query: 591  RTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPE-AVRITS 649
            + +I      S   I S +++D G YT +V N VG       + V+D+  PP    ++  
Sbjct: 4624 KYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKK 4683

Query: 650  VGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGI-L 708
            +       +    +  G  P++    +  ++ S    K  F     T +     +EG   
Sbjct: 4684 MDSIKGSFIDLECIVAGSHPISIQWFKDDQEISAS-EKYKFSFHDNTAFLEISQLEGTDS 4742

Query: 709  YEMRVFAVNAIGVSQPS----MNTKPFMPIAPTSEPLH----LIVEDVTDTTT--TLKWR 758
                  A N  G +Q S    +   P+    P S+ ++    + ++ +   T   T+KW 
Sbjct: 4743 GTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPNTRVQLKALVGGTAPMTIKWF 4802

Query: 759  PPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAG 818
              N+    G               W    +  +E   F  K   +G  I    +  ++  
Sbjct: 4803 KDNKELHSG----------AARSVWKDDTSTSLEL--FAAKATDSGTYIC--QLSNDVGT 4848

Query: 819  RSEPATLAQPVTIREIAEPPK-IRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKG 877
             +  ATL        + EPP+ I+ P       + + G+         G P+ +V W   
Sbjct: 4849 ATSKATLF-------VKEPPQFIKKP---SPVLVLRNGQSTTFECQITGTPKIRVSWYLD 4898

Query: 878  GAPLDTSRVH-VRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVE----- 931
            G  +   + H +   D    F +  A   +SG Y    + +    + +I ++V E     
Sbjct: 4899 GNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFI 4958

Query: 932  KAGPPINV-------MVKEVWGTNAL-VEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVY 983
            +   P+ V       +  EV GT    V W       N EI      ++ KK      V 
Sbjct: 4959 RELKPVEVVKYSDVELECEVTGTPPFEVTWL----KNNREI------RSSKKYTLTDRVS 5008

Query: 984  ERNRH-TSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEH 1042
              N H T C  SD     EY         C +S+  G    + R+               
Sbjct: 5009 VFNLHITKCDPSDT---GEYQ--------CIVSNEGGSCSCSTRVA-------------- 5043

Query: 1043 DFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGV 1102
              +  P F+  + +   V   SA     V G P   + W+K+   + ED    I+    V
Sbjct: 5044 -LKEPPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDSV 5102

Query: 1103 LTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVRVP 1140
             TL IR      +G YTC+A NE G       L V+ P
Sbjct: 5103 ATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEP 5140



 Score =  107 bits (266), Expect = 8e-23
 Identities = 121/519 (23%), Positives = 189/519 (36%), Gaps = 75/519 (14%)

Query: 639   PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNF-EVFTETT 697
             P PP   ++         L W  P YDGG P+ GYLVE K+  S  W++ N  +   +T 
Sbjct: 19589 PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTR 19648

Query: 698   YESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTT----- 752
             +E T ++E   Y+ RV+AVN IG S PS       P      P   +  D+  T      
Sbjct: 19649 FEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAG 19708

Query: 753   ------TTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGAR 806
                     +K RPP +I                   W   N    +R G  +K+      
Sbjct: 19709 VTMRLYVPVKGRPPPKI------------------TWSKPNVNLRDRIGLDIKSTDFDTF 19750

Query: 807   ILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQG 866
             +    V    AG+    TL      +E     K+          +   G  +N+ V    
Sbjct: 19751 LRCENVNKYDAGKYI-LTLENSCGKKEYTIVVKV----------LDTPGPPVNVTVKEIS 19799

Query: 867   KPRPQVVWTK----GGAPLDTSRVHVRTSDFDTVFFV---------RQAARSDSGEYELS 913
             K    V W      GG+P+    V  R ++  +   V         R A   +   Y   
Sbjct: 19800 KDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFR 19859

Query: 914   VQIEN---MKDTATIR--IRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYF 968
             V  EN   + D    R  ++  +  GP +++ V+ V  ++  + W+ P  DG S I+GY 
Sbjct: 19860 VFAENEYGIGDPGETRDAVKASQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYV 19919

Query: 969   VQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARIL 1028
             V    ++  +W  V  ++     +  DL  G EY FRV  EN     +  G       + 
Sbjct: 19920 VDFLTEEN-KWQRVM-KSLSLQYSAKDLTEGKEYTFRVSAEN----ENGEGTPSEITVVA 19973

Query: 1029  KTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEI 1088
             +  +     + K            P +  +     +  L   ++G P P V W K +  +
Sbjct: 19974 RDDVVAPDLDLKG----------LPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPL 20023

Query: 1089  REDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELG 1127
               D +  + +     TL +      DAG YT    N  G
Sbjct: 20024 ATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAG 20062



 Score =  107 bits (266), Expect = 8e-23
 Identities = 108/487 (22%), Positives = 190/487 (39%), Gaps = 42/487 (8%)

Query: 667   GKPVTGYLVERKKKGSQRWMKLNFEVFTET-TYESTKMIEGILYEMRVFAVNAIGVSQPS 725
             GKP+    + R     +  M+ N E+  E  T    + +        + A N+ G ++  
Sbjct: 26502 GKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAF 26561

Query: 726   MNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVP 785
             +N        P + P+  ++ D+T+ + TLKW PP   G   +  Y++      +  W  
Sbjct: 26562 INIVVLDRPGPPTGPV--VISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTE 26619

Query: 786   ANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIR---EIAEPPKIRL 842
              +   V R    V  L TG    FR+   N  G S+    A  VT++       PP    
Sbjct: 26620 VSAT-VARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSAC-VTVKLPYTTPGPPSTPW 26677

Query: 843   PRHLRQTYI-----RKVGEQLNLVVPF--QGKPRPQVVWTKGGA-PLDTSRVHVRTSDFD 894
               ++ +  I       V    + VV +  + K R  ++W K     + T+   V T    
Sbjct: 26678 VTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAG 26737

Query: 895   TVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQ 954
              ++  R  A + +G  + S   E         +  ++   PP NV + ++   +  + WQ
Sbjct: 26738 LIYEFRVYAENAAGVGKPSHPSEP--------VLAIDACEPPRNVRITDISKNSVSLSWQ 26789

Query: 955   APKDDGNSEIMGYFVQKADKKTMEWFNVYERN-RHTSCTVSDLIVGNEYYFRVYTENICG 1013
              P  DG S+I GY V++ D     W      N   T   +S L   ++Y FRV+  N  G
Sbjct: 26790 QPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVG 26849

Query: 1014  LSDSPGVSKNTARILKT---GITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCA 1070
                +P         + +    +   P EY E       K+          AG S  L   
Sbjct: 26850 SISNPSEVVGPITCIDSYGGPVIDLPLEYTE-----VVKYR---------AGTSVKLRAG 26895

Query: 1071  VRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEAL 1130
             + G P P + W K+  E++ +    + N   + ++ I+     ++G Y  +  N +G A 
Sbjct: 26896 ISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSAS 26955

Query: 1131  AECKLEV 1137
             A  ++++
Sbjct: 26956 ATIRVQI 26962



 Score =  106 bits (265), Expect = 1e-22
 Identities = 114/409 (27%), Positives = 180/409 (44%), Gaps = 52/409 (12%)

Query: 279   EISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTE 338
             EIS+ D+  +W   G+ ++PS     +  G KR LT++K  L  D A EV  +     T 
Sbjct: 11419 EISEADIPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKL--DQAGEVLYQALNAITT 11476

Query: 339   --LFVKEPPVLIVTPLEDQQVFVGDRVEMAVE-VSEEGAQVMWMKDGVELTREDSFKARY 395
               L VKE  +    PL+D  V V +R +   E V    A V+W K    +   D F    
Sbjct: 11477 AILTVKEIELDFAVPLKD--VTVPERRQARFECVLTREANVIWSKGPDIIKSSDKFD--- 11531

Query: 396   RFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQ 455
                 DGK+HIL+ +D   +D G Y     G +  A L V   +L+ +  + D TVK  E 
Sbjct: 11532 -IIADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVKEGET 11590

Query: 456   AVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGY 515
             A F CE+S EK+   W+KN  ++  S+ + IS  G+ HKL + +V  +D           
Sbjct: 11591 ATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQ--IKAQVK 11648

Query: 516   ALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPV 575
              LS +A+L  LE           P   +    KT+      V  +++ L   ++ + P  
Sbjct: 11649 ELSSTAQLKVLE---------ADPYFTVKLHDKTA------VEKDEITLKCEVSKDVP-- 11691

Query: 576   ATWLK-GDEVFTT------TEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDV 628
               W K G+E+  +       +G  RI K        I+ A  +D+G Y         +  
Sbjct: 11692 VKWFKDGEEIVPSPKYSIKADGLRRILK--------IKKADLKDKGEYVCDCGTDKTKAN 11743

Query: 629   ASIFLQVVDVPDPPEAVRITSVGE--DWAILVWEPPMYD----GGKPVT 671
              ++  +++ V  P   V +  VGE   + I + EP ++      G+P+T
Sbjct: 11744 VTVEARLIKVEKPLYGVEV-FVGETAHFEIELSEPDVHGQWKLKGQPLT 11791



 Score =  103 bits (256), Expect = 1e-21
 Identities = 109/405 (26%), Positives = 177/405 (43%), Gaps = 35/405 (8%)

Query: 249   KVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVG 308
             KV+V + AA         ++  G K + +  IS     ++W ++ + ++   KY     G
Sbjct: 12544 KVKVHELAAEFISKPQNLEILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIADG 12603

Query: 309   KKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVE 368
             KKR+L +   TL D   Y V V   +    L V E  + IV PL+D +V     V    E
Sbjct: 12604 KKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIE-KLRIVVPLKDTRVKEQQEVVFNCE 12662

Query: 369   VSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQV-ITN--- 424
             V+ EGA+  W ++  E    DS  ++Y   +    + L   D   +D+  Y V +TN   
Sbjct: 12663 VNTEGAKAKWFRN--EEAIFDS--SKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRG 12718

Query: 425   -GGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKR 483
                +  A LIVEE+ L +++ + D+     +   F C+V+   VT KW KNG EV    R
Sbjct: 12719 ENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNR 12778

Query: 484   ITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHL 543
             ++       H L I D    DEG+Y  V  G   S+ A+L  +E   E+V        HL
Sbjct: 12779 VSYRVDKYKHMLTIKDCGFPDEGEY-IVTAGQDKSV-AELLIIEAPTEFVE-------HL 12829

Query: 544   DCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRT-RIEKRVDCSS 602
             +    T  +  V            ++ E   V  +  G E+    EG+  + EK      
Sbjct: 12830 EDQTVTEFDDAV--------FSCQLSREKANVKWYRNGREI---KEGKKYKFEKDGSIHR 12878

Query: 603   FVIESAQREDEGRYTIKVTNPVGEDVASIFLQ--VVDVPDPPEAV 645
              +I+  + +DE  Y   V +   +  A +F++   V++  PP+ +
Sbjct: 12879 LIIKDCRLDDECEYACGVED--RKSRARLFVEEIPVEIIRPPQDI 12921



 Score =  102 bits (254), Expect = 2e-21
 Identities = 114/516 (22%), Positives = 191/516 (37%), Gaps = 76/516 (14%)

Query: 636   VDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTE 695
             +D P PP  +RI    +    L W  P+YDGG  VTGY+VE ++   + W  ++ +    
Sbjct: 27164 IDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVR 27223

Query: 696   TT-YESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMP-------------------IA 735
             TT Y  + +  G+ Y  RV AVN  G  +P    +P                      IA
Sbjct: 27224 TTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIA 27283

Query: 736   PTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTE-PVERC 794
                E + +++        T+ WR   +   G    Y +E     S   +P  T     + 
Sbjct: 27284 KAGEDVQVLIPFKGRPPPTVTWRKDEK-NLGSDARYSIENTDSSSLLTIPQVTRNDTGKY 27342

Query: 795   GFTVKN---LPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYI 851
               T++N    P  + +  +V+    A +          T+  + +PP I     +    I
Sbjct: 27343 ILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVI 27402

Query: 852   RKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYE 911
              K             +   +  W+       ++   +      T FF R  A ++ G  E
Sbjct: 27403 EK-------------RDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGE 27449

Query: 912   LSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQK 971
                  E +K          E   P  ++ +K+   T+ ++ W  P  DG S I  Y V++
Sbjct: 27450 PCETTEPVK--------AAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVER 27501

Query: 972   ADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTG 1031
               K    W +    ++     VS L   +   FRV+ +N  GLSD               
Sbjct: 27502 KGKGEQTWSHA-GISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDP-------------- 27546

Query: 1032  ITFKPFEYKEHDFRMAPKFLTPLIDR--------VVVAGYSAALNCAVRGHPKPKVVWMK 1083
             +T  P   KE         +TP +D          V  G++  L    +G PKP + W+K
Sbjct: 27547 VTIGPITVKE-------LIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLK 27599

Query: 1084  NKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYT 1119
             + + ++E      +  +  +TL+I+       G YT
Sbjct: 27600 DGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYT 27635



 Score = 99.8 bits (247), Expect = 1e-20
 Identities = 71/264 (26%), Positives = 127/264 (48%), Gaps = 11/264 (4%)

Query: 268  VDRGNKIKLMVEISDPDLT-LKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
            V  G K  L  ++S PD+T +KW+ N ++IKP  +      G K+ L IN+   +D+  Y
Sbjct: 2456 VIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPY 2515

Query: 327  EVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMW-MKDGVEL 385
            ++ V   +    L V++  + I+  L D        V   VE+S  G  V+W  KD    
Sbjct: 2516 KLIVGRVETNCNLSVEK--IKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKD---- 2569

Query: 386  TREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDI 445
             +E    ++Y+ +  GK + L   +++++D G+Y           +L V    +   + +
Sbjct: 2570 -KEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAIS--KPL 2626

Query: 446  ADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDE 505
             D TV  S++AVF+CEV++    G+W ++G  +  +  I     G   +L+I   + +D 
Sbjct: 2627 TDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDI 2686

Query: 506  GDYTFVPDGYALSLSAKLNFLEIK 529
            G+YT+       S   K+  ++IK
Sbjct: 2687 GEYTYKVATSKTSAKLKVEAVKIK 2710



 Score = 99.0 bits (245), Expect = 2e-20
 Identities = 109/513 (21%), Positives = 188/513 (36%), Gaps = 49/513 (9%)

Query: 639   PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEV-FTETT 697
             P PP   ++  +      L W  P+YDGG  + GY+VE+       W          +T 
Sbjct: 22838 PGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTN 22897

Query: 698   YESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEP---LHLIVEDVTDTTT- 753
              E  K++E   Y  R+ A+N  GV + +    P +       P   L L +  + +    
Sbjct: 22898 IEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAG 22957

Query: 754   -------TLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGAR 806
                     +K RP   +  G +DG + +  +      +   +         V    +G  
Sbjct: 22958 GSLRLFVPIKGRPTPEVKWGKVDGEIRDAAI------IDVTSSFTSLVLDNVNRYDSGKY 23011

Query: 807   ILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPF-Q 865
              L           +   T +  VT+R +  P     P +L+ T I K    +    P   
Sbjct: 23012 TLTL--------ENSSGTKSAFVTVRVLDTPSP---PVNLKVTEITKDSVSITWEPPLLD 23060

Query: 866   GKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIE---NMKDT 922
             G  + +    +       S   V T+     + + Q     S  + ++ + E    +   
Sbjct: 23061 GGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQ 23120

Query: 923   ATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNV 982
                 I+V E   PP  + V +V   +  + W  P+ DG S+I+ Y V+   K + +W   
Sbjct: 23121 TADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSEC 23180

Query: 983   YERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEH 1042
               R +     +++L  G EY FRV   N  G SD         R L   I  K       
Sbjct: 23181 -ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDP--------RSLAVPIVAK------- 23224

Query: 1043  DFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGV 1102
             D  + P          V  G    +   + G PKP + W K+ + +++  +  +T+   +
Sbjct: 23225 DLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDL 23284

Query: 1103  LTLNIRRPSPFDAGTYTCRAVNELGEALAECKL 1135
              TL+I+     D G Y     N +G+  A  ++
Sbjct: 23285 TTLSIKETHKDDGGQYGITVANVVGQKTASIEI 23317



 Score = 98.6 bits (244), Expect = 3e-20
 Identities = 128/541 (23%), Positives = 199/541 (36%), Gaps = 74/541 (13%)

Query: 639   PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTY 698
             P PP    +    +    L W+PP  DGG P+ GY+VE +++G+  W ++N      TT 
Sbjct: 15705 PGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTC 15764

Query: 699   EST--KMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTT--- 753
             E     + E   Y  RV AVN  G S+PS  T          EP   I     D      
Sbjct: 15765 ECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKA 15824

Query: 754   --------TLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGA 805
                      +K RP  +  +   DG   +   +G  + +P + +       +V  +P   
Sbjct: 15825 GSQIRIPAVIKGRPTPK-SSWEFDGKAKKAMKDGVHD-IPEDAQLETAENSSVIIIPECK 15882

Query: 806   RILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVP-- 863
             R       +    ++   T    V + ++  PPK      L+ + I +   +L+  +P  
Sbjct: 15883 RSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPK-----DLKVSDITRGSCRLSWKMPDD 15937

Query: 864   ----------FQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELS 913
                        + +      WTK      ++   V     +  +F R  A +  G   + 
Sbjct: 15938 DGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFG---IG 15994

Query: 914   VQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQ--- 970
               +E ++ T T R  +     PPI + +  +      + W+ PK+DG S +  Y V+   
Sbjct: 15995 PPVETIQRT-TARDPIYPP-DPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLA 16052

Query: 971   --KADKKTMEWFNVYERN-RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARI 1027
                   K   W    +R+      TV DL+ G EY FRV   N  G+S            
Sbjct: 16053 WDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVS------------ 16100

Query: 1028  LKTGITFKPFEYKEHDFRMAPKFLTPLID----RVVVAGYSAALNCAVRGHPKPKVVWMK 1083
              K   T  P + +  D       + P ID      V  G +  +   ++G P P + W K
Sbjct: 16101 -KPSATVGPCDCQRPD-------MPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPTLTWFK 16152

Query: 1084  -------NKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLE 1136
                    NK  +  D            TL I +    D G YT  AVN LG A  E +L 
Sbjct: 16153 APPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLN 16212

Query: 1137  V 1137
             V
Sbjct: 16213 V 16213



 Score = 97.4 bits (241), Expect = 7e-20
 Identities = 101/436 (23%), Positives = 166/436 (38%), Gaps = 41/436 (9%)

Query: 717   NAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
             N+ G +  ++N        P + P+ +  ++VT  + TL W PP   G   I+ Y+VE  
Sbjct: 22224 NSAGEAIETLNVIVLDKPGPPTGPVKM--DEVTADSITLSWGPPKYDGGSSINNYIVEKR 22281

Query: 777   LEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRS-----EPATLAQPVTI 831
                +  W   +   V R       L TG    FR+   N  G+S     EP     P  +
Sbjct: 22282 DTSTTTWQIVSAT-VARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKV 22340

Query: 832   REIAEPPKIRLPRH--LRQTYIRKVGEQLNLVVPF--QGKPRPQVVWTKGGAPLDTSRVH 887
                   P + L     +   +   + +  + V+ +  + K R  ++W K       ++  
Sbjct: 22341 PGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVK------LNKTP 22394

Query: 888   VRTSDFDTVFFVRQAARSDSGEYELSVQIENM----KDTATIRIRVV-EKAGPPINVMVK 942
             +  + F T          +  EYE  V  EN+    K +      V  +   PP      
Sbjct: 22395 IPQTKFKTT------GLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAI 22448

Query: 943   EVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNR-HTSCTVSDLIVGNE 1001
              V   +  ++W+ P  DG S+I GY V+K +     W      N   T   V+ L+  + 
Sbjct: 22449 IVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHR 22508

Query: 1002  YYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVA 1061
             Y FRV   N  G+   P  S        TG      E       M PK+   +   VV A
Sbjct: 22509 YEFRVIARNAAGVFSEPSES--------TGAITARDEVDPPRISMDPKYKDTI---VVHA 22557

Query: 1062  GYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCR 1121
             G S  ++  + G P P + W+K   E+    +  I +     +L+++     D+G Y  +
Sbjct: 22558 GESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILK 22617

Query: 1122  AVNELGEALAECKLEV 1137
             A N  GE      ++V
Sbjct: 22618 AKNVAGERSVTVNVKV 22633



 Score = 95.5 bits (236), Expect = 3e-19
 Identities = 116/453 (25%), Positives = 166/453 (36%), Gaps = 51/453 (11%)

Query: 694   TETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTT 753
             T  + + T   +G  Y + V   N +G    S+         P   P+    +DV+  + 
Sbjct: 23285 TTLSIKETHKDDGGQYGITV--ANVVGQKTASIEIVTLDKPDPPKGPVKF--DDVSAESI 23340

Query: 754   TLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVG 813
             TL W PP   G   I  Y+V+     +  W   +   V R    V  L TG    FR+  
Sbjct: 23341 TLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSAT-VARTTLKVTKLKTGTEYQFRIFA 23399

Query: 814   VNIAGRS---EPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLN------LVVPF 864
              N  G+S   E   +      +E   P         + + + +  E +N      +    
Sbjct: 23400 ENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHL 23459

Query: 865   QGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSG-EYELSVQIENM---- 919
             + K R  ++WTK    ++ + +H      DT F   +A   + G EYE  V  EN+    
Sbjct: 23460 ERKERNSILWTK----VNKTIIH------DTQF---KAQNLEEGIEYEFRVYAENIVGVG 23506

Query: 920   ----KDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKK 975
                      +     +  G P  +MVK        ++W  P  DG S I GY V+K D  
Sbjct: 23507 KASKNSECYVARDPCDPPGTPEPIMVKR---NEITLQWTKPVYDGGSMITGYIVEKRDLP 23563

Query: 976   TMEWFNVYERNR-HTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITF 1034
                W      N   T  TVS L     Y FRV  +N  G    P  S        TG   
Sbjct: 23564 DGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDS--------TGPIT 23615

Query: 1035  KPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKF 1094
                E +     M PKF   +   VV AG +  L   V G P P + W++   EI E  + 
Sbjct: 23616 AKDEVELPRISMDPKFRDTI---VVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARC 23672

Query: 1095  LITNYQGVLTLNIRRPSPFDAGTYTCRAVNELG 1127
              I N      L ++     D G Y  RA N  G
Sbjct: 23673 EIKNTDFKALLIVKDAIRIDGGQYILRASNVAG 23705



 Score = 94.4 bits (233), Expect = 6e-19
 Identities = 72/213 (33%), Positives = 98/213 (46%), Gaps = 16/213 (7%)

Query: 931   EKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNV-YERNRHT 989
             EK G P    +  V   + +V W+ P  DG ++I  Y+++K +KK  +W +V  E  R T
Sbjct: 30823 EKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRET 30882

Query: 990   SCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPK 1049
               +V +LI G EY FRV  EN+ G S+   +S             +P   K      AP 
Sbjct: 30883 VFSVKNLIEGLEYEFRVKCENLGGESEWSEIS-------------EPITPKSDVPIQAPH 30929

Query: 1050  FLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDP-KFLITNYQ-GVLTLNI 1107
             F   L +  V    +A L C V GHPKP V W +   EI  D  K+ I  ++ G   L I
Sbjct: 30930 FKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLII 30989

Query: 1108  RRPSPFDAGTYTCRAVNELGEALAECKLEVRVP 1140
                +  DA  Y  RA N+ G       LEV VP
Sbjct: 30990 ASVTDDDATVYQVRATNQGGSVSGTASLEVEVP 31022



 Score = 94.0 bits (232), Expect = 7e-19
 Identities = 181/889 (20%), Positives = 325/889 (36%), Gaps = 110/889 (12%)

Query: 285  LTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY-----EVAVKDEKCFTEL 339
            +++ WF    +I   +KY          L +N    +D   Y      VA  DE C   L
Sbjct: 5829 ISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDE-CRAVL 5887

Query: 340  FVKEPPVLIVTPLEDQQVFVGDRVEMAVEV-SEEGAQVMWMKDGVELTREDSFKARYRFK 398
             V+EPP  +  P E  +V  G  V     +      +V W +   EL + D     +   
Sbjct: 5888 TVQEPPSFVKEP-EPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYF--- 5943

Query: 399  KDGKRHILIFS-DVVQEDRGRYQVITNGGQ--CEAELIVEEKQLEVLQDIADLTVKASEQ 455
            +D    + +F+ D+ Q       V  N GQ  C   L V+E     L+ ++D +V+  + 
Sbjct: 5944 EDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAA-FLKRLSDHSVEPGKS 6002

Query: 456  AVFKCEVSDE-KVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDG 514
             + +   +    ++  W K+G  +  S++  I    +   L I +    D G Y+   + 
Sbjct: 6003 IILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIEN 6062

Query: 515  YALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPP 574
             A          ++    V   EPP         T    +    G+ + L   + G P  
Sbjct: 6063 EAGR--------DVCGALVSTLEPPYF------VTELEPLEAAVGDSVSLQCQVAGTPEI 6108

Query: 575  VATWLKGD-EVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFL 633
              +W KGD ++  T E RT     V  ++ V       D G YT K  N +G   +    
Sbjct: 6109 TVSWYKGDTKLRPTPEYRTYFTNNV--ATLVFNKVNINDSGEYTCKAENSIGTASSKTVF 6166

Query: 634  QVVDVPDPPEAVR-ITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEV 692
            ++ +   PP   R +  + +   + V      +G  P+    V   + G       N + 
Sbjct: 6167 RIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQ---VCWYRDGVLLRDDENLQT 6223

Query: 693  FTETTYESTKMIEGILYEMRVF---AVNAIGVSQPSMNT-------KPFMPIAPTSEPLH 742
                   + K+++  L     +   A N +G +  S           PF  I P S  + 
Sbjct: 6224 SFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVS--ID 6281

Query: 743  LIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLP 802
            +I  +  D    +    P RI                   W   N E      +T+  + 
Sbjct: 6282 VIAGESADFECHVTGAQPMRI------------------TWSKDNKEIRPGGNYTITCVG 6323

Query: 803  TGARILFRVVGVNIAGR---SEPATLAQPVTIREIA--EPPKIRLPRHLRQTYIRKVGEQ 857
                +    VG   +G+        + + +   +++  EPPK    + L  + + K GE 
Sbjct: 6324 NTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKF--VKKLEASKVAKQGES 6381

Query: 858  LNLVVPFQGKPRPQVVWTKGGAPLDTS-RVHVRTSDFDTVFFVRQAARSDSGEYELSVQI 916
            + L     G P  +V W +  + L  S + ++   +   +  + +A+  DSG+Y    + 
Sbjct: 6382 IQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDY--ICEA 6439

Query: 917  ENMKDTATIRIRVVEKAGPPINVM----VKEVWGTNALVEWQAPKDDGNSEIMGYFVQ-K 971
             N    A+    +  KA PP+       V  + G++ +++ +     G       +V+ +
Sbjct: 6440 HNGVGDASCSTALTVKA-PPVFTQKPSPVGALKGSDVILQCEI---SGTPPFEVVWVKDR 6495

Query: 972  ADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTG 1031
               +  + F +  ++  TS  + +L   +   +     N  G SD+   S          
Sbjct: 6496 KQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVG-SDTCSCSVK-------- 6546

Query: 1032 ITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKME-IRE 1090
                        F+  P+F+  L D   + G +  L   V G     VVW+K++ E IRE
Sbjct: 6547 ------------FKEPPRFVKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEVIRE 6594

Query: 1091 DPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVRV 1139
                 I+    + TL +  P   ++G Y C+  N+ G  + EC   + V
Sbjct: 6595 SENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAG--MRECSAVLTV 6641



 Score = 94.0 bits (232), Expect = 7e-19
 Identities = 95/391 (24%), Positives = 171/391 (43%), Gaps = 37/391 (9%)

Query: 240   GMLKRLKKAKVEVKK-SAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQ-EIK 297
             G  ++   AK+ V++    F K L+    V +G  + L  E++  +  + W K+G+  ++
Sbjct: 11195 GNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSCELNK-ERDVVWRKDGKIVVE 11253

Query: 298   PSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFT-ELFVKEPPVL---IVTPLE 353
                + V   +G  R LTIN     D   Y V V++         VK   V+   +V P+ 
Sbjct: 11254 KPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIR 11313

Query: 354   DQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQ 413
             DQ V        A +++++   + W K   E+  E + K      +DG    L   + + 
Sbjct: 11314 DQHVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTE--ILRDGNHLYLKIKNAMP 11371

Query: 414   EDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYK 473
             ED   Y V   G +  A+L + E+++E+L+ I D+T+   E A F  E+S+  + G+W  
Sbjct: 11372 EDIAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKL 11431

Query: 474   NGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEY- 532
              G  +RPS    I   G    L +  V+ +  G+  +         +A L   EI++++ 
Sbjct: 11432 KGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLY--QALNAITTAILTVKEIELDFA 11489

Query: 533   VPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRT 592
             VP ++                + V    + R +  +T E   +  W KG ++  +++   
Sbjct: 11490 VPLKD----------------VTVPERRQARFECVLTREANVI--WSKGPDIIKSSDKFD 11531

Query: 593   RI---EKRVDCSSFVIESAQREDEGRYTIKV 620
              I   +K +     VI  +Q +DEG YT +V
Sbjct: 11532 IIADGKKHI----LVINDSQFDDEGVYTAEV 11558



 Score = 93.6 bits (231), Expect = 1e-18
 Identities = 141/629 (22%), Positives = 246/629 (39%), Gaps = 109/629 (17%)

Query: 53   VFLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFSFKESHNS 112
            VF +KP  V    G D ++  +++G    +   + W K +     SK   +F     H  
Sbjct: 6459 VFTQKPSPVGALKGSDVILQCEISGTPPFE---VVWVKDRKQVRNSK---KFKITSKH-- 6510

Query: 113  ASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLESFKRTS 172
                +   LHI  +   D G Y  +   +   D+C  ++  + P             R  
Sbjct: 6511 ----FDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEP------------PRFV 6554

Query: 173  EKKSDTAGELDFSGLLKKREVVEEEKKKKKKDDDDLGIPP--EIWELLKGA--KKSEYEK 228
            +K SDT+  +     ++ R +VE             G  P   +W   +G   ++SE  +
Sbjct: 6555 KKLSDTSTLI--GDAVELRAIVE-------------GFQPISVVWLKDRGEVIRESENTR 6599

Query: 229  IAF-------QYGITDLRGMLKRLKKAKVE--VKKSAAFTKKLDPAYQVDR--------G 271
            I+F       Q G  +     K + + K +  +++ +A    L+PA  +++        G
Sbjct: 6600 ISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARIIEKPEPMTVTTG 6659

Query: 272  NKIKL-MVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAV 330
            N   L  V    P+L+ KWFK+G+E+   SK+    + K   L I    ++D   Y   V
Sbjct: 6660 NPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEV 6719

Query: 331  KD----EKCFTELFVKE--PPVLIVTPLEDQQVFVGDRVEMAVEVSEEG-AQVMWMKDGV 383
            K+      C   + V +   P   +  L+D    +G  V +   VS      V W +DG 
Sbjct: 6720 KNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGN 6779

Query: 384  ELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQV----ITNGGQCEAELIVEE--- 436
            E+      ++ +          L  S +   D G Y      +    +C A L V+E   
Sbjct: 6780 EIVSGPKCQSSF----SENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPS 6835

Query: 437  -----KQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGR 491
                   +EVL  ++ LT  +  +     +V       KW+K   E+ P +   IS    
Sbjct: 6836 FEQTPDSVEVLPGMS-LTFTSVIRGTPPFKV-------KWFKGSRELVPGESCNISLEDF 6887

Query: 492  FHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLN-FLEIKVEYVPKQEPPKIHLDCSGKTS 550
              +L + +V+P + GDY+ +    A S S   + F++    +V      K   D S +T 
Sbjct: 6888 VTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFV------KRLADFSVET- 6940

Query: 551  ENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQR 610
                    G+ + L+ + TG PP   +W+K DE   +   R  I      +   I  +  
Sbjct: 6941 --------GSPIVLEATYTGTPPISVSWIK-DEYLISQSERCSITMTEKSTILEILESTI 6991

Query: 611  EDEGRYTIKVTNPVGEDVASIFLQVVDVP 639
            ED  +Y+  + N  G+D+    + V++ P
Sbjct: 6992 EDYAQYSCLIENEAGQDICEALVSVLEPP 7020



 Score = 92.8 bits (229), Expect = 2e-18
 Identities = 113/454 (24%), Positives = 174/454 (38%), Gaps = 76/454 (16%)

Query: 717   NAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
             NA G    S+  K      P  +   L V  VT    TL W  P   G   I  Y+VE  
Sbjct: 29124 NASGTKAVSVMVKVLDSPGPCGK---LTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERR 29180

Query: 777   LEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIRE--- 833
                   WV    E      + V  L      +FRV  VN  G   P   ++P+  R    
Sbjct: 29181 ETSRLNWVIVEGE-CPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVE-SEPIVARNSFT 29238

Query: 834   IAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTK----GGAPLDTSRVHVR 889
             I  PP I            +VG          GK    + WTK    GG  +    V  R
Sbjct: 29239 IPSPPGIP----------EEVGT---------GKEHIIIQWTKPESDGGNEISNYLVDKR 29279

Query: 890   TSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVE------------------ 931
                  ++ + R     D   Y+  +++ ++ +    + RV                    
Sbjct: 29280 EKK--SLRWTR--VNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISC 29335

Query: 932   -----KAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN 986
                    GPP    V +    +  + W  P  DG ++I+GY ++  +K T +W+ V+   
Sbjct: 29336 REPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNA 29395

Query: 987   --RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKE-HD 1043
               R+T  TV DL +G +Y FRV   N+ G+S+    S++ A I       +P E  E  D
Sbjct: 29396 TIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSE---YSESIAEI-------EPVERIEIPD 29445

Query: 1044  FRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVL 1103
               +A      +  R   AG S  L  +V G P P + W K  +++    + +I   +   
Sbjct: 29446 LELADDLKKTVTIR---AGASLRLMVSVSGRPPPVITWSKQGIDLAS--RAIIDTTESYS 29500

Query: 1104  TLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
              L + + + +DAG YT  A N+ G+  A   ++V
Sbjct: 29501 LLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKV 29534



 Score = 91.7 bits (226), Expect = 4e-18
 Identities = 62/245 (25%), Positives = 116/245 (47%), Gaps = 7/245 (2%)

Query: 267  QVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
            +V  G+ ++L V++S   +   W K+GQE++PS +       +  +L I   T  D   Y
Sbjct: 2366 KVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNY 2425

Query: 327  EVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVS-EEGAQVMWMKDGVEL 385
               +      T   V    V ++TPL+D  V  G +  +  +VS  +   V W  +  ++
Sbjct: 2426 SFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQI 2485

Query: 386  TREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDI 445
              +D  +A  +    G +  L+ +     D G Y++I    +    L VE+  +++++ +
Sbjct: 2486 KPDDRVQAIVK----GTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVEK--IKIIRGL 2539

Query: 446  ADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDE 505
             DLT   ++  VF+ E+S   +   W     E++PS +  I   G+ +KL + ++  +DE
Sbjct: 2540 RDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDE 2599

Query: 506  GDYTF 510
            G YTF
Sbjct: 2600 GKYTF 2604



 Score = 91.3 bits (225), Expect = 5e-18
 Identities = 106/430 (24%), Positives = 163/430 (37%), Gaps = 59/430 (13%)

Query: 734   IAPTSEPLHLI-VEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVE 792
             + P S+P   I  +++   +  L W  P   G G I  Y +E        W    +  V 
Sbjct: 27654 LGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCSS-VA 27712

Query: 793   RCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIR 852
             R  F V NL   A   FRV   N  G      ++QP+    I    + R+P    +  I 
Sbjct: 27713 RTTFKVPNLVKDAEYQFRVRAENRYG------VSQPLVSSIIVAKHQFRIPGPPGKPVIY 27766

Query: 853   KV---GEQLNLVVPF------------QGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVF 897
              V   G  L    P             + K R  ++W K    ++TS +  R        
Sbjct: 27767 NVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQK----VNTSPISGRE------- 27815

Query: 898   FVRQAARSDSGEYELSVQIENMKDTA--------TIRIRVVEKAGPPINVMVKEVWGTNA 949
               R     +  +Y+  V  EN    +        T+ +  V+  G P  +   +V     
Sbjct: 27816 -YRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYI---DVTRETI 27871

Query: 950   LVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNV-YERNRHTSCTVSDLIVGNEYYFRVYT 1008
              ++W  P  DG S+I+GY ++K       W    +        TV+ L  G+ Y FR+  
Sbjct: 27872 TLKWNPPLRDGGSKIVGYSIEKRQGNE-RWVRCNFTDVSECQYTVTGLSPGDRYEFRIIA 27930

Query: 1009  ENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALN 1068
              N  G    P  S        +GI     E         P++   LI   + +G S  + 
Sbjct: 27931 RNAVGTISPPSQS--------SGIIMTRDENVPPIVEFGPEYFDGLI---IKSGESLRIK 27979

Query: 1069  CAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGE 1128
               V+G P P+V W K+ +EI +     IT+  G  +L +R  +    G YT  A N  G 
Sbjct: 27980 ALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGS 28039

Query: 1129  ALAECKLEVR 1138
             A AE K++V+
Sbjct: 28040 AKAEIKVKVQ 28049



 Score = 90.1 bits (222), Expect = 1e-17
 Identities = 105/434 (24%), Positives = 163/434 (37%), Gaps = 37/434 (8%)

Query: 710   EMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGID 769
             E ++   NA G    +++        P + P++++  DVT    T+ W+PP   G   + 
Sbjct: 17580 EYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINIL--DVTPEHMTISWQPPKDDGGSPVI 17637

Query: 770   GYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPV 829
              Y+VE      + W   ++    +    + +L  G   +FRV   N  G   P      V
Sbjct: 17638 NYIVEKQDTRKDTWGVVSSGS-SKTKLKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPTV 17696

Query: 830   TIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVR 889
                + + P     P     T I +    ++  +P      P   +      +    V V 
Sbjct: 17697 AKHKFSPPSP---PGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVN 17753

Query: 890   TSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIR--------IRVVEKAGPPINVMV 941
              +    + F R     +   YE  V  EN+   +            R ++  GPPIN  +
Sbjct: 17754 KTPIADLKF-RVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKPPGPPINPKL 17812

Query: 942   KEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEW--FNVYERNRHTSCTVSDLIVG 999
             K+     A + W  P  DG S I+GY V+     T +W   N  E  R  +  V  LI G
Sbjct: 17813 KDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEG 17872

Query: 1000  NEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVV 1059
             NEY FR+   NI G        +   R L   +  K       D    P+    +  R V
Sbjct: 17873 NEYRFRIKAANIVG--------EGEPRELAESVIAK-------DILHPPEVELDVTCRDV 17917

Query: 1060  VA---GYSAALNCAVRGHPKPKVVWMK-NKMEIREDPKFLITNYQGVLTLNIRRPSPFDA 1115
             +    G +  +   V+G P+P + W K  K+ +RE    LI +   V  L I+     D 
Sbjct: 17918 ITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRV-ELQIKEAVRADH 17976

Query: 1116  GTYTCRAVNELGEA 1129
             G Y   A N  G A
Sbjct: 17977 GKYIISAKNSSGHA 17990



 Score = 89.4 bits (220), Expect = 2e-17
 Identities = 103/435 (23%), Positives = 167/435 (38%), Gaps = 40/435 (9%)

Query: 709   YEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGI 768
             YE+++   NA+G +  ++  +      P   P+    + VT    TL WRPP   G   I
Sbjct: 26943 YELKLR--NAMGSASATIRVQILDKPGPPGGPIEF--KTVTAEKITLLWRPPADDGGAKI 26998

Query: 769   DGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQP 828
               Y+VE        W   + E +E C  T   +  G   +FRV  VN  G  EP      
Sbjct: 26999 THYIVEKRETSRVVWSMVS-EHLEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSV 27057

Query: 829   VTIREIAEPPKIRLPRHLRQT-------YIRKVGEQLNLVVPF--QGKPRPQVVWTKG-G 878
             V       P    +P   + T       + R + +  + +  +  + + +  + W K   
Sbjct: 27058 VAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLK 27117

Query: 879   APLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN 938
               +  +R  V     ++ +  R  A + +G+   S   E  K    I     +  GPP  
Sbjct: 27118 ETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPI-----DPPGPPAK 27172

Query: 939   VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN--RHTSCTVSDL 996
             + + +   ++  + W  P  DG S + GY V+    +  EW  V  +   R T   VS+L
Sbjct: 27173 IRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNL 27232

Query: 997   IVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLID 1056
               G  YYFRV   N  G  +   +++             P + K  D   AP+    +  
Sbjct: 27233 KPGVNYYFRVSAVNCAGQGEPIEMNE-------------PVQAK--DILEAPEIDLDVAL 27277

Query: 1057  RVVV---AGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPF 1113
             R  V   AG    +    +G P P V W K++  +  D ++ I N      L I + +  
Sbjct: 27278 RTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRN 27337

Query: 1114  DAGTYTCRAVNELGE 1128
             D G Y     N +GE
Sbjct: 27338 DTGKYILTIENGVGE 27352



 Score = 89.4 bits (220), Expect = 2e-17
 Identities = 134/655 (20%), Positives = 251/655 (38%), Gaps = 101/655 (15%)

Query: 23    KEAPPKEAPAEAPKEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPD 82
             K++  K   +   ++  P+   P + +P  V +      +V +   A    K  G+    
Sbjct: 32825 KKSDQKTTESTVTRKTEPKAPEPISSKP--VIVTGLQDTTVSSDSVAKFAVKATGEP--- 32879

Query: 83    KPTIKWFK-GKWLELGSKSGARFSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAK 141
             +PT  W K GK +  G K      +K S                    D+G + LE+   
Sbjct: 32880 RPTAIWTKDGKAITQGGK------YKLSE-------------------DKGGFFLEIHKT 32914

Query: 142   DTCDSCGFNIDVEAPRQDASGQ---SLESFKRTSEKKSDTAGELDFSGLLKKREVVEEE- 197
             DT DS  +   V+      S     ++++ K T  +K  T    + +   +K+ VV+EE 
Sbjct: 32915 DTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITP--QKKAVVQEEI 32972

Query: 198   ----------KKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGITDLRGMLKRLKK 247
                       K  + K  + L +  E  ++L   +  +    + +  I  +   + +  +
Sbjct: 32973 SQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSI--VHEEITKTSQ 33030

Query: 248   AKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENV 307
             A  EV+  A   K       ++ G ++ L   I+     +KW  NG E+  S +Y +   
Sbjct: 33031 ASEEVRTHAEI-KAFSTQMSINEGQRLVLKANIAGA-TDVKWVLNGVELTNSEEYRYGVS 33088

Query: 308   GKKRILTINKCTLADDAAYEVAVKDE----KCFTELF----VKEPPVLIVTPLEDQQVFV 359
             G  + LTI + +  D+       K +    KC  +L     + + P  I  P   Q +  
Sbjct: 33089 GSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQP-RSQNINE 33147

Query: 360   GDRVEMAVEVS-EEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGR 418
             G  V    E+S E   ++ W K+ + +    S  +     +    + L   +    D G+
Sbjct: 33148 GQNVLFTCEISGEPSPEIEWFKNNLPI----SISSNVSISRSRNVYSLEIRNASVSDSGK 33203

Query: 419   YQVITNG--GQCEAEL------IVEEKQLE-VLQDIADLTVKAS------EQAVFKCEVS 463
             Y +      GQC A        +VEE   E VL+   D +++ S      + +  K E S
Sbjct: 33204 YTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEAS 33263

Query: 464   DEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG--DYTFVPDGYALSLSA 521
                 +     +  E++ +  ++   +    +  ++       G  + T +    +  L A
Sbjct: 33264 FSSFSSSSASSMTEMKFAS-MSAQSMSSMQESFVEMSSSSFMGISNMTQLESSTSKMLKA 33322

Query: 522   KLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATW-LK 580
              +  +  K+E +P                   I +  G  L +  + TGEP P  TW   
Sbjct: 33323 GIRGIPPKIEALPSD-----------------ISIDEGKVLTVACAFTGEPTPEVTWSCG 33365

Query: 581   GDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQV 635
             G ++ +  +GR  IE   D ++ +I   Q++D G YT+ + N  G D A++ + +
Sbjct: 33366 GRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 33420



 Score = 89.0 bits (219), Expect = 2e-17
 Identities = 209/937 (22%), Positives = 336/937 (35%), Gaps = 129/937 (13%)

Query: 250  VEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPD-LTLKWFKNGQEIKPSSKYV----F 304
            V++K+   F  KL+ +  V  G   +L   I     + ++W K  +E+   S+ +     
Sbjct: 5604 VKLKEPPRFVSKLN-SLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFV 5662

Query: 305  ENVGKKRILTINKCTLADDAAYEVAVKDEKCFTE----LFVKEPPVLIVTPLEDQQVFVG 360
            ENV     L   K   A+   Y   +K++    E    L V EP V IV       V VG
Sbjct: 5663 ENVAT---LQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAV-IVEKAGPMTVTVG 5718

Query: 361  DRVEMAVEVS-EEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRY 419
            +   +  +V+      V W KDG  LT     K  + + K     IL    V ++D G Y
Sbjct: 5719 ETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSF-YNKISSLRIL---SVERQDAGTY 5774

Query: 420  --QVITNGGQCEAELIVEEKQLEV----LQDIADLTVKASEQAVFKCEVSDEK-VTGKWY 472
              QV  N G+     +V+     V     + + +         + +C+V+    ++  W+
Sbjct: 5775 TFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWF 5834

Query: 473  KNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEY 532
                ++    +   +       L ++ +   D G+YT V    A S   +          
Sbjct: 5835 HEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRA--------V 5886

Query: 533  VPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRT 592
            +  QEPP      S       + V+ G  +     I G PP    W +G       + R 
Sbjct: 5887 LTVQEPP------SFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGD-RC 5939

Query: 593  RIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGE 652
             I      +   + +      G YT  V+N  G+   +  L V +     + +   SV  
Sbjct: 5940 NIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDHSVEP 5999

Query: 653  DWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTE-----TTYESTKMIEGI 707
              +I++     Y G  P+           S  W K  F + T       T E T ++E I
Sbjct: 6000 GKSIIL--ESTYTGTLPI-----------SVTWKKDGFNITTSEKCNIVTTEKTCILE-I 6045

Query: 708  LYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGG 767
            L   +  A       +          +  T EP + + E             P     G 
Sbjct: 6046 LNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTE-----------LEPLEAAVG- 6093

Query: 768  IDGYLVEYCLEGSEE----WVPANTE----PVERCGFTVKNLPTGARILFRVVGVNIAGR 819
             D   ++  + G+ E    W   +T+    P  R  FT  N+ T   ++F  V +N +G 
Sbjct: 6094 -DSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFT-NNVAT---LVFNKVNINDSGE 6148

Query: 820  -----SEPATLAQPVTIREIAE---PPKI-RLPRHLRQTYIRKVGEQLNLVVPFQGKPRP 870
                       A   T+  I E   PP   R  + + QT    VG  + L     G    
Sbjct: 6149 YTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQT----VGLPVTLTCRLNGSAPI 6204

Query: 871  QVVWTKGGAPLDTSRVHVRTSDFDTVFFVR--QAARSDSGEYELSVQIENMKDTATIRIR 928
            QV W + G  L     +++TS  D V  ++  Q   S SG+Y  S        +++ R+ 
Sbjct: 6205 QVCWYRDGVLLRDDE-NLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLT 6263

Query: 929  VVEKAGPPI----NVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYE 984
              E    P      V +  + G +A  E         ++ M     K +K+     N   
Sbjct: 6264 AREPKKSPFFDIKPVSIDVIAGESADFECHVT----GAQPMRITWSKDNKEIRPGGNY-- 6317

Query: 985  RNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDF 1044
                   T++   VGN  + R+      G  DS   +      +   +       KE   
Sbjct: 6318 -------TIT--CVGNTPHLRILK---VGKGDSGQYTCQATNDVGKDMCSAQLSVKE--- 6362

Query: 1045 RMAPKFLTPL-IDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVL 1103
               PKF+  L   +V   G S  L C + G P+ KV W +N  E+ E  K+ ++    V 
Sbjct: 6363 --PPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVA 6420

Query: 1104 TLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVRVP 1140
             L I   S  D+G Y C A N +G+A     L V+ P
Sbjct: 6421 LLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAP 6457



 Score = 88.2 bits (217), Expect = 4e-17
 Identities = 106/434 (24%), Positives = 168/434 (38%), Gaps = 44/434 (10%)

Query: 713   VFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYL 772
             + AVN +G +   M         P   P+    E V+    TL W PP   G   I  Y+
Sbjct: 16196 ITAVNNLGTASKEMRLNVLGRPGPPVGPIKF--ESVSADQMTLSWFPPKDDGGSKITNYV 16253

Query: 773   VEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIR 832
             +E      + WV  ++EP E C +T+  L  G   +FR++  N  G  EP   ++P T R
Sbjct: 16254 IEKREANRKTWVHVSSEPKE-CTYTIPKLLEGHEYVFRIMAQNKYGIGEPLD-SEPETAR 16311

Query: 833   EIAEPPKIRLPRHLRQTYIRKVGEQLNLVVP-FQGKPRPQVVWTKGGAPLDTSRVHVRTS 891
              +   P    P     + + +    +N   P + G       W +     DT+    +  
Sbjct: 16312 NLFSVPGA--PDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLE---MKDTTSKRWKRV 16366

Query: 892   DFDTVFFV------RQAARSDSGEYELSVQIENM---------KDTATIRIRVVEKAGPP 936
             + D +  +      +     +  +Y+  V   N           D AT R  +    GPP
Sbjct: 16367 NRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPP-GPP 16425

Query: 937   INVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN-RHTSCTVSD 995
                 V +   ++A +EW  P  DG S++ GY V+  ++   EW    ++  R T   V+ 
Sbjct: 16426 FP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTG 16484

Query: 996   LIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLI 1055
             L  G  Y FRV   NI G+ + PG   +              E K+       +    + 
Sbjct: 16485 LKEGAFYKFRVRAVNIAGIGE-PGEVTDV------------IEMKDRLVSPDLQLDASVR 16531

Query: 1056  DRVVV-AGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFD 1114
             DR+VV AG    +   V G P P V W  N+  + ++     T      ++ I+      
Sbjct: 16532 DRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISS--SMVIKNCQRSH 16589

Query: 1115  AGTYTCRAVNELGE 1128
              G Y+  A NE GE
Sbjct: 16590 QGVYSLLAKNEAGE 16603



 Score = 88.2 bits (217), Expect = 4e-17
 Identities = 118/461 (25%), Positives = 169/461 (36%), Gaps = 66/461 (14%)

Query: 704   IEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRI 763
             I+G  Y +R  A N  G     +N K      P   P+   V  VT    +L W PP + 
Sbjct: 23691 IDGGQYILR--ASNVAGSKSFPVNVKVLDRPGPPEGPVQ--VTGVTSEKCSLTWSPPLQD 23746

Query: 764   GAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPA 823
             G   I  Y+VE        W    +E V      V  L  G   +FR++ VN  G  EP 
Sbjct: 23747 GGSDISHYVVEKRETSRLAWTVVASEVVTN-SLKVTKLLEGNEYVFRIMAVNKYGVGEPL 23805

Query: 824   TLAQPVTIREIAEPPKIRLPRHLRQTYIRKVG--------------EQLNLVVPFQGKPR 869
               A  +       P     P+ L  T I K                E +  +V  + + R
Sbjct: 23806 ESAPVLMKNPFVLPGP---PKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIV--EKRDR 23860

Query: 870   PQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDT-----AT 924
               + W K     +  R+        T   +R    ++  EYE  V  EN         AT
Sbjct: 23861 SGIRWIK----CNKRRI--------TDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPAT 23908

Query: 925   IRIRVVE---KAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQ--KADKKTMEW 979
             +  +  +   K GPP N  + +    +  + W  P  DG SEI+GY V+  KAD++  + 
Sbjct: 23909 VYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQI 23968

Query: 980   FNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEY 1039
                    R T   +S L    EY  RV   N  GL ++  V               P   
Sbjct: 23969 VTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSV---------------PGTV 24013

Query: 1040  KEHDFRMAPKFLTPLIDR---VVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLI 1096
             K  D   AP+       R   VV AG SA ++   +G P P++ W + + E  +  K  I
Sbjct: 24014 KPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTD--KVQI 24071

Query: 1097  TNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
                     L+I      DAG Y  +  N  G   A   ++V
Sbjct: 24072 EKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKV 24112



 Score = 87.8 bits (216), Expect = 5e-17
 Identities = 93/420 (22%), Positives = 167/420 (39%), Gaps = 32/420 (7%)

Query: 248  AKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENV 307
            AK+ V+      + +    QV    +  +  E+++ D+   W+K+G EI    +   + V
Sbjct: 3138 AKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYV 3197

Query: 308  GKKRI--LTINKCTLADDAAYEVAVKDEKCFTELFVKEP-PVLIVTPLEDQQVFVGDRVE 364
             ++RI  + I++   +D   Y       +    L+V  P P  ++  L+   V  G    
Sbjct: 3198 VERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPAR 3257

Query: 365  MAVEVS-EEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQED-------- 415
                +S     ++ W K+  E      FK +  F  DG+ + L+  +   ED        
Sbjct: 3258 FCAVISGRPQPKISWYKE--EQLLSTGFKCK--FLHDGQEYTLLLIEAFPEDAAVYTCEA 3313

Query: 416  RGRYQVITNGGQCEAEL---IVEEKQLEV-----LQDIADLTVKASEQAVFKCEVSDEKV 467
            +  Y V T       E+   +  ++++ V     +  + D      + A F+C VS   +
Sbjct: 3314 KNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDL 3373

Query: 468  TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNF-L 526
               WY    +++PS+   ++     ++L I +  PEDEG YTFV       +S+  N  L
Sbjct: 3374 KVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSL 3433

Query: 527  EIKVEYVPKQEPPKIHLDCSG----KTSENAIVVVAGNKLRLDVSITGEPPPVATWLK-G 581
            E     + ++   +I ++       K     + V  G+  +    I   P     W K G
Sbjct: 3434 EAPESILHERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAG 3493

Query: 582  DEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDP 641
             E++ + +   R  K +  SS  I   Q  D G YT K +N  G    +  L V +   P
Sbjct: 3494 REIYESDKCSIRSSKYI--SSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPP 3551



 Score = 87.4 bits (215), Expect = 7e-17
 Identities = 103/433 (23%), Positives = 161/433 (37%), Gaps = 50/433 (11%)

Query: 715   AVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
             A N  G    ++N K      P   P+  ++  VT    TL W+PP + G   I  Y+VE
Sbjct: 22618 AKNVAGERSVTVNVKVLDRPGPPEGPV--VISGVTAEKCTLAWKPPLQDGGSDIINYIVE 22675

Query: 775   YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAG-----RSEPATLAQPV 829
                     W   +   V+     V  L  G    FR++ VN  G      SEP     P 
Sbjct: 22676 RRETSRLVWTVVDAN-VQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPF 22734

Query: 830   TIREIAEPPKIRLPRHLRQTYI----RKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSR 885
              + +  + P++          +       G    L    + + +  + WT         R
Sbjct: 22735 VVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWT---------R 22785

Query: 886   VHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIR--------IRVVEKAGPPI 937
              H R         +R     ++ +YE  V  EN    +              + K GPP 
Sbjct: 22786 CHKRLIG---ELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPN 22842

Query: 938   NVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN--RHTSCTVSD 995
             N  V ++  ++  + W  P  DG  EI GY V+K D    EW           T+  V  
Sbjct: 22843 NPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEK 22902

Query: 996   LIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLI 1055
             L+  +EY FR+   N  G+ +   V           I  +  E  + D  +    L  +I
Sbjct: 22903 LLEKHEYNFRICAINKAGVGEHADVPGPI-------IVEEKLEAPDIDLDLE---LRKII 22952

Query: 1056  DRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLIT-NYQGVLTLNIRRPSPFD 1114
             +  + AG S  L   ++G P P+V W K   EIR+     +T ++  ++  N+ R   +D
Sbjct: 22953 N--IRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTSLVLDNVNR---YD 23007

Query: 1115  AGTYTCRAVNELG 1127
             +G YT    N  G
Sbjct: 23008 SGKYTLTLENSSG 23020



 Score = 87.4 bits (215), Expect = 7e-17
 Identities = 98/404 (24%), Positives = 147/404 (36%), Gaps = 63/404 (15%)

Query: 713   VFAVNAIGVSQPSMNT----KPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGI 768
             V A N+ G +  +++     KP  P+ P         ++V+     + W PP   G   I
Sbjct: 24384 VTATNSAGTATENLSVIVLEKPGPPVGPVR------FDEVSADFVVISWEPPAYTGGCQI 24437

Query: 769   DGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQP 828
               Y+VE     +  W   +   V R    +  L TG    FR+   N  G+S P      
Sbjct: 24438 SNYIVEKRDTTTTTWHMVSAT-VARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAV 24496

Query: 829   VTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLV---------------VPFQGKPRPQVV 873
             +      EP     P      ++  + +   LV                  + K +  ++
Sbjct: 24497 IVQYPFKEPGPPGTP------FVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSIL 24550

Query: 874   WTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSG-EYELSVQIENM----KDTATIRIR 928
             W K       ++  ++ + F T          D G EYE  V  EN+    K +      
Sbjct: 24551 WVK------LNKTPIQDTKFKTTGL-------DEGLEYEFKVSAENIVGIGKPSKVSECF 24597

Query: 929   VV-EKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN- 986
             V  +   PP       +   N  ++W+ P  DG S+I GY V+K D     W      N 
Sbjct: 24598 VARDPCDPPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNV 24657

Query: 987   RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRM 1046
               T  TVS L+    Y FRV   N  G    P  S          IT +  E    +  +
Sbjct: 24658 LETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGA-------ITARD-EIDAPNASL 24709

Query: 1047  APKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIRE 1090
              PK+   +   VV AG +  L   +RG P P VVW K+  E+ E
Sbjct: 24710 DPKYKDVI---VVHAGETFVLEADIRGKPIPDVVWSKDGKELEE 24750



 Score = 86.7 bits (213), Expect = 1e-16
 Identities = 91/398 (22%), Positives = 151/398 (37%), Gaps = 28/398 (7%)

Query: 633   LQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEV 692
             L  +D P  P  + IT        L W  P Y GG  +T Y+VE++   + RW+K NF  
Sbjct: 21354 LDPIDPPGKPVPLNIT---RHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSN 21410

Query: 693   FTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTT 752
               E  +  + + E   YE RV A NA G   P       +      E   + V+     T
Sbjct: 21411 ILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDT 21470

Query: 753   TTLKWRPPNRIGA--GGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFR 810
               LK     R+ A   G     +E+  +G E    A  E ++   F+   +   +    R
Sbjct: 21471 VILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLE-IKIADFSTNLVNKDS--TRR 21527

Query: 811   VVGVNIAGRSEPATLAQPV-TIREIAEPPKIRLPRHLRQTYIRKV-----------GEQL 858
               G      + P   A+ +  ++ +  P     P  + +    K            G ++
Sbjct: 21528 DSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKI 21587

Query: 859   NLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIEN 918
             +  +  Q +   ++ WT   + +  +++ V        +  R  A +  G        E 
Sbjct: 21588 DHYI-VQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVG------EP 21640

Query: 919   MKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTME 978
             ++    + +       PP N  V  +   + +V W  P  DG SEI+ Y V++ DK    
Sbjct: 21641 LESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQR 21700

Query: 979   WFNVYERN-RHTSCTVSDLIVGNEYYFRVYTENICGLS 1015
             W    ++        VS L  G+EY FR+  EN  G+S
Sbjct: 21701 WIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGIS 21738



 Score = 86.7 bits (213), Expect = 1e-16
 Identities = 227/1140 (19%), Positives = 382/1140 (33%), Gaps = 202/1140 (17%)

Query: 83    KPT--IKWF-KGKWLELGSK------SGA-RFSFKESHNSASNVYTVELHIGKVVLGDRG 132
             KPT  +KW+  G  L+  SK      SG       + H   S  Y       K    D  
Sbjct: 32400 KPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASD-- 32457

Query: 133   YYRLEVKAKDTCDSCGFNIDVEAPRQ------DASGQSLESFKRTSEKKSDTAGELDFSG 186
             Y  L+V   D         D E PR            ++ SFK+TSE ++ ++     S 
Sbjct: 32458 YATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQ 32517

Query: 187   LLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGITDLRGMLKRLK 246
             + + RE +   +     +     +  +  E     +KS   KI      T    +L + +
Sbjct: 32518 MTETRESLSSYEHSASAEMKSAALEEKSLE-----EKSTTRKIK----TTLAARILTKPR 32568

Query: 247   KAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFEN 306
                V   +SA F+   D                  +P  T+ W + GQ +  S+++    
Sbjct: 32569 SMTVYEGESARFSCDTD-----------------GEPVPTVTWLRKGQVLSTSARHQVTT 32611

Query: 307   VGKKRILTINKCTLADDAAYEVAV-----KDEKCFTELFVKEPPVLIVTPLEDQQVFVGD 361
                K    I+    +D+  Y V V     K E  FT    K         + ++ V    
Sbjct: 32612 TKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQK-------ARVTEKAVTSPP 32664

Query: 362   RVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQV 421
             RV+                    +   ++ K+  R K     H    S    +     +V
Sbjct: 32665 RVKSPEP---------------RVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKV 32709

Query: 422   ITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPS 481
                      + I +  + E  ++IA LT       +   EV+       WYK+G +++ +
Sbjct: 32710 QHLPVSAPPK-ITQFLKAEASKEIAKLTCVVESSVLRAKEVT-------WYKDGKKLKEN 32761

Query: 482   KRITISH-VGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLE----------IKV 530
                   +     ++L I+++   D+G+Y     G   +    L F+            K+
Sbjct: 32762 GHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKI 32821

Query: 531   EYVPKQEPPKIHLDCSGKTSENAI-------VVVAG---------NKLRLDVSITGEPPP 574
                 K +        + KT   A        V+V G         +  +  V  TGEP P
Sbjct: 32822 SETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRP 32881

Query: 575   VATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQ 634
              A W K  +  T   G+ ++ +        I      D G YT  V N  G   +S  L 
Sbjct: 32882 TAIWTKDGKAITQG-GKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLT 32940

Query: 635   VVDVPDPPEAVRITS------VGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKL 688
             +  + D  EA ++++        +  A++  E       K +    ++  +  SQ  + L
Sbjct: 32941 IKAIKDT-EAQKVSTQKTSEITPQKKAVVQEEISQ----KALRSEEIKMSEAKSQEKLAL 32995

Query: 689   NFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNT------KPFMPIAPTSEPLH 742
               E       E  K       E  +        SQ S         K F      +E   
Sbjct: 32996 KEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQR 33055

Query: 743   LIVEDVTDTTTTLKW---------RPPNRIGAGGIDGYLV----EYCLEGSEEWVPANTE 789
             L+++      T +KW             R G  G D  L      +  EG    +    E
Sbjct: 33056 LVLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKE 33115

Query: 790   PVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQT 849
              + +C + +    T ++ L             PA ++QP                  R  
Sbjct: 33116 GIVKCQYDL----TLSKEL----------SDAPAFISQP------------------RSQ 33143

Query: 850   YIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLD-TSRVHVRTSDFDTVFFVRQAARSDSG 908
              I + G+ +       G+P P++ W K   P+  +S V +  S       +R A+ SDSG
Sbjct: 33144 NINE-GQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSG 33202

Query: 909   EYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYF 968
             +Y +  +    + +AT  + V+     P   +V    G  +L                  
Sbjct: 33203 KYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSL----------QGSFSSQS 33252

Query: 969   VQKADKKTMEWFNVYERNRHTSCT--------VSDLIVGNEYYFRVYTENICGLSDSPGV 1020
             VQ +  K    F+ +  +  +S T           +    E +  + + +  G+S+   +
Sbjct: 33253 VQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQL 33312

Query: 1021  SKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVV 1080
               +T+++LK GI   P           PK      D  +  G    + CA  G P P+V 
Sbjct: 33313 ESSTSKMLKAGIRGIP-----------PKIEALPSDISIDEGKVLTVACAFTGEPTPEVT 33361

Query: 1081  WM--KNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVR 1138
             W     K+  +E  +F I N   + TL I      D G YT    NE G   A   + +R
Sbjct: 33362 WSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIR 33421



 Score = 84.7 bits (208), Expect = 4e-16
 Identities = 109/433 (25%), Positives = 158/433 (36%), Gaps = 52/433 (12%)

Query: 717   NAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
             N  G    ++N K      P + PL   +  +T    +L W  P   G   ID Y+VE  
Sbjct: 25866 NVAGTRSVAVNCKVLDKPGPPAGPLE--INGLTAEKCSLSWGRPQEDGGADIDYYIVEKR 25923

Query: 777   LEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAE 836
                   W     E ++     V  L  G   +FRV GVN  G  EP    + V I+ +  
Sbjct: 25924 ETSHLAWTICEGE-LQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPL---ESVAIKALDP 25979

Query: 837   PPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSD---- 892
                   P  L  T + K  E + L        RP+   + GG+ +    +  R  +    
Sbjct: 25980 FTVPSPPTSLEITSVTK--ESMTLCWS-----RPE---SDGGSEISGYIIERREKNSLRW 26029

Query: 893   --------FDTVFFVRQAARSDSGEYELSVQIEN-----MKDTATIRIRVVEKA---GPP 936
                     +D    V+     +  EYE  V  EN     +    +  IR  +      PP
Sbjct: 26030 VRVNKKPVYD--LRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPP 26087

Query: 937   INVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDL 996
                 + +   T   + W  P  DG + I GY V+       +W    +  R T  T+S L
Sbjct: 26088 SKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTSIQSLRGTEYTISGL 26147

Query: 997   IVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLID 1056
               G EY FRV + N  G SD    S    +I K          +E  F +  +    LI 
Sbjct: 26148 TTGAEYVFRVKSVNKVGASDPSDSSD--PQIAKE-------REEEPLFDIDSEMRKTLI- 26197

Query: 1057  RVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAG 1116
               V AG S  +    RG P P V+W K   ++R   +  +       +L I   +  D+G
Sbjct: 26198 --VKAGASFTMTVPFRGRPVPNVLWSKPDTDLR--TRAYVDTTDSRTSLTIENANRNDSG 26253

Query: 1117  TYTCRAVNELGEA 1129
              YT    N L  A
Sbjct: 26254 KYTLTIQNVLSAA 26266



 Score = 84.3 bits (207), Expect = 6e-16
 Identities = 200/926 (21%), Positives = 340/926 (36%), Gaps = 134/926 (14%)

Query: 286   TLKWFK-NGQEIKPSSKYVFENV--GKKRILTINKCTLADDAAYEVAVKDEKCFTELFV- 341
             T KW + N + IK     V E V   K+ +L +        A   + V +    +E  V 
Sbjct: 14328 TEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVR-------AVNAIGVSEPSEISENVVA 14380

Query: 342   KEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQV---MWMKDGVELTREDSFKARYRFK 398
             K+P       LE   + V +  ++++ V      V    W KDG E+   D    R   K
Sbjct: 14381 KDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASD----RLTMK 14436

Query: 399   KDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVF 458
              D     L     V+ D G Y +        A   +  K + +     D  +KAS+    
Sbjct: 14437 NDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKD--IKASDITKS 14494

Query: 459   KCEVSDEKVTGKWYKNGVEV--------RPSKRITISHVGRFHKL--VIDDVRPEDEGDY 508
              C+++ E      +  G  +           +R  I  +   +KL   + D+ P   G+Y
Sbjct: 14495 SCKLTWEPPE---FDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPN--GEY 14549

Query: 509   TFVPDGYALSLSAKLNFLEIKVEYV---PKQEP-PKIHLDCSGKTSENAIVVVAGNKLRL 564
              F     A++      ++E+K   +   PKQ P P + ++    T+E             
Sbjct: 14550 FFRVK--AVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEA------------ 14595

Query: 565   DVSITGEPPPV--ATWLKGDEVFTTTEGRTRI----EKRVDCSSFVIESAQREDEGRYTI 618
              ++IT +PP     + + G  +    +G  R     E  V   ++  +  +   E ++ +
Sbjct: 14596 -MTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRV 14654

Query: 619   KVTNPVG---EDVASIFLQVVDVPDPPEAVRITSV---------------GEDWAILVWE 660
             +  N  G      A+   + VD  D P+ +  TS+               G  +  + W 
Sbjct: 14655 RAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYPTITWI 14714

Query: 661   PP----MYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGIL-------- 708
                   + +  K     LV R+K   Q        +    + +++K  E  L        
Sbjct: 14715 KDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRP 14774

Query: 709   ----YEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIG 764
                 Y ++V   N  G+++            P   P++ + ED+  T+   KW PP   G
Sbjct: 14775 DHGLYMIKV--ENDHGIAKAPCTVSVLDTPGP---PINFVFEDIRKTSVLCKWEPPLDDG 14829

Query: 765   AGGIDGYLVEYC--LEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEP 822
                I  Y +E     +   EW+   T  +  C ++V  L  G   LFRV   N  G   P
Sbjct: 14830 GSEIINYTLEKKDKTKPDSEWIVV-TSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPP 14888

Query: 823   ATLAQPVTIREIAEPP----KIRLPRHLRQTYIRKVGEQLNLVVPFQG-----KPRPQVV 873
               +++P+  ++   PP    K  +      + + K  E  +   P  G     +      
Sbjct: 14889 C-VSKPLVAKDPFGPPDAPDKPIVEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTH 14947

Query: 874   WTK-GGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEK 932
             W++   + L+  + +V        +  R  A + +G  + S       D  T     +  
Sbjct: 14948 WSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPP----SDPKTAH-DPISP 15002

Query: 933   AGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN-RHTSC 991
              GPPI   V +   T   +EW+ P  +G  EI+GYFV K    T EW    E+  +    
Sbjct: 15003 PGPPIP-RVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQY 15061

Query: 992   TVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFL 1051
             TV ++  G +Y  RV   N  G    PG ++            +P E    +  ++ K  
Sbjct: 15062 TVKEIREGADYKLRVSAVNAAG-EGPPGETQPVT-------VAEPQEPPAVELDVSVKGG 15113

Query: 1052  TPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPS 1111
                    ++AG +  +   V G P P  VW K + E+ +D + +I N      L I+   
Sbjct: 15114 IQ-----IMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKD-RVVIDNVGTKSELIIKDAL 15167

Query: 1112  PFDAGTYTCRAVNELGEALAECKLEV 1137
               D G Y   A N  G   A  ++EV
Sbjct: 15168 RKDHGRYVITATNSCGSKFAAARVEV 15193



 Score = 84.3 bits (207), Expect = 6e-16
 Identities = 117/447 (26%), Positives = 169/447 (37%), Gaps = 58/447 (12%)

Query: 715   AVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
             A N  G ++   N K      P   PL   V +VT     L W PP   G   ID Y+V+
Sbjct: 21536 ATNPGGFAKHIFNVKVLDRPGPPEGPL--AVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQ 21593

Query: 775   YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREI 834
                     W    +E V+     V  L  G   +FRV+ VN  G  EP   ++PV     
Sbjct: 21594 KRETSRLAWTNVASE-VQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLE-SEPVLAVNP 21651

Query: 835   AEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFD 894
               PP    P++   T I K     + +V   G P      + GG+ +    V  R     
Sbjct: 21652 YGPPDP--PKNPEVTTITK-----DSMVVCWGHPD-----SDGGSEIINYIVERRDKAGQ 21699

Query: 895   ----------TVFFVRQAARSDSGEYELSVQIENMKDTATIR--------IRVVEKAGPP 936
                       T    + +  ++  EYE  +  EN    +              V K GPP
Sbjct: 21700 RWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFKPGPP 21759

Query: 937   INVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN--RHTSCTVS 994
              N  V +   ++  + W  P  DG SEI GY V+ A  +  EW  V      + TS T++
Sbjct: 21760 GNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTIT 21819

Query: 995   DLIVGNEYYFRVYTENICGLSDS---PGVSKNTARILKTGITFKPFEYKEHDFRMAPKFL 1051
              L    EY  R+Y  N  GL +    PG  K   R+L   I        + D R   K +
Sbjct: 21820 GLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIEL------DADLR---KVV 21870

Query: 1052  TPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLIT-NYQGVLTLNIRRP 1110
             T      + A  +  L   ++G P P+V W ++  E  +      T +Y  ++  N+ R 
Sbjct: 21871 T------IRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIESTSSYTLLIVGNVNR- 21923

Query: 1111  SPFDAGTYTCRAVNELGEALAECKLEV 1137
               FD+G Y     N  G   A   + V
Sbjct: 21924 --FDSGKYILTVENSSGSKSAFVNVRV 21948



 Score = 84.3 bits (207), Expect = 6e-16
 Identities = 106/412 (25%), Positives = 143/412 (34%), Gaps = 70/412 (16%)

Query: 747   DVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGAR 806
             ++T    TL W  P   G   I  Y++E        W     +  E   +T   L  G  
Sbjct: 28063 NITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIE-DKCEAQSYTAIKLINGNE 28121

Query: 807   ILFRVVGVNIAGRSEPATLAQPVTIR---EIAEPPKIRLPRHLRQTYIRKV--------G 855
               FRV  VN  G   P   + PV  +    + + P I  P ++    I           G
Sbjct: 28122 YQFRVSAVNKFGVGRPLD-SDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGG 28180

Query: 856   EQLNLVVPFQGKPRPQVVWTK--GGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELS 913
              ++   +  + + +    W K     P+  +R  V                ++  EYE  
Sbjct: 28181 SEIQQYI-LERREKKSTRWVKVISKRPISETRFKV-------------TGLTEGNEYEFH 28226

Query: 914   VQIENMKDTAT-------IRIRV-VEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIM 965
             V  EN             I+ R  V   GPP  V V +   T   +EW  P  DG  EI+
Sbjct: 28227 VMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEII 28286

Query: 966   GYFVQKADKKTMEWFNVY-ERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDS------- 1017
             GY ++       +W  V  E    T  TV+DL  G EY FRV   N  G  DS       
Sbjct: 28287 GYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTI 28346

Query: 1018  PGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKP 1077
               V + TA  L     FK                      VV AG S  L  A +G P P
Sbjct: 28347 KAVDRLTAPELDIDANFKQ-------------------THVVRAGASIRLFIAYQGRPTP 28387

Query: 1078  KVVWMK--NKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELG 1127
               VW K  + + +R D    I       TL +   +  DAG YT    N  G
Sbjct: 28388 TAVWSKPDSNLSLRAD----IHTTDSFSTLTVENCNRNDAGKYTLTVENNSG 28435



 Score = 84.0 bits (206), Expect = 8e-16
 Identities = 108/447 (24%), Positives = 166/447 (37%), Gaps = 71/447 (15%)

Query: 720   GVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEG 779
             G  Q ++  +P  P+ P S       ++VT     + W+PP   G   I  Y++E    G
Sbjct: 16902 GFCQVNVVDRPGPPVGPVS------FDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEVG 16955

Query: 780   SEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPK 839
              + W+P  T    +    V  L  G   +FR+   N+ G S+P      +    +    +
Sbjct: 16956 KDVWMPV-TSASAKTTCKVSKLLEGKDYIFRIHAENLYGISDP------LVSDSMKAKDR 17008

Query: 840   IRLPRHLRQTYIRKVGEQLNLVV---PFQG-KPRPQVV------WTKGGAPLDTSRVHVR 889
              R+P    Q  + +V +   LV    P  G KP    +       +K  A +    +H  
Sbjct: 17009 FRVPDAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKRETMSKRWARVTKDPIHPY 17068

Query: 890   TSDFDTVFFVRQAARSDSGEYELSVQIEN---MKDTATIRIRV-----VEKAGPPINVMV 941
             T         R     +  +YE  V  EN   + D +     V     + K  PP+N   
Sbjct: 17069 TK-------FRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEA 17121

Query: 942   KEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHT--SCT-----VS 994
              +    +  + WQ P+ DG S+I+GY V+       EW     R  HT  SC      V+
Sbjct: 17122 IDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEW----RRANHTPESCPETKYKVT 17177

Query: 995   DLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFL--- 1051
              L  G  Y FRV   N  G SD   V +             P   K+   R+ P  L   
Sbjct: 17178 GLRDGQTYKFRVLAVNAAGESDPAHVPE-------------PVLVKD---RLEPPELILD 17221

Query: 1052  -TPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRP 1110
                  ++ +  G +  L+  ++G P PKV W K   +     +  +T       L IR  
Sbjct: 17222 ANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGS--KLEIRNA 17279

Query: 1111  SPFDAGTYTCRAVNELGEALAECKLEV 1137
             +  D G Y+    N  G      K+ V
Sbjct: 17280 AHEDGGIYSLTVENPAGSKTVSVKVLV 17306



 Score = 84.0 bits (206), Expect = 8e-16
 Identities = 61/234 (26%), Positives = 102/234 (43%), Gaps = 24/234 (10%)

Query: 896   VFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQA 955
             +++ R  A ++ G   + V +E +       ++  E   PP  V + +V  T+A + W+ 
Sbjct: 24184 IYYFRVMAENEFG---VGVPVETVD-----AVKAAEPPSPPGKVTLTDVSQTSASLMWEK 24235

Query: 956   PKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLS 1015
             P+ DG S ++GY V+   K T +W  V E ++  +  V+ L  G EY FRV   N  G S
Sbjct: 24236 PEHDGGSRVLGYVVEMQPKGTEKWSIVAE-SKVCNAVVTGLSSGQEYQFRVKAYNEKGKS 24294

Query: 1016  DSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHP 1075
             D         R+L   +  K       D  + P    P     + AG    +   V G P
Sbjct: 24295 DP--------RVLGVPVIAK-------DLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRP 24339

Query: 1076  KPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEA 1129
             +P + W+K+   +++  +  +        L+I+  +  D G YT  A N  G A
Sbjct: 24340 RPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTA 24393



 Score = 82.8 bits (203), Expect = 2e-15
 Identities = 100/415 (24%), Positives = 149/415 (35%), Gaps = 52/415 (12%)

Query: 745   VEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTG 804
             + D+     +L W  P   G   I  Y+VE C     +WV A    V +    V  L  G
Sbjct: 19001 ISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALAS-VTKTSCRVGKLIPG 19059

Query: 805   ARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKV---------- 854
                +FRV   N  G SEP T  + V       P +   P++ R T + K           
Sbjct: 19060 QEYIFRVRAENRFGISEPLTSPKMVAQFPFGVPSE---PKNARVTKVNKDCIFVAWDRPD 19116

Query: 855   --GEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYEL 912
               G    +    + K R  ++W K    L      VR++++     V      +  EY  
Sbjct: 19117 SDGGSPIIGYLIERKERNSLLWVKANDTL------VRSTEYPCAGLV------EGLEYSF 19164

Query: 913   SVQIENM-------KDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIM 965
              +   N        K T  +  R+     PP    V +V  +   + W  PK DG S+I+
Sbjct: 19165 RIYALNKAGSSPPSKPTEYVTARM--PVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKII 19222

Query: 966   GYFVQKADKKTMEWFNVYERNRHT---SCTVSDLIVGNEYYFRVYTENICGLSDSPGVSK 1022
             GYFV+       +W               T + L    +Y FR        +S  P    
Sbjct: 19223 GYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISP-PSEPS 19281

Query: 1023  NTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWM 1082
             +   IL   +          D  +A K L       V AG +  L+  V G P P V W 
Sbjct: 19282 DPVTILAENVP------PRIDLSVAMKSLL-----TVKAGTNVCLDATVFGKPMPTVSWK 19330

Query: 1083  KNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
             K+   ++      +   + + TL +   +  D+G YT  A N  G   A  KL+V
Sbjct: 19331 KDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKV 19385



 Score = 82.8 bits (203), Expect = 2e-15
 Identities = 92/405 (22%), Positives = 156/405 (38%), Gaps = 35/405 (8%)

Query: 745   VEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTG 804
             +++V+  + T+ W PP   G   I  Y+VE     S  W   + + V R    +  L TG
Sbjct: 25496 IDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVS-QAVARTSIKIVRLTTG 25554

Query: 805   ARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQT-------YIRKVGEQ 857
             +   FRV   N  G+S  +  +  V     + P     P+ +  T       +   V + 
Sbjct: 25555 SEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDG 25614

Query: 858   LNLVVPF--QGKPRPQVVWTKGGAPLDT-SRVHVRTSDFDTVFFVRQAARSDSGEYELSV 914
              + V+ +  + K R  ++W+K    L   +++ V   D   ++  R  A + +G  + S 
Sbjct: 25615 GSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSK 25674

Query: 915   QIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADK 974
               E         +   +   PP    V  +   +  ++W  P  DG ++I GY V++ + 
Sbjct: 25675 SCEP--------VPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERREL 25726

Query: 975   KTMEWFNV-YERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGIT 1033
                 W    Y   + T   V++L     Y FRV+  N       P  S++T  I+     
Sbjct: 25727 PDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEP--SESTGPIIVKDDV 25784

Query: 1034  FKPFEYKEHDFRMAPKFLTPLIDRVVV-AGYSAALNCAVRGHPKPKVVWMKNKMEIREDP 1092
               P    +  FR          D +VV AG    +N  + G P P + W K+ +EI E  
Sbjct: 25785 EPPRVMMDVKFR----------DVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERA 25834

Query: 1093  KFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELG--EALAECKL 1135
             +  I +      L ++     D G Y     N  G       CK+
Sbjct: 25835 RTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKV 25879



 Score = 77.8 bits (190), Expect = 5e-14
 Identities = 95/402 (23%), Positives = 156/402 (38%), Gaps = 45/402 (11%)

Query: 745   VEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTG 804
             + +V+    TL W PP   G   I  Y++E        W   + E ++ C      L  G
Sbjct: 20481 ISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVS-EDIQSCRHVATKLIQG 20539

Query: 805   ARILFRVVGVNIAGRSEPATLAQPVTIREIAEPP----KIRLPRHLRQT----YIRKVGE 856
                +FRV  VN  G+ EP   ++PV + +   PP    K  +    + T    + R V +
Sbjct: 20540 NEYIFRVSAVNHYGKGEPVQ-SEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDD 20598

Query: 857   QLNLVVPF--QGKPRPQVVWTKG-GAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELS 913
               + +  +  + + +  + W +    P+   R  V      + +  R +A + +G    S
Sbjct: 20599 GGSEITGYHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPS 20658

Query: 914   VQIEN--MKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQK 971
                ++  MKD A          GPP N  V +    +A + W  P  DG  EI GY V+ 
Sbjct: 20659 EASDSVLMKDAAY-------PPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEH 20711

Query: 972   ADKKTMEWFNVYERN--RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILK 1029
                    W         R T   V DL    +Y FR+   N  G+ + P V  +   + +
Sbjct: 20712 QKVGDEAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGE-PAVIPDVEIVER 20770

Query: 1030  TGITFKPFEYKEHDFRMAPKF-LTPLIDRVVV--AGYSAALNCAVRGHPKPKVVWMKNKM 1086
                             MAP F L   + R +V  AG S  +   ++G P P+V W K+ +
Sbjct: 20771 ---------------EMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNI 20815

Query: 1087  EIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGE 1128
              ++   +  I N +    L I   + +D G +     N  G+
Sbjct: 20816 NLKN--RANIENTESFTLLIIPECNRYDTGKFVMTIENPAGK 20855



 Score = 77.4 bits (189), Expect = 7e-14
 Identities = 77/267 (28%), Positives = 117/267 (43%), Gaps = 21/267 (7%)

Query: 289   WFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAV----KDEKCFTELFVKEP 344
             W K+G  I+ S K+ F   GK R L I    L+D   Y   +    K++    +L V+E 
Sbjct: 11151 WMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEEL 11210

Query: 345   PVLIVTPLEDQQVFV-GDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKR 403
             PV  V  LE++   V G  + ++ E+++E   V+W KDG  +  +     R      G  
Sbjct: 11211 PVRFVKTLEEEVTVVKGQPLYLSCELNKE-RDVVWRKDGKIVVEK---PGRIVPGVIGLM 11266

Query: 404   HILIFSDVVQEDRGRYQV-ITNGGQCEAELIVEEKQLEVLQD-----IADLTVKASEQAV 457
               L  +D    D G Y V + N    E    V  K +EV++D     I D  VK    A+
Sbjct: 11267 RALTINDADDTDAGTYTVTVENANNLECSSCV--KVVEVIRDWLVKPIRDQHVKPKGTAI 11324

Query: 458   FKCEVSDEKVTGKWYKNGVEV--RPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGY 515
             F C+++ +    KW+K   E+   P+ +  I   G    L I +  PED  +Y    +G 
Sbjct: 11325 FACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEG- 11383

Query: 516   ALSLSAKLNFLEIKVEYVPKQEPPKIH 542
                  AKL   E +VE +   E   I+
Sbjct: 11384 -KRYPAKLTLGEREVELLKPIEDVTIY 11409



 Score = 77.4 bits (189), Expect = 7e-14
 Identities = 139/622 (22%), Positives = 222/622 (35%), Gaps = 82/622 (13%)

Query: 563   RLDVSITGEPPPVATWLKGDEVFTTTEGRTRI-----EKRVDCSSFVIESAQRED----- 612
             RLDV  T +   V  WLK D      +G +RI     E R   S F +E+   +      
Sbjct: 28551 RLDVVDTSKSSAVLAWLKPDH-----DGGSRITGYLLEMRQKGSDFWVEAGHTKQLTFTV 28605

Query: 613   -------EGRYTIKVTNPVG-----EDVASIFLQVVDVPDPPEAVRITS------VGEDW 654
                    E  + +K  N  G     E  +S+ ++   +    +   IT+       G  +
Sbjct: 28606 ERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPF 28665

Query: 655   AILVWEPPMYDGGKP---VTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEM 711
              I V   P+   G+P   VT  L E + K + R      +  T  T + +   +   Y +
Sbjct: 28666 TIDV---PI--SGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFL 28720

Query: 712   RVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGY 771
              +   N  GV   S+         P + P+   V  V+  +  L W  P   G   I  Y
Sbjct: 28721 TL--ENTAGVKTFSVTVVVIGRPGPVTGPIE--VSSVSAESCVLSWGEPKDGGGTEITNY 28776

Query: 772   LVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTI 831
             +VE    G+  W   N+  V+R    V +L       FRV   N  G S+P   A P+  
Sbjct: 28777 IVEKRESGTTAWQLVNSS-VKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESA-PIIA 28834

Query: 832   REIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPF------------QGKPRPQVVWTKGGA 879
                  PP    P      ++      +    P+            + K R  ++W K   
Sbjct: 28835 EHPFVPPSA--PTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVK--- 28889

Query: 880   PLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINV 939
                 ++V     ++     V +        Y L+    +    A+  I        P   
Sbjct: 28890 ---ENKVPCLECNYKVTGLV-EGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRP 28945

Query: 940   MVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTM---EWFNV-YERNRHTSCTVSD 995
              V +V  +   + W AP  DG S+++GY +++     +    W    Y        TV+ 
Sbjct: 28946 EVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTA 29005

Query: 996   LIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLI 1055
             L  G+ Y FRV  +N  G+     +SK +     TG      EY      +  +    L+
Sbjct: 29006 LSEGDTYEFRVLAKNAAGV-----ISKGSE---STGPVTCRDEYAPPKAELDARLHGDLV 29057

Query: 1056  DRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDA 1115
                + AG    L+ AV G P+PK++W K   E+    K  +       T  I+     D+
Sbjct: 29058 --TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDS 29115

Query: 1116  GTYTCRAVNELGEALAECKLEV 1137
             G YT    N  G       ++V
Sbjct: 29116 GKYTLTVKNASGTKAVSVMVKV 29137



 Score = 77.0 bits (188), Expect = 9e-14
 Identities = 53/204 (25%), Positives = 88/204 (43%), Gaps = 16/204 (7%)

Query: 927   IRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN 986
             ++  E+  PP  + + +V   +  + W+ P+ DG S I+GY V+   K + +W       
Sbjct: 22043 VKASERPLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATC-ATV 22101

Query: 987   RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRM 1046
             + T  T++ LI G EY FRV  +N  G+SD         R L   +  K       D  +
Sbjct: 22102 KVTEATITGLIQGEEYSFRVSAQNEKGISDP--------RQLSVPVIAK-------DLVI 22146

Query: 1047  APKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLN 1106
              P F        V+AG    ++    G P P V W K+ + +++  +    + +    L 
Sbjct: 22147 PPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLT 22206

Query: 1107  IRRPSPFDAGTYTCRAVNELGEAL 1130
             I+     D G Y  +  N  GEA+
Sbjct: 22207 IKDACREDVGHYVVKLTNSAGEAI 22230



 Score = 74.7 bits (182), Expect = 5e-13
 Identities = 97/436 (22%), Positives = 155/436 (35%), Gaps = 49/436 (11%)

Query: 713   VFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYL 772
             + A N+ G    ++  K      P   P  + +  +      L W PP   G   I  Y+
Sbjct: 19368 ITAENSSGSKSATIKLKVLDKPGP---PASVKINKMYSDRAMLSWEPPLEDGGSEITNYI 19424

Query: 773   VEYCLEGSEEWVPAN-TEPVERCGFTVKNLPTGARILFRVVGVNIAGR-----SEPATLA 826
             V+        W   + T P+  C  +V+ L  G    FR+   N  G      +EPA   
Sbjct: 19425 VDKRETSRPNWAQVSATVPITSC--SVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAK 19482

Query: 827   QPVTIREIAEPPKIR--LPRHLRQTYIRKVGEQLNLVVPF--QGKPRPQVVWTKGGAPLD 882
              P       +PP I      H+  ++     +  + +  +  + +    V WTK    ++
Sbjct: 19483 NPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTK----VN 19538

Query: 883   TSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMK--------DTATIRIRVVEKAG 934
                +  RT        ++     +  EYE  V   N            A          G
Sbjct: 19539 RKPIIERT--------LKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPG 19590

Query: 935   PPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQ--KADKKTMEWFNVYERNRHTSCT 992
             PP    V +   ++  + W  P  DG S I+GY V+  +AD       N+ +  + T   
Sbjct: 19591 PPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFE 19650

Query: 993   VSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLT 1052
             V+ L+   +Y FRVY  N  G SD   V     +     I   P    + D R       
Sbjct: 19651 VTGLMEDTQYQFRVYAVNKIGYSDPSDVPD---KHYPKDILIPPEGELDADLRKT----- 19702

Query: 1053  PLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSP 1112
                  ++ AG +  L   V+G P PK+ W K  + +R+     I +      L     + 
Sbjct: 19703 ----LILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNK 19758

Query: 1113  FDAGTYTCRAVNELGE 1128
             +DAG Y     N  G+
Sbjct: 19759 YDAGKYILTLENSCGK 19774



 Score = 73.6 bits (179), Expect = 1e-12
 Identities = 105/414 (25%), Positives = 152/414 (36%), Gaps = 56/414 (13%)

Query: 742   HLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNL 801
             +L + DV+    T+ W PP   G   I  Y++E C      W    +  V   G TV  L
Sbjct: 18302 NLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVW-STYSATVLTPGTTVTRL 18360

Query: 802   PTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLV 861
               G   +FRV   N  G   P T ++PV  +   + P    P       + KV ++   V
Sbjct: 18361 IEGNEYIFRVRAENKIGTGPP-TESKPVIAKTKYDKPGRPDPPE-----VTKVSKEEMTV 18414

Query: 862   V----PFQG-----------KPRPQVVWT---KGGAPLDTSRVHVRTSDFDTVFFVRQAA 903
             V     + G           K +    W    K   P    +V     D +  F V+   
Sbjct: 18415 VWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAEN 18474

Query: 904   RSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSE 963
                 GE  L  +    KD        +E  GPP N  V +    +  + W  P  DG + 
Sbjct: 18475 EIGIGEPSLPSRPVVAKDP-------IEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAP 18527

Query: 964   IMGYFVQK----ADKKTMEWF---NVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
             I+GY V+     AD    E +   N   +      TV+ L    EY FRV  +N  G+  
Sbjct: 18528 IIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGR 18587

Query: 1017  SPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPK 1076
                + +            KP E  E         +  L+  +V AG    L   VRG P 
Sbjct: 18588 PAELKE----------AIKPKEILEPPEIDLDASMRKLV--IVRAGCPIRLFAIVRGRPA 18635

Query: 1077  PKVVWMKNKME--IREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGE 1128
             PKV W K  ++  +R+    L+     ++  N  R    D+G Y+   VN  GE
Sbjct: 18636 PKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRD---DSGKYSLTLVNPAGE 18686



 Score = 73.6 bits (179), Expect = 1e-12
 Identities = 101/421 (23%), Positives = 155/421 (36%), Gaps = 60/421 (14%)

Query: 743   LIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLP 802
             L V  VT     L W PP + G   I  Y++E        W   +TE V+   + V  L 
Sbjct: 24809 LKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTE-VQALNYKVTKLL 24867

Query: 803   TGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPP--------KIRLPRHLRQTYIRKV 854
              G   +FRV+ VN  G  EP   + PVT     +PP               +  T+ R V
Sbjct: 24868 PGNEYIFRVMAVNKYGIGEPLE-SGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPV 24926

Query: 855   GEQLNLVVPF--QGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYEL 912
              +    +  +  + + +  V WTK      T               +R    ++   YE 
Sbjct: 24927 DDGGTEIEGYILEKRDKEGVRWTKCNKKTLTD------------LRLRVTGLTEGHSYEF 24974

Query: 913   SVQIENMKDTA-----TIRIRVVEKA---GPPINVMVKEVWGTNALVEWQAPKDDGNSEI 964
              V  EN          ++  R  +     GPP N  V +   ++  + W  P  DG + +
Sbjct: 24975 RVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPV 25034

Query: 965   MGYFVQKADKKTMEWFNVYERN--RHTSCTVSDLIVGNEYYFRVYTENICGLSDS---PG 1019
              GY V+  +    EW         +    TV+ L    EY FR+   N  G+ +    PG
Sbjct: 25035 KGYVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPG 25094

Query: 1020  VSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNC--AVRGHPKP 1077
                   RI    I        + D R           +VVV   SA L     ++G P+P
Sbjct: 25095 SVVAQERIEPPEIEL------DADLR-----------KVVVLRASATLRLFVTIKGRPEP 25137

Query: 1078  KVVWMKNKMEIREDPKFLITNYQGVLTL-NIRRPSPFDAGTYTCRAVNELGEALAECKLE 1136
             +V W K +  + +  +  +T+   +L + N+ R   FD+G Y     N  G   A   + 
Sbjct: 25138 EVKWEKAEGILTDRAQIEVTSSFTMLVIDNVTR---FDSGRYNLTLENNSGSKTAFVNVR 25194

Query: 1137  V 1137
             V
Sbjct: 25195 V 25195



 Score = 70.1 bits (170), Expect = 1e-11
 Identities = 61/232 (26%), Positives = 96/232 (41%), Gaps = 25/232 (10%)

Query: 905   SDSGEYELSVQIENM-----KDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDD 959
             S+  EY   V  EN          T  ++  E   PP ++ + ++  +   + W  PK D
Sbjct: 20932 SEGCEYFFRVMAENEYGIGEPTETTEPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKHD 20991

Query: 960   GNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPG 1019
             G S+I GY ++   K + +W ++    +   C V +L  G EY F+V   N  G S +P 
Sbjct: 20992 GGSKITGYVIEAQRKGSDQWTHI-TTVKGLECVVRNLTEGEEYTFQVMAVNSAGRS-APR 21049

Query: 1020  VSKNTARILKTGITFKPFEYKEHDFRMAPKF-LTPLIDRVVVA--GYSAALNCAVRGHPK 1076
              S+             P   KE    M P+  L  +  ++V+A  G +  +   V G PK
Sbjct: 21050 ESR-------------PVIVKEQT--MLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPK 21094

Query: 1077  PKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGE 1128
             P V W K    +++  +           LNI      D+G Y   A N +GE
Sbjct: 21095 PTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGE 21146



 Score = 69.7 bits (169), Expect = 1e-11
 Identities = 70/279 (25%), Positives = 111/279 (39%), Gaps = 31/279 (11%)

Query: 470   KWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIK 529
             KW K   E+R +  I ++    F  LV+D+V   D G YT   +    S   K  F+ ++
Sbjct: 22975 KWGKVDGEIRDAAIIDVT--SSFTSLVLDNVNRYDSGKYTLTLEN---SSGTKSAFVTVR 23029

Query: 530   VEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTE 589
             V   P    P ++L  +  T ++             VSIT EPP +    K         
Sbjct: 23030 VLDTPS---PPVNLKVTEITKDS-------------VSITWEPPLLDGGSKIKNYIVEKR 23073

Query: 590   GRTR-----IEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIF---LQVVDVPDP 641
               TR     +      +S+ I+  Q      + +   N  G  + +     ++V +VP P
Sbjct: 23074 EATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQP 23133

Query: 642   PEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYEST 701
             P  + +  V  +   L W  P +DGG  +  Y+VE + K S++W +       +     T
Sbjct: 23134 PGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVI--T 23191

Query: 702   KMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEP 740
              + +G  Y  RV AVN  G S P     P +      EP
Sbjct: 23192 NLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEP 23230



 Score = 69.3 bits (168), Expect = 2e-11
 Identities = 81/305 (26%), Positives = 128/305 (41%), Gaps = 40/305 (13%)

Query: 429   EAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISH 488
             E EL  + +++ VL+  A L +  + +   + EV  EK  G           + R  I  
Sbjct: 25106 EIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGIL---------TDRAQIEV 25156

Query: 489   VGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGK 548
                F  LVID+V   D G Y    +    +  +K  F+ ++V            LD    
Sbjct: 25157 TSSFTMLVIDNVTRFDSGRYNLTLEN---NSGSKTAFVNVRV------------LD---- 25197

Query: 549   TSENAIVVVAGNKLRLD-VSITGEPPPVATWLK-----GDEVFTTTEGRTRIEKRVDCSS 602
              S +A V +   +++ D V+++ EPP +    K      ++  TT +    I      ++
Sbjct: 25198 -SPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKTT 25256

Query: 603   FVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDV---PDPPEAVRITSVGEDWAILVW 659
             F IE+ Q      + +  +N  G  + +   + V V   P PP  V +  V  + A + W
Sbjct: 25257 FRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKW 25316

Query: 660   EPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAI 719
             E P  DGG  +TGY+VE + KGS++W         E T     +  G  Y  RV AVN  
Sbjct: 25317 EKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATISG--LTAGEEYVFRVAAVNEK 25374

Query: 720   GVSQP 724
             G S P
Sbjct: 25375 GRSDP 25379



 Score = 68.2 bits (165), Expect = 4e-11
 Identities = 79/289 (27%), Positives = 122/289 (42%), Gaps = 32/289 (11%)

Query: 340   FVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKK 399
             FVKE   +I+T  E    FVG        VS   A   WMKDG  +        ++RF  
Sbjct: 11117 FVKEIKDIILTESE----FVGSSAIFECLVSPSTAITTWMKDGSNIRE----SPKHRFIA 11168

Query: 400   DGKRHILIFSDVVQEDRGRYQVITNGGQCE----AELIVEEKQLEVLQDI-ADLTVKASE 454
             DGK   L   DV   D G Y  +   G  E    A+L+VEE  +  ++ +  ++TV   +
Sbjct: 11169 DGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQ 11228

Query: 455   QAVFKCEVSDEKVTGKWYKNG-VEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTF-VP 512
                  CE++ E+    W K+G + V    RI    +G    L I+D    D G YT  V 
Sbjct: 11229 PLYLSCELNKERDV-VWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVE 11287

Query: 513   DGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEP 572
             +   L  S+ +  +E+  +++ K  P +   D   K    AI          D++   + 
Sbjct: 11288 NANNLECSSCVKVVEVIRDWLVK--PIR---DQHVKPKGTAI-------FACDIA---KD 11332

Query: 573   PPVATWLKG-DEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKV 620
              P   W KG DE+      +T I +  +     I++A  ED   Y +++
Sbjct: 11333 TPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEI 11381



 Score = 68.2 bits (165), Expect = 4e-11
 Identities = 106/473 (22%), Positives = 165/473 (34%), Gaps = 51/473 (10%)

Query: 679   KKGSQ---RWMKLNFEVF-TETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPI 734
             KKG Q   +  ++NFE   T T     + +        + A N +G     +  +     
Sbjct: 21100 KKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIP 21159

Query: 735   APTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERC 794
              P + P+    ++V+    T  W PP   G   I  Y+VE     S  WV   T  + R 
Sbjct: 21160 GPPTGPIKF--DEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTVI-RT 21216

Query: 795   GFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKV 854
              +    L TG    FRV   N  G     T A  V       P     P+    T + K 
Sbjct: 21217 TYKATRLTTGLEYQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTPQ---VTAVTKD 21273

Query: 855   GEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFF------------VRQA 902
                ++   P           + GG+P+     HV   + + + +             + +
Sbjct: 21274 SMTISWHEPL----------SDGGSPI--LGYHVERKERNGILWQTVSKALVPGNIFKSS 21321

Query: 903   ARSDSGEYELSVQIENMKDTA-----TIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPK 957
               +D   YE  V  ENM   +     +  +  ++   PP   +   +      ++W  P+
Sbjct: 21322 GLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKWAKPE 21381

Query: 958   DDGNSEIMGYFVQKADKKTMEWFNVYERN-RHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
               G  +I  Y V+K D     W      N      TVS L     Y FRV  +N  G   
Sbjct: 21382 YTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAIS 21441

Query: 1017  SPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPK 1076
              P    +        IT +  + +    ++  KF   +I   + AG +  L   V G P 
Sbjct: 21442 PPSEPSDA-------ITCRD-DVEAPKIKVDVKFKDTVI---LKAGEAFRLEADVSGRPP 21490

Query: 1077  PKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEA 1129
             P + W K+  E+    K  I        L  +  +  D+G YT  A N  G A
Sbjct: 21491 PTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFA 21543



 Score = 67.0 bits (162), Expect = 1e-10
 Identities = 58/205 (28%), Positives = 84/205 (40%), Gaps = 19/205 (9%)

Query: 936   PINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHT-SCTVS 994
             P ++ VKEV      + W  PK DG SEI+ Y ++     T ++  V   N  +   TV 
Sbjct: 16720 PEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVK 16779

Query: 995   DLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFL-TP 1053
              L  G+ Y +RV   NI G               K     KP   K+    +AP  L   
Sbjct: 16780 GLKEGDTYEYRVSAVNIVGQG-------------KPSFCTKPITCKDE---LAPPTLHLD 16823

Query: 1054  LIDRVVV-AGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSP 1112
               D++ +  G + AL     G PKPKV W K++ ++ ED +  I      L L   +   
Sbjct: 16824 FRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKR 16883

Query: 1113  FDAGTYTCRAVNELGEALAECKLEV 1137
              D+G Y     N  G     C++ V
Sbjct: 16884 SDSGKYCVVVENSTGSRKGFCQVNV 16908



 Score = 65.9 bits (159), Expect = 2e-10
 Identities = 242/1196 (20%), Positives = 419/1196 (35%), Gaps = 189/1196 (15%)

Query: 41   EDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKS 100
            E+Q+   E     F+ KP    +  G   V   +V G     KP + W K      G   
Sbjct: 1071 EEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNP---KPHVYWKKS-----GVPL 1122

Query: 101  GARFSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDA 160
               + +K S+N  +     +L I      D G Y + V+ K    S   ++  EA  +  
Sbjct: 1123 TTGYRYKVSYNKQTG--ECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELL 1180

Query: 161  SGQSLESFKRTS-------EKKSDTAGELDFSGLLKKREVVEEE-KKKKKKDDDDLGIPP 212
                 E   +T         K  +TA    +S   K+ E  +   +KK  KD   +    
Sbjct: 1181 MKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYV 1240

Query: 213  EIWEL-LKGAKKSEYEKIAFQYGITDLRGMLKR--LKKAKVEVKKSAAFTKKLDPA---Y 266
            E  E  +   ++   ++I ++   T L  +L+    +K  V++ +S A     D     Y
Sbjct: 1241 EDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNY 1300

Query: 267  QVDRGNKIKLMVEISDPDLT-LKWFKNGQEIKPSSKYVFENVGKKRI-LTINKCTLADDA 324
            ++  G  +    ++S   L  + W+K+G+ IK   +Y  + +   R  L I      D+ 
Sbjct: 1301 RILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEG 1360

Query: 325  AYEVAVKDEK----CFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMK 380
             Y     + K    C  +L+V EP   +  P     +    R+      S   + +    
Sbjct: 1361 IYTAFASNIKGNAICSGKLYV-EPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSP 1419

Query: 381  DGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLE 440
              +   R    +        G+R        ++E                    +E QLE
Sbjct: 1420 ARMSPARMSPARMSPARMSPGRR--------LEE-------------------TDESQLE 1452

Query: 441  VLQDIADLTVKASEQAVFKCEVS-----DEKVTGK------WYKNGVEVRP--SKRITIS 487
             L       V   +   FKC        D KV G+      W+ +G ++    + ++ I 
Sbjct: 1453 RLYK----PVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIK 1508

Query: 488  HVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSG 547
              G    L+I    P D G++T V    A   S  +    + VE V  Q  P        
Sbjct: 1509 EDGT-QSLIIVPATPSDSGEWTVVAQNRAGRSSISVI---LTVEAVEHQVKPMFVEKLKN 1564

Query: 548  KTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTE-GRTRIEKRVDCSSFVIE 606
                  + +  G++L + V  TG P P   WLK  ++    +  + RIE     ++  I+
Sbjct: 1565 ------VNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKID 1618

Query: 607  SAQREDEGRYTIKVTNPVGEDVASIFLQV-VDVPDP-PEAVRITSVGEDWAILVWEPPMY 664
            S   +D   YT    N  G D     + V V+  +P PE   I   G   A  +  P + 
Sbjct: 1619 STVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPEL- 1677

Query: 665  DGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQP 724
               +P+        + G ++W                   EG LY+              
Sbjct: 1678 ---EPL------HLRYGQEQWE------------------EGDLYDKEKQQKPFFKKKLT 1710

Query: 725  SMNTKPFMP------IAPTSEPLHLI--VEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
            S+  K F P      + P  +P  ++  + D        + R  N  G   +D Y V Y 
Sbjct: 1711 SLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLD-YGVAYS 1769

Query: 777  LE------------GSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPAT 824
             +            G++          E+       LP G + L R+  +      E A 
Sbjct: 1770 RDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAH-EGAL 1828

Query: 825  LAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTS 884
                   +E  +P  +  P  +R       GE         G P+P+V W   G  +  S
Sbjct: 1829 TGVTTDQKEKQKPDIVLYPEPVRVL----EGETARFRCRVTGYPQPKVNWYLNGQLIRKS 1884

Query: 885  R--------VH----VRTSDFDTVFFVRQAARSDSG--EYELSVQIENMKDTATIRIRV- 929
            +        +H    V    +DT   V+  A +  G  E+++ ++I+  +D  ++  R  
Sbjct: 1885 KRFRVRYDGIHYLDIVDCKSYDT-GEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAP 1943

Query: 930  -----------------VEKAGPPINVM----VKEVWGTNALVEWQAPKDDGNSEIMGYF 968
                             V+K   P++      V ++     +   + P++  + E+   F
Sbjct: 1944 EPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEE--SEELRSKF 2001

Query: 969  VQKADKKTMEWFNVYE-RNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARI 1027
             ++ ++   E     E ++R    +  +L+   +     +T+ +     +    K  A  
Sbjct: 2002 KRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKEL-----TEEEKKALAEE 2056

Query: 1028 LKTGI-TFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKM 1086
             K  I TFKP + +      APK    +  + V  G  A     V G P P+  W KN +
Sbjct: 2057 GKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGV 2116

Query: 1087 EI-REDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVRVPQ 1141
            +I R D  +       V  L IR  +  D+ +   +A+N  GE  +   L V+  Q
Sbjct: 2117 KIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQ 2172



 Score = 65.9 bits (159), Expect = 2e-10
 Identities = 51/203 (25%), Positives = 82/203 (40%), Gaps = 17/203 (8%)

Query: 927   IRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN 986
             I   E+  PP  + V +   ++A++ W  P  DG S I GY ++   K +  W       
Sbjct: 28540 IVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEA-GHT 28598

Query: 987   RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRM 1046
             +  + TV  L+   EY FRV  +N  G S+                 F     KE     
Sbjct: 28599 KQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREA-------------FSSVIIKEPQIEP 28645

Query: 1047  APKFLTPLIDRVVV--AGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLT 1104
                 LT + ++++   AG    ++  + G P PKV W   +M ++E  +  IT  +   T
Sbjct: 28646 TAD-LTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTT 28704

Query: 1105  LNIRRPSPFDAGTYTCRAVNELG 1127
             L ++     D+G Y     N  G
Sbjct: 28705 LTVKDSMRGDSGRYFLTLENTAG 28727



 Score = 65.5 bits (158), Expect = 3e-10
 Identities = 33/94 (35%), Positives = 46/94 (48%)

Query: 1048 PKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNI 1107
            P  ++ L +  V+ G S  L C + G+P P V W +   +I     F IT   G+  L I
Sbjct: 943  PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMI 1002

Query: 1108 RRPSPFDAGTYTCRAVNELGEALAECKLEVRVPQ 1141
            R     D+G +TC AVNE G     C L V+V +
Sbjct: 1003 REAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSE 1036



 Score = 65.5 bits (158), Expect = 3e-10
 Identities = 55/219 (25%), Positives = 95/219 (43%), Gaps = 18/219 (8%)

Query: 922   TATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFN 981
             T  + I  +++ G P N+ + +   T   ++W+ P  DG S  + Y V++  K + +W  
Sbjct: 18090 TPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWER 18149

Query: 982   VYERNRHTSCTVSDLIVGNEYY-FRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYK 1040
             V++ +   +  + D  V N+ Y FRV T+N  G SD     K    ++K  +     + K
Sbjct: 18150 VHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDWV---KTEEVVVKEDLQKPVLDLK 18206

Query: 1041  EHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNK--MEIREDPKFLITN 1098
                       L+ ++   V AG +  L   VRG P P+V W K+K   ++   P+  I  
Sbjct: 18207 ----------LSGVL--TVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDT 18254

Query: 1099  YQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
                    ++ +    D G Y   A N  G  +A   + V
Sbjct: 18255 RADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNV 18293



 Score = 65.1 bits (157), Expect = 4e-10
 Identities = 75/317 (23%), Positives = 124/317 (39%), Gaps = 50/317 (15%)

Query: 269   DRGNKIKLMVEISDPDLTLK--WFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
             + G  +K + +I + D + +  W+   ++++ S KY         IL +   T  DD  Y
Sbjct: 31580 EEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTY 31639

Query: 327   EVAV----KDEKCFTELFVK---------------------------EPPVLIVTPLEDQ 355
                V     ++  + ELFVK                           E P     PL ++
Sbjct: 31640 RCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNK 31699

Query: 356   QVFVGDRVEMAVEVS-EEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQE 414
               +VG+ V   V ++      V W K G ++   D+ K +Y F+ D   + L  + V  +
Sbjct: 31700 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDK-KYTFESDKGLYQLTINSVTTD 31758

Query: 415   DRGRYQVITNG----GQCEAELIV------EEKQLEVL--QDIADLTVKASEQAVFKCEV 462
             D   Y V+         C+A+L V       +  L  +  + +A+   +  +   F+  V
Sbjct: 31759 DDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRV 31818

Query: 463   SD-EKVTGKWYKNGVEVRPSKRITISHVG-RFHKLVIDDVRPEDEGDYTFVPDGYALSLS 520
             S     T KW K+G  +     I I H G  ++ L I D  PED G Y       A S S
Sbjct: 31819 SGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTS 31878

Query: 521   AKLNFLEIKVEYVPKQE 537
              + +    ++ Y  KQE
Sbjct: 31879 CQAHLQVERLRY-KKQE 31894



 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 124/619 (20%), Positives = 228/619 (36%), Gaps = 56/619 (9%)

Query: 41   EDQSPTAEEP--TGVFLKKPDSVS-----VETGKDAVVVAKVNGKELPDKPTIKWFKGKW 93
            E Q+P       T V +K+P   S     VET K+A V  +      P    + W+K K 
Sbjct: 5497 EAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAEVSLECELSGTPPFEVV-WYKDKR 5555

Query: 94   LELGSKSGARFSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDV 153
                SK          +  AS  +   +HI  V   D G Y  + + +   D+C   + +
Sbjct: 5556 QLRSSKK---------YKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKL 5606

Query: 154  EAPRQDASGQSLESFKRTSEKKSDTAGELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPE 213
            + P +  S   L S    + + ++    ++ +  +  + + E+E+  ++ ++  +     
Sbjct: 5607 KEPPRFVS--KLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVEN 5664

Query: 214  IWELLKGAKKSEYEKIAFQYGITDLRGMLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNK 273
            +   L+ AK        +   I +  GM  R   A + V + A   +K  P   V  G  
Sbjct: 5665 V-ATLQFAKAEPANAGKYICQIKNDGGM--RENMATLMVLEPAVIVEKAGP-MTVTVGET 5720

Query: 274  IKLMVEIS-DPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKD 332
              L  +++  P+L+++W+K+G+ +  S K+ F    K   L I      D   Y   V++
Sbjct: 5721 CTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQN 5780

Query: 333  ----EKCFTELFVKE--PPVLIVTPLEDQQVFVGDRVEMAVEVS-EEGAQVMWMKDGVEL 385
                  C   + V +   P      L++    +G    +  +V+      V W  +  ++
Sbjct: 5781 NVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKI 5840

Query: 386  TREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQV----ITNGGQCEAELIVEEKQLEV 441
                   A+Y+         L  + +   D G Y      +    +C A L V+E     
Sbjct: 5841 VS----GAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPP-SF 5895

Query: 442  LQDIADLTVKASEQAVFKCEV-SDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDV 500
            +++   L V   +   F   +         W++   E+    R  I       +L + ++
Sbjct: 5896 VKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNI 5955

Query: 501  RPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGN 560
                 G+YT V    A   S               +EP       S  + E       G 
Sbjct: 5956 DISQSGEYTCVVSNNAGQASCTTRLF--------VKEPAAFLKRLSDHSVE------PGK 6001

Query: 561  KLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKV 620
             + L+ + TG  P   TW K     TT+E    +     C   ++ S +R D G+Y+ ++
Sbjct: 6002 SIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKR-DAGQYSCEI 6060

Query: 621  TNPVGEDVASIFLQVVDVP 639
             N  G DV    +  ++ P
Sbjct: 6061 ENEAGRDVCGALVSTLEPP 6079



 Score = 62.0 bits (149), Expect = 3e-09
 Identities = 87/412 (21%), Positives = 142/412 (34%), Gaps = 57/412 (13%)

Query: 268  VDRGNKIKLMVEISD-PDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
            V  G   +    IS  P   + W+K  Q +    K  F + G++  L + +    D A Y
Sbjct: 3250 VQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVY 3309

Query: 327  EVAVKDE----KCFTELFVKEPPVL------------IVTPLEDQQVFVGDRVEMAVEVS 370
                K++         L V+ P V+            I+TPL+D     G        VS
Sbjct: 3310 TCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVS 3369

Query: 371  EEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGG---- 426
                +V W     ++     F    R  +    + L  ++   ED G Y  + +      
Sbjct: 3370 GTDLKVSWYSKDKKIKPSRFF----RMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQV 3425

Query: 427  -----------------QCEAELIVEEKQLEVLQ-DIADLTVKASEQAVFKCEV-SDEKV 467
                             + E E+ +E K   V++  I  L V     A F CE+ S   V
Sbjct: 3426 SSTANLSLEAPESILHERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNV 3485

Query: 468  TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLE 527
              +W+K G E+  S + +I        L I   +  D G+YT        S+S       
Sbjct: 3486 RFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLT- 3544

Query: 528  IKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTT 587
                 V +  PP         +   ++    G   +   ++TG P     W K D    +
Sbjct: 3545 -----VTEAYPPTF------LSRPKSLTTFVGKAAKFICTVTGTPVIETIWQK-DGAALS 3592

Query: 588  TEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVP 639
                 RI    +     + +   +D G Y+ K +N  G D+    L ++D P
Sbjct: 3593 PSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKP 3644



 Score = 61.2 bits (147), Expect = 5e-09
 Identities = 96/440 (21%), Positives = 165/440 (37%), Gaps = 55/440 (12%)

Query: 285  LTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDE----KCFTELF 340
            LT++WFK  +E+             +  L +     +D   Y   V +     +C   LF
Sbjct: 4235 LTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLF 4294

Query: 341  VKEPPVLIVTPLEDQQVFVGDRVEMAVEVS-EEGAQVMWMKDGVELTREDSFKARYRFKK 399
            VKEP   +      Q +  GD  ++A +V+     ++ W  +  E+  ++S K R  F +
Sbjct: 4295 VKEPATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREI--KESSKHRMSFVE 4352

Query: 400  DGKRHILIFSDVVQEDRGRY----QVITNGGQCEAELIVEE--------KQLEVLQDIAD 447
                 +L  +DV  ED G Y    Q       C + +IV+E        K +EVL++  D
Sbjct: 4353 --STAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKPIEVLKEY-D 4409

Query: 448  LTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGD 507
            + + A        E++       W+K+   +R  ++           L I      D G+
Sbjct: 4410 VMLLAEVAGTPPFEIT-------WFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGE 4462

Query: 508  YTF-VPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDV 566
            Y   V +    S+ +           V  +EPP         +S      + G       
Sbjct: 4463 YQCRVTNEVGSSICS---------ARVTLREPPSFIKKIESTSS------LRGGTAAFQA 4507

Query: 567  SITGEPPPVATWLK-GDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVG 625
            ++ G  P   TWLK  DE+  T +   R+    + +S  +   + + +G+Y  +  N  G
Sbjct: 4508 TLKGSLPITVTWLKDSDEI--TEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAG 4565

Query: 626  EDVASIFLQVVD-VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQR 684
                S  L V +      EAV I     D A L      + G K +T    +  K G + 
Sbjct: 4566 IQRCSALLSVKEPATITEEAVSIDVTQGDPATL---QVKFSGTKEIT---AKWFKDGQEL 4619

Query: 685  WMKLNFEVFTETTYESTKMI 704
             +   +++    T    K+I
Sbjct: 4620 TLGSKYKISVTDTVSILKII 4639



 Score = 60.5 bits (145), Expect = 9e-09
 Identities = 50/196 (25%), Positives = 78/196 (39%), Gaps = 19/196 (9%)

Query: 936   PINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYE-RNRHTSCTVS 994
             P  + V +V  +   + W+ P  DG S + GY ++     T  W  V   +      TV+
Sbjct: 29638 PAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVT 29697

Query: 995   DLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKF-LTP 1053
              L  G +Y FR+  +N  G+S+         R   T +T +       D R+ P   L+ 
Sbjct: 29698 SLNEGEQYLFRIRAQNEKGVSEP--------RETVTAVTVQ-------DLRVLPTIDLST 29742

Query: 1054  LIDRV--VVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPS 1111
             +  +   V AG    L   + G P P   W     ++RE  +  +  +  V  L IR  +
Sbjct: 29743 MPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETT 29802

Query: 1112  PFDAGTYTCRAVNELG 1127
               D G YT    N  G
Sbjct: 29803 IRDTGEYTLELKNVTG 29818



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 69/295 (23%), Positives = 117/295 (39%), Gaps = 27/295 (9%)

Query: 348   IVTPLEDQQVFVGDRVEMAVEV-SEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHIL 406
             I   +   +V  G      + V S+  A+V W  +GVEL  ++S K  Y     G   + 
Sbjct: 32376 ITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVEL--QESSKIHYT-NTSGVLTLE 32432

Query: 407   IFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEK 466
             I  D   +D G Y+ +    + EA             D A L V   +   +  +  DE+
Sbjct: 32433 IL-DCHTDDSGTYRAVCTNYKGEAS------------DYATLDVTGGDYTTYASQRRDEE 32479

Query: 467   VTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDG---YALSLSAKL 523
             V    +    E+  ++   +S   +  ++       E +   T   +    Y  S SA++
Sbjct: 32480 VPRSVFP---ELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEM 32536

Query: 524   NFLEIKVEYVP-KQEPPKIHLDCSGK--TSENAIVVVAGNKLRLDVSITGEPPPVATWLK 580
                 ++ + +  K    KI    + +  T   ++ V  G   R      GEP P  TWL+
Sbjct: 32537 KSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLR 32596

Query: 581   GDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQV 635
               +V +T+  R ++      S+F I S Q  DEG Y++ V N  G+  A   L +
Sbjct: 32597 KGQVLSTS-ARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTI 32650



 Score = 59.3 bits (142), Expect = 2e-08
 Identities = 58/222 (26%), Positives = 88/222 (39%), Gaps = 31/222 (13%)

Query: 439   LEVLQDIADLTVKASE----QAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHK 494
             L+ +++I D+ +  SE     A+F+C VS       W K+G  +R S +      G+  K
Sbjct: 11115 LKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRK 11174

Query: 495   LVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAI 554
             L I DV+  D G+YT V     L    K +  ++ VE +P +           KT E  +
Sbjct: 11175 LHIIDVQLSDAGEYTCV---LRLGNKEKTSTAKLVVEELPVR---------FVKTLEEEV 11222

Query: 555   VVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEG 614
              VV G  L L   +  E   V  W K  ++     GR          +  I  A   D G
Sbjct: 11223 TVVKGQPLYLSCELNKERDVV--WRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAG 11280

Query: 615   RYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAI 656
              YT+ V N    + +S              V++  V  DW +
Sbjct: 11281 TYTVTVENANNLECSS-------------CVKVVEVIRDWLV 11309



 Score = 59.3 bits (142), Expect = 2e-08
 Identities = 118/608 (19%), Positives = 216/608 (35%), Gaps = 90/608 (14%)

Query: 6     PAAKKAPKGKDAPKGAPKEAPPKEAPAEAPKEAPPEDQSPTAEEPT------GVFLKKPD 59
             P   K+P+    P+    EA       ++P+ + P+  SPT  +PT       + +  P 
Sbjct: 32663 PPRVKSPE----PRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPP 32718

Query: 60    SVS----VETGKDAVVVAKVNGKELPDKPTIKWFK-GKWLELGSKSGARFSFKESHNSAS 114
              ++     E  K+   +  V    +     + W+K GK L    K    F F   H SA 
Sbjct: 32719 KITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKL----KENGHFQF---HYSAD 32771

Query: 115   NVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEA-----PRQDASGQSLESFK 169
               Y  EL I  +   D+G Y  E+  +            +A      +     ++ +S +
Sbjct: 32772 GTY--ELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQ 32829

Query: 170   RTSEKKSDTAGELDFSGLLKKREVVEEEKKKKKKDDDDLG----------IPPEIWELLK 219
             +T+E       E      +  + V+    +      D +            P  IW    
Sbjct: 32830 KTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIW---- 32885

Query: 220   GAKKSEYEKIAFQYGITDLRGMLKRLKKAKVEVKKSAAFTKKL-DPAYQVDRGNKIKLMV 278
               K  +      +Y +++ +G    L+  K +   S  +T  + + A  V    K+ +  
Sbjct: 32886 -TKDGKAITQGGKYKLSEDKGGF-FLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKA 32943

Query: 279   EISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTE 338
              I D +      +   EI P  K V +    ++ L   +  +++  + E     E+    
Sbjct: 32944 -IKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKV 33002

Query: 339   LFVKEPPVLIVTPLE---------------------------DQQVFVGDRVEMAVEVSE 371
             L  +E      T LE                             Q+ + +   + ++ + 
Sbjct: 33003 LISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANI 33062

Query: 372   EGA-QVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVI--TNGG-- 426
              GA  V W+ +GVELT  +     YR+   G    L        D G    I  T  G  
Sbjct: 33063 AGATDVKWVLNGVELTNSE----EYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIV 33118

Query: 427   QCEAELIVEEKQLEV---LQDIADLTVKASEQAVFKCEVSDEKVTG-KWYKNGVEVRPSK 482
             +C+ +L + ++  +    +       +   +  +F CE+S E     +W+KN + +  S 
Sbjct: 33119 KCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISS 33178

Query: 483   RITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIH 542
              ++IS     + L I +    D G YT     +    SA  + + + +   P +E   + 
Sbjct: 33179 NVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSRE---VV 33235

Query: 543   LDCSGKTS 550
             L  SG TS
Sbjct: 33236 LRTSGDTS 33243



 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 26/79 (32%), Positives = 41/79 (51%)

Query: 1062 GYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCR 1121
            G    L C + G P  +VVW+K++ ++R   KF IT+     +L+I      D G Y C+
Sbjct: 6472 GSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCK 6531

Query: 1122 AVNELGEALAECKLEVRVP 1140
            A NE+G     C ++ + P
Sbjct: 6532 ATNEVGSDTCSCSVKFKEP 6550



 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 34/133 (25%), Positives = 59/133 (44%), Gaps = 12/133 (9%)

Query: 605   IESAQREDEGRYTIKVTNPVGEDVAS------IFLQVVDVPDPPEAVRITSVGEDWAILV 658
             +++   + E ++ +K  N +G    S      +    ++ P PP   R+    +    L 
Sbjct: 18457 VQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTKHSITLG 18516

Query: 659   WEPPMYDGGKPVTGYLVERKKK-----GSQRWMKLNFEV-FTETTYESTKMIEGILYEMR 712
             W  P+YDGG P+ GY+VE + K       + W + N         +  T + E   YE R
Sbjct: 18517 WGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFR 18576

Query: 713   VFAVNAIGVSQPS 725
             V A N +G+ +P+
Sbjct: 18577 VCAQNQVGIGRPA 18589



 Score = 56.2 bits (134), Expect = 2e-07
 Identities = 50/208 (24%), Positives = 85/208 (40%), Gaps = 25/208 (12%)

Query: 935   PPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQ-KADKKTMEWFNVYERNRHTSCTV 993
             PP  + V E+   +A + W  P  DG ++I GY    + +++  + +  Y   +  S  V
Sbjct: 18801 PPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYSVVKDLSLVV 18860

Query: 994   SDLIVGNEYYFRVYTENICGLS---DSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKF 1050
             + L  G +Y FRV   N  G+S   ++ GV                  Y+  +  + PK 
Sbjct: 18861 TGLKEGKKYKFRVAARNAVGVSLPREAEGV------------------YEAKEQLLPPKI 18902

Query: 1051  LTPLIDRVVV-AGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRR 1109
             L P  +++ + AG    +   V G P P   W K + E+       +        L I+ 
Sbjct: 18903 LMP--EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKD 18960

Query: 1110  PSPFDAGTYTCRAVNELGEALAECKLEV 1137
              +  D+G Y+  A N  G    + K+ V
Sbjct: 18961 VTRKDSGYYSLTAENSSGTDTQKIKVVV 18988



 Score = 55.1 bits (131), Expect = 4e-07
 Identities = 59/225 (26%), Positives = 87/225 (38%), Gaps = 30/225 (13%)

Query: 927   IRVVEKAGPPIN---VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVY 983
             I  V+  GPP +   +   E   +   ++W+ P+ +G S I GY ++K      ++  V 
Sbjct: 15286 ILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVN 15345

Query: 984   ERN-RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEH 1042
             +R    TS  V +L     Y FRV   N  G S+ P +               P      
Sbjct: 15346 KRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESE-PSL---------------PLNVVIQ 15389

Query: 1043  DFRMAPKFLTPLIDR----VVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFL--- 1095
             D  + P     L  R     V AG    +   V G P PK+ W KN+  I +    L   
Sbjct: 15390 DDEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQIT 15449

Query: 1096  ---ITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
                ++  +    L+I +    D GTYT  A N LG       +EV
Sbjct: 15450 KEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEV 15494



 Score = 55.1 bits (131), Expect = 4e-07
 Identities = 72/327 (22%), Positives = 125/327 (38%), Gaps = 24/327 (7%)

Query: 518   SLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVAT 577
             +L  +  + EI     PK + P I      +   N  V    N   L   +TG P P+  
Sbjct: 30903 NLGGESEWSEISEPITPKSDVP-IQAPHFKEELRNLNVRYQSNAT-LVCKVTGHPKPIVK 30960

Query: 578   WLKGDEVFTTTEGRTRIEK-RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQV- 635
             W +  +       + RI++ +      +I S   +D   Y ++ TN  G    +  L+V 
Sbjct: 30961 WYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVE 31020

Query: 636   ----VDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFE 691
                 + +P   E +          + +  P     GKP    ++  +K         +++
Sbjct: 31021 VPAKIHLPKTLEGMGAVHALRGEVVSIKIP---FSGKPDP--VITWQKGQDLIDNNGHYQ 31075

Query: 692   VFTETTYESTKMIEGILYEMRVFAV----NAIGVSQPSMNTKPFMPIAPTSEPLHLI-VE 746
             V    ++ S     G+  +   F V    N  G+ Q ++     + +A   +P   + V 
Sbjct: 31076 VIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVE----LDVADVPDPPRGVKVS 31131

Query: 747   DVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGAR 806
             DV+  +  L W  P   G   I  Y+VE C   +E W+        R  +TV NL     
Sbjct: 31132 DVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQARETR--YTVINLFGKTS 31189

Query: 807   ILFRVVGVNIAGRSEPATLAQPVTIRE 833
               FRV+  N  G S+P+  ++P   +E
Sbjct: 31190 YQFRVIAENKFGLSKPSEPSEPTITKE 31216



 Score = 53.5 bits (127), Expect = 1e-06
 Identities = 65/294 (22%), Positives = 116/294 (39%), Gaps = 32/294 (10%)

Query: 854  VGEQLNLVVPFQGKPRPQVVWTKGGAPLDTS-RVHVRTSDFDTVFFVRQAARSDSGEYEL 912
            VGE  +      G    +V W K    + +  +  +   +      V +  + DSG+Y  
Sbjct: 8166 VGESADFECHVTGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTC 8225

Query: 913  SVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKA 972
                E  KD+ T ++ + E+  PP          T  L E    + +GNS  +   V  +
Sbjct: 8226 YAVNEVGKDSCTAQLNIKERLIPPSF--------TKRLSE-TVEETEGNSFKLEGRVAGS 8276

Query: 973  DKKTMEWF-NVYERNRHTSCTVSDLIVGNEYYFRVYTENI-------CGLSDSPGVSKNT 1024
               T+ W+ N  E    ++C ++     N    +V    +       C +S+  G +  T
Sbjct: 8277 QPITVAWYKNNIEIQPTSNCEIT--FKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCT 8334

Query: 1025 ARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKN 1084
            + I+      KP  + +H        LTP+    V  G    L+C V+G    ++ W+K 
Sbjct: 8335 SSIVIKEPK-KPPVFDQH--------LTPV---TVSEGEYVQLSCHVQGSEPIRIQWLKA 8382

Query: 1085 KMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVR 1138
              EI+   +   +   G   L +R  +  D+G Y C+A N  G    + K+ ++
Sbjct: 8383 GREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIK 8436



 Score = 52.8 bits (125), Expect = 2e-06
 Identities = 32/93 (34%), Positives = 40/93 (43%)

Query: 1048 PKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNI 1107
            P F+  L D   + G S  L C V G     V W ++  EI   PK   +  + V TLN+
Sbjct: 6741 PSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNL 6800

Query: 1108 RRPSPFDAGTYTCRAVNELGEALAECKLEVRVP 1140
                P D G YTC A N  G       L V+ P
Sbjct: 6801 SLLEPSDTGIYTCVAANVAGSDECSAVLTVQEP 6833



 Score = 52.0 bits (123), Expect = 3e-06
 Identities = 70/293 (23%), Positives = 112/293 (38%), Gaps = 38/293 (12%)

Query: 855  GEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSD-FDTVFFVRQAARSDSGEYELS 913
            G  + L     G P  +VVW K    +  S+    TS  FDT   +     SD GEY   
Sbjct: 6472 GSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCK 6531

Query: 914  VQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKAD 973
               E   DT +  ++  E   PP    VK++  T+ L+        G++  +   V+   
Sbjct: 6532 ATNEVGSDTCSCSVKFKE---PPR--FVKKLSDTSTLI--------GDAVELRAIVEGFQ 6578

Query: 974  KKTMEWFN----VYERNRHTSCTVSDLIVGNEYYFRVYTEN---ICGLSDSPGVSKNTAR 1026
              ++ W      V   + +T  +  D I   +      + +   IC + +  G+ + +A 
Sbjct: 6579 PISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAV 6638

Query: 1027 ILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKM 1086
            +       +P    E      P+ +T      V  G   AL C V G P+    W K+  
Sbjct: 6639 LT----VLEPARIIEK-----PEPMT------VTTGNPFALECVVTGTPELSAKWFKDGR 6683

Query: 1087 EIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVRV 1139
            E+  D K  IT    V +L I      D G Y+    N +G+  + C + V V
Sbjct: 6684 ELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGK--SNCTVSVHV 6734



 Score = 51.2 bits (121), Expect = 5e-06
 Identities = 30/94 (31%), Positives = 41/94 (43%), Gaps = 1/94 (1%)

Query: 1048 PKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNI 1107
            P  +TPL D V   G  A   C V G    KV W     +I+    F +T ++    L I
Sbjct: 3345 PAIITPLQDTVTSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQLEI 3403

Query: 1108 RRPSPFDAGTYTCRAVNELGEALAECKLEVRVPQ 1141
                P D GTYT  A N +G+  +   L +  P+
Sbjct: 3404 AEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPE 3437



 Score = 51.2 bits (121), Expect = 5e-06
 Identities = 68/310 (21%), Positives = 115/310 (37%), Gaps = 56/310 (18%)

Query: 367   VEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQ--VITN 424
             +E  ++  QV W     +L   + ++  Y   +DG   IL   D+ + D G Y+  V+ +
Sbjct: 31591 IENYDQSTQVTWYFGVRQLENSEKYEITY---EDGVA-ILYVKDITKLDDGTYRCKVVND 31646

Query: 425   GGQCE--AELIVE---------------------------EKQLEVLQDIADLTVKASEQ 455
              G+    AEL V+                           E+  E    + + T    E 
Sbjct: 31647 YGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGEN 31706

Query: 456   AVFKCEVS---DEKVTGKWYKNGVEVRPS---KRITISHVGRFHKLVIDDVRPEDEGDYT 509
               F   ++   +  VT  WYK+G +++P    K+ T       ++L I+ V  +D+ +YT
Sbjct: 31707 VRFGVTITVHPEPHVT--WYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYT 31764

Query: 510   FVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVA----GNKLRLD 565
              V        S K          V    PP    D + +     ++  A    G  +  +
Sbjct: 31765 VVARNKYGEDSCKAKLT------VTLHPPPT---DSTLRPMFKRLLANAECQEGQSVCFE 31815

Query: 566   VSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVG 625
             + ++G PPP   W K  +  +       I + +D  +  I     ED G Y +  TN  G
Sbjct: 31816 IRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAG 31875

Query: 626   EDVASIFLQV 635
                    LQV
Sbjct: 31876 STSCQAHLQV 31885



 Score = 50.8 bits (120), Expect = 7e-06
 Identities = 58/281 (20%), Positives = 104/281 (37%), Gaps = 30/281 (10%)

Query: 866  GKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFF-VRQAARSDSGEYELSVQIENMKDTAT 924
            G P  +V W K G  +  SR    + + +   F ++   + DSG+Y   V+ +    +  
Sbjct: 5166 GTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCD 5225

Query: 925  IRIRVVEKAGPPINVM----VKEVWGTNALVEWQAPKDDGNSEIMG-YFVQKADKKTMEW 979
              +RV+++  PP        + +V G++  +E    K  G+  I   +F    +  T   
Sbjct: 5226 AYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMEC---KVSGSLPISAQWFKDGKEISTSAK 5282

Query: 980  FNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEY 1039
            + +    R  S  V++L + +   +     N+ G     G+           +T K    
Sbjct: 5283 YRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGI-----------LTVKE--- 5328

Query: 1040 KEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNY 1099
                    P FL     +  +   +      ++G P  K+ W K+ +E+   PK  I   
Sbjct: 5329 -------PPSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIGLE 5381

Query: 1100 QGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVRVP 1140
                 LN+        G YTC   N++G       L V  P
Sbjct: 5382 GSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEP 5422



 Score = 49.3 bits (116), Expect = 2e-05
 Identities = 49/204 (24%), Positives = 86/204 (42%), Gaps = 17/204 (8%)

Query: 443 QDIADLTVKASEQAVFKCEVSDEKVTG-KWYKNGVEVRPSKR--ITISHVGRFHKLVIDD 499
           Q +  + V     A F+  +S   V    W+++G  +  S    + IS      KL I  
Sbjct: 10  QPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPA 69

Query: 500 VRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAG 559
           V   + G Y+      +   ++    L +K E  P     ++           ++ V  G
Sbjct: 70  VTKANSGRYSLKATNGSGQATSTAELL-VKAETAPPNFVQRLQ----------SMTVRQG 118

Query: 560 NKLRLDVSITGEPPPVATWLK-GDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTI 618
           +++RL V +TG P PV  + + G E+ ++ +   +I +  D  S +I  A  ED G Y++
Sbjct: 119 SQVRLQVRVTGIPTPVVKFYRDGAEIQSSLD--FQISQEGDLYSLLIAEAYPEDSGTYSV 176

Query: 619 KVTNPVGEDVASIFLQVVDVPDPP 642
             TN VG   ++  L V    + P
Sbjct: 177 NATNSVGRATSTAELLVQGEEEVP 200



 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 46/167 (27%), Positives = 77/167 (46%), Gaps = 10/167 (5%)

Query: 351 PLEDQQVFVGDRVEMAVEVSEEGA-QVMWMKDGVELTREDSFKARYRFKKDGKRHILIFS 409
           PL+   V  G        +S     +V W +DG  ++       +  F  DG+  + I +
Sbjct: 11  PLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFS-DGRAKLTIPA 69

Query: 410 DVVQEDRGRYQV-ITNG-GQCE--AELIVEEKQL--EVLQDIADLTVKASEQAVFKCEVS 463
            V + + GRY +  TNG GQ    AEL+V+ +      +Q +  +TV+   Q   +  V+
Sbjct: 70  -VTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVT 128

Query: 464 DEKV-TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYT 509
                  K+Y++G E++ S    IS  G  + L+I +  PED G Y+
Sbjct: 129 GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYS 175



 Score = 48.5 bits (114), Expect = 4e-05
 Identities = 29/94 (30%), Positives = 40/94 (42%)

Query: 1048 PKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNI 1107
            P+ L  L    V +G  A     + G P+PK+ W K +  +    K    +     TL +
Sbjct: 3239 PQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLL 3298

Query: 1108 RRPSPFDAGTYTCRAVNELGEALAECKLEVRVPQ 1141
                P DA  YTC A N+ G A     L V VP+
Sbjct: 3299 IEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPE 3332



 Score = 48.5 bits (114), Expect = 4e-05
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 3/93 (3%)

Query: 1048  PKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIR---EDPKFLITNYQGVLT 1104
             P+F  PL ++    G +      +  HP+P V W K+  +I+    D K+   + +G+  
Sbjct: 31690 PEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQ 31749

Query: 1105  LNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
             L I   +  D   YT  A N+ GE   + KL V
Sbjct: 31750 LTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 31782



 Score = 48.5 bits (114), Expect = 4e-05
 Identities = 76/332 (22%), Positives = 117/332 (35%), Gaps = 51/332 (15%)

Query: 243   KRLKKAKVEVKKSAAFTKKLDP-------AYQVDRGNKIKLMVEI-SDPDLTLKWFKNGQ 294
             ++  + K EV     FT    P       +++V  G   + ++ + S P   +KW+ NG 
Sbjct: 32353 QKTSERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGV 32412

Query: 295   EIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTPLED 354
             E++ SSK  + N      L I  C   D   Y     + K     +      L VT    
Sbjct: 32413 ELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYA----TLDVTG--- 32465

Query: 355   QQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGK-------RHILI 407
                  GD    A +  +E           ELTR +++ A   FKK  +       R +  
Sbjct: 32466 -----GDYTTYASQRRDEEVPRSVFP---ELTRTEAY-AVSSFKKTSEMEASSSVREVKS 32516

Query: 408   FSDVVQEDRGRYQVITNGGQCEAELIVEEKQLE---------------VLQDIADLTVKA 452
                  +E    Y+   +     A L  EEK LE               +L     +TV  
Sbjct: 32517 QMTETRESLSSYEHSASAEMKSAAL--EEKSLEEKSTTRKIKTTLAARILTKPRSMTVYE 32574

Query: 453   SEQAVFKCEVSDEKV-TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFV 511
              E A F C+   E V T  W + G  +  S R  ++         I  V+  DEG+Y+ V
Sbjct: 32575 GESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVV 32634

Query: 512   PDGYALSLSAKLNFLEIKVEYVPK--QEPPKI 541
              +       A+      K     K    PP++
Sbjct: 32635 VENSEGKQEAEFTLTIQKARVTEKAVTSPPRV 32666



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 30/91 (32%), Positives = 40/91 (43%)

Query: 1047  APKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLN 1106
             AP+    +    V  G +      V+  P  +V W  N +E++E  K   TN  GVLTL 
Sbjct: 32373 APRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLE 32432

Query: 1107  IRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
             I      D+GTY     N  GEA     L+V
Sbjct: 32433 ILDCHTDDSGTYRAVCTNYKGEASDYATLDV 32463



 Score = 45.4 bits (106), Expect = 3e-04
 Identities = 34/93 (36%), Positives = 43/93 (46%), Gaps = 3/93 (3%)

Query: 1032  ITFKPFEYKEHDFRMAP--KFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIR 1089
             +T K F+   + F   P  +F  PL D+ V  G +A L C V      KV W KN  EI 
Sbjct: 12267 LTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEV-SRENAKVKWFKNGTEIL 12325

Query: 1090  EDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRA 1122
             +  K+ I     V  L I   +P D  TYTC A
Sbjct: 12326 KSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDA 12358



 Score = 44.7 bits (104), Expect = 5e-04
 Identities = 48/210 (22%), Positives = 76/210 (36%), Gaps = 28/210 (13%)

Query: 457   VFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTF-VPDGY 515
             V K E  D+     WY    ++  S++  I++      L + D+   D+G Y   V + Y
Sbjct: 31588 VCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDY 31647

Query: 516   ALSLSAKLNFL----EIKVEYVPK---------------QEPPKIHLDCSGKTSENAIVV 556
                 S    F+    E+   Y  +               + PP+  L    KT+      
Sbjct: 31648 GEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTA------ 31701

Query: 557   VAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSF--VIESAQREDEG 614
               G  +R  V+IT  P P  TW K  +     +   +     D   +   I S   +D+ 
Sbjct: 31702 YVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDA 31761

Query: 615   RYTIKVTNPVGEDVASIFLQVVDVPDPPEA 644
              YT+   N  GED     L V   P P ++
Sbjct: 31762 EYTVVARNKYGEDSCKAKLTVTLHPPPTDS 31791



 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 28/91 (30%), Positives = 42/91 (46%)

Query: 1048 PKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNI 1107
            P F+  L    V  G    L   V G P P V + ++  EI+    F I+    + +L I
Sbjct: 104  PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLI 163

Query: 1108 RRPSPFDAGTYTCRAVNELGEALAECKLEVR 1138
                P D+GTY+  A N +G A +  +L V+
Sbjct: 164  AEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 43.1 bits (100), Expect = 0.001
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 2/94 (2%)

Query: 1047 APKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIRED--PKFLITNYQGVLT 1104
            AP F  PL   VV+ G +A     + G P P+V W ++   I     P   I+   G   
Sbjct: 5    APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK 64

Query: 1105 LNIRRPSPFDAGTYTCRAVNELGEALAECKLEVR 1138
            L I   +  ++G Y+ +A N  G+A +  +L V+
Sbjct: 65   LTIPAVTKANSGRYSLKATNGSGQATSTAELLVK 98



 Score = 42.7 bits (99), Expect = 0.002
 Identities = 39/170 (22%), Positives = 75/170 (44%), Gaps = 9/170 (5%)

Query: 553 AIVVVAGNKLRLDVSITGEPPPVATWLK-GDEVFTTTEGRTRIEKRVDCSSFVIESAQRE 611
           ++VV+ G+    +  I+G P P  +W + G  + T+T    +I      +   I +  + 
Sbjct: 14  SVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKA 73

Query: 612 DEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVT 671
           + GRY++K TN  G+  ++  L V     PP  V+        ++ V +         VT
Sbjct: 74  NSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQ-----SMTVRQGSQVRLQVRVT 128

Query: 672 GY---LVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNA 718
           G    +V+  + G++    L+F++  E    S  + E    +   ++VNA
Sbjct: 129 GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNA 178



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 61/285 (21%), Positives = 104/285 (36%), Gaps = 41/285 (14%)

Query: 389  DSFKARYRFKKDGKRHILIFSDVVQEDR-----GRYQVITNGGQCEAELIVEEKQLEVLQ 443
            D++K+    +   +  + I    V+E+R     GR   +T   +  A + +      ++ 
Sbjct: 888  DTYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVS 947

Query: 444  DIADLTVKASEQAVFKCEVSD-EKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRP 502
             + ++TV   E    +C +S     T  WY+   ++  S    I+      +L+I +   
Sbjct: 948  GLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFA 1007

Query: 503  EDEGDYTFVPDGYALSLSAKLNFLEIKV-EYVPKQ----------------EPPKIHLDC 545
            ED G +T      A ++S    +L ++V E   K+                E   + +  
Sbjct: 1008 EDSGRFTCSAVNEAGTVSTSC-YLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTD 1066

Query: 546  SGKTSENA--------------IV--VVAGNKLRLDVSITGEPPPVATWLKGDEVFTT-T 588
            +  T E A              +V  +V G  +     + G P P   W K     TT  
Sbjct: 1067 TSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGY 1126

Query: 589  EGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFL 633
              +    K+      VI     +D G YTI V N  GE  AS  L
Sbjct: 1127 RYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1171



 Score = 40.4 bits (93), Expect = 0.010
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 3/83 (3%)

Query: 554  IVVVAGNKLRLDVSITGEPPPVATWLKGD-EVFTTTEGRTRIEKRVDCSSFVIESAQRED 612
            + V+ G  + L+  I+G P P  TW + D ++ ++ + +   +  +  +  +I  A  ED
Sbjct: 952  VTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGI--ARLMIREAFAED 1009

Query: 613  EGRYTIKVTNPVGEDVASIFLQV 635
             GR+T    N  G    S +L V
Sbjct: 1010 SGRFTCSAVNEAGTVSTSCYLAV 1032



 Score = 39.3 bits (90), Expect = 0.022
 Identities = 61/266 (22%), Positives = 111/266 (41%), Gaps = 32/266 (12%)

Query: 2    PEAKPAAKKAPKGKDAPK--GAPKEAPPKEAPAEAPKEAPPEDQSPTAEEPTGVFLKKPD 59
            P+     KKA K KDA K    PKE  P+E   E  K+ PP    PT   P     K P+
Sbjct: 8979 PKRIEVTKKAVK-KDAKKVVAKPKEMTPRE---EIVKKPPP----PTTLIPA----KAPE 9026

Query: 60   SVSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFSFKESHNSAS-NVYT 118
             + V +  + V +  +  K+   K     ++ K      K     SF+E ++      YT
Sbjct: 9027 IIDVSSKAEEVKIMTITRKKEVQKEKEAVYEKKQAVHKEKRVFIESFEEPYDELEVEPYT 9086

Query: 119  VELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLESFKRTSEKKSDT 178
                       D  Y  ++V+AK          +V    ++   +  E ++R   ++   
Sbjct: 9087 EPFEQPYYEEPDEDYEEIKVEAKK---------EVHEEWEEDFEEGQEYYER---EEGYD 9134

Query: 179  AGELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGITDL 238
             GE ++    ++REV++ +K+  + +  +  +P ++ E     K     K+  +  I  +
Sbjct: 9135 EGEEEWEEAYQEREVIQVQKEVYE-ESHERKVPAKVPE----KKAPPPPKVIKKPVIEKI 9189

Query: 239  RGMLKRLKKAKVEVKKSAAFTKKLDP 264
                +R+++ KV+V K    +KK+ P
Sbjct: 9190 EKTSRRMEEEKVQVTKVPEVSKKIVP 9215



 Score = 38.9 bits (89), Expect = 0.028
 Identities = 19/61 (31%), Positives = 31/61 (50%)

Query: 1078  KVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
             +V W     ++    K+ IT   GV  L ++  +  D GTY C+ VN+ GE  +  +L V
Sbjct: 31599 QVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFV 31658

Query: 1138  R 1138
             +
Sbjct: 31659 K 31659



 Score = 38.1 bits (87), Expect = 0.048
 Identities = 48/197 (24%), Positives = 83/197 (42%), Gaps = 29/197 (14%)

Query: 287 LKWFKNGQEIK----PSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEK----CFTE 338
           + WF++GQ I     P  +  F +   K  LTI   T A+   Y +   +         E
Sbjct: 37  VSWFRDGQVISTSTLPGVQISFSDGRAK--LTIPAVTKANSGRYSLKATNGSGQATSTAE 94

Query: 339 LFVKEP--PVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVM-WMKDGVELTREDSFKARY 395
           L VK    P   V  L+   V  G +V + V V+     V+ + +DG E+     F+   
Sbjct: 95  LLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQ--- 151

Query: 396 RFKKDGKRHILIFSDVVQEDRGRYQV-ITNG---GQCEAELIVEEKQLEVLQDIADLTVK 451
              ++G  + L+ ++   ED G Y V  TN        AEL+V+ ++        ++  K
Sbjct: 152 -ISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEE--------EVPAK 202

Query: 452 ASEQAVFKCEVSDEKVT 468
            ++  V   ++S+ + T
Sbjct: 203 KTKTIVSTAQISESRQT 219



 Score = 37.7 bits (86), Expect = 0.063
 Identities = 28/105 (26%), Positives = 41/105 (39%), Gaps = 14/105 (13%)

Query: 830   TIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVR 889
             T+R +  PP+  LP + +  Y   VGE +   V     P P V W K G         ++
Sbjct: 31682 TMRLLERPPEFTLPLYNKTAY---VGENVRFGVTITVHPEPHVTWYKSGQ-------KIK 31731

Query: 890   TSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAG 934
               D D     +    SD G Y+L++      D A   +    K G
Sbjct: 31732 PGDNDK----KYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYG 31772



 Score = 37.4 bits (85), Expect = 0.082
 Identities = 25/97 (25%), Positives = 41/97 (42%), Gaps = 21/97 (21%)

Query: 237   DLRGMLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEI-SDPDLTLKWFKNGQE 295
             DLRG+ ++L  AK                     G+ IK+ + +   P  T+ W K  Q 
Sbjct: 21066 DLRGIYQKLVIAKA--------------------GDNIKVEIPVLGRPKPTVTWKKGDQI 21105

Query: 296   IKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKD 332
             +K + +  FE      IL IN+C  +D   Y +  ++
Sbjct: 21106 LKQTQRVNFETTATSTILNINECVRSDSGPYPLTARN 21142



 Score = 37.0 bits (84), Expect = 0.11
 Identities = 28/93 (30%), Positives = 40/93 (43%), Gaps = 22/93 (23%)

Query: 1006  VYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSA 1065
             VYT  + G        K +AR+  TGI  K              F++PL D+ V  G +A
Sbjct: 11553 VYTAEVEG-------KKTSARLFVTGIRLK--------------FMSPLEDQTVKEGETA 11591

Query: 1066  ALNCAVRGHPKPKVVWMKNKMEIREDPKFLITN 1098
                C +  H K  VVW KN  ++      LI++
Sbjct: 11592 TFVCEL-SHEKMHVVWFKNDAKLHTSRTVLISS 11623



 Score = 37.0 bits (84), Expect = 0.11
 Identities = 24/82 (29%), Positives = 31/82 (37%), Gaps = 1/82 (1%)

Query: 252   VKKSAAFTKKLDPAYQVDRGNKIKLMVEISD-PDLTLKWFKNGQEIKPSSKYVFENVGKK 310
             V  S     KL     V  G  ++    I   P  T KW  +G EIK    Y  E     
Sbjct: 17506 VPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFS 17565

Query: 311   RILTINKCTLADDAAYEVAVKD 332
              +LTI  C   D   Y++ V +
Sbjct: 17566 SVLTIKNCLRRDTGEYQITVSN 17587



 Score = 36.2 bits (82), Expect = 0.18
 Identities = 57/267 (21%), Positives = 99/267 (37%), Gaps = 40/267 (14%)

Query: 874  WTKGGAPLD-TSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEK 932
            W + G  L  T+ +   +        +      D GEY  + ++   K +A +++  V+ 
Sbjct: 2652 WLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEY--TYKVATSKTSAKLKVEAVKI 2709

Query: 933  AGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCT 992
                 N+ V E       VE   P   G   I    V ++++K    + +  +    S  
Sbjct: 2710 KKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEK----YAISVKGTIYSLR 2765

Query: 993  VSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLT 1052
            + +  + +E    VY   +  L  S  +   T +I+K                  PK +T
Sbjct: 2766 IKNCAIVDE---SVYGFRLGRLGASARLHVETVKIIKK-----------------PKDVT 2805

Query: 1053 PLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSP 1112
             L +  V    S +       H    V W    +EI+   K  + + + V  L ++  SP
Sbjct: 2806 ALENATVAFEVSVS-------HDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISP 2858

Query: 1113 FDAGTYTCRAVNELGEALAECKLEVRV 1139
             DAG YT   V +L     ECK ++ V
Sbjct: 2859 SDAGEYTA-VVGQL-----ECKAKLFV 2879



 Score = 36.2 bits (82), Expect = 0.18
 Identities = 27/97 (27%), Positives = 38/97 (39%), Gaps = 3/97 (3%)

Query: 1043  DFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGV 1102
             D  + P F   L +     G S      V G P P + W K+   +   P   I  ++G+
Sbjct: 31790 DSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEII-HEGL 31848

Query: 1103  --LTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
                 L+IR   P D G Y   A N  G    +  L+V
Sbjct: 31849 DYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 31885



 Score = 35.8 bits (81), Expect = 0.24
 Identities = 30/85 (35%), Positives = 39/85 (45%), Gaps = 6/85 (7%)

Query: 1     MPEAKPAAKKAPKGK-DAPKGAPKEAPPKEAPAEAPKEAPPEDQSPTAEEPTGVFLKKPD 59
             +PE  P  +  P+ K   P     EAPP + P EAPKE  PE + P    P     + P 
Sbjct: 10495 VPEVLPPKEVVPEKKVPVPPAKKPEAPPPKVP-EAPKEVVPEKKVPV---PPPKKPEVPP 10550

Query: 60    SVSVETGKDAVVVAKVNGKELPDKP 84
             +   E  K AV   KV  + +P KP
Sbjct: 10551 TKVPEVPKAAVPEKKV-PEAIPPKP 10574



 Score = 35.0 bits (79), Expect = 0.41
 Identities = 32/88 (36%), Positives = 38/88 (43%), Gaps = 10/88 (11%)

Query: 1     MPEAKPAAKKAPKGKDAPKGAPKEAPPKEAPAEAPKEAPPEDQSPTAEEPTGVFLKKPD- 59
             +PE   AA    K  +A    P E+PP E P EAPKE  PE + P A        KKP+ 
Sbjct: 10553 VPEVPKAAVPEKKVPEAIPPKP-ESPPPEVP-EAPKEVVPEKKVPAAPP------KKPEV 10604

Query: 60    -SVSVETGKDAVVVAKVNGKELPDKPTI 86
               V V      VV  K      P KP +
Sbjct: 10605 TPVKVPEAPKEVVPEKKVPVPPPKKPEV 10632



 Score = 34.3 bits (77), Expect = 0.69
 Identities = 29/73 (39%), Positives = 34/73 (46%), Gaps = 13/73 (17%)

Query: 3     EAKPAA-----KKAPKGKDAPKGAPK--EAPPKEAPAEAPKEAPPEDQSPT-----AEEP 50
             EA PA      KK    K  P  APK  EAPP + P E PK+  PE++ PT      E P
Sbjct: 10026 EAPPAKVPEVPKKPVPEKKVPVPAPKKVEAPPAKVP-EVPKKLIPEEKKPTPVPKKVEAP 10084

Query: 51    TGVFLKKPDSVSV 63
                  KK + V V
Sbjct: 10085 PPKVPKKREPVPV 10097



 Score = 33.5 bits (75), Expect = 1.2
 Identities = 22/92 (23%), Positives = 37/92 (40%), Gaps = 3/92 (3%)

Query: 848 QTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSR---VHVRTSDFDTVFFVRQAAR 904
           Q+ +   G          G P P+V W + G  + TS    V +  SD      +    +
Sbjct: 13  QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTK 72

Query: 905 SDSGEYELSVQIENMKDTATIRIRVVEKAGPP 936
           ++SG Y L     + + T+T  + V  +  PP
Sbjct: 73  ANSGRYSLKATNGSGQATSTAELLVKAETAPP 104



 Score = 32.7 bits (73), Expect = 2.0
 Identities = 30/88 (34%), Positives = 37/88 (42%), Gaps = 21/88 (23%)

Query: 2     PEAKP-----AAKKAPKGKDAPKGAPK--EAPPKEAPAEAPKEAPPEDQSPTA------- 47
             PE  P     A K+    K  P   PK  E PP + P E PK A PE + P A       
Sbjct: 10602 PEVTPVKVPEAPKEVVPEKKVPVPPPKKPEVPPTKVP-EVPKVAVPEKKVPEAIPPKPES 10660

Query: 48    ------EEPTGVFLKKPDSVSVETGKDA 69
                   EEP  V L++P +  VE  + A
Sbjct: 10661 PPPEVFEEPEEVALEEPPAEVVEEPEPA 10688



 Score = 32.7 bits (73), Expect = 2.0
 Identities = 31/95 (32%), Positives = 38/95 (40%), Gaps = 16/95 (16%)

Query: 2     PEAKPAAKKAPKGKDAPKGAPK------EAPPKEAPAEAPKEAPPEDQSPTAEEPTGVFL 55
             P A P     PK     K AP       E PP + P E PKE  PE + P       V  
Sbjct: 10687 PAAPPQVTVPPKKPVPEKKAPAVVAKKPELPPVKVP-EVPKEVVPEKKVPL------VVP 10739

Query: 56    KKPDSVSV---ETGKDAVVVAKVNGKELPDKPTIK 87
             KKP++      E  K+ V   KV   + P+ P  K
Sbjct: 10740 KKPEAPPAKVPEVPKEVVPEKKVAVPKKPEVPPAK 10774



 Score = 32.7 bits (73), Expect = 2.0
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 268   VDRGNKIKLMVEISD-PDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
             V  G  ++L++ I+  P     WF  G +++ S +   E   K   LTI + T+ D   Y
Sbjct: 29750 VPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEY 29809

Query: 327   EVAVKD 332
              + +K+
Sbjct: 29810 TLELKN 29815



 Score = 32.3 bits (72), Expect = 2.6
 Identities = 22/91 (24%), Positives = 39/91 (42%), Gaps = 3/91 (3%)

Query: 873  VWTKGGAPLDTS-RVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVE 931
            VW K G  +  S RVH+       +  +    + D+G Y  ++    +  +  + +  V+
Sbjct: 2387 VWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVD 2446

Query: 932  KAGPPINVMVKEVWGTNALVEWQAPKDDGNS 962
               P  +V V E  GT A++E +    D  S
Sbjct: 2447 VITPLKDVNVIE--GTKAVLECKVSVPDVTS 2475



 Score = 32.0 bits (71), Expect = 3.4
 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 268   VDRGNKIKLMVEI-SDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
             V  G K+ + V   + P  T+ W K+G+E+K S +   +N      L + K   AD   Y
Sbjct: 14398 VIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIY 14457

Query: 327   EVAVKDE 333
              + ++++
Sbjct: 14458 TITLENK 14464



 Score = 31.6 bits (70), Expect = 4.5
 Identities = 31/122 (25%), Positives = 49/122 (40%), Gaps = 6/122 (4%)

Query: 1009 ENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPK-----FLTPLIDRVVVAGY 1063
            +N+C L      ++++A I+   I     E   H F +        F   L D V     
Sbjct: 2131 DNVCELVIRDVTAEDSASIMVKAINIAG-ETSSHAFLLVQAKQLITFTQELQDVVAKEKD 2189

Query: 1064 SAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAV 1123
            + A        P  KV W K+ ME+ E  K+ + + + V  L+I      DA  Y+C  V
Sbjct: 2190 TMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLV 2249

Query: 1124 NE 1125
             +
Sbjct: 2250 ED 2251



 Score = 31.6 bits (70), Expect = 4.5
 Identities = 29/104 (27%), Positives = 40/104 (38%), Gaps = 12/104 (11%)

Query: 1048 PKFLTPLIDRVVVAGY-SAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLN 1106
            P   T  I  +VV+ + SA   C V       V W K   E+ E  K+   N      + 
Sbjct: 8833 PIQFTKRIQNIVVSEHQSATFECEV-SFDDAIVTWYKGPTELTESQKYNFRNDGRCHYMT 8891

Query: 1107 IRRPSPFDAGTYT----------CRAVNELGEALAECKLEVRVP 1140
            I   +P D G Y+           R+  EL     E KLE++ P
Sbjct: 8892 IHNVTPDDEGVYSVIARLEPRGEARSTAELYLTTKEIKLELKPP 8935



 Score = 31.6 bits (70), Expect = 4.5
 Identities = 60/257 (23%), Positives = 100/257 (38%), Gaps = 50/257 (19%)

Query: 45    PTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWFK-GKWLELGSKSGAR 103
             PT      +F +   +   + G+      +V+G  +P  PT+KW K G+ L LG      
Sbjct: 31788 PTDSTLRPMFKRLLANAECQEGQSVCFEIRVSG--IPP-PTLKWEKDGQPLSLGPNI--- 31841

Query: 104   FSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPR-QDASG 162
                 E  +   + Y   LHI   +  D GYYR+         SC  ++ VE  R +    
Sbjct: 31842 ----EIIHEGLDYYA--LHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQEF 31895

Query: 163   QSLESFKRTSEKKSDTAGELDFSGLLKKREVV--EEEKKKKKKDDDDLGIPPEIWELLKG 220
             +S E  +R  +K+ D    L  + +L   E V   +  K+  ++   L  P    + +KG
Sbjct: 31896 KSKEEHERHVQKQIDKT--LRMAEILSGTESVPLTQVAKEALREAAVLYKPAVSTKTVKG 31953

Query: 221   ------AKKSEYEKIAFQYGITDLRGMLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNKI 274
                    +K E  K+   Y + + R    + K+  +E                     +I
Sbjct: 31954 EFRLEIEEKKEERKLRMPYDVPEPR----KYKQTTIE------------------EDQRI 31991

Query: 275   KLMVEISDPDLTLKWFK 291
             K  V +SD    +KW+K
Sbjct: 31992 KQFVPMSD----MKWYK 32004



 Score = 31.2 bits (69), Expect = 5.9
 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 1/67 (1%)

Query: 261   KLDPAYQVDRGNKIKLMVEISD-PDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCT 319
             KL     V  G KI+L   ++  P+  + W K    +K   +   ENV KK  +TI    
Sbjct: 13695 KLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSK 13754

Query: 320   LADDAAY 326
              +D   Y
Sbjct: 13755 RSDTGTY 13761



 Score = 30.8 bits (68), Expect = 7.7
 Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 1/72 (1%)

Query: 1049  KFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIR 1108
             +FL PL D  V     A   C +      KV W K+  EI++  K+ I +   V  L I 
Sbjct: 12375 EFLRPLTDLQVREKEMARFECEL-SRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVIN 12433

Query: 1109  RPSPFDAGTYTC 1120
             +    D   Y+C
Sbjct: 12434 KCLLDDEAEYSC 12445


>gi|110349717 titin isoform novex-2 [Homo sapiens]
          Length = 27118

 Score =  275 bits (704), Expect = 1e-73
 Identities = 222/790 (28%), Positives = 337/790 (42%), Gaps = 43/790 (5%)

Query: 279  EISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTE 338
            ++S     +KW++NG+EIK   KY FE  G    L I  C L D+  Y   V+D K    
Sbjct: 6540 QLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRAR 6599

Query: 339  LFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFK 398
            LFV+E PV I+ P +D     G  V    E++++  +V W+++ + + + D    +++  
Sbjct: 6600 LFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGD----KHQMM 6655

Query: 399  KDGKRHILIFSDVVQEDRGRYQVITNGGQCEA--ELIVEEKQLEVLQDIA-----DLTVK 451
             +GK H L   D+   D+G Y+ I    +  A  EL    K     QD+       LT+ 
Sbjct: 6656 SEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAPKIKTADQDLVVDVGKPLTMV 6715

Query: 452  ASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFV 511
                A  K E        +W+K   E  P    TI          I + +  D+G Y  V
Sbjct: 6716 VPYDAYPKAEA-------EWFK---ENEPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIV 6765

Query: 512  PDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGE 571
                       +N   I V    +        D     +    +   G+K+ +   +   
Sbjct: 6766 LQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKI-IGYVVERR 6824

Query: 572  PPPVATWLKGDEVFTTTEGR-TRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVAS 630
                 TW+   +   + E   T ++K      F + +  R   G   ++  NPV  +  S
Sbjct: 6825 DIKRKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGE-PVETDNPV--EARS 6881

Query: 631  IFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRW---MK 687
             +    DVP PP  V IT V      L WEPP YDGG  +T Y++E + K S RW   M 
Sbjct: 6882 KY----DVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMT 6937

Query: 688  LNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM----PIAPTSEPLHL 743
            +  E  + T    T ++EG  Y  RV A N IGV +PS  T PF+    PI   S P++L
Sbjct: 6938 VRAEDLSATV---TDVVEGQEYSFRVRAQNRIGVGKPSAAT-PFVKVADPIERPSPPVNL 6993

Query: 744  IVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPT 803
               D T ++  LKW PP + G   I GY++E C EG + W+  N + V    + V  L  
Sbjct: 6994 TSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEK 7053

Query: 804  GARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVP 863
            G + L+RV   N AG S+P+ +  P+T  +    P + L        +  V   + ++VP
Sbjct: 7054 GNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVI-VPNPITILVP 7112

Query: 864  FQGKPRPQVVWTKGGAPLDTS-RVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDT 922
              G PRP   W  G   L+T  RV ++T        +  + RSD G Y L ++      +
Sbjct: 7113 STGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTIS 7172

Query: 923  ATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNV 982
              I + V+ +   P  +   ++   +  + W+ P DDG S + GY V+K +     W  V
Sbjct: 7173 GEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV 7232

Query: 983  YERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEH 1042
             +       TV DL+ G EY F+V   N CG  +   V +         +   P   K  
Sbjct: 7233 MDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWR 7292

Query: 1043 DFRMAPKFLT 1052
            D      FLT
Sbjct: 7293 DRTANSIFLT 7302



 Score =  274 bits (701), Expect = 3e-73
 Identities = 167/480 (34%), Positives = 243/480 (50%), Gaps = 13/480 (2%)

Query: 537   EPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEK 596
             EPP+I LD   +     +V+ A   LRL V+I G P P   W K + + T    R +IE 
Sbjct: 18798 EPPEIELDADLR---KVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILTD---RAQIEV 18851

Query: 597   RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAI 656
                 +  VI++  R D GRY + + N  G   A + ++V+D P  P  + I  V +D   
Sbjct: 18852 TSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVT 18911

Query: 657   LVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAV 716
             L WEPP+ DGG  +T Y+VE+++   + +  +     T+TT+    + EG  Y  RV A 
Sbjct: 18912 LSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNC-TKTTFRIENLQEGCSYYFRVLAS 18970

Query: 717   NAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
             N  G+  P+  T+P     P   P  + + DVT  T T+KW  P   G   I GY+VE  
Sbjct: 18971 NEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQ 19030

Query: 777   LEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAE 836
              +GSE+W  +    V+    T+  L  G   +FRV  VN  GRS+P  L  PV  R+I  
Sbjct: 19031 TKGSEKW--STCTQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEI 19088

Query: 837   PPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVRTSDFDT 895
              P + LP H   T+  K  EQL + VPF+G+P+  V W K G  L +T+RV+V +S   T
Sbjct: 19089 KPSVELPFH---TFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVT 19145

Query: 896   VFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQA 955
                +++A++ D G YEL V       T  I I V+++ GPP  + + EV   +  + W  
Sbjct: 19146 SLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPPGPIRIDEVSCDSITISWNP 19205

Query: 956   PKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLS 1015
             P+ DG  +I  Y V+K +  +  W  V +    TS  +  L  G+EY FRV  EN  G S
Sbjct: 19206 PEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKS 19265



 Score =  265 bits (678), Expect = 1e-70
 Identities = 169/568 (29%), Positives = 272/568 (47%), Gaps = 23/568 (4%)

Query: 535   KQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRI 594
             K E P++ LD   +     IVV AG   R+ +   G P P  TW + +  FT    + +I
Sbjct: 17713 KLEAPELDLDSELR---KGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTD---KVQI 17766

Query: 595   EKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDW 654
             EK V+ +   I++  R D G+Y +K+ N  G   A + ++V+D P PP+ + +  V +D 
Sbjct: 17767 EKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDS 17826

Query: 655   AILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVF 714
             A LVWEPP+ DGG  V  Y++++++   + +  ++ +  ++T+++   + EG +Y  RV 
Sbjct: 17827 AFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKC-SKTSFKVENLTEGAIYYFRVM 17885

Query: 715   AVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
             A N  GV  P           P S P  + + DV+ T+ +L W  P   G   + GY+VE
Sbjct: 17886 AENEFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVE 17945

Query: 775   YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREI 834
                +G+E+W       V  C   V  L +G    FRV   N  G+S+P  L  PV  +++
Sbjct: 17946 MQPKGTEKWSIVAESKV--CNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDL 18003

Query: 835   AEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVRTSDF 893
                P ++LP +   TY  + GE L + +P  G+PRP + W K G PL  T+RV+V  +  
Sbjct: 18004 TIQPSLKLPFN---TYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETAT 18060

Query: 894   DTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTNALVE 952
              TV  +++  + D G+Y ++        T  + + V+EK GPP+  V   EV     ++ 
Sbjct: 18061 STVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVSADFVVIS 18120

Query: 953   WQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENIC 1012
             W+ P   G  +I  Y V+K D  T  W  V      T+  ++ L  G EY FR++ EN  
Sbjct: 18121 WEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRY 18180

Query: 1013  GLS---DSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNC 1069
             G S   DS  V        + G    PF       +M  ++  P+ D     G +  +  
Sbjct: 18181 GKSAPLDSKAVIVQYP-FKEPGPPGTPFVTSISKDQMLVQWHEPVND-----GGTKIIGY 18234

Query: 1070  AVRGHPKPKVVWMKNKMEIREDPKFLIT 1097
              +    K  ++W+K      +D KF  T
Sbjct: 18235 HLEQKEKNSILWVKLNKTPIQDTKFKTT 18262



 Score =  261 bits (668), Expect = 2e-69
 Identities = 175/561 (31%), Positives = 269/561 (47%), Gaps = 37/561 (6%)

Query: 471   WYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKV 530
             W+  G ++R S+R+T+    +  KL I +    D G+YT        + S       IKV
Sbjct: 23467 WFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSET-----IKV 23521

Query: 531   EYVPKQEPPK--IHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPV--ATWLKG---DE 583
               + K  PP   I +D    TS               ++I+ EPP +     L G   ++
Sbjct: 23522 IILDKPGPPTGPIKIDEIDATS---------------ITISWEPPELDGGAPLSGYVVEQ 23566

Query: 584   VFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNP--VGEDVASIFLQV---VDV 638
                   G   + + V  S+F        +E  + +  TN   +G  + S  ++    + +
Sbjct: 23567 RDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIECRSSIRI 23626

Query: 639   PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTY 698
             P PPE ++I  V  D   L W PP  DGG  VTGY+VERK+  + RW+++N    T T Y
Sbjct: 23627 PGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRY 23686

Query: 699   ESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTL 755
              ST + EG+ YE RV A+NA G  +PS  +KP +   PIAP  +P +  V D T T+ +L
Sbjct: 23687 RSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSL 23746

Query: 756   KWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVN 815
              W  P   G   + GYL+E       EW   NT P +   +T+ +LP GA   FRV+  N
Sbjct: 23747 AWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACN 23806

Query: 816   IAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWT 875
               G  EPA +   V + E+ E P   L    ++    + G  + L +P +GKP P   WT
Sbjct: 23807 AGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWT 23866

Query: 876   KGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGP 935
             K G  + + R  + TS+  T   +++A R DSG Y+L ++ +  K    I++RV+     
Sbjct: 23867 KEGQDI-SKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIGSPNS 23925

Query: 936   PINVM-VKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVS 994
             P   +   ++   +  V W+ P DDG ++I+GY +++ +     W+ +  R R TS  V 
Sbjct: 23926 PEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVK 23985

Query: 995   DLIVGNEYYFRVYTENICGLS 1015
              L    EY+FRV  EN  G+S
Sbjct: 23986 GLKENVEYHFRVSAENQFGIS 24006



 Score =  252 bits (644), Expect = 1e-66
 Identities = 177/599 (29%), Positives = 286/599 (47%), Gaps = 32/599 (5%)

Query: 448   LTVKASEQAVFKCEVSDEKVTG-KWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG 506
             + VKA E      +++   +    W K+G+E+    R  I        L + D    D G
Sbjct: 19494 IVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTG 19553

Query: 507   DYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDV 566
              Y       A + S  +N      + + K  PP   L+ +G T+E   +  +  + + D 
Sbjct: 19554 QYVLTLKNVAGTRSVAVN-----CKVLDKPGPPAGPLEINGLTAEKCSL--SWGRPQEDG 19606

Query: 567   SITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNP--V 624
                 +   V         +T  EG  ++      +S  +    + +E  + +   N   V
Sbjct: 19607 GADIDYYIVEKRETSHLAWTICEGELQM------TSCKVTKLLKGNEYIFRVTGVNKYGV 19660

Query: 625   GEDVASIFLQVVD---VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKG 681
             GE + S+ ++ +D   VP PP ++ ITSV ++   L W  P  DGG  ++GY++ER++K 
Sbjct: 19661 GEPLESVAIKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSEISGYIIERREKN 19720

Query: 682   SQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM----PIAPT 737
             S RW+++N +   +   +ST + EG  YE RV+A NA G+S PS  T P +    P+   
Sbjct: 19721 SLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPS-ETSPLIRAEDPVFLP 19779

Query: 738   SEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFT 797
             S P    + D   TT T+ W  P   G   I GY VEY      +W   + + +    +T
Sbjct: 19780 SPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDW-KTSIQSLRGTEYT 19838

Query: 798   VKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQ 857
             +  L TGA  +FRV  VN  G S+P+  + P   +E  E P   +   +R+T I K G  
Sbjct: 19839 ISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGAS 19898

Query: 858   LNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIE 917
               + VPF+G+P P V+W+K    L T R +V T+D  T   +  A R+DSG+Y L++Q  
Sbjct: 19899 FTMTVPFRGRPVPNVLWSKPDTDLRT-RAYVDTTDSRTSLTIENANRNDSGKYTLTIQNV 19957

Query: 918   NMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTM 977
                 + T+ ++V++  GPP N+ V++V   +A++ W  P++DG + +  Y ++K +    
Sbjct: 19958 LSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKREASKK 20017

Query: 978   EWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKP 1036
              W +V       S  V++L  G  YYFRV  EN  G+    G+   T   +K  IT KP
Sbjct: 20018 AWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGV----GIPAETKEGVK--ITEKP 20070



 Score =  249 bits (637), Expect = 8e-66
 Identities = 181/600 (30%), Positives = 287/600 (47%), Gaps = 38/600 (6%)

Query: 448   LTVKASEQAVFKCEVSDEKV-TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG 506
             LTVKA         V  + + T  W K+G  ++P++ I ++       L +  V  +D G
Sbjct: 13000 LTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSG 13059

Query: 507   DYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDV 566
             DYT   +  + S SA      IK++ + K  PP                 V  NK+  D 
Sbjct: 13060 DYTITAENSSGSKSAT-----IKLKVLDKPGPP---------------ASVKINKMYSDR 13099

Query: 567   SITGEPPPVA------TWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKV 620
             ++    PP+       T    D+  T+     ++   V  +S  +E      E ++ I  
Sbjct: 13100 AMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICA 13159

Query: 621   TNP--VGEDVASIFLQVVDVPDPP---EAVRITSVGEDWAILVWEPPMYDGGKPVTGYLV 675
              N   VG+ V +      +  DPP   +   I+++ +D   + W+PP  DGG P+TGYL+
Sbjct: 13160 ENKYGVGDPVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLL 13219

Query: 676   ERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM--- 732
             E+++  +  W K+N +   E T ++T + EG  YE RV A+N  G  +PS  +K      
Sbjct: 13220 EKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARD 13279

Query: 733   PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANT-EPV 791
             P  P   P    V D T ++ +L W  P   G   I GYLVE     S+ WV  N  + +
Sbjct: 13280 PQYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNL 13339

Query: 792   ERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYI 851
             ++  F V  L    +  FRV  VN  G S+P+ +      ++I  PP+  L   LR+T I
Sbjct: 13340 QKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLI 13399

Query: 852   RKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVRTSDFDTVFFVRQAARSDSGEY 910
              + G  + L VP +G+P P++ W+K    L D   + ++++DFDT        + D+G+Y
Sbjct: 13400 LRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKY 13459

Query: 911   ELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQ 970
              L+++    K   TI ++V++  GPP+NV VKE+   +A V W+ P  DG S I+ Y VQ
Sbjct: 13460 ILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQ 13519

Query: 971   KADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKT 1030
             K D +   W  V      TS  V++L  G  Y+FRV+ EN  G+ D PG +++  +  +T
Sbjct: 13520 KRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGD-PGETRDAVKASQT 13578



 Score =  246 bits (628), Expect = 9e-65
 Identities = 155/494 (31%), Positives = 245/494 (49%), Gaps = 17/494 (3%)

Query: 530   VEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTE 589
             +E   +   P + LD S +   + IVV AG  +R+   ++G+PPP  TW   +    T  
Sbjct: 10208 IEMKDRLVSPDLQLDASVR---DRIVVHAGGVIRIIAYVSGKPPPTVTWNMNER---TLP 10261

Query: 590   GRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRIT- 648
                 IE     SS VI++ QR  +G Y++   N  GE   +I + V+DVP P     +  
Sbjct: 10262 QEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAH 10321

Query: 649   SVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGIL 708
             ++  +   L W  P  DGG P+T Y++E+++   + W  + + V T        +I+G  
Sbjct: 10322 NLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTV-TRQNATVQGLIQGKA 10380

Query: 709   YEMRVFAVNAIGVSQPSMNTKPFM----PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIG 764
             Y  R+ A N+IG+  P + T   +    PI     P  L V++VT  T TL W PP   G
Sbjct: 10381 YFFRIAAENSIGMG-PFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDG 10439

Query: 765   AGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPAT 824
                I  Y++E  L G+E++     + +    +TVK L  G    +RV  VNI G+ +P+ 
Sbjct: 10440 GSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSF 10499

Query: 825   LAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAP-LDT 883
               +P+T ++   PP + L    R     +VGE   L   + GKP+P+V W K  A  L+ 
Sbjct: 10500 CTKPITCKDELAPPTLHL--DFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLED 10557

Query: 884   SRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVK 942
              R H++T+         +A RSDSG+Y + V+          ++ VV++ GPP+  V   
Sbjct: 10558 DRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFD 10617

Query: 943   EVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEY 1002
             EV     ++ W+ P DDG S+I  Y ++K +     W  V   +  T+C VS L+ G +Y
Sbjct: 10618 EVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDY 10677

Query: 1003  YFRVYTENICGLSD 1016
              FR++ EN+ G+SD
Sbjct: 10678 IFRIHAENLYGISD 10691



 Score =  246 bits (627), Expect = 1e-64
 Identities = 150/488 (30%), Positives = 235/488 (48%), Gaps = 9/488 (1%)

Query: 529   KVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTT 588
             ++E V + E P + L       +  + + AG  LRL VS++G PPPV TW K        
Sbjct: 23129 EIEPVERIEIPDLEL---ADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQG---IDL 23182

Query: 589   EGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRIT 648
               R  I+     S  +++   R D G+YTI+  N  G+  A++ ++V D P P  +V++ 
Sbjct: 23183 ASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVK 23242

Query: 649   SVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGIL 708
              V  D   + WE P  DGG PV  Y+VE K++ + R  K      ++T Y  + ++EG +
Sbjct: 23243 EVSRDSVTITWEIPTIDGGAPVNNYIVE-KREAAMRAFKTVTTKCSKTLYRISGLVEGTM 23301

Query: 709   YEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGI 768
             Y  RV   N  G+ +P   +   +       P  L V DVT +T TL W  P   G   +
Sbjct: 23302 YYFRVLPENIYGIGEPCETSDAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRL 23361

Query: 769   DGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQP 828
              GY++E C  G+E W+   T        TV +L  G + LFR+   N  G SEP      
Sbjct: 23362 TGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTA 23421

Query: 829   VTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVH 887
             VT++++   P I L    ++T     G  + LV+P  G+P P   W   G+ L ++ RV 
Sbjct: 23422 VTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVT 23481

Query: 888   VRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWG 946
             V T        +R+    D+GEY L ++      + TI++ +++K GPP   + + E+  
Sbjct: 23482 VETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDA 23541

Query: 947   TNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRV 1006
             T+  + W+ P+ DG + + GY V++ D     W  V E    ++   + L  GNEY FRV
Sbjct: 23542 TSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRV 23601

Query: 1007  YTENICGL 1014
                N  G+
Sbjct: 23602 AATNRFGI 23609



 Score =  243 bits (620), Expect = 8e-64
 Identities = 162/502 (32%), Positives = 240/502 (47%), Gaps = 27/502 (5%)

Query: 527   EIKVEYVPKQ--EPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEV 584
             E+K    PK+  EPP+I LD S +     ++V AG  +RL   + G P P  TW K    
Sbjct: 12285 ELKEAIKPKEILEPPEIDLDASMR---KLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGID 12341

Query: 585   FTTTEGRTRIEKRVDCSSF-VIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPE 643
                 +G+  +   VD  +F VI ++ R+D G+Y++ + NP GE    + ++V+D P P  
Sbjct: 12342 NVVRKGQVDL---VDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVS 12398

Query: 644   AVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKM 703
              ++++ V +    + W PP  DGG  VT Y+VE+++   + W  +  EV  +T++  T +
Sbjct: 12399 DLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEV-KKTSFHVTNL 12457

Query: 704   IEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSE---PLHLIVEDVTDTTTTLKWRPP 760
             + G  Y  RV AVN  G   P+   KP +   P SE   P  L V ++T  + TL W PP
Sbjct: 12458 VPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPP 12517

Query: 761   NRIGAGGIDGYLVEYCLEGSEEWVPANT----EPVERCGFTVKNLPTGARILFRVVGVNI 816
              R G   IDGY+  Y     EE  PA+       V+     V  L  G +  FRV   N 
Sbjct: 12518 LRDGGAKIDGYITSY----REEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNA 12573

Query: 817   AGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTK 876
              G S P         +E   PPKI +P  +      K G++L +     GKP P   W K
Sbjct: 12574 VGVSLPREAEGVYEAKEQLLPPKILMPEQI----TIKAGKKLRIEAHVYGKPHPTCKWKK 12629

Query: 877   GGAPLDT-SRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGP 935
             G   + T S + V  +D  ++  ++   R DSG Y L+ +  +  DT  I++ V++  GP
Sbjct: 12630 GEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGP 12689

Query: 936   PINVM-VKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVS 994
             P     + ++      + W  P +DG S I  Y V+K D    +W         TSC V 
Sbjct: 12690 PQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVG 12749

Query: 995   DLIVGNEYYFRVYTENICGLSD 1016
              LI G EY FRV  EN  G+S+
Sbjct: 12750 KLIPGQEYIFRVRAENRFGISE 12771



 Score =  239 bits (610), Expect = 1e-62
 Identities = 152/487 (31%), Positives = 236/487 (48%), Gaps = 22/487 (4%)

Query: 535   KQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRI 594
             K E P I LD   +   N   + AG  LRL V I G P P   W K D       G  R 
Sbjct: 16631 KLEAPDIDLDLELRKIIN---IRAGGSLRLFVPIKGRPTPEVKWGKVD-------GEIRD 16680

Query: 595   EKRVDCSS----FVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSV 650
                +D +S     V+++  R D G+YT+ + N  G   A + ++V+D P PP  +++T +
Sbjct: 16681 AAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEI 16740

Query: 651   GEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYE 710
              +D   + WEPP+ DGG  +  Y+VE+++   + +  +      + +++  ++ EG  Y 
Sbjct: 16741 TKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCH-KNSWKIDQLQEGCSYY 16799

Query: 711   MRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDG 770
              RV A N  G+  P+    P         P  + V+DVT  + +L W  P   G   I  
Sbjct: 16800 FRVTAENEYGIGLPAQTADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQ 16859

Query: 771   YLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVT 830
             Y+VE   + SE+W  +    V+     + NL  G   LFRVV VN  GRS+P +LA P+ 
Sbjct: 16860 YIVEMQAKHSEKW--SECARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIV 16917

Query: 831   IREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVR 889
              +++   P +   +    +Y  +VG+ L + VP  G+P+P + WTK G PL  T+R++V 
Sbjct: 16918 AKDLVIEPDV---KPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVT 16974

Query: 890   TSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTN 948
              S   T   +++  + D G+Y ++V     + TA+I I  ++K  PP   V   +V   +
Sbjct: 16975 DSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAES 17034

Query: 949   ALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYT 1008
               + W  P   G  +I  Y VQK D  T  W  V      T+  V+ L  G EY FR++ 
Sbjct: 17035 ITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFA 17094

Query: 1009  ENICGLS 1015
             EN  G S
Sbjct: 17095 ENRYGQS 17101



 Score =  238 bits (607), Expect = 2e-62
 Identities = 178/616 (28%), Positives = 277/616 (44%), Gaps = 39/616 (6%)

Query: 429   EAELIVEEKQLEVLQDIA---DLTVKASEQAVFKCEVSDEK-VTGKWYKNGVEVRPSKRI 484
             EAE + E K+  +   I     +T+KA ++   +  V  +   T KW K   EV  S  +
Sbjct: 12581 EAEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHL 12640

Query: 485   TISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLD 544
              +        L+I DV  +D G Y+   +      S+  +  +IKV  +    PP+   D
Sbjct: 12641 AVHKADSSSILIIKDVTRKDSGYYSLTAEN-----SSGTDTQKIKVVVMDAPGPPQPPFD 12695

Query: 545   CSGKTSENA-----IVVVAGNKLRLDVSITGEPPPVATWLKGDEVF---TTTEGRTRIEK 596
              S   ++       I +  G       +IT          +GD V    + T+   R+ K
Sbjct: 12696 ISDIDADACSLSWHIPLEDGGS-----NITNYIVEKCDVSRGDWVTALASVTKTSCRVGK 12750

Query: 597   RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAI 656
              +    ++        E R+ I       + VA        VP  P+  R+T V +D   
Sbjct: 12751 LIPGQEYIFRVRA---ENRFGISEPLTSPKMVAQF---PFGVPSEPKNARVTKVNKDCIF 12804

Query: 657   LVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAV 716
             + W+ P  DGG P+ GYL+ERK++ S  W+K N  +   T Y    ++EG+ Y  R++A+
Sbjct: 12805 VAWDRPDSDGGSPIIGYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYAL 12864

Query: 717   NAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
             N  G S PS  T+      P   P    V DVT +T +L W  P   G   I GY VE C
Sbjct: 12865 NKAGSSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEAC 12924

Query: 777   LEGSEEWVPANTEP--VERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREI 834
                 ++WV  NT P  + +  +T   L   A+  FR +       S P+  + PVTI   
Sbjct: 12925 KLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAE 12984

Query: 835   AEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGA---PLDTSRVHVRTS 891
               PP+I L   ++     K G  + L     GKP P V W K G    P +  ++ ++ +
Sbjct: 12985 NVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRN 13044

Query: 892   DFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALV 951
                   F     R DSG+Y ++ +  +   +ATI+++V++K GPP +V + +++   A++
Sbjct: 13045 LCTLELF--SVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAML 13102

Query: 952   EWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENI 1011
              W+ P +DG SEI  Y V K +     W  V      TSC+V  LI G+EY FR+  EN 
Sbjct: 13103 SWEPPLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENK 13162

Query: 1012  CGLSD----SPGVSKN 1023
              G+ D     P ++KN
Sbjct: 13163 YGVGDPVFTEPAIAKN 13178



 Score =  238 bits (606), Expect = 3e-62
 Identities = 157/496 (31%), Positives = 232/496 (46%), Gaps = 19/496 (3%)

Query: 537   EPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEK 596
             EPP++ LD +    ++   +  G+ LRL   I G P P  TW K D    T   + RI+ 
Sbjct: 10909 EPPELILDANMAREQH---IKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPT---KARIDV 10962

Query: 597   RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAI 656
                 S   I +A  ED G Y++ V NP G    S+ + V+D P PP  + ++ + +D   
Sbjct: 10963 TPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCY 11022

Query: 657   LVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAV 716
             L W+ P+ DGG  +T Y+VER+   S +W  L+     + ++ +  + EG  Y  RV A 
Sbjct: 11023 LTWKEPLDDGGSVITNYVVERRDVASAQWSPLS-ATSKKKSHFAKHLNEGNQYLFRVAAE 11081

Query: 717   NAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLV 773
             N  G        KP     P+ P   P  L   DV  T  +L W  P+R G   I GYLV
Sbjct: 11082 NQYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLV 11141

Query: 774   EYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIRE 833
             EY  EG+++W+   T     C   V  L  G    FRV   NI G   P T   P+  +E
Sbjct: 11142 EYQEEGTQDWIKFKTVTNLEC--VVTGLQQGKTYRFRVKAENIVGLGLPDTTI-PIECQE 11198

Query: 834   IAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVH-VRTSD 892
                PP + L   L +  + K G  +      +G P P   WT  G+ + T   + V T +
Sbjct: 11199 KLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDN 11258

Query: 893   FDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTNALV 951
             F +V  ++   R D+GEY+++V       T  + + V++  GPP   + + +V   +  +
Sbjct: 11259 FSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTI 11318

Query: 952   EWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENI 1011
              WQ PKDDG S ++ Y V+K D +   W  V   +  T   +  L  G EY FRV  EN 
Sbjct: 11319 SWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENK 11378

Query: 1012  CG----LSDSPGVSKN 1023
              G    L  +P V+K+
Sbjct: 11379 IGVGPPLDSTPTVAKH 11394



 Score =  234 bits (598), Expect = 3e-61
 Identities = 149/496 (30%), Positives = 239/496 (48%), Gaps = 18/496 (3%)

Query: 530   VEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTE 589
             VE V ++  P   LD   + +   +VV AG  +R+ V I G P P  TW K +      +
Sbjct: 14460 VEIVEREMAPDFELDAELRRT---LVVRAGLSIRIFVPIKGRPAPEVTWTKDN---INLK 14513

Query: 590   GRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITS 649
              R  IE     +  +I    R D G++ + + NP G+    + ++V+D P P   +R T 
Sbjct: 14514 NRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTD 14573

Query: 650   VGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILY 709
             + +D   L W+ P+ DGG  +T Y+VE+++   + +     +   + TY+ T + EG  Y
Sbjct: 14574 ITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTKCH-KCTYKVTGLSEGCEY 14632

Query: 710   EMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGID 769
               RV A N  G+ +P+  T+P       S P  L + D+T +T +L W  P   G   I 
Sbjct: 14633 FFRVMAENEYGIGEPTETTEPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKIT 14692

Query: 770   GYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPV 829
             GY++E   +GS++W    T     C   V+NL  G    F+V+ VN AGRS P   ++PV
Sbjct: 14693 GYVIEAQRKGSDQWTHITTVKGLEC--VVRNLTEGEEYTFQVMAVNSAGRSAPRE-SRPV 14749

Query: 830   TIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHV 888
              ++E    P++ L    ++  I K G+ + + +P  G+P+P V W KG   L  T RV+ 
Sbjct: 14750 IVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNF 14809

Query: 889   RTSDFDTVFFVRQAARSDSGEYELSVQ--IENMKDTATIRIRVVEKAGPPIN-VMVKEVW 945
              T+   T+  + +  RSDSG Y L+ +  +  + D  TI++  +   GPP   +   EV 
Sbjct: 14810 ETTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDI--PGPPTGPIKFDEVS 14867

Query: 946   GTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFR 1005
                    W  P++DG   I  Y V+     +  W  +      T+   + L  G EY FR
Sbjct: 14868 SDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGLEYQFR 14927

Query: 1006  VYTENICGLSDSPGVS 1021
             V  +N  G+   PG++
Sbjct: 14928 VKAQNRYGV--GPGIT 14941



 Score =  232 bits (592), Expect = 1e-60
 Identities = 161/551 (29%), Positives = 248/551 (45%), Gaps = 28/551 (5%)

Query: 469   GKWYKNGVEVRPSKRITISHV--GRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFL 526
             G W+K   E     R T++ +  G  +K  +  +    +GD   V               
Sbjct: 21993 GDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTG------------- 22039

Query: 527   EIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFT 586
                ++ V +   P++ +D + K +    VV AG  +RL ++  G P P A W K D   +
Sbjct: 22040 --TIKAVDRLTAPELDIDANFKQTH---VVRAGASIRLFIAYQGRPTPTAVWSKPDSNLS 22094

Query: 587   TTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVR 646
                 R  I      S+  +E+  R D G+YT+ V N  G    +  ++V+D P PP  + 
Sbjct: 22095 L---RADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPIT 22151

Query: 647   ITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEG 706
                V    A L+W+ P+ DGG  +  Y+VE+++   + W  ++ E  T   ++   + EG
Sbjct: 22152 FKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVIS-EKCTRQIFKVNDLAEG 22210

Query: 707   ILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAG 766
             + Y  RV AVN  GV +P    +P +     + P  L V D + ++  L W  P+  G  
Sbjct: 22211 VPYYFRVSAVNEYGVGEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGS 22270

Query: 767   GIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLA 826
              I GYL+E   +GS+ WV A     ++  FTV+ L       FRV   N AG SEP    
Sbjct: 22271 RITGYLLEMRQKGSDFWVEAG--HTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAF 22328

Query: 827   QPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSR 885
               V I+E    P   L     Q    K G    + VP  G+P P+V W      L +T R
Sbjct: 22329 SSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDR 22388

Query: 886   VHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEV 944
             V + T+   T   V+ + R DSG Y L+++      T ++ + V+ + GP    + V  V
Sbjct: 22389 VSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSV 22448

Query: 945   WGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYF 1004
                + ++ W  PKD G +EI  Y V+K +  T  W  V    + T   V+ L    EY F
Sbjct: 22449 SAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSF 22508

Query: 1005  RVYTENICGLS 1015
             RV +EN  G+S
Sbjct: 22509 RVSSENRFGVS 22519



 Score =  231 bits (588), Expect = 4e-60
 Identities = 141/480 (29%), Positives = 230/480 (47%), Gaps = 7/480 (1%)

Query: 551  ENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQR 610
            ++ + V+  N + + V  TG P P ATW  GD+V  T + R +++     +  VI  ++R
Sbjct: 7096 KDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGD-RVKMKTLSAYAELVISPSER 7154

Query: 611  EDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPV 670
             D+G YT+K+ N V      I + V+  P  P+ ++   + +D   L WEPP  DGG P+
Sbjct: 7155 SDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPL 7214

Query: 671  TGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKP 730
            TGY+VE+++   + W K+  +  T+  +    +++G  Y  +V A N  G  +P+   +P
Sbjct: 7215 TGYVVEKREVSRKTWTKV-MDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEP 7273

Query: 731  FMPIAPTS---EPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPAN 787
                 P +    P ++   D T  +  L W PP   G   I GY+VE C  GS++WV   
Sbjct: 7274 VNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACG 7333

Query: 788  TEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLR 847
             EPV      V  L  G    +RV  +N  G S+P+   + +   +  E P+I L   L 
Sbjct: 7334 -EPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLL 7392

Query: 848  QTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVRTSDFDTVFFVRQAARSD 906
                 K G ++ L     GKP P++ WTK    L    R+ +      +   +  + RSD
Sbjct: 7393 AGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSD 7452

Query: 907  SGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMG 966
            +G Y +       + TA + + V++K GPP    + +V   + L+ W  P+DDG S+I  
Sbjct: 7453 TGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITN 7512

Query: 967  YFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTAR 1026
            Y V++    +  W  +    + T+   + LI   EY FRV  EN+ G+ +    S  TA+
Sbjct: 7513 YVVERRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQASPITAK 7572



 Score =  228 bits (581), Expect = 3e-59
 Identities = 138/484 (28%), Positives = 226/484 (46%), Gaps = 11/484 (2%)

Query: 535   KQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRI 594
             ++E P   +D   + +   ++V AG    + V   G P P   W K D   T    R  +
Sbjct: 19875 REEEPLFDIDSEMRKT---LIVKAGASFTMTVPFRGRPVPNVLWSKPD---TDLRTRAYV 19928

Query: 595   EKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDW 654
             +     +S  IE+A R D G+YT+ + N +     ++ ++V+D P PP  + +  V ++ 
Sbjct: 19929 DTTDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKES 19988

Query: 655   AILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVF 714
             A+L W+ P  DGG PV  Y +E+++   + W+ +        +Y+ T + EG +Y  RV 
Sbjct: 19989 AVLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNC-NRLSYKVTNLQEGAIYYFRVS 20047

Query: 715   AVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
               N  GV  P+   +        S P  L V  ++  + +L W  P   G   I  Y+VE
Sbjct: 20048 GENEFGVGIPAETKEGVKITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVE 20107

Query: 775   YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREI 834
                +G + WV       +     V  L   +   FRV   N AG S+P  L  PV I+E 
Sbjct: 20108 ALEKGQKNWVKCAV--AKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQ 20165

Query: 835   AEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLD-TSRVHVRTSDF 893
              EPP+I +      T   + G  L + +P  GKP P+V  ++ G PL  T R +   +  
Sbjct: 20166 LEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAE 20225

Query: 894   DTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTNALVE 952
             +    ++++  +D+G YE++    +    A I I V+++ GPP   V++ ++   +  ++
Sbjct: 20226 NLTINLKESVTADAGRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLK 20285

Query: 953   WQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENIC 1012
             W+ PK DG S++  Y + K +  T  W  V      T   V  L  G EY FR+  EN  
Sbjct: 20286 WEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRF 20345

Query: 1013  GLSD 1016
             G+SD
Sbjct: 20346 GISD 20349



 Score =  226 bits (577), Expect = 7e-59
 Identities = 133/383 (34%), Positives = 202/383 (52%), Gaps = 10/383 (2%)

Query: 638   VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFE-VFTET 696
             VPD P+   +T V +D A++ W  P +DGGKP+T Y++E+++  S+RW ++  + +   T
Sbjct: 10706 VPDAPDQPIVTEVTKDSALVTWNKP-HDGGKPITNYILEKRETMSKRWARVTKDPIHPYT 10764

Query: 697   TYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTT 753
              +    ++EG  YE RV A N IG+  PS  +KP     PIA  S P++    D T  + 
Sbjct: 10765 KFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSV 10824

Query: 754   TLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFT---VKNLPTGARILFR 810
              L W+PP   G   I GY+VEY   G EEW  AN  P E C  T   V  L  G    FR
Sbjct: 10825 DLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTP-ESCPETKYKVTGLRDGQTYKFR 10883

Query: 811   VVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRP 870
             V+ VN AG S+PA + +PV +++  EPP++ L  ++ +    KVG+ L L    +G P P
Sbjct: 10884 VLAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFP 10943

Query: 871   QVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVV 930
             +V W K      T +  +  +   +   +R AA  D G Y L+V+      T ++++ V+
Sbjct: 10944 KVTWKKEDRDAPT-KARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVL 11002

Query: 931   EKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTS 990
             +K GPP ++ V E+   +  + W+ P DDG S I  Y V++ D  + +W  +   ++  S
Sbjct: 11003 DKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKS 11062

Query: 991   CTVSDLIVGNEYYFRVYTENICG 1013
                  L  GN+Y FRV  EN  G
Sbjct: 11063 HFAKHLNEGNQYLFRVAAENQYG 11085



 Score =  225 bits (574), Expect = 2e-58
 Identities = 147/490 (30%), Positives = 230/490 (46%), Gaps = 22/490 (4%)

Query: 534   PKQE----PPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLK--GDEVFTT 587
             PK E    PP+I LD   +     + + A   LRL V I G P P   W +  G+ +   
Sbjct: 15544 PKAEDRMLPPEIELDADLR---KVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESL--- 15597

Query: 588   TEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRI 647
                +  IE     +  ++ +  R D G+Y + V N  G   A + ++V+D P PP+ +++
Sbjct: 15598 --DKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKV 15655

Query: 648   TSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGI 707
               V +    L W+PP+ DGG  +  Y+VE+++   + +  +      +T+++  ++ EG 
Sbjct: 15656 KEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCH-KTSWKVDQLQEGC 15714

Query: 708   LYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGG 767
              Y  RV A N  G+  P+   +          P  + + DVT  + +L W  P   G   
Sbjct: 15715 SYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITLMDVTRNSVSLSWEKPEHDGGSR 15774

Query: 768   IDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQ 827
             I GY+VE   +GS++W    T  V     T+  L  G    FRV   N  G S+P  L+ 
Sbjct: 15775 ILGYIVEMQTKGSDKWATCATVKVTEA--TITGLIQGEEYSFRVSAQNEKGISDPRQLSV 15832

Query: 828   PVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRV 886
             PV  +++  PP  +L   L  T+    GE L + VPF G+P P V W K   PL  T+RV
Sbjct: 15833 PVIAKDLVIPPAFKL---LFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRV 15889

Query: 887   HVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVW 945
             +  +++ +++  ++ A R D G Y + +     +   T+ + V++K GPP   V + EV 
Sbjct: 15890 NAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVT 15949

Query: 946   GTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFR 1005
               +  + W  PK DG S I  Y V+K D  T  W  V      T+     L  G EY FR
Sbjct: 15950 ADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFR 16009

Query: 1006  VYTENICGLS 1015
             +  EN  G S
Sbjct: 16010 IAAENRYGKS 16019



 Score =  219 bits (557), Expect = 2e-56
 Identities = 145/484 (29%), Positives = 237/484 (48%), Gaps = 18/484 (3%)

Query: 538   PPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIE-K 596
             PP+  LD   + +   +++ AG  +RL V + G PPP  TW K +        R  ++ K
Sbjct: 13385 PPEGELDADLRKT---LILRAGVTMRLYVPVKGRPPPKITWSKPN---VNLRDRIGLDIK 13438

Query: 597   RVDCSSFV-IESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWA 655
               D  +F+  E+  + D G+Y + + N  G+   +I ++V+D P PP  V +  + +D A
Sbjct: 13439 STDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSA 13498

Query: 656   ILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFA 715
              + WEPP+ DGG P+  Y+V+++    + W  +  E  ++T++    + EG  Y  RVFA
Sbjct: 13499 YVTWEPPIIDGGSPIINYVVQKRDAERKSWSTVTTEC-SKTSFRVANLEEGKSYFFRVFA 13557

Query: 716   VNAIGVSQPSMNTKPFMPIAPTSEPL-HLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
              N  G+  P   T+  +  + T  P+  L V  V+ ++ ++ W+ P+  G   I GY+V+
Sbjct: 13558 ENEYGIGDPG-ETRDAVKASQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVD 13616

Query: 775   YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREI 834
             +  E ++      +  ++   ++ K+L  G    FRV   N  G   P+ +   V  R+ 
Sbjct: 13617 FLTEENKWQRVMKSLSLQ---YSAKDLTEGKEYTFRVSAENENGEGTPSEIT--VVARDD 13671

Query: 835   AEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDT-SRVHVRTSDF 893
                P + L       Y+ K      L +P +GKP P V W KG  PL T +RV V +S  
Sbjct: 13672 VVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAV 13731

Query: 894   DTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTNALVE 952
             +T   V    +SD+G+Y ++++        TI I+VV K G P   +   EV      ++
Sbjct: 13732 NTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLK 13791

Query: 953   WQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENIC 1012
             W  PKDDG SEI  Y ++K D    +W       + T+  V+ L  G EY FRV  EN  
Sbjct: 13792 WAPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKY 13851

Query: 1013  GLSD 1016
             G+ +
Sbjct: 13852 GVGE 13855



 Score =  218 bits (556), Expect = 2e-56
 Identities = 158/516 (30%), Positives = 233/516 (45%), Gaps = 54/516 (10%)

Query: 529  KVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTT 588
            +++ V  QE P+I LD         + V AG K+ L  ++TG+P P  TW K D +    
Sbjct: 7373 EIQAVDTQEAPEIFLDVKLLAG---LTVKAGTKIELPATVTGKPEPKITWTKADMILKQD 7429

Query: 589  EGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRIT 648
            + R  IE     S+  I  ++R D G Y I+  N  G   A + + V+D P PP A  IT
Sbjct: 7430 K-RITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDIT 7488

Query: 649  SVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGIL 708
             V  +  +L W PP  DGG  +T Y+VER+   S+ W KL+  V  +T +++TK+I    
Sbjct: 7489 DVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTV-KDTNFKATKLIPNKE 7547

Query: 709  YEMRVFAVNAIGVSQPSMNTKPF---MPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGA 765
            Y  RV A N  GV +P +   P        P   P  L   D+T    TL W  P+  G 
Sbjct: 7548 YIFRVAAENMYGVGEP-VQASPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGG 7606

Query: 766  GGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATL 825
              I GY VE     +++WV  N  PV+   + VK L    +  FRV+  N+AG  +P+  
Sbjct: 7607 SPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKS 7666

Query: 826  AQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTK----GGAPL 881
             +P+ I++  +PP                       V   GK   ++ WTK    GGA +
Sbjct: 7667 TEPILIKDPIDPP----------------WPPGKPTVKDVGKTSVRLNWTKPEHDGGAKI 7710

Query: 882  DTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAG------- 934
            ++  + +  +  D   +VR A    + ++ L   +E  +   + R+R V KAG       
Sbjct: 7711 ESYVIEMLKTGTDE--WVRVAEGVPTTQHLLPGLMEGQE--YSFRVRAVNKAGESEPSEP 7766

Query: 935  --------------PPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWF 980
                          PP  + V  +    A ++W  P+ DG S I  Y V+K D +   W 
Sbjct: 7767 SDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQ 7826

Query: 981  NVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
             V    + T CTV+ L  G+ Y FRV  EN  G SD
Sbjct: 7827 TVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSD 7862



 Score =  218 bits (556), Expect = 2e-56
 Identities = 180/670 (26%), Positives = 295/670 (44%), Gaps = 50/670 (7%)

Query: 364   EMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVIT 423
             E  VE   +G Q  W   G+  T E          +  ++ +L F    + ++G    +T
Sbjct: 21191 EYVVERKGKGEQT-WSHAGISKTCE------IEVSQLKEQSVLEFRVFAKNEKGLSDPVT 21243

Query: 424   NGGQCEAELIVEEKQLEVLQDI--ADLTVKASEQAVFKCEVSDE-KVTGKWYKNGVEVRP 480
              G     ELI+  +    L DI  A +TV+       +     + K +  W K+G+ ++ 
Sbjct: 21244 IGPITVKELIITPEV--DLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKE 21301

Query: 481   SKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPK 540
             S+ +  S       L I + + E  G YT + D     ++  +  + +     PK     
Sbjct: 21302 SEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKGP--- 21358

Query: 541   IHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGR--TRIEKRV 598
                             +  ++++ D  I     P      G+    + E R  ++   ++
Sbjct: 21359 ----------------IRFDEIKADSVILSWDVPEDNG-GGEITCYSIEKRETSQTNWKM 21401

Query: 599   DCSS-----FVIESAQREDEGRYTIKVTNPVGED---VASIFL--QVVDVPDPPEAVRIT 648
              CSS     F + +  ++ E ++ ++  N  G     V+SI +      +P PP    I 
Sbjct: 21402 VCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIY 21461

Query: 649   SVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGIL 708
             +V  D   L W+ P+YDGG  VTG+ VE+K++ S  W K+N    +   Y +T ++EG+ 
Sbjct: 21462 NVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLD 21521

Query: 709   YEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGI 768
             Y+ RV+A N+ G+S PS  +K  + ++P   P      DVT  T TLKW PP R G   I
Sbjct: 21522 YQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKI 21581

Query: 769   DGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGR-SEPATLAQ 827
              GY +E   +G+E WV  N   V  C +TV  L  G R  FR++  N  G  S P+  + 
Sbjct: 21582 VGYSIEK-RQGNERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSG 21640

Query: 828   PVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVH 887
              +  R+   PP +          I K GE L +    QG+P P+V W K G  ++  R++
Sbjct: 21641 IIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIE-KRMN 21699

Query: 888   VRTSDF--DTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEV 944
             +  +D    T  FVR A R   G Y +  +  +    A I+++V +  G  +  +    +
Sbjct: 21700 MEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNI 21759

Query: 945   WGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYF 1004
              G    + W AP +DG + I  Y ++K +   + W  + ++    S T   LI GNEY F
Sbjct: 21760 TGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQF 21819

Query: 1005  RVYTENICGL 1014
             RV   N  G+
Sbjct: 21820 RVSAVNKFGV 21829



 Score =  218 bits (555), Expect = 3e-56
 Identities = 160/568 (28%), Positives = 254/568 (44%), Gaps = 31/568 (5%)

Query: 471   WYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKV 530
             W+K+ V ++ + R+          L I D   ED G Y        L+ SA      + V
Sbjct: 15876 WHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVV-----KLTNSAGEAIETLNV 15930

Query: 531   EYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITG-----EPPPVATWLKGDEVF 585
               + K  PP   +     T+++  +     K     SI             TW    ++ 
Sbjct: 15931 IVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTW----QIV 15986

Query: 586   TTTEGRTRIEK---RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPP 642
             + T  RT I+    +  C  +    A     G+ T   + P      ++      VP PP
Sbjct: 15987 SATVARTTIKACRLKTGCE-YQFRIAAENRYGKSTYLNSEP------TVAQYPFKVPGPP 16039

Query: 643   EAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTK 702
                 +T    D   + W  P+ DGG  V GY +ERK++ S  W+KLN     +T +++T 
Sbjct: 16040 GTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTG 16099

Query: 703   MIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNR 762
             + EG+ YE RV A N +G+ +PS  ++ ++   P   P       VT  + TL+W+ P  
Sbjct: 16100 LEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQWKKPTY 16159

Query: 763   IGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAG-RSE 821
              G   I GY+VE        W+ A+   +    F V  L    R  FRV+  N AG  SE
Sbjct: 16160 DGGSKITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSE 16219

Query: 822   PATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL 881
             P+     +T R+  +PP+I +    + T +   GE   +     GKP P + W KG   L
Sbjct: 16220 PSESTGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL 16279

Query: 882   -DTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-V 939
              +T+R+ ++++DF T   V+ A R DSG Y L  +    + + T+ ++V+++ GPP   V
Sbjct: 16280 SNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPV 16339

Query: 940   MVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVG 999
             ++  V      + W+ P  DG S+I+ Y V++ +   + W  V    +  SC V+ L+ G
Sbjct: 16340 VISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEG 16399

Query: 1000  NEYYFRVYTENICG----LSDSPGVSKN 1023
             NEY FR+   N  G    L   P V+KN
Sbjct: 16400 NEYTFRIMAVNKYGVGEPLESEPVVAKN 16427



 Score =  218 bits (554), Expect = 3e-56
 Identities = 167/650 (25%), Positives = 284/650 (43%), Gaps = 55/650 (8%)

Query: 427   QCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKV-TGKWYKNGVEVRPSKRIT 485
             +C+ +L+    +L+V + I  L VKA     F   +    V T KW  +G E++  +  T
Sbjct: 11195 ECQEKLVPPSVELDV-KLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYT 11253

Query: 486   ISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDC 545
             +        L I +    D G+Y       A S +  ++   + V       PP   ++ 
Sbjct: 11254 VETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVP-----GPPTGPINI 11308

Query: 546   SGKTSENAIVVVAGNKLRLDVSITGEPP------PVATWLKGDEVFTTTEGRTRIEKRVD 599
                T E+             ++I+ +PP      PV  ++  ++  T  +    +     
Sbjct: 11309 LDVTPEH-------------MTISWQPPKDDGGSPVINYIV-EKQDTRKDTWGVVSSGSS 11354

Query: 600   CSSFVIESAQREDEGRYTIKVTNPVG-----EDVASIFLQVVDVPDPPEAVRITSVGEDW 654
              +   I   Q+  E  + ++  N +G     +   ++       P PP    +T + E+ 
Sbjct: 11355 KTKLKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENA 11414

Query: 655   AILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVF 714
             A + W  P  DGG P+TGY +ER++  + +W+++N     +  +  T + EG  YE RVF
Sbjct: 11415 ATVSWTLPKSDGGSPITGYYMERREV-TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVF 11473

Query: 715   AVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGY 771
             A N  G+S+PS ++ P     PI P   P++  ++D +  T  L W  P   G   I GY
Sbjct: 11474 AENLAGLSKPSPSSDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGY 11533

Query: 772   LVEYCLEGSEEWVPANT-EPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVT 830
             +VE    G+ +W   N  E + +C F V  L  G    FR+   NI G  EP  LA+ V 
Sbjct: 11534 VVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVI 11593

Query: 831   IREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRT 890
              ++I  PP++ L    R     +VG+ + ++   +G+P P + WTK G  L   +     
Sbjct: 11594 AKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLI 11653

Query: 891   SDFDTV-FFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNA 949
              D   V   +++A R+D G+Y +S +  +     +  + V+++ GP  N+ V  V   N 
Sbjct: 11654 QDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENC 11713

Query: 950   LVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTE 1009
              + W+ P D+G SEI  + V+        W ++   +       ++L+  NEYYFRV  E
Sbjct: 11714 TISWENPLDNGGSEITNFIVEYRKPNQKGW-SIVASDVTKRLIKANLLANNEYYFRVCAE 11772

Query: 1010  NICGLS---------------DSPGVSKNTARILKTGITFKPFEYKEHDF 1044
             N  G+                D PG  +N   I   G TF   +++  D+
Sbjct: 11773 NKVGVGPTIETKTPILAINPIDRPGEPEN-LHIADKGKTFVYLKWRRPDY 11821



 Score =  217 bits (553), Expect = 4e-56
 Identities = 125/382 (32%), Positives = 192/382 (50%), Gaps = 3/382 (0%)

Query: 638   VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETT 697
             VP PP   ++T+V +D   + W  P+ DGG P+ GY VERK++    W  ++  +     
Sbjct: 14953 VPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNI 15012

Query: 698   YESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKW 757
             ++S+ + +GI YE RV A N  G S+PS  ++P + + P   P   +  ++T  T TLKW
Sbjct: 15013 FKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKW 15072

Query: 758   RPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIA 817
               P   G   I  Y+VE     +  W+ AN   +    FTV  L   A   FRV+  N A
Sbjct: 15073 AKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAA 15132

Query: 818   GR-SEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTK 876
             G  S P+  +  +T R+  E PKI++    + T I K GE   L     G+P P + W+K
Sbjct: 15133 GAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSK 15192

Query: 877   GGAPLD-TSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGP 935
              G  L+ T+++ ++ +DF T    + + R DSG Y L+             ++V+++ GP
Sbjct: 15193 DGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGP 15252

Query: 936   PIN-VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVS 994
             P   + V EV     ++ W  P DDG ++I  Y VQK +   + W NV    + T   V+
Sbjct: 15253 PEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVT 15312

Query: 995   DLIVGNEYYFRVYTENICGLSD 1016
              L+ GNEY FRV   N  G+ +
Sbjct: 15313 KLLKGNEYIFRVMAVNKYGVGE 15334



 Score =  217 bits (552), Expect = 6e-56
 Identities = 155/560 (27%), Positives = 257/560 (45%), Gaps = 34/560 (6%)

Query: 537   EPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEK 596
             E P+I LD + +TS   ++  AG  +++ +   G PPP  TW K DE    ++ R  IE 
Sbjct: 20962 EAPEIDLDVALRTS---VIAKAGEDVQVLIPFKGRPPPTVTWRK-DEKNLGSDARYSIEN 21017

Query: 597   RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVAS-IFLQVVDVPDPPEAVRITSVGEDWA 655
                 S   I    R D G+Y + + N VGE  +S + ++V+D P   + +++  V     
Sbjct: 21018 TDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTV 21077

Query: 656   ILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFA 715
              L+W+PP+ DGG P+  Y++E++    + W  ++ +  + T+++   + E   +  RV A
Sbjct: 21078 TLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKC-SSTSFKLIDLSEKTPFFFRVLA 21136

Query: 716   VNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEY 775
              N IG+ +P   T+P       +    L ++D T T+  L W  P+  G   I  Y+VE 
Sbjct: 21137 ENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVER 21196

Query: 776   CLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIA 835
               +G + W  A     + C   V  L   + + FRV   N  G S+P T+  P+T++E+ 
Sbjct: 21197 KGKGEQTWSHAGIS--KTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIG-PITVKELI 21253

Query: 836   EPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSR-VHVRTSDFD 894
               P++ L          ++G  ++L +P++GKP+P + W K G PL  S  V    ++  
Sbjct: 21254 ITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENK 21313

Query: 895   TVFFVRQAARSDSGEYELSVQIENMKDTATIRIRV---VEKAGPPIN----VMVKEVWGT 947
                 ++ A +   G+Y +      + D A  RI V   V   GPP      +   E+   
Sbjct: 21314 ITLSIKNAKKEHGGKYTV------ILDNAVCRIAVPITVITLGPPSKPKGPIRFDEIKAD 21367

Query: 948   NALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVY 1007
             + ++ W  P+D+G  EI  Y ++K +     W  V      T+  V +L+   EY FRV 
Sbjct: 21368 SVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCSSVARTTFKVPNLVKDAEYQFRVR 21427

Query: 1008  TENICGLS----DSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGY 1063
              EN  G+S     S  V+K+  RI   G   KP  Y      M+  +  P+ D     G 
Sbjct: 21428 AENRYGVSQPLVSSIIVAKHQFRI--PGPPGKPVIYNVTSDGMSLTWDAPVYD-----GG 21480

Query: 1064  SAALNCAVRGHPKPKVVWMK 1083
             S      V    +  ++W K
Sbjct: 21481 SEVTGFHVEKKERNSILWQK 21500



 Score =  216 bits (551), Expect = 8e-56
 Identities = 174/617 (28%), Positives = 273/617 (44%), Gaps = 49/617 (7%)

Query: 434   VEEKQLEVLQDIADLTV-KASEQAVFKCEVSDEKV-TGKWYKNGVEVRPSKRITISHVGR 491
             VE  +++V     D  + KA E    + +VS     T +W K+G E+  + ++ I     
Sbjct: 15151 VEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADF 15210

Query: 492   FHKLVIDDVRPEDEGDYTFV---PDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGK 548
                LV  D    D G YT     P G+A  +          V+ + +  PP+  L  +  
Sbjct: 15211 STNLVNKDSTRRDSGAYTLTATNPGGFAKHI--------FNVKVLDRPGPPEGPLAVTEV 15262

Query: 549   TSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVF-----TTTEGRTRIEKRVDCSSF 603
             TSE  +             ++  PP      K D        T+    T +   V  +  
Sbjct: 15263 TSEKCV-------------LSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKL 15309

Query: 604   VIESAQREDEGRYTIKVTNP--VGEDVASIFLQVVDV---PDPPEAVRITSVGEDWAILV 658
              +    + +E  + +   N   VGE + S  +  V+    PDPP+   +T++ +D  ++ 
Sbjct: 15310 KVTKLLKGNEYIFRVMAVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVC 15369

Query: 659   WEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNA 718
             W  P  DGG  +  Y+VER+ K  QRW+K N +  T+  Y+ + + EG  YE R+ A NA
Sbjct: 15370 WGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENA 15429

Query: 719   IGVSQPSMNTKPFMPIAPT----SEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
              G+S PS  T PF     T      P +  V D + ++ ++ W  P   G   I GY+VE
Sbjct: 15430 AGISAPS-PTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVE 15488

Query: 775   YCLEGSEEW-VPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIRE 833
               L   +EW +      ++   +T+  L        R+  +N  G  EPA +       +
Sbjct: 15489 IALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAED 15548

Query: 834   IAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKG-GAPLDTSRVHVRTSD 892
                PP+I L   LR+    +    L L VP +G+P P+V W +  G  LD + +   TS 
Sbjct: 15549 RMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIE-STSS 15607

Query: 893   FDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVE 952
             + T+  V    R DSG+Y L+V+  +   +A + +RV++  GPP ++ VKEV  T+  + 
Sbjct: 15608 Y-TLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLT 15666

Query: 953   WQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENIC 1012
             W  P  DG S+I  Y V+K +     +  V      TS  V  L  G  YYFRV  EN  
Sbjct: 15667 WDPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEY 15726

Query: 1013  GLSDSPGVSKNTARILK 1029
             G+    G+   TA  +K
Sbjct: 15727 GI----GLPAETAESVK 15739



 Score =  215 bits (548), Expect = 2e-55
 Identities = 150/495 (30%), Positives = 223/495 (45%), Gaps = 24/495 (4%)

Query: 536  QEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIE 595
            QEPP + LD S K     I ++AG  LR+   +TG P P   W K  E     + R  I+
Sbjct: 8794 QEPPAVELDVSVK---GGIQIMAGKTLRIPAVVTGRPVPTKVWTK--EEGELDKDRVVID 8848

Query: 596  KRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWA 655
                 S  +I+ A R+D GRY I  TN  G   A+  ++V DVP P   ++         
Sbjct: 8849 NVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMC 8908

Query: 656  ILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTE-TTYESTKMIEGILYEMRVF 714
            +L W  P  DGG  +TG+++ERK      W +    + TE +  + T ++EG  Y+ RV 
Sbjct: 8909 LLNWSDPEDDGGSEITGFIIERKDAKMHTWRQ---PIETERSKCDITGLLEGQEYKFRVI 8965

Query: 715  AVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGY 771
            A N  G   P +   P +   P+ P + P  L   + T +T TL W+ P   G   I GY
Sbjct: 8966 AKNKFGCG-PPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGY 9024

Query: 772  LVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTI 831
            ++E       ++   N        F V+NL       FRV  VN  G SEP +L   V I
Sbjct: 9025 IIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEP-SLPLNVVI 9083

Query: 832  REIAEPPKIRLPRHLRQTYIR-KVGEQLNLVVPFQGKPRPQVVWTKGGA-------PLDT 883
            ++   PP I+L   +R   I+ K GE +++     G P P++ W+K           L  
Sbjct: 9084 QDDEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQI 9143

Query: 884  SRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKE 943
            ++  V  S+  T   + +A R D G Y ++           + + V ++  PP N+ V +
Sbjct: 9144 TKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTD 9203

Query: 944  VWGTNALVEWQAPKDDGNSEIMGYFVQKAD--KKTMEWFNVYERNRHTSCTVSDLIVGNE 1001
            +   +  + W AP D+G SEI  Y + K D  +K  EW  V          +  LI   +
Sbjct: 9204 IKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKRYGIWKLIPNGQ 9263

Query: 1002 YYFRVYTENICGLSD 1016
            Y FRV   N  G+SD
Sbjct: 9264 YEFRVRAVNKYGISD 9278



 Score =  213 bits (543), Expect = 6e-55
 Identities = 157/584 (26%), Positives = 263/584 (45%), Gaps = 34/584 (5%)

Query: 448   LTVKASEQAVFKCEVSDEKVTG-KWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG 506
             L +K+ E    K  V    V    W+K+GVE+     + I+ V     L + D   +  G
Sbjct: 21663 LIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRG 21722

Query: 507   DYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRL-- 564
              YT      + S  A++   ++KV+  P +    I               + G K+ L  
Sbjct: 21723 VYTVEAKNASGSAKAEI---KVKVQDTPGKVVGPIRF-----------TNITGEKMTLWW 21768

Query: 565   DVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTN-- 622
             D  +     P+  ++  ++  T+      IE + +  S+        +E ++ +   N  
Sbjct: 21769 DAPLNDGCAPITHYII-EKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNKF 21827

Query: 623   ----PVGED--VASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVE 676
                 P+  D  VA I   V D P  PE   IT    +   L W  P  DGG  +  Y++E
Sbjct: 21828 GVGRPLDSDPVVAQIQYTVPDAPGIPEPSNITG---NSITLTWARPESDGGSEIQQYILE 21884

Query: 677   RKKKGSQRWMK-LNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM--- 732
             R++K S RW+K ++    +ET ++ T + EG  YE  V A NA GV   S  ++      
Sbjct: 21885 RREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCRE 21944

Query: 733   PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVE 792
             P+ P   P  + V D + TT +L+W  P   G   I GY++E C     +W   N E   
Sbjct: 21945 PVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACV 22004

Query: 793   RCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIR 852
             +  +TV +L  G    FRV  +N AG+ +   +   +   +    P++ +  + +QT++ 
Sbjct: 22005 KTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVV 22064

Query: 853   KVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYEL 912
             + G  + L + +QG+P P  VW+K  + L + R  + T+D  +   V    R+D+G+Y L
Sbjct: 22065 RAGASIRLFIAYQGRPTPTAVWSKPDSNL-SLRADIHTTDSFSTLTVENCNRNDAGKYTL 22123

Query: 913   SVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKA 972
             +V+  +   + T  ++V++  GPP  +  K+V   +A + W AP  DG + I  Y V+K 
Sbjct: 22124 TVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKR 22183

Query: 973   DKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
             +     W  + E+       V+DL  G  YYFRV   N  G+ +
Sbjct: 22184 EASRRSWQVISEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGE 22227



 Score =  213 bits (542), Expect = 8e-55
 Identities = 131/391 (33%), Positives = 192/391 (49%), Gaps = 16/391 (4%)

Query: 639   PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTY 698
             PDPPE   +T V ++   +VW PP YDGGK +TGY +E+K+K S RW+ +N     E   
Sbjct: 12094 PDPPE---VTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRM 12150

Query: 699   ESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTL 755
             +   ++    Y+ RV A N IG+ +PS+ ++P +   PI P   P +  V D T  + TL
Sbjct: 12151 KVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTKHSITL 12210

Query: 756   KWRPPNRIGAGGIDGYLVEYC-----LEGSEEWVPANTEP-VERCGFTVKNLPTGARILF 809
              W  P   G   I GY+VE           E W   N    + R  FTV +L       F
Sbjct: 12211 GWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEF 12270

Query: 810   RVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPR 869
             RV   N  G   PA L + +  +EI EPP+I L   +R+  I + G  + L    +G+P 
Sbjct: 12271 RVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPA 12330

Query: 870   PQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRV 929
             P+V W K G      +  V   D      +  + R DSG+Y L++     +    + +RV
Sbjct: 12331 PKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRV 12390

Query: 930   VEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHT 989
             ++  GP  ++ V +V  T+  V W  P++DG S++  Y V+K +     W  V    + T
Sbjct: 12391 LDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVKKT 12450

Query: 990   SCTVSDLIVGNEYYFRVYTENICGLSDSPGV 1020
             S  V++L+ GNEYYFRV   N  G    PGV
Sbjct: 12451 SFHVTNLVPGNEYYFRVTAVNEYG----PGV 12477



 Score =  211 bits (538), Expect = 2e-54
 Identities = 145/521 (27%), Positives = 236/521 (45%), Gaps = 40/521 (7%)

Query: 536   QEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATW--------LKGDEVFTT 587
             QE P++ +D     +++ +V  AG+++R+   I G P P ++W           D V   
Sbjct: 9500  QEEPEVFIDIG---AQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDI 9556

Query: 588   TEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRI 647
              E   ++E   + S  +I   +R   G+Y+I   N  G+  A+  ++V+DVP PP+ +++
Sbjct: 9557  PED-AQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKV 9615

Query: 648   TSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGI 707
             + +      L W+ P  DGG  + GY++E++    + W K+N +    TT+    ++   
Sbjct: 9616  SDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDC-GSTTFVVPDLLSEQ 9674

Query: 708   LYEMRVFAVNAIGVSQP---SMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIG 764
              Y  RV A N  G+  P      T    PI P   P+ L +  +T  T  L W+PP   G
Sbjct: 9675  QYFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDG 9734

Query: 765   AGGIDGYLVEYCL------EGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAG 818
                +  Y+VE CL         E W   N   VE   FTV++L  G    FRV  VN AG
Sbjct: 9735  GSPVTHYIVE-CLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAG 9793

Query: 819   RSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGG 878
              S+P+    P   +    PP I L   +      + G  +N+V   +G P P + W K  
Sbjct: 9794  VSKPSATVGPCDCQRPDMPPSIDLKEFMEV----EEGTNVNIVAKIKGVPFPTLTWFK-- 9847

Query: 879   AP----------LDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIR 928
             AP          L  + V+    D      + Q+ RSD+G Y ++        +  +R+ 
Sbjct: 9848  APPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLN 9907

Query: 929   VVEKAGPPIN-VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNR 987
             V+ + GPP+  +  + V      + W  PKDDG S+I  Y ++K +     W +V    +
Sbjct: 9908  VLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPK 9967

Query: 988   HTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARIL 1028
               + T+  L+ G+EY FR+  +N  G+ +       TAR L
Sbjct: 9968  ECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNL 10008



 Score =  211 bits (536), Expect = 4e-54
 Identities = 160/614 (26%), Positives = 270/614 (43%), Gaps = 45/614 (7%)

Query: 431   ELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDE-KVTGKWYKNGVEVRPSKRITISHV 489
             +L++E    +V    +  +V+  +    +  +S   K T  W K+G+ ++ + RI ++  
Sbjct: 16920 DLVIEP---DVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDS 16976

Query: 490   GRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKT 549
                  L I +   +D G Y     G  ++         I++  + K +PPK  +     +
Sbjct: 16977 LDLTTLSIKETHKDDGGQY-----GITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVS 17031

Query: 550   SENAIV-----VVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFV 604
             +E+  +     +  G     +  +         W    +V + T  RT ++         
Sbjct: 17032 AESITLSWNPPLYTGGCQITNYIVQKRDTTTTVW----DVVSATVARTTLK--------- 17078

Query: 605   IESAQREDEGRYTIKVTNPVGEDVASIFLQVV-----DVPDPPEAVRITSVGEDWAILVW 659
             +   +   E ++ I   N  G+  A     +V       P PP     T++ +D  ++ W
Sbjct: 17079 VTKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQW 17138

Query: 660   EPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAI 719
               P+ +GG PV GY +ERK++ S  W K+N  +  +T +++  + EGI YE RV+A N +
Sbjct: 17139 HEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIV 17198

Query: 720   GVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
             GV + S N++ ++   P  P   P  ++V+       TL+W  P   G   I GY+VE  
Sbjct: 17199 GVGKASKNSECYVARDPCDPPGTPEPIMVK---RNEITLQWTKPVYDGGSMITGYIVEKR 17255

Query: 777   LEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGR-SEPATLAQPVTIREIA 835
                   W+ A+   V    FTV  L    R  FRV+  N AG  S+P+    P+T ++  
Sbjct: 17256 DLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEV 17315

Query: 836   EPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTS-RVHVRTSDFD 894
             E P+I +    R T +   GE   L     GKP P + W +G   ++ S R  ++ +DF 
Sbjct: 17316 ELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFK 17375

Query: 895   TVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTNALVEW 953
              +  V+ A R D G+Y L         +  + ++V+++ GPP   V V  V      + W
Sbjct: 17376 ALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTW 17435

Query: 954   QAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICG 1013
               P  DG S+I  Y V+K +   + W  V       S  V+ L+ GNEY FR+   N  G
Sbjct: 17436 SPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYG 17495

Query: 1014  ----LSDSPGVSKN 1023
                 L  +P + KN
Sbjct: 17496 VGEPLESAPVLMKN 17509



 Score =  210 bits (535), Expect = 5e-54
 Identities = 152/568 (26%), Positives = 255/568 (44%), Gaps = 40/568 (7%)

Query: 468   TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLE 527
             T +WYK+  E++ +  + + +      ++I D    + G Y         S SA      
Sbjct: 20598 TIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASAT----- 20652

Query: 528   IKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTT 587
             I+V+ + K  PP   ++    T+E              +++   PP      K       
Sbjct: 20653 IRVQILDKPGPPGGPIEFKTVTAEK-------------ITLLWRPPADDGGAKITHYIVE 20699

Query: 588   TEGRTRI------EKRVDCSSFVIESAQ--REDEGRYTIKVTNPVG-----EDVASIFLQ 634
                 +R+      E   +C   +I + +  + +E  + ++  N  G     E  + +   
Sbjct: 20700 KRETSRVVWSMVSEHLEEC---IITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKN 20756

Query: 635   VVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFT 694
                 P PP    +T + ++   +VW  P+ DGG  ++GY +E++ K S  W K+  E   
Sbjct: 20757 AFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIR 20816

Query: 695   ETTYESTKMIEGILYEMRVFAVNAIG---VSQPSMNTKPFMPIAPTSEPLHLIVEDVTDT 751
             +T  + T + E   Y+ RV AVNA G    S+PS   K   PI P   P  + + D T +
Sbjct: 20817 DTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKS 20876

Query: 752   TTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTE-PVERCGFTVKNLPTGARILFR 810
             + TL W  P   G   + GY+VE      EEW   +T+  V    + V NL  G    FR
Sbjct: 20877 SITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFR 20936

Query: 811   VVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRP 870
             V  VN AG+ EP  + +PV  ++I E P+I L   LR + I K GE + +++PF+G+P P
Sbjct: 20937 VSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPP 20996

Query: 871   QVVWTKGGAPLDT-SRVHVRTSDFDTVFFVRQAARSDSGEYELSVQI-ENMKDTATIRIR 928
              V W K    L + +R  +  +D  ++  + Q  R+D+G+Y L+++       ++T+ ++
Sbjct: 20997 TVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVK 21056

Query: 929   VVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRH 988
             V++       + VK V      + W  P  DG S I+ Y ++K D     W  V  +   
Sbjct: 21057 VLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSS 21116

Query: 989   TSCTVSDLIVGNEYYFRVYTENICGLSD 1016
             TS  + DL     ++FRV  EN  G+ +
Sbjct: 21117 TSFKLIDLSEKTPFFFRVLAENEIGIGE 21144



 Score =  209 bits (532), Expect = 1e-53
 Identities = 154/579 (26%), Positives = 261/579 (45%), Gaps = 27/579 (4%)

Query: 448   LTVKASEQAVFKCEVSDEKVTGK-WYKNGVEVRPSK-RITISHVGRFHKLVIDDVRPEDE 505
             + V A E  V + ++  + +    W K+G E+  +  R+ I    +   LV+ D    D 
Sbjct: 18412 IVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDG 18471

Query: 506   GDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLD 565
             G Y        LS       + I V+ + +  PP+  L  +G T+E   +  A N    D
Sbjct: 18472 GQYIL-----KLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYL--AWNPPLQD 18524

Query: 566   VSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNP-- 623
                      ++ ++  ++  T+    T++   V   ++ +      +E  + +   N   
Sbjct: 18525 GGAN-----ISHYII-EKRETSRLSWTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNKYG 18578

Query: 624   VGEDVASIFLQVVDV---PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKK 680
             +GE + S  +   +    P PP    ++++ +D  ++ W  P+ DGG  + GY++E++ K
Sbjct: 18579 IGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDK 18638

Query: 681   GSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGV---SQPSMNTKPFMPIAPT 737
                RW K N +  T+     T + EG  YE RV A NA GV   S+PS+  +    + P 
Sbjct: 18639 EGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPP 18698

Query: 738   SEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCG-- 795
               P +  V D + ++ +L W  P   G   + GY+VE     ++EW    T P    G  
Sbjct: 18699 GPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTC-TPPTGLQGKQ 18757

Query: 796   FTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVG 855
             FTV  L       FR+  +N  G  EPATL   V  +E  EPP+I L   LR+  + +  
Sbjct: 18758 FTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRAS 18817

Query: 856   EQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQ 915
               L L V  +G+P P+V W K    L T R  +  +   T+  +    R DSG Y L+++
Sbjct: 18818 ATLRLFVTIKGRPEPEVKWEKAEGIL-TDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLE 18876

Query: 916   IENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKK 975
               +   TA + +RV++    P+N+ ++EV   +  + W+ P  DG ++I  Y V+K +  
Sbjct: 18877 NNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETT 18936

Query: 976   TMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGL 1014
                +  +      T+  + +L  G  YYFRV   N  G+
Sbjct: 18937 RKAYATITNNCTKTTFRIENLQEGCSYYFRVLASNEYGI 18975



 Score =  208 bits (529), Expect = 3e-53
 Identities = 149/504 (29%), Positives = 229/504 (45%), Gaps = 42/504 (8%)

Query: 554  IVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDE 613
            I+V+ G KL + V     P P  +W K  +    ++  T     +     V +S  R D 
Sbjct: 8091 IIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSV-RADA 8149

Query: 614  GRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGY 673
            G YTI + N +G   ASI ++V+ +P P + ++ + + +    L WEPP +DGG P+  Y
Sbjct: 8150 GIYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHY 8209

Query: 674  LVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM- 732
            ++ER++ G + ++ +      + ++    +I    Y  RV AVN +G  +      P + 
Sbjct: 8210 VLERREAGRRTYIPV-MSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIA 8268

Query: 733  --PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEP 790
              P  P   P+ + V + T    T+ W+PP   G   I GY++E   +G E W   N   
Sbjct: 8269 QDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHL 8328

Query: 791  VERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTY 850
            V    +T K L  G    FRV   N AG SEP+    P    +  + PK+     LR + 
Sbjct: 8329 VPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKV----ILRTSL 8384

Query: 851  IRKVGEQLNLVVPFQGKPRPQVVWTKG------------GAPLD---------------- 882
              K G+++ L     G P P + W K              APL                 
Sbjct: 8385 EVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLP 8444

Query: 883  -TSRVHVRTS-DFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVM 940
             T R+ +  S   ++   VR + R D G Y + V+ ++    A   + V++  GPPIN +
Sbjct: 8445 LTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFV 8504

Query: 941  VKEVWGTNALVEWQAPKDDGNSEIMGYFVQKAD--KKTMEWFNVYERNRHTSCTVSDLIV 998
             +++  T+ L +W+ P DDG SEI+ Y ++K D  K   EW  V    RH   +V+ LI 
Sbjct: 8505 FEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIE 8564

Query: 999  GNEYYFRVYTENICGLSDSPGVSK 1022
            G EY FRV  EN  G    P VSK
Sbjct: 8565 GKEYLFRVRAENRFG-PGPPCVSK 8587



 Score =  205 bits (522), Expect = 2e-52
 Identities = 154/585 (26%), Positives = 255/585 (43%), Gaps = 40/585 (6%)

Query: 448   LTVKASEQAVFKCEVSDEKV-TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG 506
             + V A E    + +V  + + T +W +   E+  S R  I +      L++ D    D G
Sbjct: 17330 IVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGG 17389

Query: 507   DYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDV 566
              Y       A S S  +N     V+ + +  PP+  +  +G TSE               
Sbjct: 17390 QYILRASNVAGSKSFPVN-----VKVLDRPGPPEGPVQVTGVTSEKC------------- 17431

Query: 567   SITGEPP------PVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKV 620
             S+T  PP       ++ ++  ++  T+    T +   V  +S  +      +E  + I  
Sbjct: 17432 SLTWSPPLQDGGSDISHYVV-EKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMA 17490

Query: 621   TNPVG-----EDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLV 675
              N  G     E    +      +P PP+++ +T++ +D   + W  P  DGG  + GY+V
Sbjct: 17491 VNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIV 17550

Query: 676   ERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNT---KPFM 732
             E++ +   RW+K N    T+     T + E   YE RV A NA GV +PS  T   K   
Sbjct: 17551 EKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACD 17610

Query: 733   PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEW---VPANTE 789
             P+     P +  + D T  + TL W  P   G   I GY+VE C    EEW    P    
Sbjct: 17611 PVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGL 17670

Query: 790   PVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQT 849
              V R  F +  L        RV  +N  G  E  ++   V   +  E P++ L   LR+ 
Sbjct: 17671 RVTR--FEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKG 17728

Query: 850   YIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGE 909
              + + G    + +PF+G+P P++ W++      T +V +      T   +    R+D+G+
Sbjct: 17729 IVVRAGGSARIHIPFKGRPTPEITWSREEGEF-TDKVQIEKGVNYTQLSIDNCDRNDAGK 17787

Query: 910   YELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFV 969
             Y L ++  +   +A + ++V++  GPP N+ VKEV   +A + W+ P  DG +++  Y +
Sbjct: 17788 YILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVI 17847

Query: 970   QKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGL 1014
              K +     + NV  +   TS  V +L  G  YYFRV  EN  G+
Sbjct: 17848 DKRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGV 17892



 Score =  205 bits (521), Expect = 2e-52
 Identities = 150/561 (26%), Positives = 249/561 (44%), Gaps = 34/561 (6%)

Query: 471   WYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKV 530
             W K+G  ++ + R+ +        L I +   +D G YT      A + +  L+ + ++ 
Sbjct: 18040 WVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLE- 18098

Query: 531   EYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLD-VSITGEPPPVATWLKGDEVF---- 585
                 K  PP              +  V  +++  D V I+ EPP      +         
Sbjct: 18099 ----KPGPP--------------VGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKR 18140

Query: 586   -TTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGE----DVASIFLQV-VDVP 639
              TTT     +   V  ++  I   +   E ++ I   N  G+    D  ++ +Q     P
Sbjct: 18141 DTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEP 18200

Query: 640   DPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYE 699
              PP    +TS+ +D  ++ W  P+ DGG  + GY +E+K+K S  W+KLN     +T ++
Sbjct: 18201 GPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFK 18260

Query: 700   STKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRP 759
             +T + EG+ YE +V A N +G+ +PS  ++ F+   P   P       +T    TLKW+ 
Sbjct: 18261 TTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKK 18320

Query: 760   PNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGR 819
             P   G   I GY+VE        W+ A+   V    FTV  L    R  FRV+  N AG 
Sbjct: 18321 PAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGN 18380

Query: 820   -SEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGG 878
              SEP+  +  +T R+  + P   L    +   +   GE   L    +GKP P VVW+K G
Sbjct: 18381 FSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDG 18440

Query: 879   APLD--TSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPP 936
               L+   +R+ ++++   T   V+   R+D G+Y L +       +  I ++V+++ GPP
Sbjct: 18441 KELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPP 18500

Query: 937   IN-VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSD 995
                + V  V      + W  P  DG + I  Y ++K +   + W  V    +  +  V+ 
Sbjct: 18501 EGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTK 18560

Query: 996   LIVGNEYYFRVYTENICGLSD 1016
             L+ GNEY FRV   N  G+ +
Sbjct: 18561 LLPGNEYIFRVMAVNKYGIGE 18581



 Score =  204 bits (519), Expect = 4e-52
 Identities = 159/589 (26%), Positives = 267/589 (45%), Gaps = 45/589 (7%)

Query: 448   LTVKASEQAVFKCEVSDEKVTGK--WYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDE 505
             LT+KA +  V        K   K  W K G ++RPS    I+       L I     +D 
Sbjct: 14083 LTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDA 14142

Query: 506   GDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLD 565
             G+YT            K+  +++ V  VP    P   ++ S  ++E A            
Sbjct: 14143 GEYTITATN---PFGTKVEHVKVTVLDVPGPPGP---VEISNVSAEKA------------ 14184

Query: 566   VSITGEPP------PVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIK 619
              ++T  PP      P+ +++  ++  T+    T + + +     V     + +E  + + 
Sbjct: 14185 -TLTWTPPLEDGGSPIKSYIL-EKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFRVS 14242

Query: 620   VTNPVG--EDVASIFLQVVD---VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYL 674
               N  G  E V S  +++VD    P PPE   +++V ++ A + W+ P+ DGG  +TGY 
Sbjct: 14243 AVNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYH 14302

Query: 675   VERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM-- 732
             VER++K S RW++      ++   + T + EG  YE RV A N  G+  PS  +   +  
Sbjct: 14303 VERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMK 14362

Query: 733   ----PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANT 788
                 P  P S P    V D T  + +L W  P+  G   I GY+VE+   G E W+   T
Sbjct: 14363 DAAYPPGPPSNPH---VTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTT 14419

Query: 789   EPVERCG-FTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLR 847
                 R   F V +L T  +  FR+  +N AG  EPA +   V I E    P   L   LR
Sbjct: 14420 GTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPD-VEIVEREMAPDFELDAELR 14478

Query: 848   QTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDS 907
             +T + + G  + + VP +G+P P+V WTK    L  +R ++  ++  T+  + +  R D+
Sbjct: 14479 RTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLK-NRANIENTESFTLLIIPECNRYDT 14537

Query: 908   GEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGY 967
             G++ ++++    K +  + +RV++  GP +N+   ++   +  + W  P  DG S I  Y
Sbjct: 14538 GKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNY 14597

Query: 968   FVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
              V+K +     +     +    +  V+ L  G EY+FRV  EN  G+ +
Sbjct: 14598 IVEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGE 14646



 Score =  203 bits (517), Expect = 7e-52
 Identities = 166/605 (27%), Positives = 260/605 (42%), Gaps = 40/605 (6%)

Query: 448   LTVKASEQAVFKCEVSDEKV-TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG 506
             + V A E      ++  + + T +W K   E+  + R+ I        L + D    D G
Sbjct: 16248 IVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSG 16307

Query: 507   DYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIV-----VVAGNK 561
             +Y       A   S  +N     V+ + +  PP+  +  SG T+E   +     +  G  
Sbjct: 16308 NYILKAKNVAGERSVTVN-----VKVLDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGS 16362

Query: 562   LRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVT 621
               ++  +         W             T ++  V   S  +      +E  + I   
Sbjct: 16363 DIINYIVERRETSRLVW-------------TVVDANVQTLSCKVTKLLEGNEYTFRIMAV 16409

Query: 622   NP--VGEDVAS---IFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVE 676
             N   VGE + S   +      VPD P+A  +T+V +D  I+VWE P  DGG  + GY++E
Sbjct: 16410 NKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVLE 16469

Query: 677   RKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNT---KPFMP 733
             ++ K   RW + +  +  E     T +IE   YE RV A NA G+S+PS  +   K   P
Sbjct: 16470 KRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACDP 16529

Query: 734   IAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEP--V 791
             I     P +  V D+T ++  L W  P   G   I GY+VE C     EW    T P  +
Sbjct: 16530 IYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMC-TPPTGI 16588

Query: 792   ERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYI 851
              +    V+ L       FR+  +N AG  E A +  P+ + E  E P I L   LR+   
Sbjct: 16589 NKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKIIN 16648

Query: 852   RKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYE 911
              + G  L L VP +G+P P+V W K    +  + +   TS F T   +    R DSG+Y 
Sbjct: 16649 IRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSF-TSLVLDNVNRYDSGKYT 16707

Query: 912   LSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQK 971
             L+++  +   +A + +RV++   PP+N+ V E+   +  + W+ P  DG S+I  Y V+K
Sbjct: 16708 LTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEK 16767

Query: 972   ADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTG 1031
              +     +  V       S  +  L  G  YYFRV  EN  G+    G+   TA  +K  
Sbjct: 16768 REATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGI----GLPAQTADPIKVA 16823

Query: 1032  ITFKP 1036
                +P
Sbjct: 16824 EVPQP 16828



 Score =  203 bits (516), Expect = 9e-52
 Identities = 157/575 (27%), Positives = 257/575 (44%), Gaps = 39/575 (6%)

Query: 462   VSDEKVTGK------WYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGY 515
             V D  V GK      W K   E+   +++++ + G+    VI      D G YT      
Sbjct: 22761 VLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNA 22820

Query: 516   ALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPV 575
             +     K   + +KV            LD  G   +  +  V   K  L  S+  E    
Sbjct: 22821 S---GTKAVSVMVKV------------LDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGA 22865

Query: 576   A-TWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQ 634
               T    +   T+      +E      S+V+    + +E  + ++  N  G  V      
Sbjct: 22866 EITHYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEP 22925

Query: 635   VV-----DVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLN 689
             +V      +P PP        G++  I+ W  P  DGG  ++ YLV++++K S RW ++N
Sbjct: 22926 IVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVN 22985

Query: 690   FE-VFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNT------KPFMPIAPTSEPLH 742
              + V  +T  + T ++EG  Y+ RV AVNA G S+PS  +      +P     P S P  
Sbjct: 22986 KDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPR- 23044

Query: 743   LIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEP-VERCGFTVKNL 801
               V D T  + +L W  P   G   I GY++E   + +++W   +T   +    FTV +L
Sbjct: 23045 --VVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDL 23102

Query: 802   PTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLV 861
               G +  FRV  VN+ G SE +     +   E  E P + L   L++T   + G  L L+
Sbjct: 23103 KMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGASLRLM 23162

Query: 862   VPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKD 921
             V   G+P P + W+K G  L  SR  + T++  ++  V +  R D+G+Y +  + ++ K 
Sbjct: 23163 VSVSGRPPPVITWSKQGIDL-ASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKK 23221

Query: 922   TATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFN 981
             +AT+ ++V +  GP  +V VKEV   +  + W+ P  DG + +  Y V+K +     +  
Sbjct: 23222 SATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREAAMRAFKT 23281

Query: 982   VYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
             V  +   T   +S L+ G  YYFRV  ENI G+ +
Sbjct: 23282 VTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGE 23316



 Score =  202 bits (515), Expect = 1e-51
 Identities = 126/404 (31%), Positives = 190/404 (47%), Gaps = 12/404 (2%)

Query: 638   VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETT 697
             VP  P+   ++SV  +   + WE P YDGG PVTGY +E K   S+RW ++N +     T
Sbjct: 10011 VPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMT 10070

Query: 698   ----YESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTD 750
                 Y+ T +IEG  Y+ RV+A+NA GV   S+ + P     PIAP   P   +  D T 
Sbjct: 10071 LGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPGPPFPKVT-DWTK 10129

Query: 751   TTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFR 810
             ++  L+W PP + G   + GY+VEY  EG EEW     + V      V  L  GA   FR
Sbjct: 10130 SSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFR 10189

Query: 811   VVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRP 870
             V  VNIAG  EP  +   + +++    P ++L   +R   +   G  + ++    GKP P
Sbjct: 10190 VRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPP 10249

Query: 871   QVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVV 930
              V W      L      + T+   +   ++   RS  G Y L  + E  +   TI + V+
Sbjct: 10250 TVTWNMNERTL-PQEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVL 10308

Query: 931   EKAGP-PINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHT 989
             +  GP     +   +   +  + W +P+DDG S I  Y ++K +     W  V       
Sbjct: 10309 DVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQ 10368

Query: 990   SCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGIT 1033
             + TV  LI G  Y+FR+  EN  G+   P V  + A +++  IT
Sbjct: 10369 NATVQGLIQGKAYFFRIAAENSIGM--GPFVETSEALVIREPIT 10410



 Score =  201 bits (510), Expect = 4e-51
 Identities = 227/907 (25%), Positives = 363/907 (40%), Gaps = 108/907 (11%)

Query: 267  QVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
            +V    ++    E++      KWF+N + I  SSKY+         L I    L D A Y
Sbjct: 6345 RVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANY 6404

Query: 327  EVAVKDE-----KCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKD 381
             V++ +      K    L V+E  + IV PL+D +      V    +V+     + W K+
Sbjct: 6405 NVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKN 6464

Query: 382  GVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEV 441
            G E+     F  R  ++ D  +H+L   D    D G Y V     +  AEL++ E   E 
Sbjct: 6465 GEEVP----FDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEF 6520

Query: 442  LQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVR 501
            ++ + D TV   + AVF C++S EK   KWY+NG E++  K+      G  H+L+I D R
Sbjct: 6521 VEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCR 6580

Query: 502  PEDEGDYTF-VPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGN 560
             +DE +Y   V D  +    A+L   EI VE +    PP+  L+  G    + + +   N
Sbjct: 6581 LDDECEYACGVEDRKS---RARLFVEEIPVEII---RPPQDILEAPG---ADVVFLAELN 6631

Query: 561  KLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKV 620
            K +++V        V   ++GD+    +EG  +I +   C        +  D+G Y    
Sbjct: 6632 KDKVEVQWLRNNMVV---VQGDKHQMMSEG--KIHRLQIC------DIKPRDQGEYRFIA 6680

Query: 621  TNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYL-VERKK 679
                 +  A   L++   P      +I +  +D  +        D GKP+T  +  +   
Sbjct: 6681 K----DKEARAKLELAAAP------KIKTADQDLVV--------DVGKPLTMVVPYDAYP 6722

Query: 680  KGSQRWMKLNFEVFT---ETTYEST--KMIE---GILYEMRVFAVNAIGVSQPSMNTKPF 731
            K    W K N  + T   +TT E T  +++E   G     ++   N  G ++  +N K  
Sbjct: 6723 KAEAEWFKENEPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVI 6782

Query: 732  MPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPV 791
                P     +L V +  D   +L W  P   G   I GY+VE      + WV A T+  
Sbjct: 6783 DVPGPVR---NLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLA-TDRA 6838

Query: 792  ERCGFTVKNLPT-GARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTY 850
            E C FTV  L   G   LFRV   N  G  EP     PV  R   + P    P ++  T 
Sbjct: 6839 ESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVP--GPPLNVTITD 6896

Query: 851  IRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSD---FDTVFFVRQAARS-- 905
            + + G  L    P             GGA +    + +R      +DT   VR    S  
Sbjct: 6897 VNRFGVSLTWEPPEY----------DGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSAT 6946

Query: 906  -----DSGEYELSVQIEN-----MKDTATIRIRV---VEKAGPPINVMVKEVWGTNALVE 952
                 +  EY   V+ +N         AT  ++V   +E+  PP+N+   +   ++  ++
Sbjct: 6947 VTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLK 7006

Query: 953  WQAPKDDGNSEIMGYFVQKADKKTMEWFNV-YERNRHTSCTVSDLIVGNEYYFRVYTENI 1011
            W+ P  DG S I+GY +++ ++    W     +     +  V+ L  GN+Y +RV  EN 
Sbjct: 7007 WEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENK 7066

Query: 1012 CGLSD-SPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCA 1070
             G+SD S  +   TA       T     +K+    + P  +T L+               
Sbjct: 7067 AGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPST------------ 7114

Query: 1071 VRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEAL 1130
              G+P+P   W      +    +  +        L I      D G YT +  N +    
Sbjct: 7115 --GYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTIS 7172

Query: 1131 AECKLEV 1137
             E  + V
Sbjct: 7173 GEIDVNV 7179



 Score =  201 bits (510), Expect = 4e-51
 Identities = 147/489 (30%), Positives = 221/489 (45%), Gaps = 29/489 (5%)

Query: 538   PPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKR 597
             PP++ LD    T  + I V  G  +R+   + G P P  TW K  +V          EKR
Sbjct: 11600 PPEVELDV---TCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVR-------EKR 11649

Query: 598   VDCSSFV------IESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVG 651
             VD    +      I+ A R D G+Y I   N  G    S  + V+D P P + +++T+V 
Sbjct: 11650 VDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVT 11709

Query: 652   EDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEM 711
             ++   + WE P+ +GG  +T ++VE +K   + W  +  +V          ++    Y  
Sbjct: 11710 KENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLI--KANLLANNEYYF 11767

Query: 712   RVFAVNAIGVSQPSMNTK-PFMPIAPTS---EPLHLIVEDVTDTTTTLKWRPPNRIGAGG 767
             RV A N +GV  P++ TK P + I P     EP +L + D   T   LKWR P+  G   
Sbjct: 11768 RVCAENKVGVG-PTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSP 11826

Query: 768   IDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQ 827
                Y VE  L+GS++W   +   ++   + V          FRV   N  G S+     +
Sbjct: 11827 NLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDWVK-TE 11885

Query: 828   PVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSR-- 885
              V ++E  + P + L   L      K G+ + L    +GKP P+V WTK     D +R  
Sbjct: 11886 EVVVKEDLQKPVLDLK--LSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSP 11943

Query: 886   -VHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEV 944
              V + T    + F + +A RSD G+Y ++         A   + V++K GP  N+ + +V
Sbjct: 11944 RVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKIVDV 12003

Query: 945   WGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYF 1004
                   V W  P+DDG  EI  Y ++K + K M W            TV+ LI GNEY F
Sbjct: 12004 SSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIEGNEYIF 12063

Query: 1005  RVYTENICG 1013
             RV  EN  G
Sbjct: 12064 RVRAENKIG 12072



 Score =  200 bits (508), Expect = 7e-51
 Identities = 148/582 (25%), Positives = 254/582 (43%), Gaps = 35/582 (6%)

Query: 450   VKASEQAVFKCEVSDE-KVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDY 508
             VKA EQ           + T  W K+G  ++ + R+ +S       L I +   ED G Y
Sbjct: 19101 VKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTY 19160

Query: 509   TFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSI 568
                    A S++  +                 I LD  G      I  V+ +     ++I
Sbjct: 19161 ELCVSNSAGSITVPITI---------------IVLDRPGPPGPIRIDEVSCDS----ITI 19201

Query: 569   TGEPPP------VATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTN 622
             +  PP       ++ ++   +  T+T     + + V  +S  I       E ++ +   N
Sbjct: 19202 SWNPPEYDGGCQISNYIVEKKETTSTTWHI-VSQAVARTSIKIVRLTTGSEYQFRVCAEN 19260

Query: 623   PVGEDVASIFLQVV-----DVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVER 677
               G+   S    VV       P PP   ++    +   ++ W+ P+ DGG  V GY +E 
Sbjct: 19261 RYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEY 19320

Query: 678   KKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPT 737
             K++ S  W K N  +  +T  + + + EG++YE RV+A N  G+ + S + +P     P 
Sbjct: 19321 KERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPC 19380

Query: 738   SEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFT 797
               P    V ++T  + +LKW  P+  G   I GY+VE        W+  N   ++   F 
Sbjct: 19381 DPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQETYFE 19440

Query: 798   VKNLPTGARILFRVVGVNIAGR-SEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGE 856
             V  L    R  FRV   N A   SEP+    P+ +++  EPP++ +    R   + K GE
Sbjct: 19441 VTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGE 19500

Query: 857   QLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQ 915
              L +     G+P P + W K G  + + +R  + ++D  T+  V+   R D+G+Y L+++
Sbjct: 19501 VLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLK 19560

Query: 916   IENMKDTATIRIRVVEKAGPPINVM-VKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADK 974
                   +  +  +V++K GPP   + +  +      + W  P++DG ++I  Y V+K + 
Sbjct: 19561 NVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRET 19620

Query: 975   KTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
               + W       + TSC V+ L+ GNEY FRV   N  G+ +
Sbjct: 19621 SHLAWTICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGE 19662



 Score =  198 bits (504), Expect = 2e-50
 Identities = 117/410 (28%), Positives = 204/410 (49%), Gaps = 22/410 (5%)

Query: 638  VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTET- 696
            +P PP   ++ +  +   ++ W PP+ +GG P+TGY +E++++GS  W +++    T+  
Sbjct: 9293 LPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVG 9352

Query: 697  ----TYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVT 749
                 +   +++EG+ Y+ R  A+NA G+  PS  + P +   PI P   P    V+D T
Sbjct: 9353 LKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPPGPPSCPEVKDKT 9412

Query: 750  DTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEP---VERCGFTVKNLPTGAR 806
             ++ +L W+PP + G   I GY+VE   EG+ +W   N EP   +  C   V NL    +
Sbjct: 9413 KSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVN-EPDKLITTCECVVPNLKELRK 9471

Query: 807  ILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQG 866
              FRV  VN AG SEP+     +   +I E P++ +    +   + K G Q+ +    +G
Sbjct: 9472 YRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKG 9531

Query: 867  KPRPQVVWTKGGAPLDTSR--VH-------VRTSDFDTVFFVRQAARSDSGEYELSVQIE 917
            +P P+  W   G      +  VH       + T++  +V  + +  RS +G+Y ++ + +
Sbjct: 9532 RPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHTGKYSITAKNK 9591

Query: 918  NMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTM 977
              + TA  R++V++  GPP ++ V ++   +  + W+ P DDG   I GY ++K      
Sbjct: 9592 AGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGK 9651

Query: 978  EWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDS-PGVSKNTAR 1026
             W  V      T+  V DL+   +Y+FRV  EN  G+      + + TAR
Sbjct: 9652 AWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQRTTAR 9701



 Score =  198 bits (503), Expect = 3e-50
 Identities = 169/622 (27%), Positives = 268/622 (43%), Gaps = 40/622 (6%)

Query: 430   AELIVEEKQLEVLQDIADLT-----VKASEQAVFKCEVSDE---KVTGKWYKNGVEVRPS 481
             + +I++E Q+E   D+  +T      KA         +S     KVT  W    + ++ +
Sbjct: 22329 SSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVT--WKLEEMRLKET 22386

Query: 482   KRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKI 541
              R++I+       L + D    D G Y        L  +A +    + V  + +  P   
Sbjct: 22387 DRVSITTTKDRTTLTVKDSMRGDSGRYFLT-----LENTAGVKTFSVTVVVIGRPGPVTG 22441

Query: 542   HLDCSGKTSENAIVVVAGNKLRLDVSITG------EPPPVATWLKGDEVFTTTEGRTRIE 595
              ++ S  ++E+ ++     K      IT       E    A  L    V  T    T + 
Sbjct: 22442 PIEVSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLT 22501

Query: 596   KRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWA 655
             K ++ S F + S  R         V+ P+ E    I       P  P    +  V  +  
Sbjct: 22502 KYMEYS-FRVSSENR-------FGVSKPL-ESAPIIAEHPFVPPSAPTRPEVYHVSANAM 22552

Query: 656   ILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFA 715
              + WE P +DGG  + GY VE+K++ +  W+K N     E  Y+ T ++EG+ Y+ R +A
Sbjct: 22553 SIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYA 22612

Query: 716   VNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE- 774
             +NA GVS+ S  ++P M   P   P    V DVT +T +L W  P   G   + GY++E 
Sbjct: 22613 LNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRSTVSLIWSAPAYDGGSKVVGYIIER 22672

Query: 775   --YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAG-RSEPATLAQPVTI 831
                   G   W+  N   V    FTV  L  G    FRV+  N AG  S+ +    PVT 
Sbjct: 22673 KPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTC 22732

Query: 832   REIAEPPKIRLPRHLRQTYIR-KVGEQLNLVVPFQGKPRPQVVWTKGGAPLD-TSRVHVR 889
             R+   PPK  L   L    +  + G  L L     GKP P+++WTKG   LD   +V ++
Sbjct: 22733 RDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQ 22792

Query: 890   TSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNA 949
              +       ++   RSDSG+Y L+V+  +     ++ ++V++  GP   + V  V     
Sbjct: 22793 YTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKC 22852

Query: 950   LVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTE 1009
              + W  P++DG +EI  Y V++ +   + W  V       S  V+ LI  NEY FRV   
Sbjct: 22853 TLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAV 22912

Query: 1010  NICG----LSDSPGVSKNTARI 1027
             N  G    +   P V++N+  I
Sbjct: 22913 NKYGPGVPVESEPIVARNSFTI 22934



 Score =  197 bits (501), Expect = 5e-50
 Identities = 164/594 (27%), Positives = 258/594 (43%), Gaps = 46/594 (7%)

Query: 442   LQDIADLTVKASEQAVFKCEVSDEKVTGK------WYKNGVEVRPSKRITISHVGRFHKL 495
             L+ + DL   A E + F+ ++    + GK      W K    +    R+++        L
Sbjct: 13679 LKGLPDLCYLAKENSNFRLKIP---IKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTL 13735

Query: 496   VIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIV 555
             ++ D +  D G YT      A     K   + IKV  V K   P   +     T+E    
Sbjct: 13736 IVYDCQKSDAGKYTITLKNVA---GTKEGTISIKV--VGKPGIPTGPIKFDEVTAEA--- 13787

Query: 556   VVAGNKLRLDVSITGEPPPVATWLKGDEVFT-TTEGRTRIEKR-VDCSSFVIESA---QR 610
                       +++   PP       G E+     E R  +  + V C+S V ++     R
Sbjct: 13788 ----------MTLKWAPPKDDG---GSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTR 13834

Query: 611   EDEG-RYTIKVTNP----VGEDVAS---IFLQVVDVPDPPEAVRITSVGEDWAILVWEPP 662
               EG  YT +V+      VGE + S   +     DVPD P    I  V  D   L W  P
Sbjct: 13835 LHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDP 13894

Query: 663   MYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVS 722
                GG P+TGY +E K++ S  W + N        ++ T + EG+ YE RV A+N  GV 
Sbjct: 13895 KKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVG 13954

Query: 723   QPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEE 782
             +PS+ ++P + + P   P    V ++T  + TL W  P   G   + GY+VE     S+ 
Sbjct: 13955 KPSLPSEPVVALDPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKS 14014

Query: 783   WVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGR-SEPATLAQPVTIREIAEPPKIR 841
             W+ AN   V  C FTV +L  G +  FR+   N AG  S P+   + +  ++  E P I 
Sbjct: 14015 WMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIV 14074

Query: 842   LPRHLRQTYIRKVGEQLNL-VVPFQGKPRPQVVWTKGGAPLDTSRV-HVRTSDFDTVFFV 899
             L   ++     K G+ + L  +   GKP P+  W+K G  +  S +  + ++   ++  +
Sbjct: 14075 LDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTI 14134

Query: 900   RQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDD 959
             + A R D+GEY ++           +++ V++  GPP  V +  V    A + W  P +D
Sbjct: 14135 KYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLED 14194

Query: 960   GNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICG 1013
             G S I  Y ++K +   + W  V E  +      + LI GNEY FRV   N  G
Sbjct: 14195 GGSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYG 14248



 Score =  192 bits (489), Expect = 1e-48
 Identities = 116/380 (30%), Positives = 190/380 (50%), Gaps = 8/380 (2%)

Query: 639  PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTY 698
            P PP A+ +  V +    L WEPP  DGG+P+  Y++E+K++   RW+K       +  +
Sbjct: 7879 PGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNF 7938

Query: 699  ESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTL 755
              T +IEG   + +V A N  GV  PS  T+      P +P S PL L V D       +
Sbjct: 7939 RVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAI 7998

Query: 756  KWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTV-KNLPTGARILFRVVGV 814
             W+PP + G   I GY VE C  G+E+W+  N+ P++   F V + +      + RV  V
Sbjct: 7999 AWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAV 8058

Query: 815  NIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVW 874
            N  G SEP+ +++ V  ++    P I L  H     I   GE+L++ VPF+  P P V W
Sbjct: 8059 NAIGVSEPSEISENVVAKDPDCKPTIDLETH---DIIVIEGEKLSIPVPFRAVPVPTVSW 8115

Query: 875  TKGGAPLDTS-RVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKA 933
             K G  +  S R+ ++         V ++ R+D+G Y ++++ +    TA+I ++V+   
Sbjct: 8116 HKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLP 8175

Query: 934  GPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTV 993
            GP  ++   ++  ++  + W+ P+ DG + I+ Y +++ +     +  V       S TV
Sbjct: 8176 GPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTV 8235

Query: 994  SDLIVGNEYYFRVYTENICG 1013
             DLI   EY+FRV   N  G
Sbjct: 8236 KDLIPNGEYFFRVKAVNKVG 8255



 Score =  191 bits (485), Expect = 3e-48
 Identities = 127/440 (28%), Positives = 205/440 (46%), Gaps = 10/440 (2%)

Query: 586   TTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGE----DVASIFLQV-VDVPD 640
             T+T   T +   V  +   +      +E ++ IK  N  G     D A + +++    P 
Sbjct: 20307 TSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPG 20366

Query: 641   PPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYES 700
             PP    +T+V  +   + W  P+ +GG  V GY +E K + S  W K N  V   T ++ 
Sbjct: 20367 PPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKV 20426

Query: 701   TKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPP 760
             T +  G++YE RV+A NA GV +PS  ++P + I     P ++ + D++  + +L W+ P
Sbjct: 20427 TTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQP 20486

Query: 761   NRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGR- 819
                G   I GY+VE        W  A+   V    F +  L   ++  FRV   N  G  
Sbjct: 20487 AFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSI 20546

Query: 820   SEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGA 879
             S P+ +  P+T  +    P I LP    +    + G  + L     GKP P + W K   
Sbjct: 20547 SNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDK 20606

Query: 880   PLDTSRVHV--RTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPI 937
              L T+ +     T+D  ++  ++ A R +SG YEL ++      +ATIR+++++K GPP 
Sbjct: 20607 ELQTNALVCVENTTDLASI-LIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPG 20665

Query: 938   N-VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDL 996
               +  K V      + W+ P DDG ++I  Y V+K +   + W  V E       T + +
Sbjct: 20666 GPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECIITTTKI 20725

Query: 997   IVGNEYYFRVYTENICGLSD 1016
             I GNEY FRV   N  G+ +
Sbjct: 20726 IKGNEYIFRVRAVNKYGIGE 20745



 Score =  189 bits (480), Expect = 1e-47
 Identities = 117/378 (30%), Positives = 174/378 (46%), Gaps = 7/378 (1%)

Query: 639  PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTY 698
            PD P+   +  V  +  ++ W  P  D G P+ GY +E+++  S  W ++N  +      
Sbjct: 8598 PDAPDKPIVEDVTSNSMLVKWNEPK-DNGSPILGYWLEKREVNSTHWSRVNKSLLNALKA 8656

Query: 699  ESTKMIEGILYEMRVFAVNAIG---VSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTL 755
                ++EG+ Y  RV A NA G    S PS       PI+P   P+  +  D + TT  L
Sbjct: 8657 NVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIPRVT-DTSSTTIEL 8715

Query: 756  KWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVN 815
            +W PP   G G I GY V+  L G+ EW     + ++   +TVK +  GA    RV  VN
Sbjct: 8716 EWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVN 8775

Query: 816  IAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWT 875
             AG   P    QPVT+ E  EPP + L   ++       G+ L +     G+P P  VWT
Sbjct: 8776 AAGEGPPGE-TQPVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWT 8834

Query: 876  KGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGP 935
            K    LD  RV +      +   ++ A R D G Y ++         A  R+ V +  GP
Sbjct: 8835 KEEGELDKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGP 8894

Query: 936  PINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSD 995
             +++          L+ W  P+DDG SEI G+ +++ D K   W    E  R + C ++ 
Sbjct: 8895 VLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETER-SKCDITG 8953

Query: 996  LIVGNEYYFRVYTENICG 1013
            L+ G EY FRV  +N  G
Sbjct: 8954 LLEGQEYKFRVIAKNKFG 8971



 Score =  171 bits (432), Expect = 5e-42
 Identities = 168/618 (27%), Positives = 263/618 (42%), Gaps = 61/618 (9%)

Query: 429  EAELIVEEKQLEVLQDI---ADLTVKASEQAVFKCEVS---DEKVTGKWYKNGVEVRPSK 482
            E + +  ++  E+  D+   A LTVKA  +      V+   + K+T  W K  + ++  K
Sbjct: 7373 EIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKIT--WTKADMILKQDK 7430

Query: 483  RITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIH 542
            RITI +V +   + I D +  D G Y       A+++  +   + ++V  + K  PP   
Sbjct: 7431 RITIENVPKKSTVTIVDSKRSDTGTYII----EAVNVCGRATAV-VEVNVLDKPGPPAA- 7484

Query: 543  LDCSGKTSENAIVV------VAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEK 596
             D +  T+E+ ++         G+K+  +  +         W K     T  +   +  K
Sbjct: 7485 FDITDVTNESCLLTWNPPRDDGGSKI-TNYVVERRATDSEVWHKLSS--TVKDTNFKATK 7541

Query: 597  RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAI 656
             +    ++   A     G     V  PV     +   Q  D P PP  +  + + +D   
Sbjct: 7542 LIPNKEYIFRVAAENMYG-----VGEPVQASPITAKYQ-FDPPGPPTRLEPSDITKDAVT 7595

Query: 657  LVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAV 716
            L W  P  DGG P+TGY VER    + +W++ N     +TTY    +     Y  RV A 
Sbjct: 7596 LTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAE 7655

Query: 717  NAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLV 773
            N  G  +PS +T+P +   PI P   P    V+DV  T+  L W  P   G   I+ Y++
Sbjct: 7656 NLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVI 7715

Query: 774  EYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIRE 833
            E    G++EWV    E V      +  L  G    FRV  VN AG SEP+  + PV  RE
Sbjct: 7716 EMLKTGTDEWVRV-AEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCRE 7774

Query: 834  IAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQ--GKP------RPQVVWTKGGAPLDT-- 883
               PP    PR L    I K    L   VP +  G P        + V  KG   +DT  
Sbjct: 7775 KLYPPS--PPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTV 7832

Query: 884  --SRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIEN---MKDTATIRIRVVEKAGPPIN 938
              ++  V      +++  R AA +  G+ + + +IE+    KDT T         GPP  
Sbjct: 7833 KDTKCTVTPLTEGSLYVFRVAAENAIGQSDYT-EIEDSVLAKDTFT-------TPGPPYA 7884

Query: 939  VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCT--VSDL 996
            + V +V   +  ++W+ PK+DG   I  Y ++K ++    W     +     C   V+D+
Sbjct: 7885 LAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKA-GKTAGPDCNFRVTDV 7943

Query: 997  IVGNEYYFRVYTENICGL 1014
            I G E  F+V  EN  G+
Sbjct: 7944 IEGTEVQFQVRAENEAGV 7961



 Score =  169 bits (427), Expect = 2e-41
 Identities = 134/515 (26%), Positives = 221/515 (42%), Gaps = 40/515 (7%)

Query: 441   VLQDIADLTVKASEQAVFKCEVSDEKVTG-KWYKNGVEVRPSKRITISHVGRFHKLVIDD 499
             + +++ D+T K  E A   C++    +   KWY+ G E+  S++  +S  GR H L +  
Sbjct: 24230 IRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMT 24289

Query: 500   VRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAG 559
                EDEG YT +       +      L         Q  P+ H    G   +       G
Sbjct: 24290 EEQEDEGVYTCIATNEVGEVETSSKLL--------LQATPQFH---PGYPLKEKYYGAVG 24338

Query: 560   NKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDE-GRYTI 618
             + LRL V   G P P  TW  G ++   +E  T IE     +  V+++ QR+   G+Y +
Sbjct: 24339 STLRLHVMYIGRPVPAMTWFHGQKLLQNSENIT-IENTEHYTHLVMKNVQRKTHAGKYKV 24397

Query: 619   KVTNPVGEDVASIFLQVVDVPDPPEA-VRITSVGEDWAILVWEPPMYDGGKPVTGYLVER 677
             +++N  G   A + +++ D PD P   + I ++ ++ A++ W+PP  DGG  +T Y+VE+
Sbjct: 24398 QLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEK 24457

Query: 678   -KKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQP----------SM 726
              + K    W  ++  + + TT     + E   Y  RV A N  G+S P          S 
Sbjct: 24458 CEAKEGAEWQLVSSAI-SVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSP 24516

Query: 727   NTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPA 786
               KP  P  PT       +  VT  +  + W+PP   G   I  Y +E   +   +W+  
Sbjct: 24517 FEKPGAPGKPT-------ITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISV 24569

Query: 787   NTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHL 846
              TE +    F+VKNL  G    FRV   N+ G SE + +++P+T +             L
Sbjct: 24570 TTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEEL 24629

Query: 847   RQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVF---FVRQAA 903
             R   +R       LV    G P+P V W + G  +    +  R  +F   +    +    
Sbjct: 24630 RNLNVR-YQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVT 24688

Query: 904   RSDSGEYELSV--QIENMKDTATIRIRVVEKAGPP 936
               D+  Y++    Q  ++  TA++ + V  K   P
Sbjct: 24689 DDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLP 24723



 Score =  156 bits (395), Expect = 9e-38
 Identities = 95/314 (30%), Positives = 153/314 (48%), Gaps = 13/314 (4%)

Query: 530   VEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTE 589
             V  + +  PP+I L  + K+    + V AG  + LD ++ G+P P  +W K   +    E
Sbjct: 12979 VTILAENVPPRIDLSVAMKS---LLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAE 13035

Query: 590   GRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITS 649
             G     +R  C +  + S  R+D G YTI   N  G   A+I L+V+D P PP +V+I  
Sbjct: 13036 GIKMAMQRNLC-TLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINK 13094

Query: 650   VGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILY 709
             +  D A+L WEPP+ DGG  +T Y+V++++     W +++  V   T+    K+IEG  Y
Sbjct: 13095 MYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVSATV-PITSCSVEKLIEGHEY 13153

Query: 710   EMRVFAVNAIGV-----SQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIG 764
             + R+ A N  GV     ++P++   P+ P      P   ++ ++T    T+ W+PP   G
Sbjct: 13154 QFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDPP---VISNITKDHMTVSWKPPADDG 13210

Query: 765   AGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPAT 824
                I GYL+E     +  W   N +P+         L  G    FRV  +N AG  +P+ 
Sbjct: 13211 GSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSD 13270

Query: 825   LAQPVTIREIAEPP 838
              ++    R+   PP
Sbjct: 13271 ASKAAYARDPQYPP 13284



 Score =  154 bits (388), Expect = 6e-37
 Identities = 221/934 (23%), Positives = 348/934 (37%), Gaps = 146/934 (15%)

Query: 271  GNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAV 330
            G  +  + E++   + ++W +N   +    K+   + GK   L I      D   Y    
Sbjct: 6621 GADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIA 6680

Query: 331  KDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSE-EGAQVMWMKDGVELTRE- 388
            KD++   +L +   P  I T  +D  V VG  + M V       A+  W K+   L+ + 
Sbjct: 6681 KDKEARAKLELAAAPK-IKTADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKT 6739

Query: 389  -DSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIAD 447
             D+   +  F+           +  + D+GRY+++      +AE  +  K ++V   + +
Sbjct: 6740 IDTTAEQTSFR---------ILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRN 6790

Query: 448  LTVKASEQAVFKCEVS---DEKVT---GKWYKNGVEVRPSKRITISHVGRFHKLVIDDVR 501
            L V  +    F  EVS   +E +T    K     VE R  KR T         ++  D  
Sbjct: 6791 LEVTET----FDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTW--------VLATDRA 6838

Query: 502  PEDEGDYTFVPDG---YALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVA 558
               E   T +  G   Y   +SA+      +          +   D  G      I  V 
Sbjct: 6839 ESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVN 6898

Query: 559  GNKLRLDVSITGEPPP------VATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQRED 612
                R  VS+T EPP       +  ++      T+    T +  R +  S  +       
Sbjct: 6899 ----RFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQ 6954

Query: 613  EGRYTIKVTNPVG---EDVASIFLQVVDV---PDPPEAVRITSVGEDWAILVWEPPMYDG 666
            E  + ++  N +G      A+ F++V D    P PP  +  +   +    L WEPP+ DG
Sbjct: 6955 EYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDG 7014

Query: 667  GKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSM 726
            G P+ GY++ER ++G   W++ N ++  E TY+ T + +G  Y  RV A N  GVS PS 
Sbjct: 7015 GSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSE 7074

Query: 727  NTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPA 786
               P        EP      D++     L+   PN I                    VP+
Sbjct: 7075 ILGPLTADDAFVEP----TMDLSAFKDGLEVIVPNPITI-----------------LVPS 7113

Query: 787  N--TEPVERCGFTVKNLPTGARILFRVVG------VNIAGRSEPA-----------TLAQ 827
                 P     F  K L TG R+  + +       ++ + RS+             T++ 
Sbjct: 7114 TGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISG 7173

Query: 828  PVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLD----- 882
             + +  IA P     P+ L+   I K    L    P             GG+PL      
Sbjct: 7174 EIDVNVIARPSA---PKELKFGDITKDSVHLTWEPPDDD----------GGSPLTGYVVE 7220

Query: 883  ----TSRVHVRTSDFDT-------------VFFVRQAARSDSGEYELSVQIE--NMKDTA 923
                + +   +  DF T              +  +  AR+  G  E +   E  NM   A
Sbjct: 7221 KREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPA 7280

Query: 924  TIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVY 983
            T+         PP NV  ++    +  + W  PK+DG S I GY V++  + + +W    
Sbjct: 7281 TV-------PDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACG 7333

Query: 984  ERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHD 1043
            E    T   V+ L  G  Y +RV   N  G S     S+ T  I        P      +
Sbjct: 7334 EPVAETKMEVTGLEEGKWYAYRVKALNRQGASKP---SRPTEEIQAVDTQEAP------E 7384

Query: 1044 FRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVL 1103
              +  K L  L    V AG    L   V G P+PK+ W K  M +++D +  I N     
Sbjct: 7385 IFLDVKLLAGL---TVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKS 7441

Query: 1104 TLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
            T+ I      D GTY   AVN  G A A  ++ V
Sbjct: 7442 TVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 7475



 Score =  152 bits (385), Expect = 1e-36
 Identities = 103/305 (33%), Positives = 150/305 (49%), Gaps = 8/305 (2%)

Query: 537   EPPKIHLDCSGKTSENAIVVVAGNKLRLD-VSITGEPPPVATWLKGDEVFTTTEGRTRIE 595
             E P I LD    T ++ + + AG+ + L+ +SI G+P P ++W K  +    ++  T+I 
Sbjct: 14069 EAPTIVLD---PTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSD-ITQIT 14124

Query: 596   KRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWA 655
                  S   I+ A R+D G YTI  TNP G  V  + + V+DVP PP  V I++V  + A
Sbjct: 14125 STPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPPGPVEISNVSAEKA 14184

Query: 656   ILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFA 715
              L W PP+ DGG P+  Y++E+++     W  ++ E      + +TK+I+G  Y  RV A
Sbjct: 14185 TLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVS-EDIQSCRHVATKLIQGNEYIFRVSA 14243

Query: 716   VNAIGVSQP--SMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLV 773
             VN  G  +P  S   K      P   P    V +VT  T T+ W+ P   G   I GY V
Sbjct: 14244 VNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHV 14303

Query: 774   EYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIRE 833
             E   + S  WV A   PV      V  L  G+   FRV   N AG   P+  +  V +++
Sbjct: 14304 ERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKD 14363

Query: 834   IAEPP 838
              A PP
Sbjct: 14364 AAYPP 14368



 Score =  150 bits (378), Expect = 9e-36
 Identities = 188/818 (22%), Positives = 320/818 (39%), Gaps = 114/818 (13%)

Query: 277   MVEISDPDLTLKWFK----NGQEI-------KPSSKYVFENVGKKRI----LTINKCTLA 321
             ++ IS   +TL+W K     G+EI       + S    ++   K+RI     TI     A
Sbjct: 24134 ILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEA 24193

Query: 322   DDAAYEVAVKDEKCF-----------TELFVKEPPVLIVTPLEDQQVFVGDRVEMAVE-V 369
              +  + V  ++E              T+L   E P  I   ++D    +G+  +++ + V
Sbjct: 24194 TEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPG-IRKEMKDVTTKLGEAAQLSCQIV 24252

Query: 370   SEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCE 429
                   + W + G EL +      +Y+   DG+ H L      QED G Y  I      E
Sbjct: 24253 GRPLPDIKWYRFGKELIQS----RKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGE 24308

Query: 430   AE-----LIVEEKQLEVLQDIADLTVKA--SEQAVFKCEVSDEKVTGKWYKNGVEVRPSK 482
              E     L+    Q      + +    A  S   +    +        W+     ++ S+
Sbjct: 24309 VETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSE 24368

Query: 483   RITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIH 542
              ITI +   +  LV+ +V+ +           Y + LS     ++  ++   + +P K  
Sbjct: 24369 NITIENTEHYTHLVMKNVQRKTHAGK------YKVQLSNVFGTVDAILDVEIQDKPDK-- 24420

Query: 543   LDCSGKTSENAIVVVAGNKLRLDVSITGEPPPV--ATWLKGDEVFTTTEGRTRIEKRVDC 600
                        IV+ A   L+    I+ +PP     +W+  + V    E +   E ++  
Sbjct: 24421 -------PTGPIVIEA--LLKNSAVISWKPPADDGGSWIT-NYVVEKCEAKEGAEWQLVS 24470

Query: 601   SSFVIESAQ----REDEGRY-------TIKVTNPVGEDVASIFLQVVDVPDPPEAVRITS 649
             S+  + + +     E+ G Y       T  +++P+      I     + P  P    IT+
Sbjct: 24471 SAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITA 24530

Query: 650   VGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILY 709
             V +D  ++ W+PP  DGG  +  Y +E+++K   +W+ +  E   ET +    +IEG+ Y
Sbjct: 24531 VTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEY 24590

Query: 710   EMRVFAVNAIGVSQPSMNTKPFMPIAPT--------SEPLHLIVEDVTDTTTTLK----- 756
             E RV   N  G S+ S  ++P  P +           E  +L V   ++ T   K     
Sbjct: 24591 EFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHP 24650

Query: 757   ------WRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFR 810
                   +R    I A G+  Y ++    G  + + A+    +   + V+    G  +   
Sbjct: 24651 KPIVKWYRQGKEIIADGLK-YRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSV--- 24706

Query: 811   VVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKV--GEQLNLVVPFQGKP 868
                      S  A+L       E+  P KI LP+ L          GE +++ +PF GKP
Sbjct: 24707 ---------SGTASL-------EVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKP 24750

Query: 869   RPQVVWTKGGAPLDTSRVH--VRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIR 926
              P + W KG   +D +  +  + T  F ++ F     R D+G Y +  +     D  T+ 
Sbjct: 24751 DPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVE 24810

Query: 927   IRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN 986
             + V +   PP  V V +V   +  + W  P  DG S+I  Y V+K       W  V +  
Sbjct: 24811 LDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQA- 24869

Query: 987   RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNT 1024
             R T  TV +L     Y FRV  EN  GLS     S+ T
Sbjct: 24870 RETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPT 24907



 Score =  149 bits (375), Expect = 2e-35
 Identities = 110/360 (30%), Positives = 159/360 (44%), Gaps = 37/360 (10%)

Query: 268  VDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYE 327
            V  G       E+S  D+ ++W+  G++++PS K V  + GK   LT+    L D    +
Sbjct: 5902 VTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQ 5961

Query: 328  VAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTR 387
            +  KD K    LFVKEPPV    PLEDQ V  G    +  EVS E A+V W K+G E+ +
Sbjct: 5962 LTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILK 6021

Query: 388  EDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIAD 447
                  +Y    DG+   L+  D   ED   Y       +    L V    +E L+ + D
Sbjct: 6022 ----SKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTD 6077

Query: 448  LTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGD 507
            L V+  E A F+CE+S E    KW+K+G E++  K+  I   G    LVI+    +DE +
Sbjct: 6078 LQVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAE 6137

Query: 508  YTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVS 567
            Y+   +      S  L  LE +  +             + + SE   +     KL  +VS
Sbjct: 6138 YSC--EVRTARTSGMLTVLEEEAVFTKNL--------ANIEVSETDTI-----KLVCEVS 6182

Query: 568  ITGEPPPVATWLKGDEVF-------TTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKV 620
               +P     W KGDE           TEGR RI         VI++A  ED G Y  ++
Sbjct: 6183 ---KPGAEVIWYKGDEEIIETGRYEILTEGRKRI--------LVIQNAHLEDAGNYNCRL 6231



 Score =  149 bits (375), Expect = 2e-35
 Identities = 101/318 (31%), Positives = 146/318 (45%), Gaps = 14/318 (4%)

Query: 528   IKVEYVPKQEP---PKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKG-DE 583
             +K E V  +E    P + L  SG      + V AG+ +RL+  + G+P P   W K  D 
Sbjct: 11882 VKTEEVVVKEDLQKPVLDLKLSG-----VLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDA 11936

Query: 584   VFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPE 643
                T   R +I+ R D S F +  A+R D G+Y +  TN  G  VA   + V+D P P  
Sbjct: 11937 TDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVR 11996

Query: 644   AVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKM 703
              ++I  V  D   + W+PP  DGG  +  Y++E+ +     W   +  V T  T   T++
Sbjct: 11997 NLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGT-TVTRL 12055

Query: 704   IEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTT---TTLKWRPP 760
             IEG  Y  RV A N IG   P+  +KP +      +P      +VT  +    T+ W PP
Sbjct: 12056 IEGNEYIFRVRAENKIGTGPPT-ESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPP 12114

Query: 761   NRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRS 820
                G   I GY +E   + S  WVP N   +      V+NL       FRV   N  G  
Sbjct: 12115 EYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIG 12174

Query: 821   EPATLAQPVTIREIAEPP 838
             EP+  ++PV  ++  EPP
Sbjct: 12175 EPSLPSRPVVAKDPIEPP 12192



 Score =  145 bits (366), Expect = 2e-34
 Identities = 135/522 (25%), Positives = 214/522 (40%), Gaps = 46/522 (8%)

Query: 636  VDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTE 695
            +D P PP    +  VG+    L W  P +DGG  +  Y++E  K G+  W+++   V T 
Sbjct: 7676 IDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPT- 7734

Query: 696  TTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTT 752
            T +    ++EG  Y  RV AVN  G S+PS  + P +    + P S P  L V ++T  T
Sbjct: 7735 TQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNT 7794

Query: 753  TTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVV 812
              LKW  P + G   I  Y+VE      + W   +T  V+    TV  L  G+  +FRV 
Sbjct: 7795 ADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTT-VKDTKCTVTPLTEGSLYVFRVA 7853

Query: 813  GVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQ--GKPRP 870
              N  G+S+   +   V  ++    P    P  L    + K    L    P    G+P  
Sbjct: 7854 AENAIGQSDYTEIEDSVLAKDTFTTPGP--PYALAVVDVTKRHVDLKWEPPKNDGGRPIQ 7911

Query: 871  QVV----------WTKGG---APLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIE 917
            + V          W K G    P    RV       +  F VR    +  G      +I 
Sbjct: 7912 RYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEIL 7971

Query: 918  NMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTM 977
            +++D  +          PP+++ V +    +  + W+ P+ +G S I+GY V+     T 
Sbjct: 7972 SIEDPTS-------PPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTE 8024

Query: 978  EWFNVYERN-RHTSCTVSDLIVGN-EYYFRVYTENICGLSDSPGVSKNTARILKTGITFK 1035
            +W  V  R  +     V + +V + EY  RV   N  G+S+   +S+N   + K      
Sbjct: 8025 KWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENV--VAKDPDCKP 8082

Query: 1036 PFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFL 1095
              + + HD              +V+ G   ++    R  P P V W K+  E++   +  
Sbjct: 8083 TIDLETHDI-------------IVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLT 8129

Query: 1096 ITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
            + N      L + +    DAG YT    N+LG A A   ++V
Sbjct: 8130 MKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKV 8171



 Score =  137 bits (345), Expect = 6e-32
 Identities = 141/569 (24%), Positives = 234/569 (41%), Gaps = 50/569 (8%)

Query: 68   DAVVVAKVNGKELPDKPTIKWFKGKWL----ELGSKSG--ARFSFKESHNSASNVY---T 118
            + V  A+V GK+   +  +   + K++    +   K G  A F  + SH     V+    
Sbjct: 5246 EGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKND 5305

Query: 119  VELHIGKVVL--GDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLESFKRTSEKKS 176
             +LH  + VL   +   ++LE+K     D       V+     A  + LE+    + K  
Sbjct: 5306 AKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLH 5365

Query: 177  D-TAGELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGI 235
            D TA E D   L  K EV ++   K  KD +++   P+      G ++    K A     
Sbjct: 5366 DKTAVEKDEITL--KCEVSKDVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKA----- 5418

Query: 236  TDLRGMLKRL-----KKAKVEVKKSAAFTKKLDPAYQVDR--GNKIKLMVEISDPDLTLK 288
             DL+   + +      K K  V   A   K   P Y V+   G      +E+S+PD+  +
Sbjct: 5419 -DLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEPDVHGQ 5477

Query: 289  WFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLI 348
            W   GQ +  S        GKK IL ++ C L           + K    L VKE P++ 
Sbjct: 5478 WKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLIF 5537

Query: 349  VTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIF 408
            +TPL D +VF  D  +   EVS E     W+K   E+T +D    R+   KDG +H ++ 
Sbjct: 5538 ITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDD----RFELIKDGTKHSMVI 5593

Query: 409  SDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVT 468
                 ED  +Y           +LI+E  +L+ L  + D+T K  E AVF  E+S + + 
Sbjct: 5594 KSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIR 5653

Query: 469  GKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEI 528
             KW+KN   +  ++ +++   G+ H +   D+  +D        +   +S  AKL  LE 
Sbjct: 5654 VKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRV--EAMGMSSEAKLTVLEG 5711

Query: 529  KVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTT 588
               +  K +      D +G   +  I         L   I+    PV  +  G E+  + 
Sbjct: 5712 DPYFTGKLQ------DYTGVEKDEVI---------LQCEISKADAPVKWFKDGKEIKPSK 5756

Query: 589  EGRTRIEKRVDCSSFVIESAQREDEGRYT 617
                + + +      +++ A + D G+YT
Sbjct: 5757 NAVIKADGKK--RMLILKKALKSDIGQYT 5783



 Score =  136 bits (342), Expect = 1e-31
 Identities = 97/354 (27%), Positives = 155/354 (43%), Gaps = 30/354 (8%)

Query: 551   ENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQR 610
             ++ IVV AG    L+  I G+P P   W K  +    T  R  I+  +  ++ V++   R
Sbjct: 18409 KDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIR 18468

Query: 611   EDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEA-VRITSVGEDWAILVWEPPMYDGGKP 669
              D G+Y +K++N  G     I ++V+D P PPE  +++T V  +   L W PP+ DGG  
Sbjct: 18469 TDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGAN 18528

Query: 670   VTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMN-- 727
             ++ Y++E+++     W +++ EV     Y+ TK++ G  Y  RV AVN  G+ +P  +  
Sbjct: 18529 ISHYIIEKRETSRLSWTQVSTEV-QALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESGP 18587

Query: 728   ---TKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWV 784
                  P+ P  P S P    V  +T  +  + W  P   G   I+GY++E   +    W 
Sbjct: 18588 VTACNPYKPPGPPSTPE---VSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWT 18644

Query: 785   PANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPR 844
               N + +      V  L  G    FRV   N AG  EP+  +      +   PP      
Sbjct: 18645 KCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPP------ 18698

Query: 845   HLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTK----GGAPLDTSRVHVRTSDFD 894
                       G   N  V    +    + W+K    GGAP+    V V+ +  D
Sbjct: 18699 ----------GPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAAD 18742



 Score =  134 bits (338), Expect = 4e-31
 Identities = 118/428 (27%), Positives = 186/428 (43%), Gaps = 39/428 (9%)

Query: 430   AELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKW----YKNGVEV-RPSKRI 484
             +E +V  + + V +   DL VK         EV+   VT  W    Y  G E+       
Sbjct: 10400 SEALVIREPITVPERPEDLEVK---------EVTKNTVTLTWNPPKYDGGSEIINYVLES 10450

Query: 485   TISHVGRFHKLVIDD-------VRPEDEGD-YTFVPDGYALSLSAKLNFLEIKVEYVPKQ 536
              +    +FHK+  D+       V+   EGD Y +      +    K +F    +    + 
Sbjct: 10451 RLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDEL 10510

Query: 537   EPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEK 596
              PP +HLD   K     + +  G    L    +G+P P  +W K DE     + RT I+ 
Sbjct: 10511 APPTLHLDFRDK-----LTIRVGEAFALTGRYSGKPKPKVSWFK-DEADVLEDDRTHIKT 10564

Query: 597   RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEA-VRITSVGEDWA 655
                  +     A+R D G+Y + V N  G       + VVD P PP   V    V +D+ 
Sbjct: 10565 TPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYM 10624

Query: 656   ILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFA 715
             ++ W+PP+ DGG  +T Y++E+K+ G   WM +      +TT + +K++EG  Y  R+ A
Sbjct: 10625 VISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVT-SASAKTTCKVSKLLEGKDYIFRIHA 10683

Query: 716   VNAIGVSQP----SMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGY 771
              N  G+S P    SM  K    +     P   IV +VT  +  + W  P+  G   I  Y
Sbjct: 10684 ENLYGISDPLVSDSMKAKDRFRV--PDAPDQPIVTEVTKDSALVTWNKPHD-GGKPITNY 10740

Query: 772   LVEYCLEGSEEWVPANTEPVE-RCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVT 830
             ++E     S+ W     +P+     F V +L  G +  FRV   N  G  +P+  ++PV 
Sbjct: 10741 ILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVF 10800

Query: 831   IRE-IAEP 837
              ++ IA+P
Sbjct: 10801 AKDPIAKP 10808



 Score =  130 bits (326), Expect = 9e-30
 Identities = 119/457 (26%), Positives = 183/457 (40%), Gaps = 38/457 (8%)

Query: 470   KWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIK 529
             KW K G ++  SKR  I+      +LVI +    D G Y  V +        K  +++++
Sbjct: 23864 KWTKEGQDI--SKRAMIATSETHTELVIKEADRGDSGTYDLVLEN---KCGKKAVYIKVR 23918

Query: 530   VEYVPKQEPPKIHLDC----SGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVF 585
             V   P      +  D     S + S        G  + L   +     P A W       
Sbjct: 23919 VIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADI-LGYILERREVPKAAWYT----- 23972

Query: 586   TTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTN------PVGEDVASIFLQVVDVP 639
                     I+ RV  +S V++  +   E  + +   N      P+  +        ++ P
Sbjct: 23973 --------IDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPP 24024

Query: 640   DPPE-AVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTY 698
             +PP     +  V +    L W  P  DGG  VTGY +ERK+  + +W++ N    T T Y
Sbjct: 24025 EPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMY 24084

Query: 699   ESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTL 755
               T ++    Y+ R+ A N +G+S+ S  ++P +   P    S+P  L +  ++  + TL
Sbjct: 24085 TVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTL 24144

Query: 756   KWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVN 815
             +W  P   G   I GY VEY   G   W  +N E ++   FT+  L       FRV   N
Sbjct: 24145 QWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAEN 24204

Query: 816   IAGRSEPATLAQPV-TIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVW 874
               G S P   A  + T     E P IR      +    K+GE   L     G+P P + W
Sbjct: 24205 ETGLSRPRRTAMSIKTKLTSGEAPGIRKE---MKDVTTKLGEAAQLSCQIVGRPLPDIKW 24261

Query: 875   TKGGAPLDTSRVHVRTSDFDT-VFFVRQAARSDSGEY 910
              + G  L  SR +  +SD  T    V    + D G Y
Sbjct: 24262 YRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVY 24298



 Score =  126 bits (316), Expect = 1e-28
 Identities = 97/360 (26%), Positives = 157/360 (43%), Gaps = 24/360 (6%)

Query: 258  FTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINK 317
            FT KL     V++ +++ L  EIS  D  +KWFK+G+EIKPS   V +  GKKR+L + K
Sbjct: 5715 FTGKLQDYTGVEK-DEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKK 5773

Query: 318  CTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVM 377
               +D   Y      +K   +L +++  + +V PL   +V   +      E+SE+     
Sbjct: 5774 ALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLHSVEVMETETARFETEISEDDIHAN 5833

Query: 378  WMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEK 437
            W   G  L +    +     K++GK H L+  +   +  G         +  A L V+ +
Sbjct: 5834 WKLKGEALLQTPDCE----IKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPR 5889

Query: 438  QLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVI 497
             + +L+ + D+TV A E A F CE+S E +  +WY  G ++ PS ++     G+ H L +
Sbjct: 5890 VIGLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTL 5949

Query: 498  DDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVV 557
             DV+ ED G+       +     A L   E  VE+    E   +         E A  V 
Sbjct: 5950 RDVKLEDAGEVQLTAKDF--KTHANLFVKEPPVEFTKPLEDQTV--------EEGATAV- 5998

Query: 558  AGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYT 617
                  L+  ++ E   V  +  G E+  + +     + RV     VI     ED   YT
Sbjct: 5999 ------LECEVSRENAKVKWFKNGTEILKSKKYEIVADGRV--RKLVIHDCTPEDIKTYT 6050



 Score =  126 bits (316), Expect = 1e-28
 Identities = 95/335 (28%), Positives = 146/335 (43%), Gaps = 33/335 (9%)

Query: 526  LEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVF 585
            L + V     + PP I L  S +   + I V AG  + +   +TG P P   W K + V 
Sbjct: 9077 LPLNVVIQDDEVPPTIKLRLSVRG--DTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVI 9134

Query: 586  T--------TTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVD 637
                     T E  +R E + + S   I  A RED+G YT+  +N +G    ++ ++V D
Sbjct: 9135 EKPTDALQITKEEVSRSEAKTELS---IPKAVREDKGTYTVTASNRLGSVFRNVHVEVYD 9191

Query: 638  VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETT 697
             P PP  + +T +  +   L W+ P+ +GG  +T Y+++++    +   K  +E  T T 
Sbjct: 9192 RPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRK---KAEWEEVTNTA 9248

Query: 698  YEST----KMIEGILYEMRVFAVNAIGVSQPSMNTK-----PFMPIAPTSEPLHLIVEDV 748
             E      K+I    YE RV AVN  G+S    + K     P+    P  +P  L     
Sbjct: 9249 VEKRYGIWKLIPNGQYEFRVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLA---R 9305

Query: 749  TDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCG-----FTVKNLPT 803
            T  +  + W PP   G   I GY +E   EGS  W   +  P+ + G     F V  L  
Sbjct: 9306 TKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLE 9365

Query: 804  GARILFRVVGVNIAGRSEPATLAQPVTIREIAEPP 838
            G +  FR + +N AG   P+  + P    +   PP
Sbjct: 9366 GVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPP 9400



 Score =  125 bits (313), Expect = 3e-28
 Identities = 224/1082 (20%), Positives = 389/1082 (35%), Gaps = 140/1082 (12%)

Query: 90   KGKWLELGSKSGARFSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGF 149
            KG+WL    + G       +  S S+ +   L I    L D G Y  +V    T      
Sbjct: 2603 KGEWL----RDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKT----SA 2654

Query: 150  NIDVEAPRQDASGQSLESFKRTSEKKSDTAGELDFSGL-----LKKREVVEEEKKKKKKD 204
             + VEA +     ++L++   T  + +    EL    +     +K   V+E  +K     
Sbjct: 2655 KLKVEAVKIK---KTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYA--- 2708

Query: 205  DDDLGIPPEIWEL-LKGAKKSEYEKIAFQYGITDLRGMLKRLKKAKVEVKKSAAFTKKLD 263
               + +   I+ L +K     +     F+ G     G   RL    V++ K       L+
Sbjct: 2709 ---ISVKGTIYSLRIKNCAIVDESVYGFRLGRL---GASARLHVETVKIIKKPKDVTALE 2762

Query: 264  PAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADD 323
             A        +   V +S   + +KWF    EIKPS K+   +  K   L +   + +D 
Sbjct: 2763 NA-------TVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDA 2815

Query: 324  AAYEVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGV 383
              Y   V   +C  +LFV+   + I   +++ +V          EVS      MW+K+GV
Sbjct: 2816 GEYTAVVGQLECKAKLFVET--LHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGV 2873

Query: 384  ELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQ 443
            E+   + FK   +    GK H LI  +   ED   Y  +    Q  A L V    + +  
Sbjct: 2874 EIEMSEKFKIVVQ----GKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTP--IMITS 2927

Query: 444  DIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPE 503
             + D+  +  +   F+  V+ E ++ KW KNGVE++ + +  +      H L I +V   
Sbjct: 2928 MLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFG 2987

Query: 504  DEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLR 563
            D  DYTFV  G A S +     L ++  ++  ++  K             I V+   +  
Sbjct: 2988 DAADYTFVA-GKATSTAT----LYVEARHIEFRKHIK------------DIKVLEKKRAM 3030

Query: 564  LDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNP 623
             +  ++ EP     W+K D+    T+ R +I+K       +I S +  D G+YT+     
Sbjct: 3031 FECEVS-EPDITVQWMKDDQELQITD-RIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGN 3088

Query: 624  VGEDVASIFLQ-----------VVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTG 672
            V    A +F++            V V +   AV    V ED     W    Y  G  +  
Sbjct: 3089 VS--TAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHW----YKDGIEINF 3142

Query: 673  YLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM 732
             + ER K   +R +   F   +ET          +    R      +   +P    +   
Sbjct: 3143 QVQERHKYVVERRIHRMF--ISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQ 3200

Query: 733  PIAPTS-EPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPV 791
            P+   S +P              + W    ++ +    G+  ++  +G E  +       
Sbjct: 3201 PVTVQSGKPARFCAVISGRPQPKISWYKEEQLLS---TGFKCKFLHDGQEYTL------- 3250

Query: 792  ERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYI 851
                  ++  P  A +       +    +  A+L+         E P++  P      Y 
Sbjct: 3251 ----LLIEAFPEDAAVYTCEAKNDYGVATTSASLS--------VEVPEVVSPDQEMPVYP 3298

Query: 852  RKVGEQLNLVVPFQGKPRP----------QVVWTKGGAPLDTSRVHVRTSDFDTVFF-VR 900
              +   L   V  +G+P            +V W      +  SR    T   DT    + 
Sbjct: 3299 PAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIA 3358

Query: 901  QAARSDSGEYEL--SVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKD 958
            +A   D G Y    S  +  +  TA + + V           V+E   + A+ +    K+
Sbjct: 3359 EAYPEDEGTYTFVASNAVGQVSSTANLSLEVQALDRQSSGKDVRESAKSQAVADSSFTKE 3418

Query: 959  DGN---SEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLS 1015
            +      EI  +     + +   + +V + + HT+ +V D  +        +T ++  ++
Sbjct: 3419 ESKISQKEIKSFQGSSYEYEVQVFESVSQSSIHTAASVQDTQL-------CHTASLSQIA 3471

Query: 1016 DSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHP 1075
            +S  +SK  A+   TG               APK    L D  V  G +A   C ++   
Sbjct: 3472 ESTELSKECAKE-STG--------------EAPKIFLHLQDVTVKCGDTAQFLCVLKDDS 3516

Query: 1076 KPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKL 1135
               V W     +I E  +   +    +  L I      D G Y+C   N+ GE      L
Sbjct: 3517 FIDVTWTHEGAKIEESERLKQSQNGNIQFLTICNVQLVDQGLYSCIVHNDCGERTTSAVL 3576

Query: 1136 EV 1137
             V
Sbjct: 3577 SV 3578



 Score =  124 bits (310), Expect = 7e-28
 Identities = 96/374 (25%), Positives = 160/374 (42%), Gaps = 24/374 (6%)

Query: 267  QVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
            QV      +   E+S  +  +KWFK+G EIK   KY   + G  RIL INKC L D+A Y
Sbjct: 6079 QVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEY 6138

Query: 327  EVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELT 386
               V+  +    L V E   +    L + +V   D +++  EVS+ GA+V+W K   E+ 
Sbjct: 6139 SCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEII 6198

Query: 387  REDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIA 446
                   RY    +G++ IL+  +   ED G Y       + + ++ V E   E +    
Sbjct: 6199 E----TGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQ 6254

Query: 447  DLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG 506
            +L +   E+A F C +S E    +W ++   +    +  +   G+   LV+ D   +D G
Sbjct: 6255 NLEILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMG 6314

Query: 507  DYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDV 566
             Y  +    A   +A L  +E     VP ++          +  E   VV        +V
Sbjct: 6315 TYVVMVG--AARAAAHLTVIEKLRIVVPLKDT---------RVKEQQEVV-----FNCEV 6358

Query: 567  SITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGE 626
            +  G     A W + +E    +     ++K +   +  I  A  +D+  Y + +TN  GE
Sbjct: 6359 NTEGAK---AKWFRNEEAIFDSSKYIILQKDL-VYTLRIRDAHLDDQANYNVSLTNHRGE 6414

Query: 627  DVASIFLQVVDVPD 640
            +V S    +V+  D
Sbjct: 6415 NVKSAANLIVEEED 6428



 Score =  123 bits (309), Expect = 9e-28
 Identities = 99/374 (26%), Positives = 159/374 (42%), Gaps = 25/374 (6%)

Query: 250  VEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGK 309
            V+ K+   FT++L      ++        E S+P + +KW+K+G E+    KY   +  K
Sbjct: 2122 VQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRK 2181

Query: 310  KRILTINKCTLADDAAYE-VAVKDE--KCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMA 366
               L+I     +D   Y  V V+DE  K   +L V+   V  V  L+D +V      E+ 
Sbjct: 2182 VHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELE 2241

Query: 367  VEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGG 426
              VS E  +  W  + VEL        +Y       R  L   DV +ED+G Y  + +G 
Sbjct: 2242 CIVSPENIEGKWYHNDVELKSN----GKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGK 2297

Query: 427  QCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITI 486
            +   +L ++ + + +LQ ++D  V   +    + +VS E V G W K+G EV+PS R+ I
Sbjct: 2298 KTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHI 2357

Query: 487  SHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCS 546
                + H L+I+D+  ED G+Y+F      LS S +++   + V                
Sbjct: 2358 VIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDV---------------- 2401

Query: 547  GKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIE 606
              T    + V+ G K  L+  ++        W   DE     +    I K       VI 
Sbjct: 2402 -ITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTK-QRLVIN 2459

Query: 607  SAQREDEGRYTIKV 620
                 DEG Y + V
Sbjct: 2460 RTHASDEGPYKLIV 2473



 Score =  121 bits (303), Expect = 4e-27
 Identities = 99/330 (30%), Positives = 138/330 (41%), Gaps = 46/330 (13%)

Query: 553  AIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTR------------------- 593
            ++ V  G+++ LD SI+G P P  TW+K + V    E + R                   
Sbjct: 8383 SLEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFV 8442

Query: 594  --IEKRVDC-------SSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPP-- 642
              + +R+         S   +  + R D G Y IKV N  G   A   + V+D P PP  
Sbjct: 8443 LPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPIN 8502

Query: 643  ---EAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVER--KKKGSQRWMKLNFEVFTETT 697
               E +R TSV     +  WEPP+ DGG  +  Y +E+  K K    W+ +         
Sbjct: 8503 FVFEDIRKTSV-----LCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVT-STLRHCK 8556

Query: 698  YESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTT 754
            Y  TK+IEG  Y  RV A N  G   P + +KP +   P  P   P   IVEDVT  +  
Sbjct: 8557 YSVTKLIEGKEYLFRVRAENRFGPGPPCV-SKPLVAKDPFGPPDAPDKPIVEDVTSNSML 8615

Query: 755  LKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGV 814
            +KW  P   G+  I GY +E     S  W   N   +      V  L  G   +FRV   
Sbjct: 8616 VKWNEPKDNGS-PILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAE 8674

Query: 815  NIAGRSEPATLAQPVTIREIAEPPKIRLPR 844
            N AG  + +  + P T  +   PP   +PR
Sbjct: 8675 NAAGPGKFSPPSDPKTAHDPISPPGPPIPR 8704



 Score =  120 bits (302), Expect = 6e-27
 Identities = 88/295 (29%), Positives = 136/295 (46%), Gaps = 15/295 (5%)

Query: 558   AGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYT 617
             AG  ++L   I+G+P P   W K D+   T      +E   D +S +I+ A R + G Y 
Sbjct: 20581 AGTSVKLRAGISGKPAPTIEWYKDDKELQTN-ALVCVENTTDLASILIKDADRLNSGCYE 20639

Query: 618   IKVTNPVGEDVASIFLQVVDVPDPPEA-VRITSVGEDWAILVWEPPMYDGGKPVTGYLVE 676
             +K+ N +G   A+I +Q++D P PP   +   +V  +   L+W PP  DGG  +T Y+VE
Sbjct: 20640 LKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVE 20699

Query: 677   RKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQP-----SMNTKPF 731
             +++     W  ++ E   E    +TK+I+G  Y  RV AVN  G+ +P      +    F
Sbjct: 20700 KRETSRVVWSMVS-EHLEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAF 20758

Query: 732   MPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPV 791
             +   P   P    V  +T  + T+ W  P   G   I GY +E   + S  W     E +
Sbjct: 20759 VTPGPPGIP---EVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETI 20815

Query: 792   ERCGFTVKNLPTGARILFRVVGVNIAGR---SEPATLAQPVTIREIAEPP-KIRL 842
                   V  L   +   +RV  VN AG+   SEP+   +     +   PP KIR+
Sbjct: 20816 RDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRI 20870



 Score =  120 bits (300), Expect = 1e-26
 Identities = 87/326 (26%), Positives = 140/326 (42%), Gaps = 29/326 (8%)

Query: 523   LNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGD 582
             L+ +  K  +VP   P ++ +  +G+    A    AG+KLR    +T             
Sbjct: 23435 LSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVT------------- 23481

Query: 583   EVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPP 642
                        +E     +   I      D G YT+++ N  G    +I + ++D P PP
Sbjct: 23482 -----------VETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPP 23530

Query: 643   EA-VRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYEST 701
                ++I  +      + WEPP  DGG P++GY+VE++      W+ ++ E  T +T++ T
Sbjct: 23531 TGPIKIDEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVS-ESVTRSTFKFT 23589

Query: 702   KMIEGILYEMRVFAVNAIGVSQ--PSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRP 759
             ++ EG  Y  RV A N  G+     S   +    I     P  L + DV+    TL W P
Sbjct: 23590 RLTEGNEYVFRVAATNRFGIGSYLQSEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYP 23649

Query: 760   PNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGR 819
             P   G   + GY+VE     ++ WV  N  PV    +    L  G     RV  +N  G 
Sbjct: 23650 PEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGS 23709

Query: 820   SEPATLAQPVTIRE-IAEPPKIRLPR 844
              +P+  ++P+   + IA P K + PR
Sbjct: 23710 GKPSRPSKPIVAMDPIAPPGKPQNPR 23735



 Score =  117 bits (294), Expect = 5e-26
 Identities = 129/529 (24%), Positives = 197/529 (37%), Gaps = 82/529 (15%)

Query: 636   VDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTE 695
             V +P PP   +I   G+    + W  P++DGG P+TGY VE KK     W K + +    
Sbjct: 19776 VFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDW-KTSIQSLRG 19834

Query: 696   TTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLH---------LIVE 746
             T Y  + +  G  Y  RV +VN +G S PS ++ P +      EPL          LIV+
Sbjct: 19835 TEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVK 19894

Query: 747   DVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGAR 806
                  T T+ +R           G  V   L     W   +T+   R      +  T   
Sbjct: 19895 AGASFTMTVPFR-----------GRPVPNVL-----WSKPDTDLRTRAYVDTTDSRTSLT 19938

Query: 807   ILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQG 866
             I         A R++       +TI+ +     + L   +  T     G   N+ V    
Sbjct: 19939 I-------ENANRNDSGKYT--LTIQNVLSAASLTLVVKVLDT----PGPPTNITVQDVT 19985

Query: 867   KPRPQVVW----TKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDT 922
             K    + W      GGAP+    +  R +       V            LS ++ N+++ 
Sbjct: 19986 KESAVLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCN------RLSYKVTNLQEG 20039

Query: 923   ATIRIRV--------------------VEKAGPPINVMVKEVWGTNALVEWQAPKDDGNS 962
             A    RV                     EK  PP  + V  +   +  + W  P+ DG S
Sbjct: 20040 AIYYFRVSGENEFGVGIPAETKEGVKITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGS 20099

Query: 963   EIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSK 1022
              I+ Y V+  +K    W       + T   VS L   +EY+FRV+ EN  GLSD      
Sbjct: 20100 RIVHYVVEALEKGQKNWVKCAVA-KSTHHVVSGLRENSEYFFRVFAENQAGLSDP----- 20153

Query: 1023  NTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWM 1082
                 +L   +  +  E  E D +  P          V AG +  ++  + G P PKV   
Sbjct: 20154 --RELLLPVLIKEQLEPPEIDMKNFPSHTV-----YVRAGSNLKVDIPISGKPLPKVTLS 20206

Query: 1083  KNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALA 1131
             ++ + ++   +F        LT+N++     DAG Y   A N  G   A
Sbjct: 20207 RDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKA 20255



 Score =  117 bits (293), Expect = 6e-26
 Identities = 130/526 (24%), Positives = 205/526 (38%), Gaps = 68/526 (12%)

Query: 639   PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNF--EVFTET 696
             P  PEA+  T    D   L W+PP +DGG  + GY+VE +K G + W + N   E   ET
Sbjct: 10811 PVNPEAIDTTCNSVD---LTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPET 10867

Query: 697   TYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLK 756
              Y+ T + +G  Y+ RV AVNA G S P+   +P + +    EP  LI++        +K
Sbjct: 10868 KYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVL-VKDRLEPPELILDANMAREQHIK 10926

Query: 757   WRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFR------ 810
                  R+ A      +++        W   + +   +    V   P G+++  R      
Sbjct: 10927 VGDTLRLSA------IIKGVPFPKVTWKKEDRDAPTKARIDVT--PVGSKLEIRNAAHED 10978

Query: 811   --VVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPF---- 864
               +  + +   +   T++  V + +   PP     R L  + IRK    L    P     
Sbjct: 10979 GGIYSLTVENPAGSKTVSVKVLVLDKPGPP-----RDLEVSEIRKDSCYLTWKEPLDDGG 11033

Query: 865   --------QGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQI 916
                     + +      W+   A         +  +    +  R AA +  G       +
Sbjct: 11034 SVITNYVVERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPF---V 11090

Query: 917   ENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKT 976
             E  K    +    +   GPP ++   +V  T   + W  P  DG S I GY V+  ++ T
Sbjct: 11091 ETPKPIKALD--PLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGT 11148

Query: 977   MEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKP 1036
              +W   ++   +  C V+ L  G  Y FRV  ENI GL    G+   T           P
Sbjct: 11149 QDWIK-FKTVTNLECVVTGLQQGKTYRFRVKAENIVGL----GLPDTTI----------P 11193

Query: 1037  FEYKEHDFRMAPKFLTPLIDRVVV-AGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFL 1095
              E +E     + +    LI+ +VV AG +      +RG P P   W  +  EI+ D  + 
Sbjct: 11194 IECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYT 11253

Query: 1096  I--TNYQGVLTLN--IRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
             +   N+  VLT+   +RR    D G Y     N  G       L V
Sbjct: 11254 VETDNFSSVLTIKNCLRR----DTGEYQITVSNAAGSKTVAVHLTV 11295



 Score =  117 bits (293), Expect = 6e-26
 Identities = 82/297 (27%), Positives = 135/297 (45%), Gaps = 18/297 (6%)

Query: 552   NAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQRE 611
             + +++ +G  LR+   + G P P  TW K D V         I   +  +S  +  A R+
Sbjct: 21661 DGLIIKSGESLRIKALVQGRPVPRVTWFK-DGVEIEKRMNMEITDVLGSTSLFVRDATRD 21719

Query: 612   DEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEA-VRITSVGEDWAILVWEPPMYDGGKPV 670
               G YT++  N  G   A I ++V D P      +R T++  +   L W+ P+ DG  P+
Sbjct: 21720 HRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPI 21779

Query: 671   TGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKP 730
             T Y++E+++     W  +  +   + +Y + K+I G  Y+ RV AVN  GV +P +++ P
Sbjct: 21780 THYIIEKRETSRLAWALIEDKCEAQ-SYTAIKLINGNEYQFRVSAVNKFGVGRP-LDSDP 21837

Query: 731   F-------MPIAP-TSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEE 782
                     +P AP   EP      ++T  + TL W  P   G   I  Y++E   + S  
Sbjct: 21838 VVAQIQYTVPDAPGIPEP-----SNITGNSITLTWARPESDGGSEIQQYILERREKKSTR 21892

Query: 783   WVPA-NTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPP 838
             WV   +  P+    F V  L  G    F V+  N AG    + +++ +  RE   PP
Sbjct: 21893 WVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPP 21949



 Score =  117 bits (292), Expect = 8e-26
 Identities = 112/425 (26%), Positives = 166/425 (39%), Gaps = 46/425 (10%)

Query: 729   KPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANT 788
             KP +P  P         ++VT    TLKW PP   G   I  Y++E     + +WV    
Sbjct: 13770 KPGIPTGPIK------FDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTC-A 13822

Query: 789   EPVERCGFTVKNLPTGARILFRVVGVNIAG-----RSEPATLAQPVTIREIAEPPKIRLP 843
               V++  F V  L  G    FRV   N  G     +SEP     P  + +   PP I   
Sbjct: 13823 SAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIVDV 13882

Query: 844   RH----LRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFV 899
             RH    L  T  +K G         + K R  ++W +       ++  +R  DF      
Sbjct: 13883 RHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRA------NKTPIRMRDF------ 13930

Query: 900   RQAARSDSGEYELSVQIENMKDTA-----TIRIRVVEKAGPPINVMVKEVWGTNALVEWQ 954
             +    ++  EYE  V   N+         +  +  ++   PP    V  +   +  + W 
Sbjct: 13931 KVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITRNSVTLIWT 13990

Query: 955   APKDDGNSEIMGYFVQKADKKTMEWFNVYERN-RHTSCTVSDLIVGNEYYFRVYTENICG 1013
              PK DG  ++ GY V+K D  +  W      N    + TV+DL+ G +Y FR+  +N  G
Sbjct: 13991 EPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAG 14050

Query: 1014  LSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNC-AVR 1072
                +P  S  T  I K        EY+     + P     L    + AG +  LN  ++ 
Sbjct: 14051 AISAPSESTETI-ICKD-------EYEAPTIVLDPTIKDGL---TIKAGDTIVLNAISIL 14099

Query: 1073  GHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAE 1132
             G P PK  W K   +IR      IT+      L I+  +  DAG YT  A N  G  +  
Sbjct: 14100 GKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEH 14159

Query: 1133  CKLEV 1137
              K+ V
Sbjct: 14160 VKVTV 14164



 Score =  115 bits (287), Expect = 3e-25
 Identities = 132/509 (25%), Positives = 215/509 (42%), Gaps = 64/509 (12%)

Query: 159  DASGQSLESFKRTSEK---KSDTAGELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPEIW 215
            + S +    FKR +E+   ++ TA EL      +K++   EE  +K KD        E+ 
Sbjct: 1946 EESEELRSKFKRRTEEGYYEAITAVELKS----RKKDESYEELLRKTKD--------ELL 1993

Query: 216  ELLKGAKKSEYEKIAFQYGITDLRGMLKRLKKAKVEVKKSAAFTKKLD--PAYQVDRGNK 273
               K   + E + +A +  IT     +   K  K+E+  S    K  +   +  V +G+ 
Sbjct: 1994 HWTKELTEEEKKALAEEGKIT-----IPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSD 2048

Query: 274  IKLMVEI-SDPDLTLKWFKNGQEIKPSSKYVF----ENVGKKRILTINKCTLADDAAYEV 328
                V +   PD   +W+KNG +I+ S +  +    +NV +   L I   T  D A+  V
Sbjct: 2049 AHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCE---LVIRDVTAEDSASIMV 2105

Query: 329  A---VKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAV---EVSEEGAQVMWMKDG 382
                +  E       + +   LI    E Q V   ++  MA    E SE   +V W KDG
Sbjct: 2106 KAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDG 2165

Query: 383  VELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVI---TNGGQCEAELIVEEKQL 439
            +E+   D    +YR   D K H L    +   D   Y  +       +  A+LIVE   +
Sbjct: 2166 MEVHEGD----KYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVV 2221

Query: 440  EVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDD 499
            E ++++ D+ V  S     +C VS E + GKWY N VE++ + + TI+       L + D
Sbjct: 2222 EFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKD 2281

Query: 500  VRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAG 559
            V  ED+G+Y+FV DG   +   K+           K  P  I    S +       V  G
Sbjct: 2282 VTKEDQGEYSFVIDGKKTTCKLKM-----------KPRPIAILQGLSDQK------VCEG 2324

Query: 560  NKLRLDVSITGEPPPVATWLK-GDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTI 618
            + ++L+V ++ E      W+K G EV  +      I+K+      +IE   +ED G Y+ 
Sbjct: 2325 DIVQLEVKVSLESVE-GVWMKDGQEVQPSDRVHIVIDKQ--SHMLLIEDMTKEDAGNYSF 2381

Query: 619  KVTNPVGEDVASIFLQVVDVPDPPEAVRI 647
             +          + +  VDV  P + V +
Sbjct: 2382 TIPALGLSTSGRVSVYSVDVITPLKDVNV 2410



 Score =  114 bits (286), Expect = 4e-25
 Identities = 137/562 (24%), Positives = 213/562 (37%), Gaps = 62/562 (11%)

Query: 586   TTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGE-DVASIFLQVVDV---PDP 641
             T T+ R R+    +  S+    A     G         VGE    S+F +  D    P P
Sbjct: 18650 TLTDLRLRVTGLTEGHSYEFRVAAENAAG---------VGEPSEPSVFYRACDALYPPGP 18700

Query: 642   PEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTE-TTYES 700
             P   ++T        L W  P+YDGG PV GY+VE K+  +  W         +   +  
Sbjct: 18701 PSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTV 18760

Query: 701   TKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTS-EP--------LHLIVEDVTDT 751
             TK+ E   Y  R+ A+N+ GV +P+  T P   +A    EP        L  +V      
Sbjct: 18761 TKLKENTEYNFRICAINSEGVGEPA--TLPGSVVAQERIEPPEIELDADLRKVVVLRASA 18818

Query: 752   T----TTLKWRPPNRIGAGGIDGYLVEYC-LEGSEEWVPANTEPVERCGFTVKNLPTGAR 806
             T     T+K RP   +     +G L +   +E +  +     + V R      NL     
Sbjct: 18819 TLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENN 18878

Query: 807   ILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQG 866
                +   VN+     P+     +TIRE+    K  +        I    +  N +V  + 
Sbjct: 18879 SGSKTAFVNVRVLDSPSAPVN-LTIREVK---KDSVTLSWEPPLIDGGAKITNYIVEKRE 18934

Query: 867   KPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIR 926
               R             T R+          F V       S EY + +  E      T  
Sbjct: 18935 TTRKAYATITNNCTKTTFRIENLQEGCSYYFRVLA-----SNEYGIGLPAET-----TEP 18984

Query: 927   IRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN 986
             ++V E   PP  V + +V    A ++W+ P+ DG S+I GY V+   K + +W +   + 
Sbjct: 18985 VKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKW-STCTQV 19043

Query: 987   RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKP-FEYKEHDFR 1045
             +    T+S L  G EY FRV   N  G SD   +      ++   I  KP  E   H F 
Sbjct: 19044 KTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLG---VPVIARDIEIKPSVELPFHTFN 19100

Query: 1046  MAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTL 1105
                          V A     ++   +G P+  V W K+   ++E  +  +++ + V +L
Sbjct: 19101 -------------VKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSL 19147

Query: 1106  NIRRPSPFDAGTYTCRAVNELG 1127
             +I+  S  D GTY     N  G
Sbjct: 19148 SIKEASKEDVGTYELCVSNSAG 19169



 Score =  108 bits (271), Expect = 2e-23
 Identities = 107/416 (25%), Positives = 166/416 (39%), Gaps = 37/416 (8%)

Query: 735   APTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERC 794
             +P S    L  +D+   +  + WRPP   G   I GY++E        W   ++  V   
Sbjct: 23922 SPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSR-VRGT 23980

Query: 795   GFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPK--IRLPRHLRQT--- 849
                VK L       FRV   N  G S+P    +PVT +    PP+     P  L  T   
Sbjct: 23981 SLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSS 24040

Query: 850   ----YIRKVGEQLNLVVPF--QGKPRPQVVWTKGGAPLDTSRVHVRTSDF-DTVFFVRQA 902
                 + R   +  + V  +  + K      W +      T+ ++  T    D  +  R  
Sbjct: 24041 VSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRII 24100

Query: 903   ARSDSGEYELSVQIENM--KDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDG 960
             A++D G  E S   E +  KD         +K   P  + +  +   +  ++W+ P+ DG
Sbjct: 24101 AQNDVGLSETSPASEPVVCKDP-------FDKPSQPGELEILSISKDSVTLQWEKPECDG 24153

Query: 961   NSEIMGYFVQKADKKTMEWFNVY-ERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPG 1019
               EI+GY+V+        W     ER +    T+  L+   EY FRV+ EN  GLS    
Sbjct: 24154 GKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRP-- 24211

Query: 1020  VSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKV 1079
               + TA  +KT +T             AP     + D     G +A L+C + G P P +
Sbjct: 24212 --RRTAMSIKTKLTSGE----------APGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDI 24259

Query: 1080  VWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKL 1135
              W +   E+ +  K+ +++     TL +      D G YTC A NE+GE     KL
Sbjct: 24260 KWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKL 24315



 Score =  107 bits (266), Expect = 8e-23
 Identities = 121/519 (23%), Positives = 189/519 (36%), Gaps = 75/519 (14%)

Query: 639   PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNF-EVFTETT 697
             P PP   ++         L W  P YDGG P+ GYLVE K+  S  W++ N  +   +T 
Sbjct: 13284 PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTR 13343

Query: 698   YESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTT----- 752
             +E T ++E   Y+ RV+AVN IG S PS       P      P   +  D+  T      
Sbjct: 13344 FEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAG 13403

Query: 753   ------TTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGAR 806
                     +K RPP +I                   W   N    +R G  +K+      
Sbjct: 13404 VTMRLYVPVKGRPPPKI------------------TWSKPNVNLRDRIGLDIKSTDFDTF 13445

Query: 807   ILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQG 866
             +    V    AG+    TL      +E     K+          +   G  +N+ V    
Sbjct: 13446 LRCENVNKYDAGKYI-LTLENSCGKKEYTIVVKV----------LDTPGPPVNVTVKEIS 13494

Query: 867   KPRPQVVWTK----GGAPLDTSRVHVRTSDFDTVFFV---------RQAARSDSGEYELS 913
             K    V W      GG+P+    V  R ++  +   V         R A   +   Y   
Sbjct: 13495 KDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFR 13554

Query: 914   VQIEN---MKDTATIR--IRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYF 968
             V  EN   + D    R  ++  +  GP +++ V+ V  ++  + W+ P  DG S I+GY 
Sbjct: 13555 VFAENEYGIGDPGETRDAVKASQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYV 13614

Query: 969   VQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARIL 1028
             V    ++  +W  V  ++     +  DL  G EY FRV  EN     +  G       + 
Sbjct: 13615 VDFLTEEN-KWQRVM-KSLSLQYSAKDLTEGKEYTFRVSAEN----ENGEGTPSEITVVA 13668

Query: 1029  KTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEI 1088
             +  +     + K            P +  +     +  L   ++G P P V W K +  +
Sbjct: 13669 RDDVVAPDLDLKG----------LPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPL 13718

Query: 1089  REDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELG 1127
               D +  + +     TL +      DAG YT    N  G
Sbjct: 13719 ATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAG 13757



 Score =  107 bits (266), Expect = 8e-23
 Identities = 108/487 (22%), Positives = 190/487 (39%), Gaps = 42/487 (8%)

Query: 667   GKPVTGYLVERKKKGSQRWMKLNFEVFTET-TYESTKMIEGILYEMRVFAVNAIGVSQPS 725
             GKP+    + R     +  M+ N E+  E  T    + +        + A N+ G ++  
Sbjct: 20197 GKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAF 20256

Query: 726   MNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVP 785
             +N        P + P+  ++ D+T+ + TLKW PP   G   +  Y++      +  W  
Sbjct: 20257 INIVVLDRPGPPTGPV--VISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTE 20314

Query: 786   ANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIR---EIAEPPKIRL 842
              +   V R    V  L TG    FR+   N  G S+    A  VT++       PP    
Sbjct: 20315 VSAT-VARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSAC-VTVKLPYTTPGPPSTPW 20372

Query: 843   PRHLRQTYI-----RKVGEQLNLVVPF--QGKPRPQVVWTKGGA-PLDTSRVHVRTSDFD 894
               ++ +  I       V    + VV +  + K R  ++W K     + T+   V T    
Sbjct: 20373 VTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAG 20432

Query: 895   TVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQ 954
              ++  R  A + +G  + S   E         +  ++   PP NV + ++   +  + WQ
Sbjct: 20433 LIYEFRVYAENAAGVGKPSHPSEP--------VLAIDACEPPRNVRITDISKNSVSLSWQ 20484

Query: 955   APKDDGNSEIMGYFVQKADKKTMEWFNVYERN-RHTSCTVSDLIVGNEYYFRVYTENICG 1013
              P  DG S+I GY V++ D     W      N   T   +S L   ++Y FRV+  N  G
Sbjct: 20485 QPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVG 20544

Query: 1014  LSDSPGVSKNTARILKT---GITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCA 1070
                +P         + +    +   P EY E       K+          AG S  L   
Sbjct: 20545 SISNPSEVVGPITCIDSYGGPVIDLPLEYTE-----VVKYR---------AGTSVKLRAG 20590

Query: 1071  VRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEAL 1130
             + G P P + W K+  E++ +    + N   + ++ I+     ++G Y  +  N +G A 
Sbjct: 20591 ISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSAS 20650

Query: 1131  AECKLEV 1137
             A  ++++
Sbjct: 20651 ATIRVQI 20657



 Score =  106 bits (265), Expect = 1e-22
 Identities = 114/409 (27%), Positives = 180/409 (44%), Gaps = 52/409 (12%)

Query: 279  EISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTE 338
            EIS+ D+  +W   G+ ++PS     +  G KR LT++K  L  D A EV  +     T 
Sbjct: 5114 EISEADIPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKL--DQAGEVLYQALNAITT 5171

Query: 339  --LFVKEPPVLIVTPLEDQQVFVGDRVEMAVE-VSEEGAQVMWMKDGVELTREDSFKARY 395
              L VKE  +    PL+D  V V +R +   E V    A V+W K    +   D F    
Sbjct: 5172 AILTVKEIELDFAVPLKD--VTVPERRQARFECVLTREANVIWSKGPDIIKSSDKFD--- 5226

Query: 396  RFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQ 455
                DGK+HIL+ +D   +D G Y     G +  A L V   +L+ +  + D TVK  E 
Sbjct: 5227 -IIADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVKEGET 5285

Query: 456  AVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGY 515
            A F CE+S EK+   W+KN  ++  S+ + IS  G+ HKL + +V  +D           
Sbjct: 5286 ATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQ--IKAQVK 5343

Query: 516  ALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPV 575
             LS +A+L  LE           P   +    KT+      V  +++ L   ++ + P  
Sbjct: 5344 ELSSTAQLKVLE---------ADPYFTVKLHDKTA------VEKDEITLKCEVSKDVP-- 5386

Query: 576  ATWLK-GDEVFTT------TEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDV 628
              W K G+E+  +       +G  RI K        I+ A  +D+G Y         +  
Sbjct: 5387 VKWFKDGEEIVPSPKYSIKADGLRRILK--------IKKADLKDKGEYVCDCGTDKTKAN 5438

Query: 629  ASIFLQVVDVPDPPEAVRITSVGE--DWAILVWEPPMYD----GGKPVT 671
             ++  +++ V  P   V +  VGE   + I + EP ++      G+P+T
Sbjct: 5439 VTVEARLIKVEKPLYGVEV-FVGETAHFEIELSEPDVHGQWKLKGQPLT 5486



 Score =  103 bits (256), Expect = 1e-21
 Identities = 109/405 (26%), Positives = 177/405 (43%), Gaps = 35/405 (8%)

Query: 249  KVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVG 308
            KV+V + AA         ++  G K + +  IS     ++W ++ + ++   KY     G
Sbjct: 6239 KVKVHELAAEFISKPQNLEILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIADG 6298

Query: 309  KKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVE 368
            KKR+L +   TL D   Y V V   +    L V E  + IV PL+D +V     V    E
Sbjct: 6299 KKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIE-KLRIVVPLKDTRVKEQQEVVFNCE 6357

Query: 369  VSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQV-ITN--- 424
            V+ EGA+  W ++  E    DS  ++Y   +    + L   D   +D+  Y V +TN   
Sbjct: 6358 VNTEGAKAKWFRN--EEAIFDS--SKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRG 6413

Query: 425  -GGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKR 483
               +  A LIVEE+ L +++ + D+     +   F C+V+   VT KW KNG EV    R
Sbjct: 6414 ENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNR 6473

Query: 484  ITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHL 543
            ++       H L I D    DEG+Y  V  G   S+ A+L  +E   E+V        HL
Sbjct: 6474 VSYRVDKYKHMLTIKDCGFPDEGEY-IVTAGQDKSV-AELLIIEAPTEFVE-------HL 6524

Query: 544  DCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRT-RIEKRVDCSS 602
            +    T  +  V            ++ E   V  +  G E+    EG+  + EK      
Sbjct: 6525 EDQTVTEFDDAV--------FSCQLSREKANVKWYRNGREI---KEGKKYKFEKDGSIHR 6573

Query: 603  FVIESAQREDEGRYTIKVTNPVGEDVASIFLQ--VVDVPDPPEAV 645
             +I+  + +DE  Y   V +   +  A +F++   V++  PP+ +
Sbjct: 6574 LIIKDCRLDDECEYACGVED--RKSRARLFVEEIPVEIIRPPQDI 6616



 Score =  102 bits (254), Expect = 2e-21
 Identities = 114/516 (22%), Positives = 191/516 (37%), Gaps = 76/516 (14%)

Query: 636   VDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTE 695
             +D P PP  +RI    +    L W  P+YDGG  VTGY+VE ++   + W  ++ +    
Sbjct: 20859 IDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVR 20918

Query: 696   TT-YESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMP-------------------IA 735
             TT Y  + +  G+ Y  RV AVN  G  +P    +P                      IA
Sbjct: 20919 TTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIA 20978

Query: 736   PTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTE-PVERC 794
                E + +++        T+ WR   +   G    Y +E     S   +P  T     + 
Sbjct: 20979 KAGEDVQVLIPFKGRPPPTVTWRKDEK-NLGSDARYSIENTDSSSLLTIPQVTRNDTGKY 21037

Query: 795   GFTVKN---LPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYI 851
               T++N    P  + +  +V+    A +          T+  + +PP I     +    I
Sbjct: 21038 ILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVI 21097

Query: 852   RKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYE 911
              K             +   +  W+       ++   +      T FF R  A ++ G  E
Sbjct: 21098 EK-------------RDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGE 21144

Query: 912   LSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQK 971
                  E +K          E   P  ++ +K+   T+ ++ W  P  DG S I  Y V++
Sbjct: 21145 PCETTEPVK--------AAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVER 21196

Query: 972   ADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTG 1031
               K    W +    ++     VS L   +   FRV+ +N  GLSD               
Sbjct: 21197 KGKGEQTWSHA-GISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDP-------------- 21241

Query: 1032  ITFKPFEYKEHDFRMAPKFLTPLIDR--------VVVAGYSAALNCAVRGHPKPKVVWMK 1083
             +T  P   KE         +TP +D          V  G++  L    +G PKP + W+K
Sbjct: 21242 VTIGPITVKE-------LIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLK 21294

Query: 1084  NKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYT 1119
             + + ++E      +  +  +TL+I+       G YT
Sbjct: 21295 DGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYT 21330



 Score = 99.8 bits (247), Expect = 1e-20
 Identities = 71/264 (26%), Positives = 127/264 (48%), Gaps = 11/264 (4%)

Query: 268  VDRGNKIKLMVEISDPDLT-LKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
            V  G K  L  ++S PD+T +KW+ N ++IKP  +      G K+ L IN+   +D+  Y
Sbjct: 2410 VIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPY 2469

Query: 327  EVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMW-MKDGVEL 385
            ++ V   +    L V++  + I+  L D        V   VE+S  G  V+W  KD    
Sbjct: 2470 KLIVGRVETNCNLSVEK--IKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKD---- 2523

Query: 386  TREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDI 445
             +E    ++Y+ +  GK + L   +++++D G+Y           +L V    +   + +
Sbjct: 2524 -KEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAIS--KPL 2580

Query: 446  ADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDE 505
             D TV  S++AVF+CEV++    G+W ++G  +  +  I     G   +L+I   + +D 
Sbjct: 2581 TDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDI 2640

Query: 506  GDYTFVPDGYALSLSAKLNFLEIK 529
            G+YT+       S   K+  ++IK
Sbjct: 2641 GEYTYKVATSKTSAKLKVEAVKIK 2664



 Score = 99.0 bits (245), Expect = 2e-20
 Identities = 109/513 (21%), Positives = 188/513 (36%), Gaps = 49/513 (9%)

Query: 639   PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEV-FTETT 697
             P PP   ++  +      L W  P+YDGG  + GY+VE+       W          +T 
Sbjct: 16533 PGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTN 16592

Query: 698   YESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEP---LHLIVEDVTDTTT- 753
              E  K++E   Y  R+ A+N  GV + +    P +       P   L L +  + +    
Sbjct: 16593 IEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAG 16652

Query: 754   -------TLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGAR 806
                     +K RP   +  G +DG + +  +      +   +         V    +G  
Sbjct: 16653 GSLRLFVPIKGRPTPEVKWGKVDGEIRDAAI------IDVTSSFTSLVLDNVNRYDSGKY 16706

Query: 807   ILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPF-Q 865
              L           +   T +  VT+R +  P     P +L+ T I K    +    P   
Sbjct: 16707 TLTL--------ENSSGTKSAFVTVRVLDTPSP---PVNLKVTEITKDSVSITWEPPLLD 16755

Query: 866   GKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIE---NMKDT 922
             G  + +    +       S   V T+     + + Q     S  + ++ + E    +   
Sbjct: 16756 GGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQ 16815

Query: 923   ATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNV 982
                 I+V E   PP  + V +V   +  + W  P+ DG S+I+ Y V+   K + +W   
Sbjct: 16816 TADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSEC 16875

Query: 983   YERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEH 1042
               R +     +++L  G EY FRV   N  G SD         R L   I  K       
Sbjct: 16876 -ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDP--------RSLAVPIVAK------- 16919

Query: 1043  DFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGV 1102
             D  + P          V  G    +   + G PKP + W K+ + +++  +  +T+   +
Sbjct: 16920 DLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDL 16979

Query: 1103  LTLNIRRPSPFDAGTYTCRAVNELGEALAECKL 1135
              TL+I+     D G Y     N +G+  A  ++
Sbjct: 16980 TTLSIKETHKDDGGQYGITVANVVGQKTASIEI 17012



 Score = 98.6 bits (244), Expect = 3e-20
 Identities = 128/541 (23%), Positives = 199/541 (36%), Gaps = 74/541 (13%)

Query: 639  PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTY 698
            P PP    +    +    L W+PP  DGG P+ GY+VE +++G+  W ++N      TT 
Sbjct: 9400 PGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTC 9459

Query: 699  EST--KMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTT--- 753
            E     + E   Y  RV AVN  G S+PS  T          EP   I     D      
Sbjct: 9460 ECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKA 9519

Query: 754  --------TLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGA 805
                     +K RP  +  +   DG   +   +G  + +P + +       +V  +P   
Sbjct: 9520 GSQIRIPAVIKGRPTPK-SSWEFDGKAKKAMKDGVHD-IPEDAQLETAENSSVIIIPECK 9577

Query: 806  RILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVP-- 863
            R       +    ++   T    V + ++  PPK      L+ + I +   +L+  +P  
Sbjct: 9578 RSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPK-----DLKVSDITRGSCRLSWKMPDD 9632

Query: 864  ----------FQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELS 913
                       + +      WTK      ++   V     +  +F R  A +  G   + 
Sbjct: 9633 DGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFG---IG 9689

Query: 914  VQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQ--- 970
              +E ++ T T R  +     PPI + +  +      + W+ PK+DG S +  Y V+   
Sbjct: 9690 PPVETIQRT-TARDPIYPP-DPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLA 9747

Query: 971  --KADKKTMEWFNVYERN-RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARI 1027
                  K   W    +R+      TV DL+ G EY FRV   N  G+S            
Sbjct: 9748 WDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVS------------ 9795

Query: 1028 LKTGITFKPFEYKEHDFRMAPKFLTPLID----RVVVAGYSAALNCAVRGHPKPKVVWMK 1083
             K   T  P + +  D       + P ID      V  G +  +   ++G P P + W K
Sbjct: 9796 -KPSATVGPCDCQRPD-------MPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPTLTWFK 9847

Query: 1084 -------NKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLE 1136
                   NK  +  D            TL I +    D G YT  AVN LG A  E +L 
Sbjct: 9848 APPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLN 9907

Query: 1137 V 1137
            V
Sbjct: 9908 V 9908



 Score = 97.4 bits (241), Expect = 7e-20
 Identities = 101/436 (23%), Positives = 166/436 (38%), Gaps = 41/436 (9%)

Query: 717   NAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
             N+ G +  ++N        P + P+ +  ++VT  + TL W PP   G   I+ Y+VE  
Sbjct: 15919 NSAGEAIETLNVIVLDKPGPPTGPVKM--DEVTADSITLSWGPPKYDGGSSINNYIVEKR 15976

Query: 777   LEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRS-----EPATLAQPVTI 831
                +  W   +   V R       L TG    FR+   N  G+S     EP     P  +
Sbjct: 15977 DTSTTTWQIVSAT-VARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKV 16035

Query: 832   REIAEPPKIRLPRH--LRQTYIRKVGEQLNLVVPF--QGKPRPQVVWTKGGAPLDTSRVH 887
                   P + L     +   +   + +  + V+ +  + K R  ++W K       ++  
Sbjct: 16036 PGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVK------LNKTP 16089

Query: 888   VRTSDFDTVFFVRQAARSDSGEYELSVQIENM----KDTATIRIRVV-EKAGPPINVMVK 942
             +  + F T          +  EYE  V  EN+    K +      V  +   PP      
Sbjct: 16090 IPQTKFKTT------GLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAI 16143

Query: 943   EVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNR-HTSCTVSDLIVGNE 1001
              V   +  ++W+ P  DG S+I GY V+K +     W      N   T   V+ L+  + 
Sbjct: 16144 IVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHR 16203

Query: 1002  YYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVA 1061
             Y FRV   N  G+   P  S        TG      E       M PK+   +   VV A
Sbjct: 16204 YEFRVIARNAAGVFSEPSES--------TGAITARDEVDPPRISMDPKYKDTI---VVHA 16252

Query: 1062  GYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCR 1121
             G S  ++  + G P P + W+K   E+    +  I +     +L+++     D+G Y  +
Sbjct: 16253 GESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILK 16312

Query: 1122  AVNELGEALAECKLEV 1137
             A N  GE      ++V
Sbjct: 16313 AKNVAGERSVTVNVKV 16328



 Score = 95.5 bits (236), Expect = 3e-19
 Identities = 116/453 (25%), Positives = 166/453 (36%), Gaps = 51/453 (11%)

Query: 694   TETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTT 753
             T  + + T   +G  Y + V   N +G    S+         P   P+    +DV+  + 
Sbjct: 16980 TTLSIKETHKDDGGQYGITV--ANVVGQKTASIEIVTLDKPDPPKGPVKF--DDVSAESI 17035

Query: 754   TLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVG 813
             TL W PP   G   I  Y+V+     +  W   +   V R    V  L TG    FR+  
Sbjct: 17036 TLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSAT-VARTTLKVTKLKTGTEYQFRIFA 17094

Query: 814   VNIAGRS---EPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLN------LVVPF 864
              N  G+S   E   +      +E   P         + + + +  E +N      +    
Sbjct: 17095 ENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHL 17154

Query: 865   QGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSG-EYELSVQIENM---- 919
             + K R  ++WTK    ++ + +H      DT F   +A   + G EYE  V  EN+    
Sbjct: 17155 ERKERNSILWTK----VNKTIIH------DTQF---KAQNLEEGIEYEFRVYAENIVGVG 17201

Query: 920   ----KDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKK 975
                      +     +  G P  +MVK        ++W  P  DG S I GY V+K D  
Sbjct: 17202 KASKNSECYVARDPCDPPGTPEPIMVKR---NEITLQWTKPVYDGGSMITGYIVEKRDLP 17258

Query: 976   TMEWFNVYERNR-HTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITF 1034
                W      N   T  TVS L     Y FRV  +N  G    P  S        TG   
Sbjct: 17259 DGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDS--------TGPIT 17310

Query: 1035  KPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKF 1094
                E +     M PKF   +   VV AG +  L   V G P P + W++   EI E  + 
Sbjct: 17311 AKDEVELPRISMDPKFRDTI---VVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARC 17367

Query: 1095  LITNYQGVLTLNIRRPSPFDAGTYTCRAVNELG 1127
              I N      L ++     D G Y  RA N  G
Sbjct: 17368 EIKNTDFKALLIVKDAIRIDGGQYILRASNVAG 17400



 Score = 94.4 bits (233), Expect = 6e-19
 Identities = 72/213 (33%), Positives = 98/213 (46%), Gaps = 16/213 (7%)

Query: 931   EKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNV-YERNRHT 989
             EK G P    +  V   + +V W+ P  DG ++I  Y+++K +KK  +W +V  E  R T
Sbjct: 24518 EKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRET 24577

Query: 990   SCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPK 1049
               +V +LI G EY FRV  EN+ G S+   +S             +P   K      AP 
Sbjct: 24578 VFSVKNLIEGLEYEFRVKCENLGGESEWSEIS-------------EPITPKSDVPIQAPH 24624

Query: 1050  FLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDP-KFLITNYQ-GVLTLNI 1107
             F   L +  V    +A L C V GHPKP V W +   EI  D  K+ I  ++ G   L I
Sbjct: 24625 FKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLII 24684

Query: 1108  RRPSPFDAGTYTCRAVNELGEALAECKLEVRVP 1140
                +  DA  Y  RA N+ G       LEV VP
Sbjct: 24685 ASVTDDDATVYQVRATNQGGSVSGTASLEVEVP 24717



 Score = 94.0 bits (232), Expect = 7e-19
 Identities = 95/391 (24%), Positives = 171/391 (43%), Gaps = 37/391 (9%)

Query: 240  GMLKRLKKAKVEVKK-SAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQ-EIK 297
            G  ++   AK+ V++    F K L+    V +G  + L  E++  +  + W K+G+  ++
Sbjct: 4890 GNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSCELNK-ERDVVWRKDGKIVVE 4948

Query: 298  PSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFT-ELFVKEPPVL---IVTPLE 353
               + V   +G  R LTIN     D   Y V V++         VK   V+   +V P+ 
Sbjct: 4949 KPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIR 5008

Query: 354  DQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQ 413
            DQ V        A +++++   + W K   E+  E + K      +DG    L   + + 
Sbjct: 5009 DQHVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTE--ILRDGNHLYLKIKNAMP 5066

Query: 414  EDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYK 473
            ED   Y V   G +  A+L + E+++E+L+ I D+T+   E A F  E+S+  + G+W  
Sbjct: 5067 EDIAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKL 5126

Query: 474  NGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEY- 532
             G  +RPS    I   G    L +  V+ +  G+  +         +A L   EI++++ 
Sbjct: 5127 KGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLY--QALNAITTAILTVKEIELDFA 5184

Query: 533  VPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRT 592
            VP ++                + V    + R +  +T E   +  W KG ++  +++   
Sbjct: 5185 VPLKD----------------VTVPERRQARFECVLTREANVI--WSKGPDIIKSSDKFD 5226

Query: 593  RI---EKRVDCSSFVIESAQREDEGRYTIKV 620
             I   +K +     VI  +Q +DEG YT +V
Sbjct: 5227 IIADGKKHI----LVINDSQFDDEGVYTAEV 5253



 Score = 92.8 bits (229), Expect = 2e-18
 Identities = 113/454 (24%), Positives = 174/454 (38%), Gaps = 76/454 (16%)

Query: 717   NAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
             NA G    S+  K      P  +   L V  VT    TL W  P   G   I  Y+VE  
Sbjct: 22819 NASGTKAVSVMVKVLDSPGPCGK---LTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERR 22875

Query: 777   LEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIRE--- 833
                   WV    E      + V  L      +FRV  VN  G   P   ++P+  R    
Sbjct: 22876 ETSRLNWVIVEGE-CPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVE-SEPIVARNSFT 22933

Query: 834   IAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTK----GGAPLDTSRVHVR 889
             I  PP I            +VG          GK    + WTK    GG  +    V  R
Sbjct: 22934 IPSPPGIP----------EEVGT---------GKEHIIIQWTKPESDGGNEISNYLVDKR 22974

Query: 890   TSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVE------------------ 931
                  ++ + R     D   Y+  +++ ++ +    + RV                    
Sbjct: 22975 EKK--SLRWTR--VNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISC 23030

Query: 932   -----KAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN 986
                    GPP    V +    +  + W  P  DG ++I+GY ++  +K T +W+ V+   
Sbjct: 23031 REPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNA 23090

Query: 987   --RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKE-HD 1043
               R+T  TV DL +G +Y FRV   N+ G+S+    S++ A I       +P E  E  D
Sbjct: 23091 TIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSE---YSESIAEI-------EPVERIEIPD 23140

Query: 1044  FRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVL 1103
               +A      +  R   AG S  L  +V G P P + W K  +++    + +I   +   
Sbjct: 23141 LELADDLKKTVTIR---AGASLRLMVSVSGRPPPVITWSKQGIDLAS--RAIIDTTESYS 23195

Query: 1104  TLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
              L + + + +DAG YT  A N+ G+  A   ++V
Sbjct: 23196 LLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKV 23229



 Score = 91.7 bits (226), Expect = 4e-18
 Identities = 62/245 (25%), Positives = 116/245 (47%), Gaps = 7/245 (2%)

Query: 267  QVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
            +V  G+ ++L V++S   +   W K+GQE++PS +       +  +L I   T  D   Y
Sbjct: 2320 KVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNY 2379

Query: 327  EVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVS-EEGAQVMWMKDGVEL 385
               +      T   V    V ++TPL+D  V  G +  +  +VS  +   V W  +  ++
Sbjct: 2380 SFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQI 2439

Query: 386  TREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDI 445
              +D  +A  +    G +  L+ +     D G Y++I    +    L VE+  +++++ +
Sbjct: 2440 KPDDRVQAIVK----GTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVEK--IKIIRGL 2493

Query: 446  ADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDE 505
             DLT   ++  VF+ E+S   +   W     E++PS +  I   G+ +KL + ++  +DE
Sbjct: 2494 RDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDE 2553

Query: 506  GDYTF 510
            G YTF
Sbjct: 2554 GKYTF 2558



 Score = 91.3 bits (225), Expect = 5e-18
 Identities = 106/430 (24%), Positives = 163/430 (37%), Gaps = 59/430 (13%)

Query: 734   IAPTSEPLHLI-VEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVE 792
             + P S+P   I  +++   +  L W  P   G G I  Y +E        W    +  V 
Sbjct: 21349 LGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCSS-VA 21407

Query: 793   RCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIR 852
             R  F V NL   A   FRV   N  G      ++QP+    I    + R+P    +  I 
Sbjct: 21408 RTTFKVPNLVKDAEYQFRVRAENRYG------VSQPLVSSIIVAKHQFRIPGPPGKPVIY 21461

Query: 853   KV---GEQLNLVVPF------------QGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVF 897
              V   G  L    P             + K R  ++W K    ++TS +  R        
Sbjct: 21462 NVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQK----VNTSPISGRE------- 21510

Query: 898   FVRQAARSDSGEYELSVQIENMKDTA--------TIRIRVVEKAGPPINVMVKEVWGTNA 949
               R     +  +Y+  V  EN    +        T+ +  V+  G P  +   +V     
Sbjct: 21511 -YRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYI---DVTRETI 21566

Query: 950   LVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNV-YERNRHTSCTVSDLIVGNEYYFRVYT 1008
              ++W  P  DG S+I+GY ++K       W    +        TV+ L  G+ Y FR+  
Sbjct: 21567 TLKWNPPLRDGGSKIVGYSIEKRQGNE-RWVRCNFTDVSECQYTVTGLSPGDRYEFRIIA 21625

Query: 1009  ENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALN 1068
              N  G    P  S        +GI     E         P++   LI   + +G S  + 
Sbjct: 21626 RNAVGTISPPSQS--------SGIIMTRDENVPPIVEFGPEYFDGLI---IKSGESLRIK 21674

Query: 1069  CAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGE 1128
               V+G P P+V W K+ +EI +     IT+  G  +L +R  +    G YT  A N  G 
Sbjct: 21675 ALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGS 21734

Query: 1129  ALAECKLEVR 1138
             A AE K++V+
Sbjct: 21735 AKAEIKVKVQ 21744



 Score = 90.1 bits (222), Expect = 1e-17
 Identities = 105/434 (24%), Positives = 163/434 (37%), Gaps = 37/434 (8%)

Query: 710   EMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGID 769
             E ++   NA G    +++        P + P++++  DVT    T+ W+PP   G   + 
Sbjct: 11275 EYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINIL--DVTPEHMTISWQPPKDDGGSPVI 11332

Query: 770   GYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPV 829
              Y+VE      + W   ++    +    + +L  G   +FRV   N  G   P      V
Sbjct: 11333 NYIVEKQDTRKDTWGVVSSGS-SKTKLKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPTV 11391

Query: 830   TIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVR 889
                + + P     P     T I +    ++  +P      P   +      +    V V 
Sbjct: 11392 AKHKFSPPSP---PGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVN 11448

Query: 890   TSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIR--------IRVVEKAGPPINVMV 941
              +    + F R     +   YE  V  EN+   +            R ++  GPPIN  +
Sbjct: 11449 KTPIADLKF-RVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKPPGPPINPKL 11507

Query: 942   KEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEW--FNVYERNRHTSCTVSDLIVG 999
             K+     A + W  P  DG S I+GY V+     T +W   N  E  R  +  V  LI G
Sbjct: 11508 KDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEG 11567

Query: 1000  NEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVV 1059
             NEY FR+   NI G        +   R L   +  K       D    P+    +  R V
Sbjct: 11568 NEYRFRIKAANIVG--------EGEPRELAESVIAK-------DILHPPEVELDVTCRDV 11612

Query: 1060  VA---GYSAALNCAVRGHPKPKVVWMK-NKMEIREDPKFLITNYQGVLTLNIRRPSPFDA 1115
             +    G +  +   V+G P+P + W K  K+ +RE    LI +   V  L I+     D 
Sbjct: 11613 ITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRV-ELQIKEAVRADH 11671

Query: 1116  GTYTCRAVNELGEA 1129
             G Y   A N  G A
Sbjct: 11672 GKYIISAKNSSGHA 11685



 Score = 89.4 bits (220), Expect = 2e-17
 Identities = 103/435 (23%), Positives = 167/435 (38%), Gaps = 40/435 (9%)

Query: 709   YEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGI 768
             YE+++   NA+G +  ++  +      P   P+    + VT    TL WRPP   G   I
Sbjct: 20638 YELKLR--NAMGSASATIRVQILDKPGPPGGPIEF--KTVTAEKITLLWRPPADDGGAKI 20693

Query: 769   DGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQP 828
               Y+VE        W   + E +E C  T   +  G   +FRV  VN  G  EP      
Sbjct: 20694 THYIVEKRETSRVVWSMVS-EHLEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSV 20752

Query: 829   VTIREIAEPPKIRLPRHLRQT-------YIRKVGEQLNLVVPF--QGKPRPQVVWTKG-G 878
             V       P    +P   + T       + R + +  + +  +  + + +  + W K   
Sbjct: 20753 VAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLK 20812

Query: 879   APLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN 938
               +  +R  V     ++ +  R  A + +G+   S   E  K    I     +  GPP  
Sbjct: 20813 ETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPI-----DPPGPPAK 20867

Query: 939   VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN--RHTSCTVSDL 996
             + + +   ++  + W  P  DG S + GY V+    +  EW  V  +   R T   VS+L
Sbjct: 20868 IRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNL 20927

Query: 997   IVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLID 1056
               G  YYFRV   N  G  +   +++             P + K  D   AP+    +  
Sbjct: 20928 KPGVNYYFRVSAVNCAGQGEPIEMNE-------------PVQAK--DILEAPEIDLDVAL 20972

Query: 1057  RVVV---AGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPF 1113
             R  V   AG    +    +G P P V W K++  +  D ++ I N      L I + +  
Sbjct: 20973 RTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRN 21032

Query: 1114  DAGTYTCRAVNELGE 1128
             D G Y     N +GE
Sbjct: 21033 DTGKYILTIENGVGE 21047



 Score = 89.4 bits (220), Expect = 2e-17
 Identities = 134/655 (20%), Positives = 251/655 (38%), Gaps = 101/655 (15%)

Query: 23    KEAPPKEAPAEAPKEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPD 82
             K++  K   +   ++  P+   P + +P  V +      +V +   A    K  G+    
Sbjct: 26520 KKSDQKTTESTVTRKTEPKAPEPISSKP--VIVTGLQDTTVSSDSVAKFAVKATGEP--- 26574

Query: 83    KPTIKWFK-GKWLELGSKSGARFSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAK 141
             +PT  W K GK +  G K      +K S                    D+G + LE+   
Sbjct: 26575 RPTAIWTKDGKAITQGGK------YKLSE-------------------DKGGFFLEIHKT 26609

Query: 142   DTCDSCGFNIDVEAPRQDASGQ---SLESFKRTSEKKSDTAGELDFSGLLKKREVVEEE- 197
             DT DS  +   V+      S     ++++ K T  +K  T    + +   +K+ VV+EE 
Sbjct: 26610 DTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITP--QKKAVVQEEI 26667

Query: 198   ----------KKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGITDLRGMLKRLKK 247
                       K  + K  + L +  E  ++L   +  +    + +  I  +   + +  +
Sbjct: 26668 SQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSI--VHEEITKTSQ 26725

Query: 248   AKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENV 307
             A  EV+  A   K       ++ G ++ L   I+     +KW  NG E+  S +Y +   
Sbjct: 26726 ASEEVRTHAEI-KAFSTQMSINEGQRLVLKANIAGA-TDVKWVLNGVELTNSEEYRYGVS 26783

Query: 308   GKKRILTINKCTLADDAAYEVAVKDE----KCFTELF----VKEPPVLIVTPLEDQQVFV 359
             G  + LTI + +  D+       K +    KC  +L     + + P  I  P   Q +  
Sbjct: 26784 GSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQP-RSQNINE 26842

Query: 360   GDRVEMAVEVS-EEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGR 418
             G  V    E+S E   ++ W K+ + +    S  +     +    + L   +    D G+
Sbjct: 26843 GQNVLFTCEISGEPSPEIEWFKNNLPI----SISSNVSISRSRNVYSLEIRNASVSDSGK 26898

Query: 419   YQVITNG--GQCEAEL------IVEEKQLE-VLQDIADLTVKAS------EQAVFKCEVS 463
             Y +      GQC A        +VEE   E VL+   D +++ S      + +  K E S
Sbjct: 26899 YTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEAS 26958

Query: 464   DEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG--DYTFVPDGYALSLSA 521
                 +     +  E++ +  ++   +    +  ++       G  + T +    +  L A
Sbjct: 26959 FSSFSSSSASSMTEMKFAS-MSAQSMSSMQESFVEMSSSSFMGISNMTQLESSTSKMLKA 27017

Query: 522   KLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATW-LK 580
              +  +  K+E +P                   I +  G  L +  + TGEP P  TW   
Sbjct: 27018 GIRGIPPKIEALPSD-----------------ISIDEGKVLTVACAFTGEPTPEVTWSCG 27060

Query: 581   GDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQV 635
             G ++ +  +GR  IE   D ++ +I   Q++D G YT+ + N  G D A++ + +
Sbjct: 27061 GRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 27115



 Score = 88.2 bits (217), Expect = 4e-17
 Identities = 106/434 (24%), Positives = 168/434 (38%), Gaps = 44/434 (10%)

Query: 713   VFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYL 772
             + AVN +G +   M         P   P+    E V+    TL W PP   G   I  Y+
Sbjct: 9891  ITAVNNLGTASKEMRLNVLGRPGPPVGPIKF--ESVSADQMTLSWFPPKDDGGSKITNYV 9948

Query: 773   VEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIR 832
             +E      + WV  ++EP E C +T+  L  G   +FR++  N  G  EP   ++P T R
Sbjct: 9949  IEKREANRKTWVHVSSEPKE-CTYTIPKLLEGHEYVFRIMAQNKYGIGEPLD-SEPETAR 10006

Query: 833   EIAEPPKIRLPRHLRQTYIRKVGEQLNLVVP-FQGKPRPQVVWTKGGAPLDTSRVHVRTS 891
              +   P    P     + + +    +N   P + G       W +     DT+    +  
Sbjct: 10007 NLFSVPGA--PDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLE---MKDTTSKRWKRV 10061

Query: 892   DFDTVFFV------RQAARSDSGEYELSVQIENM---------KDTATIRIRVVEKAGPP 936
             + D +  +      +     +  +Y+  V   N           D AT R  +    GPP
Sbjct: 10062 NRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPP-GPP 10120

Query: 937   INVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN-RHTSCTVSD 995
                 V +   ++A +EW  P  DG S++ GY V+  ++   EW    ++  R T   V+ 
Sbjct: 10121 FP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTG 10179

Query: 996   LIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLI 1055
             L  G  Y FRV   NI G+ + PG   +              E K+       +    + 
Sbjct: 10180 LKEGAFYKFRVRAVNIAGIGE-PGEVTDV------------IEMKDRLVSPDLQLDASVR 10226

Query: 1056  DRVVV-AGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFD 1114
             DR+VV AG    +   V G P P V W  N+  + ++     T      ++ I+      
Sbjct: 10227 DRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISS--SMVIKNCQRSH 10284

Query: 1115  AGTYTCRAVNELGE 1128
              G Y+  A NE GE
Sbjct: 10285 QGVYSLLAKNEAGE 10298



 Score = 88.2 bits (217), Expect = 4e-17
 Identities = 118/461 (25%), Positives = 169/461 (36%), Gaps = 66/461 (14%)

Query: 704   IEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRI 763
             I+G  Y +R  A N  G     +N K      P   P+   V  VT    +L W PP + 
Sbjct: 17386 IDGGQYILR--ASNVAGSKSFPVNVKVLDRPGPPEGPVQ--VTGVTSEKCSLTWSPPLQD 17441

Query: 764   GAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPA 823
             G   I  Y+VE        W    +E V      V  L  G   +FR++ VN  G  EP 
Sbjct: 17442 GGSDISHYVVEKRETSRLAWTVVASEVVTN-SLKVTKLLEGNEYVFRIMAVNKYGVGEPL 17500

Query: 824   TLAQPVTIREIAEPPKIRLPRHLRQTYIRKVG--------------EQLNLVVPFQGKPR 869
               A  +       P     P+ L  T I K                E +  +V  + + R
Sbjct: 17501 ESAPVLMKNPFVLPGP---PKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIV--EKRDR 17555

Query: 870   PQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDT-----AT 924
               + W K     +  R+        T   +R    ++  EYE  V  EN         AT
Sbjct: 17556 SGIRWIK----CNKRRI--------TDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPAT 17603

Query: 925   IRIRVVE---KAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQ--KADKKTMEW 979
             +  +  +   K GPP N  + +    +  + W  P  DG SEI+GY V+  KAD++  + 
Sbjct: 17604 VYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQI 17663

Query: 980   FNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEY 1039
                    R T   +S L    EY  RV   N  GL ++  V               P   
Sbjct: 17664 VTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSV---------------PGTV 17708

Query: 1040  KEHDFRMAPKFLTPLIDR---VVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLI 1096
             K  D   AP+       R   VV AG SA ++   +G P P++ W + + E  +  K  I
Sbjct: 17709 KPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTD--KVQI 17766

Query: 1097  TNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
                     L+I      DAG Y  +  N  G   A   ++V
Sbjct: 17767 EKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKV 17807



 Score = 87.4 bits (215), Expect = 7e-17
 Identities = 103/433 (23%), Positives = 161/433 (37%), Gaps = 50/433 (11%)

Query: 715   AVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
             A N  G    ++N K      P   P+  ++  VT    TL W+PP + G   I  Y+VE
Sbjct: 16313 AKNVAGERSVTVNVKVLDRPGPPEGPV--VISGVTAEKCTLAWKPPLQDGGSDIINYIVE 16370

Query: 775   YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAG-----RSEPATLAQPV 829
                     W   +   V+     V  L  G    FR++ VN  G      SEP     P 
Sbjct: 16371 RRETSRLVWTVVDAN-VQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPF 16429

Query: 830   TIREIAEPPKIRLPRHLRQTYI----RKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSR 885
              + +  + P++          +       G    L    + + +  + WT         R
Sbjct: 16430 VVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWT---------R 16480

Query: 886   VHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIR--------IRVVEKAGPPI 937
              H R         +R     ++ +YE  V  EN    +              + K GPP 
Sbjct: 16481 CHKRLIG---ELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPN 16537

Query: 938   NVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN--RHTSCTVSD 995
             N  V ++  ++  + W  P  DG  EI GY V+K D    EW           T+  V  
Sbjct: 16538 NPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEK 16597

Query: 996   LIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLI 1055
             L+  +EY FR+   N  G+ +   V           I  +  E  + D  +    L  +I
Sbjct: 16598 LLEKHEYNFRICAINKAGVGEHADVPGPI-------IVEEKLEAPDIDLDLE---LRKII 16647

Query: 1056  DRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLIT-NYQGVLTLNIRRPSPFD 1114
             +  + AG S  L   ++G P P+V W K   EIR+     +T ++  ++  N+ R   +D
Sbjct: 16648 N--IRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTSLVLDNVNR---YD 16702

Query: 1115  AGTYTCRAVNELG 1127
             +G YT    N  G
Sbjct: 16703 SGKYTLTLENSSG 16715



 Score = 87.4 bits (215), Expect = 7e-17
 Identities = 98/404 (24%), Positives = 147/404 (36%), Gaps = 63/404 (15%)

Query: 713   VFAVNAIGVSQPSMNT----KPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGI 768
             V A N+ G +  +++     KP  P+ P         ++V+     + W PP   G   I
Sbjct: 18079 VTATNSAGTATENLSVIVLEKPGPPVGPVR------FDEVSADFVVISWEPPAYTGGCQI 18132

Query: 769   DGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQP 828
               Y+VE     +  W   +   V R    +  L TG    FR+   N  G+S P      
Sbjct: 18133 SNYIVEKRDTTTTTWHMVSAT-VARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAV 18191

Query: 829   VTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLV---------------VPFQGKPRPQVV 873
             +      EP     P      ++  + +   LV                  + K +  ++
Sbjct: 18192 IVQYPFKEPGPPGTP------FVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSIL 18245

Query: 874   WTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSG-EYELSVQIENM----KDTATIRIR 928
             W K       ++  ++ + F T          D G EYE  V  EN+    K +      
Sbjct: 18246 WVK------LNKTPIQDTKFKTTGL-------DEGLEYEFKVSAENIVGIGKPSKVSECF 18292

Query: 929   VV-EKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN- 986
             V  +   PP       +   N  ++W+ P  DG S+I GY V+K D     W      N 
Sbjct: 18293 VARDPCDPPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNV 18352

Query: 987   RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRM 1046
               T  TVS L+    Y FRV   N  G    P  S          IT +  E    +  +
Sbjct: 18353 LETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGA-------ITARD-EIDAPNASL 18404

Query: 1047  APKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIRE 1090
              PK+   +   VV AG +  L   +RG P P VVW K+  E+ E
Sbjct: 18405 DPKYKDVI---VVHAGETFVLEADIRGKPIPDVVWSKDGKELEE 18445



 Score = 86.7 bits (213), Expect = 1e-16
 Identities = 91/398 (22%), Positives = 151/398 (37%), Gaps = 28/398 (7%)

Query: 633   LQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEV 692
             L  +D P  P  + IT        L W  P Y GG  +T Y+VE++   + RW+K NF  
Sbjct: 15049 LDPIDPPGKPVPLNIT---RHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSN 15105

Query: 693   FTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTT 752
               E  +  + + E   YE RV A NA G   P       +      E   + V+     T
Sbjct: 15106 ILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDT 15165

Query: 753   TTLKWRPPNRIGA--GGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFR 810
               LK     R+ A   G     +E+  +G E    A  E ++   F+   +   +    R
Sbjct: 15166 VILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLE-IKIADFSTNLVNKDS--TRR 15222

Query: 811   VVGVNIAGRSEPATLAQPV-TIREIAEPPKIRLPRHLRQTYIRKV-----------GEQL 858
               G      + P   A+ +  ++ +  P     P  + +    K            G ++
Sbjct: 15223 DSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKI 15282

Query: 859   NLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIEN 918
             +  +  Q +   ++ WT   + +  +++ V        +  R  A +  G        E 
Sbjct: 15283 DHYI-VQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVG------EP 15335

Query: 919   MKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTME 978
             ++    + +       PP N  V  +   + +V W  P  DG SEI+ Y V++ DK    
Sbjct: 15336 LESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQR 15395

Query: 979   WFNVYERN-RHTSCTVSDLIVGNEYYFRVYTENICGLS 1015
             W    ++        VS L  G+EY FR+  EN  G+S
Sbjct: 15396 WIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGIS 15433



 Score = 86.7 bits (213), Expect = 1e-16
 Identities = 227/1140 (19%), Positives = 382/1140 (33%), Gaps = 202/1140 (17%)

Query: 83    KPT--IKWF-KGKWLELGSK------SGA-RFSFKESHNSASNVYTVELHIGKVVLGDRG 132
             KPT  +KW+  G  L+  SK      SG       + H   S  Y       K    D  
Sbjct: 26095 KPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASD-- 26152

Query: 133   YYRLEVKAKDTCDSCGFNIDVEAPRQ------DASGQSLESFKRTSEKKSDTAGELDFSG 186
             Y  L+V   D         D E PR            ++ SFK+TSE ++ ++     S 
Sbjct: 26153 YATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQ 26212

Query: 187   LLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGITDLRGMLKRLK 246
             + + RE +   +     +     +  +  E     +KS   KI      T    +L + +
Sbjct: 26213 MTETRESLSSYEHSASAEMKSAALEEKSLE-----EKSTTRKIK----TTLAARILTKPR 26263

Query: 247   KAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFEN 306
                V   +SA F+   D                  +P  T+ W + GQ +  S+++    
Sbjct: 26264 SMTVYEGESARFSCDTD-----------------GEPVPTVTWLRKGQVLSTSARHQVTT 26306

Query: 307   VGKKRILTINKCTLADDAAYEVAV-----KDEKCFTELFVKEPPVLIVTPLEDQQVFVGD 361
                K    I+    +D+  Y V V     K E  FT    K         + ++ V    
Sbjct: 26307 TKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQK-------ARVTEKAVTSPP 26359

Query: 362   RVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQV 421
             RV+                    +   ++ K+  R K     H    S    +     +V
Sbjct: 26360 RVKSPEP---------------RVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKV 26404

Query: 422   ITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPS 481
                      + I +  + E  ++IA LT       +   EV+       WYK+G +++ +
Sbjct: 26405 QHLPVSAPPK-ITQFLKAEASKEIAKLTCVVESSVLRAKEVT-------WYKDGKKLKEN 26456

Query: 482   KRITISH-VGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLE----------IKV 530
                   +     ++L I+++   D+G+Y     G   +    L F+            K+
Sbjct: 26457 GHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKI 26516

Query: 531   EYVPKQEPPKIHLDCSGKTSENAI-------VVVAG---------NKLRLDVSITGEPPP 574
                 K +        + KT   A        V+V G         +  +  V  TGEP P
Sbjct: 26517 SETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRP 26576

Query: 575   VATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQ 634
              A W K  +  T   G+ ++ +        I      D G YT  V N  G   +S  L 
Sbjct: 26577 TAIWTKDGKAITQG-GKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLT 26635

Query: 635   VVDVPDPPEAVRITS------VGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKL 688
             +  + D  EA ++++        +  A++  E       K +    ++  +  SQ  + L
Sbjct: 26636 IKAIKDT-EAQKVSTQKTSEITPQKKAVVQEEISQ----KALRSEEIKMSEAKSQEKLAL 26690

Query: 689   NFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNT------KPFMPIAPTSEPLH 742
               E       E  K       E  +        SQ S         K F      +E   
Sbjct: 26691 KEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQR 26750

Query: 743   LIVEDVTDTTTTLKW---------RPPNRIGAGGIDGYLV----EYCLEGSEEWVPANTE 789
             L+++      T +KW             R G  G D  L      +  EG    +    E
Sbjct: 26751 LVLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKE 26810

Query: 790   PVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQT 849
              + +C + +    T ++ L             PA ++QP                  R  
Sbjct: 26811 GIVKCQYDL----TLSKEL----------SDAPAFISQP------------------RSQ 26838

Query: 850   YIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLD-TSRVHVRTSDFDTVFFVRQAARSDSG 908
              I + G+ +       G+P P++ W K   P+  +S V +  S       +R A+ SDSG
Sbjct: 26839 NINE-GQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSG 26897

Query: 909   EYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYF 968
             +Y +  +    + +AT  + V+     P   +V    G  +L                  
Sbjct: 26898 KYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSL----------QGSFSSQS 26947

Query: 969   VQKADKKTMEWFNVYERNRHTSCT--------VSDLIVGNEYYFRVYTENICGLSDSPGV 1020
             VQ +  K    F+ +  +  +S T           +    E +  + + +  G+S+   +
Sbjct: 26948 VQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQL 27007

Query: 1021  SKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVV 1080
               +T+++LK GI   P           PK      D  +  G    + CA  G P P+V 
Sbjct: 27008 ESSTSKMLKAGIRGIP-----------PKIEALPSDISIDEGKVLTVACAFTGEPTPEVT 27056

Query: 1081  WM--KNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVR 1138
             W     K+  +E  +F I N   + TL I      D G YT    NE G   A   + +R
Sbjct: 27057 WSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIR 27116



 Score = 84.7 bits (208), Expect = 4e-16
 Identities = 109/433 (25%), Positives = 158/433 (36%), Gaps = 52/433 (12%)

Query: 717   NAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
             N  G    ++N K      P + PL   +  +T    +L W  P   G   ID Y+VE  
Sbjct: 19561 NVAGTRSVAVNCKVLDKPGPPAGPLE--INGLTAEKCSLSWGRPQEDGGADIDYYIVEKR 19618

Query: 777   LEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAE 836
                   W     E ++     V  L  G   +FRV GVN  G  EP    + V I+ +  
Sbjct: 19619 ETSHLAWTICEGE-LQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPL---ESVAIKALDP 19674

Query: 837   PPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSD---- 892
                   P  L  T + K  E + L        RP+   + GG+ +    +  R  +    
Sbjct: 19675 FTVPSPPTSLEITSVTK--ESMTLCWS-----RPE---SDGGSEISGYIIERREKNSLRW 19724

Query: 893   --------FDTVFFVRQAARSDSGEYELSVQIEN-----MKDTATIRIRVVEKA---GPP 936
                     +D    V+     +  EYE  V  EN     +    +  IR  +      PP
Sbjct: 19725 VRVNKKPVYD--LRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPP 19782

Query: 937   INVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDL 996
                 + +   T   + W  P  DG + I GY V+       +W    +  R T  T+S L
Sbjct: 19783 SKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTSIQSLRGTEYTISGL 19842

Query: 997   IVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLID 1056
               G EY FRV + N  G SD    S    +I K          +E  F +  +    LI 
Sbjct: 19843 TTGAEYVFRVKSVNKVGASDPSDSSD--PQIAKE-------REEEPLFDIDSEMRKTLI- 19892

Query: 1057  RVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAG 1116
               V AG S  +    RG P P V+W K   ++R   +  +       +L I   +  D+G
Sbjct: 19893 --VKAGASFTMTVPFRGRPVPNVLWSKPDTDLR--TRAYVDTTDSRTSLTIENANRNDSG 19948

Query: 1117  TYTCRAVNELGEA 1129
              YT    N L  A
Sbjct: 19949 KYTLTIQNVLSAA 19961



 Score = 84.3 bits (207), Expect = 6e-16
 Identities = 200/926 (21%), Positives = 340/926 (36%), Gaps = 134/926 (14%)

Query: 286  TLKWFK-NGQEIKPSSKYVFENV--GKKRILTINKCTLADDAAYEVAVKDEKCFTELFV- 341
            T KW + N + IK     V E V   K+ +L +        A   + V +    +E  V 
Sbjct: 8023 TEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVR-------AVNAIGVSEPSEISENVVA 8075

Query: 342  KEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQV---MWMKDGVELTREDSFKARYRFK 398
            K+P       LE   + V +  ++++ V      V    W KDG E+   D    R   K
Sbjct: 8076 KDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASD----RLTMK 8131

Query: 399  KDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVF 458
             D     L     V+ D G Y +        A   +  K + +     D  +KAS+    
Sbjct: 8132 NDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKD--IKASDITKS 8189

Query: 459  KCEVSDEKVTGKWYKNGVEV--------RPSKRITISHVGRFHKL--VIDDVRPEDEGDY 508
             C+++ E      +  G  +           +R  I  +   +KL   + D+ P   G+Y
Sbjct: 8190 SCKLTWEPPE---FDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPN--GEY 8244

Query: 509  TFVPDGYALSLSAKLNFLEIKVEYV---PKQEP-PKIHLDCSGKTSENAIVVVAGNKLRL 564
             F     A++      ++E+K   +   PKQ P P + ++    T+E             
Sbjct: 8245 FFRVK--AVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEA------------ 8290

Query: 565  DVSITGEPPPV--ATWLKGDEVFTTTEGRTRI----EKRVDCSSFVIESAQREDEGRYTI 618
             ++IT +PP     + + G  +    +G  R     E  V   ++  +  +   E ++ +
Sbjct: 8291 -MTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRV 8349

Query: 619  KVTNPVG---EDVASIFLQVVDVPDPPEAVRITSV---------------GEDWAILVWE 660
            +  N  G      A+   + VD  D P+ +  TS+               G  +  + W 
Sbjct: 8350 RAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYPTITWI 8409

Query: 661  PP----MYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGIL-------- 708
                  + +  K     LV R+K   Q        +    + +++K  E  L        
Sbjct: 8410 KDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRP 8469

Query: 709  ----YEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIG 764
                Y ++V   N  G+++            P   P++ + ED+  T+   KW PP   G
Sbjct: 8470 DHGLYMIKV--ENDHGIAKAPCTVSVLDTPGP---PINFVFEDIRKTSVLCKWEPPLDDG 8524

Query: 765  AGGIDGYLVEYC--LEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEP 822
               I  Y +E     +   EW+   T  +  C ++V  L  G   LFRV   N  G   P
Sbjct: 8525 GSEIINYTLEKKDKTKPDSEWIVV-TSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPP 8583

Query: 823  ATLAQPVTIREIAEPP----KIRLPRHLRQTYIRKVGEQLNLVVPFQG-----KPRPQVV 873
              +++P+  ++   PP    K  +      + + K  E  +   P  G     +      
Sbjct: 8584 C-VSKPLVAKDPFGPPDAPDKPIVEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTH 8642

Query: 874  WTK-GGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEK 932
            W++   + L+  + +V        +  R  A + +G  + S       D  T     +  
Sbjct: 8643 WSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPP----SDPKTAH-DPISP 8697

Query: 933  AGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN-RHTSC 991
             GPPI   V +   T   +EW+ P  +G  EI+GYFV K    T EW    E+  +    
Sbjct: 8698 PGPPIP-RVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQY 8756

Query: 992  TVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFL 1051
            TV ++  G +Y  RV   N  G    PG ++            +P E    +  ++ K  
Sbjct: 8757 TVKEIREGADYKLRVSAVNAAG-EGPPGETQPVT-------VAEPQEPPAVELDVSVKGG 8808

Query: 1052 TPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPS 1111
                   ++AG +  +   V G P P  VW K + E+ +D + +I N      L I+   
Sbjct: 8809 IQ-----IMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKD-RVVIDNVGTKSELIIKDAL 8862

Query: 1112 PFDAGTYTCRAVNELGEALAECKLEV 1137
              D G Y   A N  G   A  ++EV
Sbjct: 8863 RKDHGRYVITATNSCGSKFAAARVEV 8888



 Score = 84.3 bits (207), Expect = 6e-16
 Identities = 117/447 (26%), Positives = 169/447 (37%), Gaps = 58/447 (12%)

Query: 715   AVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
             A N  G ++   N K      P   PL   V +VT     L W PP   G   ID Y+V+
Sbjct: 15231 ATNPGGFAKHIFNVKVLDRPGPPEGPL--AVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQ 15288

Query: 775   YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREI 834
                     W    +E V+     V  L  G   +FRV+ VN  G  EP   ++PV     
Sbjct: 15289 KRETSRLAWTNVASE-VQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLE-SEPVLAVNP 15346

Query: 835   AEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFD 894
               PP    P++   T I K     + +V   G P      + GG+ +    V  R     
Sbjct: 15347 YGPPDP--PKNPEVTTITK-----DSMVVCWGHPD-----SDGGSEIINYIVERRDKAGQ 15394

Query: 895   ----------TVFFVRQAARSDSGEYELSVQIENMKDTATIR--------IRVVEKAGPP 936
                       T    + +  ++  EYE  +  EN    +              V K GPP
Sbjct: 15395 RWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFKPGPP 15454

Query: 937   INVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN--RHTSCTVS 994
              N  V +   ++  + W  P  DG SEI GY V+ A  +  EW  V      + TS T++
Sbjct: 15455 GNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTIT 15514

Query: 995   DLIVGNEYYFRVYTENICGLSDS---PGVSKNTARILKTGITFKPFEYKEHDFRMAPKFL 1051
              L    EY  R+Y  N  GL +    PG  K   R+L   I        + D R   K +
Sbjct: 15515 GLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIEL------DADLR---KVV 15565

Query: 1052  TPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLIT-NYQGVLTLNIRRP 1110
             T      + A  +  L   ++G P P+V W ++  E  +      T +Y  ++  N+ R 
Sbjct: 15566 T------IRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIESTSSYTLLIVGNVNR- 15618

Query: 1111  SPFDAGTYTCRAVNELGEALAECKLEV 1137
               FD+G Y     N  G   A   + V
Sbjct: 15619 --FDSGKYILTVENSSGSKSAFVNVRV 15643



 Score = 84.3 bits (207), Expect = 6e-16
 Identities = 106/412 (25%), Positives = 143/412 (34%), Gaps = 70/412 (16%)

Query: 747   DVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGAR 806
             ++T    TL W  P   G   I  Y++E        W     +  E   +T   L  G  
Sbjct: 21758 NITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIE-DKCEAQSYTAIKLINGNE 21816

Query: 807   ILFRVVGVNIAGRSEPATLAQPVTIR---EIAEPPKIRLPRHLRQTYIRKV--------G 855
               FRV  VN  G   P   + PV  +    + + P I  P ++    I           G
Sbjct: 21817 YQFRVSAVNKFGVGRPLD-SDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGG 21875

Query: 856   EQLNLVVPFQGKPRPQVVWTK--GGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELS 913
              ++   +  + + +    W K     P+  +R  V                ++  EYE  
Sbjct: 21876 SEIQQYI-LERREKKSTRWVKVISKRPISETRFKV-------------TGLTEGNEYEFH 21921

Query: 914   VQIENMKDTAT-------IRIRV-VEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIM 965
             V  EN             I+ R  V   GPP  V V +   T   +EW  P  DG  EI+
Sbjct: 21922 VMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEII 21981

Query: 966   GYFVQKADKKTMEWFNVY-ERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDS------- 1017
             GY ++       +W  V  E    T  TV+DL  G EY FRV   N  G  DS       
Sbjct: 21982 GYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTI 22041

Query: 1018  PGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKP 1077
               V + TA  L     FK                      VV AG S  L  A +G P P
Sbjct: 22042 KAVDRLTAPELDIDANFKQ-------------------THVVRAGASIRLFIAYQGRPTP 22082

Query: 1078  KVVWMK--NKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELG 1127
               VW K  + + +R D    I       TL +   +  DAG YT    N  G
Sbjct: 22083 TAVWSKPDSNLSLRAD----IHTTDSFSTLTVENCNRNDAGKYTLTVENNSG 22130



 Score = 84.0 bits (206), Expect = 8e-16
 Identities = 108/447 (24%), Positives = 166/447 (37%), Gaps = 71/447 (15%)

Query: 720   GVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEG 779
             G  Q ++  +P  P+ P S       ++VT     + W+PP   G   I  Y++E    G
Sbjct: 10597 GFCQVNVVDRPGPPVGPVS------FDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEVG 10650

Query: 780   SEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPK 839
              + W+P  T    +    V  L  G   +FR+   N+ G S+P      +    +    +
Sbjct: 10651 KDVWMPV-TSASAKTTCKVSKLLEGKDYIFRIHAENLYGISDP------LVSDSMKAKDR 10703

Query: 840   IRLPRHLRQTYIRKVGEQLNLVV---PFQG-KPRPQVV------WTKGGAPLDTSRVHVR 889
              R+P    Q  + +V +   LV    P  G KP    +       +K  A +    +H  
Sbjct: 10704 FRVPDAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKRETMSKRWARVTKDPIHPY 10763

Query: 890   TSDFDTVFFVRQAARSDSGEYELSVQIEN---MKDTATIRIRV-----VEKAGPPINVMV 941
             T         R     +  +YE  V  EN   + D +     V     + K  PP+N   
Sbjct: 10764 TK-------FRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEA 10816

Query: 942   KEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHT--SCT-----VS 994
              +    +  + WQ P+ DG S+I+GY V+       EW     R  HT  SC      V+
Sbjct: 10817 IDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEW----RRANHTPESCPETKYKVT 10872

Query: 995   DLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFL--- 1051
              L  G  Y FRV   N  G SD   V +             P   K+   R+ P  L   
Sbjct: 10873 GLRDGQTYKFRVLAVNAAGESDPAHVPE-------------PVLVKD---RLEPPELILD 10916

Query: 1052  -TPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRP 1110
                  ++ +  G +  L+  ++G P PKV W K   +     +  +T       L IR  
Sbjct: 10917 ANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGS--KLEIRNA 10974

Query: 1111  SPFDAGTYTCRAVNELGEALAECKLEV 1137
             +  D G Y+    N  G      K+ V
Sbjct: 10975 AHEDGGIYSLTVENPAGSKTVSVKVLV 11001



 Score = 84.0 bits (206), Expect = 8e-16
 Identities = 61/234 (26%), Positives = 102/234 (43%), Gaps = 24/234 (10%)

Query: 896   VFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQA 955
             +++ R  A ++ G   + V +E +       ++  E   PP  V + +V  T+A + W+ 
Sbjct: 17879 IYYFRVMAENEFG---VGVPVETVD-----AVKAAEPPSPPGKVTLTDVSQTSASLMWEK 17930

Query: 956   PKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLS 1015
             P+ DG S ++GY V+   K T +W  V E ++  +  V+ L  G EY FRV   N  G S
Sbjct: 17931 PEHDGGSRVLGYVVEMQPKGTEKWSIVAE-SKVCNAVVTGLSSGQEYQFRVKAYNEKGKS 17989

Query: 1016  DSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHP 1075
             D         R+L   +  K       D  + P    P     + AG    +   V G P
Sbjct: 17990 DP--------RVLGVPVIAK-------DLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRP 18034

Query: 1076  KPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEA 1129
             +P + W+K+   +++  +  +        L+I+  +  D G YT  A N  G A
Sbjct: 18035 RPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTA 18088



 Score = 82.8 bits (203), Expect = 2e-15
 Identities = 100/415 (24%), Positives = 149/415 (35%), Gaps = 52/415 (12%)

Query: 745   VEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTG 804
             + D+     +L W  P   G   I  Y+VE C     +WV A    V +    V  L  G
Sbjct: 12696 ISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALAS-VTKTSCRVGKLIPG 12754

Query: 805   ARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKV---------- 854
                +FRV   N  G SEP T  + V       P +   P++ R T + K           
Sbjct: 12755 QEYIFRVRAENRFGISEPLTSPKMVAQFPFGVPSE---PKNARVTKVNKDCIFVAWDRPD 12811

Query: 855   --GEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYEL 912
               G    +    + K R  ++W K    L      VR++++     V      +  EY  
Sbjct: 12812 SDGGSPIIGYLIERKERNSLLWVKANDTL------VRSTEYPCAGLV------EGLEYSF 12859

Query: 913   SVQIENM-------KDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIM 965
              +   N        K T  +  R+     PP    V +V  +   + W  PK DG S+I+
Sbjct: 12860 RIYALNKAGSSPPSKPTEYVTARM--PVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKII 12917

Query: 966   GYFVQKADKKTMEWFNVYERNRHT---SCTVSDLIVGNEYYFRVYTENICGLSDSPGVSK 1022
             GYFV+       +W               T + L    +Y FR        +S  P    
Sbjct: 12918 GYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISP-PSEPS 12976

Query: 1023  NTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWM 1082
             +   IL   +          D  +A K L       V AG +  L+  V G P P V W 
Sbjct: 12977 DPVTILAENVP------PRIDLSVAMKSLL-----TVKAGTNVCLDATVFGKPMPTVSWK 13025

Query: 1083  KNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
             K+   ++      +   + + TL +   +  D+G YT  A N  G   A  KL+V
Sbjct: 13026 KDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKV 13080



 Score = 82.8 bits (203), Expect = 2e-15
 Identities = 92/405 (22%), Positives = 156/405 (38%), Gaps = 35/405 (8%)

Query: 745   VEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTG 804
             +++V+  + T+ W PP   G   I  Y+VE     S  W   + + V R    +  L TG
Sbjct: 19191 IDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVS-QAVARTSIKIVRLTTG 19249

Query: 805   ARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQT-------YIRKVGEQ 857
             +   FRV   N  G+S  +  +  V     + P     P+ +  T       +   V + 
Sbjct: 19250 SEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDG 19309

Query: 858   LNLVVPF--QGKPRPQVVWTKGGAPLDT-SRVHVRTSDFDTVFFVRQAARSDSGEYELSV 914
              + V+ +  + K R  ++W+K    L   +++ V   D   ++  R  A + +G  + S 
Sbjct: 19310 GSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSK 19369

Query: 915   QIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADK 974
               E         +   +   PP    V  +   +  ++W  P  DG ++I GY V++ + 
Sbjct: 19370 SCEP--------VPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERREL 19421

Query: 975   KTMEWFNV-YERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGIT 1033
                 W    Y   + T   V++L     Y FRV+  N       P  S++T  I+     
Sbjct: 19422 PDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEP--SESTGPIIVKDDV 19479

Query: 1034  FKPFEYKEHDFRMAPKFLTPLIDRVVV-AGYSAALNCAVRGHPKPKVVWMKNKMEIREDP 1092
               P    +  FR          D +VV AG    +N  + G P P + W K+ +EI E  
Sbjct: 19480 EPPRVMMDVKFR----------DVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERA 19529

Query: 1093  KFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELG--EALAECKL 1135
             +  I +      L ++     D G Y     N  G       CK+
Sbjct: 19530 RTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKV 19574



 Score = 77.8 bits (190), Expect = 5e-14
 Identities = 95/402 (23%), Positives = 156/402 (38%), Gaps = 45/402 (11%)

Query: 745   VEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTG 804
             + +V+    TL W PP   G   I  Y++E        W   + E ++ C      L  G
Sbjct: 14176 ISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVS-EDIQSCRHVATKLIQG 14234

Query: 805   ARILFRVVGVNIAGRSEPATLAQPVTIREIAEPP----KIRLPRHLRQT----YIRKVGE 856
                +FRV  VN  G+ EP   ++PV + +   PP    K  +    + T    + R V +
Sbjct: 14235 NEYIFRVSAVNHYGKGEPVQ-SEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDD 14293

Query: 857   QLNLVVPF--QGKPRPQVVWTKG-GAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELS 913
               + +  +  + + +  + W +    P+   R  V      + +  R +A + +G    S
Sbjct: 14294 GGSEITGYHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPS 14353

Query: 914   VQIEN--MKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQK 971
                ++  MKD A          GPP N  V +    +A + W  P  DG  EI GY V+ 
Sbjct: 14354 EASDSVLMKDAAY-------PPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEH 14406

Query: 972   ADKKTMEWFNVYERN--RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILK 1029
                    W         R T   V DL    +Y FR+   N  G+ + P V  +   + +
Sbjct: 14407 QKVGDEAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGE-PAVIPDVEIVER 14465

Query: 1030  TGITFKPFEYKEHDFRMAPKF-LTPLIDRVVV--AGYSAALNCAVRGHPKPKVVWMKNKM 1086
                             MAP F L   + R +V  AG S  +   ++G P P+V W K+ +
Sbjct: 14466 ---------------EMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNI 14510

Query: 1087  EIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGE 1128
              ++   +  I N +    L I   + +D G +     N  G+
Sbjct: 14511 NLKN--RANIENTESFTLLIIPECNRYDTGKFVMTIENPAGK 14550



 Score = 77.4 bits (189), Expect = 7e-14
 Identities = 77/267 (28%), Positives = 117/267 (43%), Gaps = 21/267 (7%)

Query: 289  WFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAV----KDEKCFTELFVKEP 344
            W K+G  I+ S K+ F   GK R L I    L+D   Y   +    K++    +L V+E 
Sbjct: 4846 WMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEEL 4905

Query: 345  PVLIVTPLEDQQVFV-GDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKR 403
            PV  V  LE++   V G  + ++ E+++E   V+W KDG  +  +     R      G  
Sbjct: 4906 PVRFVKTLEEEVTVVKGQPLYLSCELNKE-RDVVWRKDGKIVVEK---PGRIVPGVIGLM 4961

Query: 404  HILIFSDVVQEDRGRYQV-ITNGGQCEAELIVEEKQLEVLQD-----IADLTVKASEQAV 457
              L  +D    D G Y V + N    E    V  K +EV++D     I D  VK    A+
Sbjct: 4962 RALTINDADDTDAGTYTVTVENANNLECSSCV--KVVEVIRDWLVKPIRDQHVKPKGTAI 5019

Query: 458  FKCEVSDEKVTGKWYKNGVEV--RPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGY 515
            F C+++ +    KW+K   E+   P+ +  I   G    L I +  PED  +Y    +G 
Sbjct: 5020 FACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEG- 5078

Query: 516  ALSLSAKLNFLEIKVEYVPKQEPPKIH 542
                 AKL   E +VE +   E   I+
Sbjct: 5079 -KRYPAKLTLGEREVELLKPIEDVTIY 5104



 Score = 77.4 bits (189), Expect = 7e-14
 Identities = 139/622 (22%), Positives = 222/622 (35%), Gaps = 82/622 (13%)

Query: 563   RLDVSITGEPPPVATWLKGDEVFTTTEGRTRI-----EKRVDCSSFVIESAQRED----- 612
             RLDV  T +   V  WLK D      +G +RI     E R   S F +E+   +      
Sbjct: 22246 RLDVVDTSKSSAVLAWLKPDH-----DGGSRITGYLLEMRQKGSDFWVEAGHTKQLTFTV 22300

Query: 613   -------EGRYTIKVTNPVG-----EDVASIFLQVVDVPDPPEAVRITS------VGEDW 654
                    E  + +K  N  G     E  +S+ ++   +    +   IT+       G  +
Sbjct: 22301 ERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPF 22360

Query: 655   AILVWEPPMYDGGKP---VTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEM 711
              I V   P+   G+P   VT  L E + K + R      +  T  T + +   +   Y +
Sbjct: 22361 TIDV---PI--SGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFL 22415

Query: 712   RVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGY 771
              +   N  GV   S+         P + P+   V  V+  +  L W  P   G   I  Y
Sbjct: 22416 TL--ENTAGVKTFSVTVVVIGRPGPVTGPIE--VSSVSAESCVLSWGEPKDGGGTEITNY 22471

Query: 772   LVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTI 831
             +VE    G+  W   N+  V+R    V +L       FRV   N  G S+P   A P+  
Sbjct: 22472 IVEKRESGTTAWQLVNSS-VKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESA-PIIA 22529

Query: 832   REIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPF------------QGKPRPQVVWTKGGA 879
                  PP    P      ++      +    P+            + K R  ++W K   
Sbjct: 22530 EHPFVPPSA--PTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVK--- 22584

Query: 880   PLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINV 939
                 ++V     ++     V +        Y L+    +    A+  I        P   
Sbjct: 22585 ---ENKVPCLECNYKVTGLV-EGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRP 22640

Query: 940   MVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTM---EWFNV-YERNRHTSCTVSD 995
              V +V  +   + W AP  DG S+++GY +++     +    W    Y        TV+ 
Sbjct: 22641 EVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTA 22700

Query: 996   LIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLI 1055
             L  G+ Y FRV  +N  G+     +SK +     TG      EY      +  +    L+
Sbjct: 22701 LSEGDTYEFRVLAKNAAGV-----ISKGSE---STGPVTCRDEYAPPKAELDARLHGDLV 22752

Query: 1056  DRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDA 1115
                + AG    L+ AV G P+PK++W K   E+    K  +       T  I+     D+
Sbjct: 22753 --TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDS 22810

Query: 1116  GTYTCRAVNELGEALAECKLEV 1137
             G YT    N  G       ++V
Sbjct: 22811 GKYTLTVKNASGTKAVSVMVKV 22832



 Score = 77.0 bits (188), Expect = 9e-14
 Identities = 53/204 (25%), Positives = 88/204 (43%), Gaps = 16/204 (7%)

Query: 927   IRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN 986
             ++  E+  PP  + + +V   +  + W+ P+ DG S I+GY V+   K + +W       
Sbjct: 15738 VKASERPLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATC-ATV 15796

Query: 987   RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRM 1046
             + T  T++ LI G EY FRV  +N  G+SD         R L   +  K       D  +
Sbjct: 15797 KVTEATITGLIQGEEYSFRVSAQNEKGISDP--------RQLSVPVIAK-------DLVI 15841

Query: 1047  APKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLN 1106
              P F        V+AG    ++    G P P V W K+ + +++  +    + +    L 
Sbjct: 15842 PPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLT 15901

Query: 1107  IRRPSPFDAGTYTCRAVNELGEAL 1130
             I+     D G Y  +  N  GEA+
Sbjct: 15902 IKDACREDVGHYVVKLTNSAGEAI 15925



 Score = 74.7 bits (182), Expect = 5e-13
 Identities = 97/436 (22%), Positives = 155/436 (35%), Gaps = 49/436 (11%)

Query: 713   VFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYL 772
             + A N+ G    ++  K      P   P  + +  +      L W PP   G   I  Y+
Sbjct: 13063 ITAENSSGSKSATIKLKVLDKPGP---PASVKINKMYSDRAMLSWEPPLEDGGSEITNYI 13119

Query: 773   VEYCLEGSEEWVPAN-TEPVERCGFTVKNLPTGARILFRVVGVNIAGR-----SEPATLA 826
             V+        W   + T P+  C  +V+ L  G    FR+   N  G      +EPA   
Sbjct: 13120 VDKRETSRPNWAQVSATVPITSC--SVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAK 13177

Query: 827   QPVTIREIAEPPKIR--LPRHLRQTYIRKVGEQLNLVVPF--QGKPRPQVVWTKGGAPLD 882
              P       +PP I      H+  ++     +  + +  +  + +    V WTK    ++
Sbjct: 13178 NPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTK----VN 13233

Query: 883   TSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMK--------DTATIRIRVVEKAG 934
                +  RT        ++     +  EYE  V   N            A          G
Sbjct: 13234 RKPIIERT--------LKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPG 13285

Query: 935   PPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQ--KADKKTMEWFNVYERNRHTSCT 992
             PP    V +   ++  + W  P  DG S I+GY V+  +AD       N+ +  + T   
Sbjct: 13286 PPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFE 13345

Query: 993   VSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLT 1052
             V+ L+   +Y FRVY  N  G SD   V     +     I   P    + D R       
Sbjct: 13346 VTGLMEDTQYQFRVYAVNKIGYSDPSDVPD---KHYPKDILIPPEGELDADLRKT----- 13397

Query: 1053  PLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSP 1112
                  ++ AG +  L   V+G P PK+ W K  + +R+     I +      L     + 
Sbjct: 13398 ----LILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNK 13453

Query: 1113  FDAGTYTCRAVNELGE 1128
             +DAG Y     N  G+
Sbjct: 13454 YDAGKYILTLENSCGK 13469



 Score = 73.6 bits (179), Expect = 1e-12
 Identities = 105/414 (25%), Positives = 152/414 (36%), Gaps = 56/414 (13%)

Query: 742   HLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNL 801
             +L + DV+    T+ W PP   G   I  Y++E C      W    +  V   G TV  L
Sbjct: 11997 NLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVW-STYSATVLTPGTTVTRL 12055

Query: 802   PTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLV 861
               G   +FRV   N  G   P T ++PV  +   + P    P       + KV ++   V
Sbjct: 12056 IEGNEYIFRVRAENKIGTGPP-TESKPVIAKTKYDKPGRPDPPE-----VTKVSKEEMTV 12109

Query: 862   V----PFQG-----------KPRPQVVWT---KGGAPLDTSRVHVRTSDFDTVFFVRQAA 903
             V     + G           K +    W    K   P    +V     D +  F V+   
Sbjct: 12110 VWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAEN 12169

Query: 904   RSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSE 963
                 GE  L  +    KD        +E  GPP N  V +    +  + W  P  DG + 
Sbjct: 12170 EIGIGEPSLPSRPVVAKDP-------IEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAP 12222

Query: 964   IMGYFVQK----ADKKTMEWF---NVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
             I+GY V+     AD    E +   N   +      TV+ L    EY FRV  +N  G+  
Sbjct: 12223 IIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGR 12282

Query: 1017  SPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPK 1076
                + +            KP E  E         +  L+  +V AG    L   VRG P 
Sbjct: 12283 PAELKE----------AIKPKEILEPPEIDLDASMRKLV--IVRAGCPIRLFAIVRGRPA 12330

Query: 1077  PKVVWMKNKME--IREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGE 1128
             PKV W K  ++  +R+    L+     ++  N  R    D+G Y+   VN  GE
Sbjct: 12331 PKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRD---DSGKYSLTLVNPAGE 12381



 Score = 73.6 bits (179), Expect = 1e-12
 Identities = 101/421 (23%), Positives = 155/421 (36%), Gaps = 60/421 (14%)

Query: 743   LIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLP 802
             L V  VT     L W PP + G   I  Y++E        W   +TE V+   + V  L 
Sbjct: 18504 LKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTE-VQALNYKVTKLL 18562

Query: 803   TGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPP--------KIRLPRHLRQTYIRKV 854
              G   +FRV+ VN  G  EP   + PVT     +PP               +  T+ R V
Sbjct: 18563 PGNEYIFRVMAVNKYGIGEPLE-SGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPV 18621

Query: 855   GEQLNLVVPF--QGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYEL 912
              +    +  +  + + +  V WTK      T               +R    ++   YE 
Sbjct: 18622 DDGGTEIEGYILEKRDKEGVRWTKCNKKTLTD------------LRLRVTGLTEGHSYEF 18669

Query: 913   SVQIENMKDTA-----TIRIRVVEKA---GPPINVMVKEVWGTNALVEWQAPKDDGNSEI 964
              V  EN          ++  R  +     GPP N  V +   ++  + W  P  DG + +
Sbjct: 18670 RVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPV 18729

Query: 965   MGYFVQKADKKTMEWFNVYERN--RHTSCTVSDLIVGNEYYFRVYTENICGLSDS---PG 1019
              GY V+  +    EW         +    TV+ L    EY FR+   N  G+ +    PG
Sbjct: 18730 KGYVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPG 18789

Query: 1020  VSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNC--AVRGHPKP 1077
                   RI    I        + D R           +VVV   SA L     ++G P+P
Sbjct: 18790 SVVAQERIEPPEIEL------DADLR-----------KVVVLRASATLRLFVTIKGRPEP 18832

Query: 1078  KVVWMKNKMEIREDPKFLITNYQGVLTL-NIRRPSPFDAGTYTCRAVNELGEALAECKLE 1136
             +V W K +  + +  +  +T+   +L + N+ R   FD+G Y     N  G   A   + 
Sbjct: 18833 EVKWEKAEGILTDRAQIEVTSSFTMLVIDNVTR---FDSGRYNLTLENNSGSKTAFVNVR 18889

Query: 1137  V 1137
             V
Sbjct: 18890 V 18890



 Score = 70.1 bits (170), Expect = 1e-11
 Identities = 61/232 (26%), Positives = 96/232 (41%), Gaps = 25/232 (10%)

Query: 905   SDSGEYELSVQIENM-----KDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDD 959
             S+  EY   V  EN          T  ++  E   PP ++ + ++  +   + W  PK D
Sbjct: 14627 SEGCEYFFRVMAENEYGIGEPTETTEPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKHD 14686

Query: 960   GNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPG 1019
             G S+I GY ++   K + +W ++    +   C V +L  G EY F+V   N  G S +P 
Sbjct: 14687 GGSKITGYVIEAQRKGSDQWTHI-TTVKGLECVVRNLTEGEEYTFQVMAVNSAGRS-APR 14744

Query: 1020  VSKNTARILKTGITFKPFEYKEHDFRMAPKF-LTPLIDRVVVA--GYSAALNCAVRGHPK 1076
              S+             P   KE    M P+  L  +  ++V+A  G +  +   V G PK
Sbjct: 14745 ESR-------------PVIVKEQT--MLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPK 14789

Query: 1077  PKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGE 1128
             P V W K    +++  +           LNI      D+G Y   A N +GE
Sbjct: 14790 PTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGE 14841



 Score = 69.7 bits (169), Expect = 1e-11
 Identities = 70/279 (25%), Positives = 111/279 (39%), Gaps = 31/279 (11%)

Query: 470   KWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIK 529
             KW K   E+R +  I ++    F  LV+D+V   D G YT   +    S   K  F+ ++
Sbjct: 16670 KWGKVDGEIRDAAIIDVT--SSFTSLVLDNVNRYDSGKYTLTLEN---SSGTKSAFVTVR 16724

Query: 530   VEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTE 589
             V   P    P ++L  +  T ++             VSIT EPP +    K         
Sbjct: 16725 VLDTPS---PPVNLKVTEITKDS-------------VSITWEPPLLDGGSKIKNYIVEKR 16768

Query: 590   GRTR-----IEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIF---LQVVDVPDP 641
               TR     +      +S+ I+  Q      + +   N  G  + +     ++V +VP P
Sbjct: 16769 EATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQP 16828

Query: 642   PEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYEST 701
             P  + +  V  +   L W  P +DGG  +  Y+VE + K S++W +       +     T
Sbjct: 16829 PGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVI--T 16886

Query: 702   KMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEP 740
              + +G  Y  RV AVN  G S P     P +      EP
Sbjct: 16887 NLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEP 16925



 Score = 69.3 bits (168), Expect = 2e-11
 Identities = 81/305 (26%), Positives = 128/305 (41%), Gaps = 40/305 (13%)

Query: 429   EAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISH 488
             E EL  + +++ VL+  A L +  + +   + EV  EK  G           + R  I  
Sbjct: 18801 EIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGIL---------TDRAQIEV 18851

Query: 489   VGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGK 548
                F  LVID+V   D G Y    +    +  +K  F+ ++V            LD    
Sbjct: 18852 TSSFTMLVIDNVTRFDSGRYNLTLEN---NSGSKTAFVNVRV------------LD---- 18892

Query: 549   TSENAIVVVAGNKLRLD-VSITGEPPPVATWLK-----GDEVFTTTEGRTRIEKRVDCSS 602
              S +A V +   +++ D V+++ EPP +    K      ++  TT +    I      ++
Sbjct: 18893 -SPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKTT 18951

Query: 603   FVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDV---PDPPEAVRITSVGEDWAILVW 659
             F IE+ Q      + +  +N  G  + +   + V V   P PP  V +  V  + A + W
Sbjct: 18952 FRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKW 19011

Query: 660   EPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAI 719
             E P  DGG  +TGY+VE + KGS++W         E T     +  G  Y  RV AVN  
Sbjct: 19012 EKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATISG--LTAGEEYVFRVAAVNEK 19069

Query: 720   GVSQP 724
             G S P
Sbjct: 19070 GRSDP 19074



 Score = 68.2 bits (165), Expect = 4e-11
 Identities = 79/289 (27%), Positives = 122/289 (42%), Gaps = 32/289 (11%)

Query: 340  FVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKK 399
            FVKE   +I+T  E    FVG        VS   A   WMKDG  +        ++RF  
Sbjct: 4812 FVKEIKDIILTESE----FVGSSAIFECLVSPSTAITTWMKDGSNIRE----SPKHRFIA 4863

Query: 400  DGKRHILIFSDVVQEDRGRYQVITNGGQCE----AELIVEEKQLEVLQDI-ADLTVKASE 454
            DGK   L   DV   D G Y  +   G  E    A+L+VEE  +  ++ +  ++TV   +
Sbjct: 4864 DGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQ 4923

Query: 455  QAVFKCEVSDEKVTGKWYKNG-VEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTF-VP 512
                 CE++ E+    W K+G + V    RI    +G    L I+D    D G YT  V 
Sbjct: 4924 PLYLSCELNKERDV-VWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVE 4982

Query: 513  DGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEP 572
            +   L  S+ +  +E+  +++ K  P +   D   K    AI          D++   + 
Sbjct: 4983 NANNLECSSCVKVVEVIRDWLVK--PIR---DQHVKPKGTAI-------FACDIA---KD 5027

Query: 573  PPVATWLKG-DEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKV 620
             P   W KG DE+      +T I +  +     I++A  ED   Y +++
Sbjct: 5028 TPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEI 5076



 Score = 68.2 bits (165), Expect = 4e-11
 Identities = 106/473 (22%), Positives = 165/473 (34%), Gaps = 51/473 (10%)

Query: 679   KKGSQ---RWMKLNFEVF-TETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPI 734
             KKG Q   +  ++NFE   T T     + +        + A N +G     +  +     
Sbjct: 14795 KKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIP 14854

Query: 735   APTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERC 794
              P + P+    ++V+    T  W PP   G   I  Y+VE     S  WV   T  + R 
Sbjct: 14855 GPPTGPIKF--DEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTVI-RT 14911

Query: 795   GFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKV 854
              +    L TG    FRV   N  G     T A  V       P     P+    T + K 
Sbjct: 14912 TYKATRLTTGLEYQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTPQ---VTAVTKD 14968

Query: 855   GEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFF------------VRQA 902
                ++   P           + GG+P+     HV   + + + +             + +
Sbjct: 14969 SMTISWHEPL----------SDGGSPI--LGYHVERKERNGILWQTVSKALVPGNIFKSS 15016

Query: 903   ARSDSGEYELSVQIENMKDTA-----TIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPK 957
               +D   YE  V  ENM   +     +  +  ++   PP   +   +      ++W  P+
Sbjct: 15017 GLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKWAKPE 15076

Query: 958   DDGNSEIMGYFVQKADKKTMEWFNVYERN-RHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
               G  +I  Y V+K D     W      N      TVS L     Y FRV  +N  G   
Sbjct: 15077 YTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAIS 15136

Query: 1017  SPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPK 1076
              P    +        IT +  + +    ++  KF   +I   + AG +  L   V G P 
Sbjct: 15137 PPSEPSDA-------ITCRD-DVEAPKIKVDVKFKDTVI---LKAGEAFRLEADVSGRPP 15185

Query: 1077  PKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEA 1129
             P + W K+  E+    K  I        L  +  +  D+G YT  A N  G A
Sbjct: 15186 PTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFA 15238



 Score = 67.0 bits (162), Expect = 1e-10
 Identities = 58/205 (28%), Positives = 84/205 (40%), Gaps = 19/205 (9%)

Query: 936   PINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHT-SCTVS 994
             P ++ VKEV      + W  PK DG SEI+ Y ++     T ++  V   N  +   TV 
Sbjct: 10415 PEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVK 10474

Query: 995   DLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFL-TP 1053
              L  G+ Y +RV   NI G               K     KP   K+    +AP  L   
Sbjct: 10475 GLKEGDTYEYRVSAVNIVGQG-------------KPSFCTKPITCKDE---LAPPTLHLD 10518

Query: 1054  LIDRVVV-AGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSP 1112
               D++ +  G + AL     G PKPKV W K++ ++ ED +  I      L L   +   
Sbjct: 10519 FRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKR 10578

Query: 1113  FDAGTYTCRAVNELGEALAECKLEV 1137
              D+G Y     N  G     C++ V
Sbjct: 10579 SDSGKYCVVVENSTGSRKGFCQVNV 10603



 Score = 65.9 bits (159), Expect = 2e-10
 Identities = 242/1196 (20%), Positives = 419/1196 (35%), Gaps = 189/1196 (15%)

Query: 41   EDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKS 100
            E+Q+   E     F+ KP    +  G   V   +V G     KP + W K      G   
Sbjct: 1025 EEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNP---KPHVYWKKS-----GVPL 1076

Query: 101  GARFSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDA 160
               + +K S+N  +     +L I      D G Y + V+ K    S   ++  EA  +  
Sbjct: 1077 TTGYRYKVSYNKQTG--ECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELL 1134

Query: 161  SGQSLESFKRTS-------EKKSDTAGELDFSGLLKKREVVEEE-KKKKKKDDDDLGIPP 212
                 E   +T         K  +TA    +S   K+ E  +   +KK  KD   +    
Sbjct: 1135 MKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYV 1194

Query: 213  EIWEL-LKGAKKSEYEKIAFQYGITDLRGMLKR--LKKAKVEVKKSAAFTKKLDPA---Y 266
            E  E  +   ++   ++I ++   T L  +L+    +K  V++ +S A     D     Y
Sbjct: 1195 EDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNY 1254

Query: 267  QVDRGNKIKLMVEISDPDLT-LKWFKNGQEIKPSSKYVFENVGKKRI-LTINKCTLADDA 324
            ++  G  +    ++S   L  + W+K+G+ IK   +Y  + +   R  L I      D+ 
Sbjct: 1255 RILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEG 1314

Query: 325  AYEVAVKDEK----CFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMK 380
             Y     + K    C  +L+V EP   +  P     +    R+      S   + +    
Sbjct: 1315 IYTAFASNIKGNAICSGKLYV-EPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSP 1373

Query: 381  DGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLE 440
              +   R    +        G+R        ++E                    +E QLE
Sbjct: 1374 ARMSPARMSPARMSPARMSPGRR--------LEE-------------------TDESQLE 1406

Query: 441  VLQDIADLTVKASEQAVFKCEVS-----DEKVTGK------WYKNGVEVRP--SKRITIS 487
             L       V   +   FKC        D KV G+      W+ +G ++    + ++ I 
Sbjct: 1407 RLYK----PVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIK 1462

Query: 488  HVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSG 547
              G    L+I    P D G++T V    A   S  +    + VE V  Q  P        
Sbjct: 1463 EDGT-QSLIIVPATPSDSGEWTVVAQNRAGRSSISVI---LTVEAVEHQVKPMFVEKLKN 1518

Query: 548  KTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTE-GRTRIEKRVDCSSFVIE 606
                  + +  G++L + V  TG P P   WLK  ++    +  + RIE     ++  I+
Sbjct: 1519 ------VNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKID 1572

Query: 607  SAQREDEGRYTIKVTNPVGEDVASIFLQV-VDVPDP-PEAVRITSVGEDWAILVWEPPMY 664
            S   +D   YT    N  G D     + V V+  +P PE   I   G   A  +  P + 
Sbjct: 1573 STVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPEL- 1631

Query: 665  DGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQP 724
               +P+        + G ++W                   EG LY+              
Sbjct: 1632 ---EPL------HLRYGQEQWE------------------EGDLYDKEKQQKPFFKKKLT 1664

Query: 725  SMNTKPFMP------IAPTSEPLHLI--VEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
            S+  K F P      + P  +P  ++  + D        + R  N  G   +D Y V Y 
Sbjct: 1665 SLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLD-YGVAYS 1723

Query: 777  LE------------GSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPAT 824
             +            G++          E+       LP G + L R+  +      E A 
Sbjct: 1724 RDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAH-EGAL 1782

Query: 825  LAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTS 884
                   +E  +P  +  P  +R       GE         G P+P+V W   G  +  S
Sbjct: 1783 TGVTTDQKEKQKPDIVLYPEPVRVL----EGETARFRCRVTGYPQPKVNWYLNGQLIRKS 1838

Query: 885  R--------VH----VRTSDFDTVFFVRQAARSDSG--EYELSVQIENMKDTATIRIRV- 929
            +        +H    V    +DT   V+  A +  G  E+++ ++I+  +D  ++  R  
Sbjct: 1839 KRFRVRYDGIHYLDIVDCKSYDT-GEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAP 1897

Query: 930  -----------------VEKAGPPINVM----VKEVWGTNALVEWQAPKDDGNSEIMGYF 968
                             V+K   P++      V ++     +   + P++  + E+   F
Sbjct: 1898 EPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEE--SEELRSKF 1955

Query: 969  VQKADKKTMEWFNVYE-RNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARI 1027
             ++ ++   E     E ++R    +  +L+   +     +T+ +     +    K  A  
Sbjct: 1956 KRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKEL-----TEEEKKALAEE 2010

Query: 1028 LKTGI-TFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKM 1086
             K  I TFKP + +      APK    +  + V  G  A     V G P P+  W KN +
Sbjct: 2011 GKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGV 2070

Query: 1087 EI-REDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVRVPQ 1141
            +I R D  +       V  L IR  +  D+ +   +A+N  GE  +   L V+  Q
Sbjct: 2071 KIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQ 2126



 Score = 65.9 bits (159), Expect = 2e-10
 Identities = 133/651 (20%), Positives = 240/651 (36%), Gaps = 106/651 (16%)

Query: 33   EAPKEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWFKGK 92
            E P+   P+ + P    P  +     D+V+ E G+ A    +V+G +L     + W+   
Sbjct: 3283 EVPEVVSPDQEMPVY--PPAIITPLQDTVTSE-GQPARFQCRVSGTDLK----VSWYSKD 3335

Query: 93   WLELGSKSGARFSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVK--AKDTCDSCGFN 150
                 S+      F++         T +L I +    D G Y             +   +
Sbjct: 3336 KKIKPSRFFRMTQFED---------TYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLS 3386

Query: 151  IDVEAPRQDASGQSLESFKRTSEKKSDTAGELDFSGLLKKREVVEEEKKKKKKDDDDLGI 210
            ++V+A  + +SG+ +         KS    +  F+    K E    +K+ K         
Sbjct: 3387 LEVQALDRQSSGKDVRE-----SAKSQAVADSSFT----KEESKISQKEIKSFQGSSYEY 3437

Query: 211  PPEIWELLKGAKKSEYEKIAFQ----YGITDLRGMLKRLKKAKVEVKKSAAFTKKLDPAY 266
              +++E +  ++ S +   + Q         L  + +  + +K   K+S     K+    
Sbjct: 3438 EVQVFESV--SQSSIHTAASVQDTQLCHTASLSQIAESTELSKECAKESTGEAPKIFLHL 3495

Query: 267  Q---VDRGNKIKLMVEISDPD-LTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLAD 322
            Q   V  G+  + +  + D   + + W   G +I+ S +      G  + LTI    L D
Sbjct: 3496 QDVTVKCGDTAQFLCVLKDDSFIDVTWTHEGAKIEESERLKQSQNGNIQFLTICNVQLVD 3555

Query: 323  DAAYEVAVKDE----KCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMA------VEVSEE 372
               Y   V ++         L V+  P  I+    +Q++     +EM       +   EE
Sbjct: 3556 QGLYSCIVHNDCGERTTSAVLSVEGAPESILHERIEQEI----EMEMKEFSSSFLSAEEE 3611

Query: 373  GA-----QVMWMKDGVELTREDS-FKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGG 426
            G      Q+  + + +EL  E   +  ++  +K+G   I I  +V   D      I+ G 
Sbjct: 3612 GLHSAELQLSKINETLELLSESPVYPTKFDSEKEGTGPIFI-KEVSNAD------ISMG- 3663

Query: 427  QCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITI 486
                             D+A L+V           +   K   +W+ NGV + PS     
Sbjct: 3664 -----------------DVATLSVTV---------IGIPKPKIQWFFNGVLLTPSADYKF 3697

Query: 487  SHVGRFHKLVIDDVRPEDEGDYT-FVPDGYALSLSA---KLN-----FLEIKVEYVPKQE 537
               G  H L+I   + EDEG+YT    + Y  ++ +   K+N       + + E    + 
Sbjct: 3698 VFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKS 3757

Query: 538  PPKIHLDCSGKTSENA--IVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIE 595
              K+   C     +    I    G     + ++ GEP P  TW K ++   T+   T I 
Sbjct: 3758 LEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIH 3817

Query: 596  KRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVAS----IFLQVVDVPDPP 642
                  +F++   QRED G Y  K  N +GE   +    + L+  D+ D P
Sbjct: 3818 NPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLLEDTDMTDTP 3868



 Score = 65.9 bits (159), Expect = 2e-10
 Identities = 51/203 (25%), Positives = 82/203 (40%), Gaps = 17/203 (8%)

Query: 927   IRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN 986
             I   E+  PP  + V +   ++A++ W  P  DG S I GY ++   K +  W       
Sbjct: 22235 IVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEA-GHT 22293

Query: 987   RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRM 1046
             +  + TV  L+   EY FRV  +N  G S+                 F     KE     
Sbjct: 22294 KQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREA-------------FSSVIIKEPQIEP 22340

Query: 1047  APKFLTPLIDRVVV--AGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLT 1104
                 LT + ++++   AG    ++  + G P PKV W   +M ++E  +  IT  +   T
Sbjct: 22341 TAD-LTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTT 22399

Query: 1105  LNIRRPSPFDAGTYTCRAVNELG 1127
             L ++     D+G Y     N  G
Sbjct: 22400 LTVKDSMRGDSGRYFLTLENTAG 22422



 Score = 65.5 bits (158), Expect = 3e-10
 Identities = 33/94 (35%), Positives = 46/94 (48%)

Query: 1048 PKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNI 1107
            P  ++ L +  V+ G S  L C + G+P P V W +   +I     F IT   G+  L I
Sbjct: 897  PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMI 956

Query: 1108 RRPSPFDAGTYTCRAVNELGEALAECKLEVRVPQ 1141
            R     D+G +TC AVNE G     C L V+V +
Sbjct: 957  REAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSE 990



 Score = 65.5 bits (158), Expect = 3e-10
 Identities = 55/219 (25%), Positives = 95/219 (43%), Gaps = 18/219 (8%)

Query: 922   TATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFN 981
             T  + I  +++ G P N+ + +   T   ++W+ P  DG S  + Y V++  K + +W  
Sbjct: 11785 TPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWER 11844

Query: 982   VYERNRHTSCTVSDLIVGNEYY-FRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYK 1040
             V++ +   +  + D  V N+ Y FRV T+N  G SD     K    ++K  +     + K
Sbjct: 11845 VHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDWV---KTEEVVVKEDLQKPVLDLK 11901

Query: 1041  EHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNK--MEIREDPKFLITN 1098
                       L+ ++   V AG +  L   VRG P P+V W K+K   ++   P+  I  
Sbjct: 11902 ----------LSGVL--TVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDT 11949

Query: 1099  YQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
                    ++ +    D G Y   A N  G  +A   + V
Sbjct: 11950 RADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNV 11988



 Score = 65.1 bits (157), Expect = 4e-10
 Identities = 75/317 (23%), Positives = 124/317 (39%), Gaps = 50/317 (15%)

Query: 269   DRGNKIKLMVEISDPDLTLK--WFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
             + G  +K + +I + D + +  W+   ++++ S KY         IL +   T  DD  Y
Sbjct: 25275 EEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTY 25334

Query: 327   EVAV----KDEKCFTELFVK---------------------------EPPVLIVTPLEDQ 355
                V     ++  + ELFVK                           E P     PL ++
Sbjct: 25335 RCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNK 25394

Query: 356   QVFVGDRVEMAVEVS-EEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQE 414
               +VG+ V   V ++      V W K G ++   D+ K +Y F+ D   + L  + V  +
Sbjct: 25395 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDK-KYTFESDKGLYQLTINSVTTD 25453

Query: 415   DRGRYQVITNG----GQCEAELIV------EEKQLEVL--QDIADLTVKASEQAVFKCEV 462
             D   Y V+         C+A+L V       +  L  +  + +A+   +  +   F+  V
Sbjct: 25454 DDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRV 25513

Query: 463   SD-EKVTGKWYKNGVEVRPSKRITISHVG-RFHKLVIDDVRPEDEGDYTFVPDGYALSLS 520
             S     T KW K+G  +     I I H G  ++ L I D  PED G Y       A S S
Sbjct: 25514 SGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTS 25573

Query: 521   AKLNFLEIKVEYVPKQE 537
              + +    ++ Y  KQE
Sbjct: 25574 CQAHLQVERLRY-KKQE 25589



 Score = 60.5 bits (145), Expect = 9e-09
 Identities = 50/196 (25%), Positives = 78/196 (39%), Gaps = 19/196 (9%)

Query: 936   PINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYE-RNRHTSCTVS 994
             P  + V +V  +   + W+ P  DG S + GY ++     T  W  V   +      TV+
Sbjct: 23333 PAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVT 23392

Query: 995   DLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKF-LTP 1053
              L  G +Y FR+  +N  G+S+         R   T +T +       D R+ P   L+ 
Sbjct: 23393 SLNEGEQYLFRIRAQNEKGVSEP--------RETVTAVTVQ-------DLRVLPTIDLST 23437

Query: 1054  LIDRV--VVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPS 1111
             +  +   V AG    L   + G P P   W     ++RE  +  +  +  V  L IR  +
Sbjct: 23438 MPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETT 23497

Query: 1112  PFDAGTYTCRAVNELG 1127
               D G YT    N  G
Sbjct: 23498 IRDTGEYTLELKNVTG 23513



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 69/295 (23%), Positives = 117/295 (39%), Gaps = 27/295 (9%)

Query: 348   IVTPLEDQQVFVGDRVEMAVEV-SEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHIL 406
             I   +   +V  G      + V S+  A+V W  +GVEL  ++S K  Y     G   + 
Sbjct: 26071 ITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVEL--QESSKIHYT-NTSGVLTLE 26127

Query: 407   IFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEK 466
             I  D   +D G Y+ +    + EA             D A L V   +   +  +  DE+
Sbjct: 26128 IL-DCHTDDSGTYRAVCTNYKGEAS------------DYATLDVTGGDYTTYASQRRDEE 26174

Query: 467   VTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDG---YALSLSAKL 523
             V    +    E+  ++   +S   +  ++       E +   T   +    Y  S SA++
Sbjct: 26175 VPRSVFP---ELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEM 26231

Query: 524   NFLEIKVEYVP-KQEPPKIHLDCSGK--TSENAIVVVAGNKLRLDVSITGEPPPVATWLK 580
                 ++ + +  K    KI    + +  T   ++ V  G   R      GEP P  TWL+
Sbjct: 26232 KSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLR 26291

Query: 581   GDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQV 635
               +V +T+  R ++      S+F I S Q  DEG Y++ V N  G+  A   L +
Sbjct: 26292 KGQVLSTS-ARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTI 26345



 Score = 59.3 bits (142), Expect = 2e-08
 Identities = 58/222 (26%), Positives = 88/222 (39%), Gaps = 31/222 (13%)

Query: 439  LEVLQDIADLTVKASE----QAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHK 494
            L+ +++I D+ +  SE     A+F+C VS       W K+G  +R S +      G+  K
Sbjct: 4810 LKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRK 4869

Query: 495  LVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAI 554
            L I DV+  D G+YT V     L    K +  ++ VE +P +           KT E  +
Sbjct: 4870 LHIIDVQLSDAGEYTCV---LRLGNKEKTSTAKLVVEELPVR---------FVKTLEEEV 4917

Query: 555  VVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEG 614
             VV G  L L   +  E   V  W K  ++     GR          +  I  A   D G
Sbjct: 4918 TVVKGQPLYLSCELNKERDVV--WRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAG 4975

Query: 615  RYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAI 656
             YT+ V N    + +S              V++  V  DW +
Sbjct: 4976 TYTVTVENANNLECSS-------------CVKVVEVIRDWLV 5004



 Score = 59.3 bits (142), Expect = 2e-08
 Identities = 118/608 (19%), Positives = 216/608 (35%), Gaps = 90/608 (14%)

Query: 6     PAAKKAPKGKDAPKGAPKEAPPKEAPAEAPKEAPPEDQSPTAEEPT------GVFLKKPD 59
             P   K+P+    P+    EA       ++P+ + P+  SPT  +PT       + +  P 
Sbjct: 26358 PPRVKSPE----PRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPP 26413

Query: 60    SVS----VETGKDAVVVAKVNGKELPDKPTIKWFK-GKWLELGSKSGARFSFKESHNSAS 114
              ++     E  K+   +  V    +     + W+K GK L    K    F F   H SA 
Sbjct: 26414 KITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKL----KENGHFQF---HYSAD 26466

Query: 115   NVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEA-----PRQDASGQSLESFK 169
               Y  EL I  +   D+G Y  E+  +            +A      +     ++ +S +
Sbjct: 26467 GTY--ELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQ 26524

Query: 170   RTSEKKSDTAGELDFSGLLKKREVVEEEKKKKKKDDDDLG----------IPPEIWELLK 219
             +T+E       E      +  + V+    +      D +            P  IW    
Sbjct: 26525 KTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIW---- 26580

Query: 220   GAKKSEYEKIAFQYGITDLRGMLKRLKKAKVEVKKSAAFTKKL-DPAYQVDRGNKIKLMV 278
               K  +      +Y +++ +G    L+  K +   S  +T  + + A  V    K+ +  
Sbjct: 26581 -TKDGKAITQGGKYKLSEDKGGF-FLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKA 26638

Query: 279   EISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTE 338
              I D +      +   EI P  K V +    ++ L   +  +++  + E     E+    
Sbjct: 26639 -IKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKV 26697

Query: 339   LFVKEPPVLIVTPLE---------------------------DQQVFVGDRVEMAVEVSE 371
             L  +E      T LE                             Q+ + +   + ++ + 
Sbjct: 26698 LISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANI 26757

Query: 372   EGA-QVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVI--TNGG-- 426
              GA  V W+ +GVELT  +     YR+   G    L        D G    I  T  G  
Sbjct: 26758 AGATDVKWVLNGVELTNSE----EYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIV 26813

Query: 427   QCEAELIVEEKQLEV---LQDIADLTVKASEQAVFKCEVSDEKVTG-KWYKNGVEVRPSK 482
             +C+ +L + ++  +    +       +   +  +F CE+S E     +W+KN + +  S 
Sbjct: 26814 KCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISS 26873

Query: 483   RITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIH 542
              ++IS     + L I +    D G YT     +    SA  + + + +   P +E   + 
Sbjct: 26874 NVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSRE---VV 26930

Query: 543   LDCSGKTS 550
             L  SG TS
Sbjct: 26931 LRTSGDTS 26938



 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 34/133 (25%), Positives = 59/133 (44%), Gaps = 12/133 (9%)

Query: 605   IESAQREDEGRYTIKVTNPVGEDVAS------IFLQVVDVPDPPEAVRITSVGEDWAILV 658
             +++   + E ++ +K  N +G    S      +    ++ P PP   R+    +    L 
Sbjct: 12152 VQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTKHSITLG 12211

Query: 659   WEPPMYDGGKPVTGYLVERKKK-----GSQRWMKLNFEV-FTETTYESTKMIEGILYEMR 712
             W  P+YDGG P+ GY+VE + K       + W + N         +  T + E   YE R
Sbjct: 12212 WGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFR 12271

Query: 713   VFAVNAIGVSQPS 725
             V A N +G+ +P+
Sbjct: 12272 VCAQNQVGIGRPA 12284



 Score = 56.2 bits (134), Expect = 2e-07
 Identities = 50/208 (24%), Positives = 85/208 (40%), Gaps = 25/208 (12%)

Query: 935   PPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQ-KADKKTMEWFNVYERNRHTSCTV 993
             PP  + V E+   +A + W  P  DG ++I GY    + +++  + +  Y   +  S  V
Sbjct: 12496 PPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYSVVKDLSLVV 12555

Query: 994   SDLIVGNEYYFRVYTENICGLS---DSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKF 1050
             + L  G +Y FRV   N  G+S   ++ GV                  Y+  +  + PK 
Sbjct: 12556 TGLKEGKKYKFRVAARNAVGVSLPREAEGV------------------YEAKEQLLPPKI 12597

Query: 1051  LTPLIDRVVV-AGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRR 1109
             L P  +++ + AG    +   V G P P   W K + E+       +        L I+ 
Sbjct: 12598 LMP--EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKD 12655

Query: 1110  PSPFDAGTYTCRAVNELGEALAECKLEV 1137
              +  D+G Y+  A N  G    + K+ V
Sbjct: 12656 VTRKDSGYYSLTAENSSGTDTQKIKVVV 12683



 Score = 55.1 bits (131), Expect = 4e-07
 Identities = 53/239 (22%), Positives = 92/239 (38%), Gaps = 24/239 (10%)

Query: 907  SGEYELSVQIENMKDTATIRIR-----VVEKAGPPINVMVKEVWGTNALVEWQAPKDDGN 961
            S E E S      ++ AT++I+     ++++ GP I+  + +       +          
Sbjct: 4402 SEEKEESSSESGTEEVATVKIQEAEGGLIKEDGPMIHTPLVDTVSEEGDIVHLTTSITNA 4461

Query: 962  SEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVS 1021
             E+  YF  K      ++  + ++N +T   V D +   ++      E +C   +  G +
Sbjct: 4462 KEVNWYFENKLVPSDEKFKCLQDQNTYT--LVIDKVNTEDHQ----GEYVCEALNDSGKT 4515

Query: 1022 KNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVW 1081
              +A++                 R AP     +    V  G+ A   C ++  P  +  W
Sbjct: 4516 ATSAKLTVVK-------------RAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQW 4562

Query: 1082 MKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVRVP 1140
             K   EI E  K  I + + + +L I R    D G YTC+A NE G       L V VP
Sbjct: 4563 FKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTVP 4621



 Score = 55.1 bits (131), Expect = 4e-07
 Identities = 59/225 (26%), Positives = 87/225 (38%), Gaps = 30/225 (13%)

Query: 927  IRVVEKAGPPIN---VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVY 983
            I  V+  GPP +   +   E   +   ++W+ P+ +G S I GY ++K      ++  V 
Sbjct: 8981 ILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVN 9040

Query: 984  ERN-RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEH 1042
            +R    TS  V +L     Y FRV   N  G S+ P +               P      
Sbjct: 9041 KRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESE-PSL---------------PLNVVIQ 9084

Query: 1043 DFRMAPKFLTPLIDR----VVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFL--- 1095
            D  + P     L  R     V AG    +   V G P PK+ W KN+  I +    L   
Sbjct: 9085 DDEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQIT 9144

Query: 1096 ---ITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
               ++  +    L+I +    D GTYT  A N LG       +EV
Sbjct: 9145 KEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEV 9189



 Score = 55.1 bits (131), Expect = 4e-07
 Identities = 72/327 (22%), Positives = 125/327 (38%), Gaps = 24/327 (7%)

Query: 518   SLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVAT 577
             +L  +  + EI     PK + P I      +   N  V    N   L   +TG P P+  
Sbjct: 24598 NLGGESEWSEISEPITPKSDVP-IQAPHFKEELRNLNVRYQSNAT-LVCKVTGHPKPIVK 24655

Query: 578   WLKGDEVFTTTEGRTRIEK-RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQV- 635
             W +  +       + RI++ +      +I S   +D   Y ++ TN  G    +  L+V 
Sbjct: 24656 WYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVE 24715

Query: 636   ----VDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFE 691
                 + +P   E +          + +  P     GKP    ++  +K         +++
Sbjct: 24716 VPAKIHLPKTLEGMGAVHALRGEVVSIKIP---FSGKPDP--VITWQKGQDLIDNNGHYQ 24770

Query: 692   VFTETTYESTKMIEGILYEMRVFAV----NAIGVSQPSMNTKPFMPIAPTSEPLHLI-VE 746
             V    ++ S     G+  +   F V    N  G+ Q ++     + +A   +P   + V 
Sbjct: 24771 VIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVE----LDVADVPDPPRGVKVS 24826

Query: 747   DVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGAR 806
             DV+  +  L W  P   G   I  Y+VE C   +E W+        R  +TV NL     
Sbjct: 24827 DVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQARETR--YTVINLFGKTS 24884

Query: 807   ILFRVVGVNIAGRSEPATLAQPVTIRE 833
               FRV+  N  G S+P+  ++P   +E
Sbjct: 24885 YQFRVIAENKFGLSKPSEPSEPTITKE 24911



 Score = 51.2 bits (121), Expect = 5e-06
 Identities = 68/310 (21%), Positives = 115/310 (37%), Gaps = 56/310 (18%)

Query: 367   VEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQ--VITN 424
             +E  ++  QV W     +L   + ++  Y   +DG   IL   D+ + D G Y+  V+ +
Sbjct: 25286 IENYDQSTQVTWYFGVRQLENSEKYEITY---EDGVA-ILYVKDITKLDDGTYRCKVVND 25341

Query: 425   GGQCE--AELIVE---------------------------EKQLEVLQDIADLTVKASEQ 455
              G+    AEL V+                           E+  E    + + T    E 
Sbjct: 25342 YGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGEN 25401

Query: 456   AVFKCEVS---DEKVTGKWYKNGVEVRPS---KRITISHVGRFHKLVIDDVRPEDEGDYT 509
               F   ++   +  VT  WYK+G +++P    K+ T       ++L I+ V  +D+ +YT
Sbjct: 25402 VRFGVTITVHPEPHVT--WYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYT 25459

Query: 510   FVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVA----GNKLRLD 565
              V        S K          V    PP    D + +     ++  A    G  +  +
Sbjct: 25460 VVARNKYGEDSCKAKLT------VTLHPPPT---DSTLRPMFKRLLANAECQEGQSVCFE 25510

Query: 566   VSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVG 625
             + ++G PPP   W K  +  +       I + +D  +  I     ED G Y +  TN  G
Sbjct: 25511 IRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAG 25570

Query: 626   EDVASIFLQV 635
                    LQV
Sbjct: 25571 STSCQAHLQV 25580



 Score = 49.3 bits (116), Expect = 2e-05
 Identities = 49/204 (24%), Positives = 86/204 (42%), Gaps = 17/204 (8%)

Query: 443 QDIADLTVKASEQAVFKCEVSDEKVTG-KWYKNGVEVRPSKR--ITISHVGRFHKLVIDD 499
           Q +  + V     A F+  +S   V    W+++G  +  S    + IS      KL I  
Sbjct: 10  QPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPA 69

Query: 500 VRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAG 559
           V   + G Y+      +   ++    L +K E  P     ++           ++ V  G
Sbjct: 70  VTKANSGRYSLKATNGSGQATSTAELL-VKAETAPPNFVQRLQ----------SMTVRQG 118

Query: 560 NKLRLDVSITGEPPPVATWLK-GDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTI 618
           +++RL V +TG P PV  + + G E+ ++ +   +I +  D  S +I  A  ED G Y++
Sbjct: 119 SQVRLQVRVTGIPTPVVKFYRDGAEIQSSLD--FQISQEGDLYSLLIAEAYPEDSGTYSV 176

Query: 619 KVTNPVGEDVASIFLQVVDVPDPP 642
             TN VG   ++  L V    + P
Sbjct: 177 NATNSVGRATSTAELLVQGEEEVP 200



 Score = 49.3 bits (116), Expect = 2e-05
 Identities = 30/92 (32%), Positives = 40/92 (43%), Gaps = 1/92 (1%)

Query: 1048 PKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNI 1107
            P  +TPL D V   G  A   C V G    KV W     +I+    F +T ++    L I
Sbjct: 3299 PAIITPLQDTVTSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQLEI 3357

Query: 1108 RRPSPFDAGTYTCRAVNELGEALAECKLEVRV 1139
                P D GTYT  A N +G+  +   L + V
Sbjct: 3358 AEAYPEDEGTYTFVASNAVGQVSSTANLSLEV 3389



 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 46/167 (27%), Positives = 77/167 (46%), Gaps = 10/167 (5%)

Query: 351 PLEDQQVFVGDRVEMAVEVSEEGA-QVMWMKDGVELTREDSFKARYRFKKDGKRHILIFS 409
           PL+   V  G        +S     +V W +DG  ++       +  F  DG+  + I +
Sbjct: 11  PLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFS-DGRAKLTIPA 69

Query: 410 DVVQEDRGRYQV-ITNG-GQCE--AELIVEEKQL--EVLQDIADLTVKASEQAVFKCEVS 463
            V + + GRY +  TNG GQ    AEL+V+ +      +Q +  +TV+   Q   +  V+
Sbjct: 70  -VTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVT 128

Query: 464 DEKV-TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYT 509
                  K+Y++G E++ S    IS  G  + L+I +  PED G Y+
Sbjct: 129 GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYS 175



 Score = 48.5 bits (114), Expect = 4e-05
 Identities = 29/94 (30%), Positives = 40/94 (42%)

Query: 1048 PKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNI 1107
            P+ L  L    V +G  A     + G P+PK+ W K +  +    K    +     TL +
Sbjct: 3193 PQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLL 3252

Query: 1108 RRPSPFDAGTYTCRAVNELGEALAECKLEVRVPQ 1141
                P DA  YTC A N+ G A     L V VP+
Sbjct: 3253 IEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPE 3286



 Score = 48.5 bits (114), Expect = 4e-05
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 3/93 (3%)

Query: 1048  PKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIR---EDPKFLITNYQGVLT 1104
             P+F  PL ++    G +      +  HP+P V W K+  +I+    D K+   + +G+  
Sbjct: 25385 PEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQ 25444

Query: 1105  LNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
             L I   +  D   YT  A N+ GE   + KL V
Sbjct: 25445 LTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 25477



 Score = 48.5 bits (114), Expect = 4e-05
 Identities = 76/332 (22%), Positives = 117/332 (35%), Gaps = 51/332 (15%)

Query: 243   KRLKKAKVEVKKSAAFTKKLDP-------AYQVDRGNKIKLMVEI-SDPDLTLKWFKNGQ 294
             ++  + K EV     FT    P       +++V  G   + ++ + S P   +KW+ NG 
Sbjct: 26048 QKTSERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGV 26107

Query: 295   EIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTPLED 354
             E++ SSK  + N      L I  C   D   Y     + K     +      L VT    
Sbjct: 26108 ELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYA----TLDVTG--- 26160

Query: 355   QQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGK-------RHILI 407
                  GD    A +  +E           ELTR +++ A   FKK  +       R +  
Sbjct: 26161 -----GDYTTYASQRRDEEVPRSVFP---ELTRTEAY-AVSSFKKTSEMEASSSVREVKS 26211

Query: 408   FSDVVQEDRGRYQVITNGGQCEAELIVEEKQLE---------------VLQDIADLTVKA 452
                  +E    Y+   +     A L  EEK LE               +L     +TV  
Sbjct: 26212 QMTETRESLSSYEHSASAEMKSAAL--EEKSLEEKSTTRKIKTTLAARILTKPRSMTVYE 26269

Query: 453   SEQAVFKCEVSDEKV-TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFV 511
              E A F C+   E V T  W + G  +  S R  ++         I  V+  DEG+Y+ V
Sbjct: 26270 GESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVV 26329

Query: 512   PDGYALSLSAKLNFLEIKVEYVPK--QEPPKI 541
              +       A+      K     K    PP++
Sbjct: 26330 VENSEGKQEAEFTLTIQKARVTEKAVTSPPRV 26361



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 30/91 (32%), Positives = 40/91 (43%)

Query: 1047  APKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLN 1106
             AP+    +    V  G +      V+  P  +V W  N +E++E  K   TN  GVLTL 
Sbjct: 26068 APRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLE 26127

Query: 1107  IRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
             I      D+GTY     N  GEA     L+V
Sbjct: 26128 ILDCHTDDSGTYRAVCTNYKGEASDYATLDV 26158



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 47/176 (26%), Positives = 78/176 (44%), Gaps = 12/176 (6%)

Query: 341  VKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKD 400
            +KE   +I TPL D     GD V +   ++    +V W  +   +  ++ FK      +D
Sbjct: 4430 IKEDGPMIHTPLVDTVSEEGDIVHLTTSITN-AKEVNWYFENKLVPSDEKFKCL----QD 4484

Query: 401  GKRHILIFSDVVQED-RGRY--QVITNGGQC--EAELIVEEKQLEVLQ-DIADLTVKASE 454
               + L+   V  ED +G Y  + + + G+    A+L V ++   V++  I  L V    
Sbjct: 4485 QNTYTLVIDKVNTEDHQGEYVCEALNDSGKTATSAKLTVVKRAAPVIKRKIEPLEVALGH 4544

Query: 455  QAVFKCEV-SDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYT 509
             A F CE+ S   V  +W+K G E+  S + +I        L I   +  D G+YT
Sbjct: 4545 LAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYT 4600



 Score = 45.4 bits (106), Expect = 3e-04
 Identities = 34/93 (36%), Positives = 43/93 (46%), Gaps = 3/93 (3%)

Query: 1032 ITFKPFEYKEHDFRMAP--KFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIR 1089
            +T K F+   + F   P  +F  PL D+ V  G +A L C V      KV W KN  EI 
Sbjct: 5962 LTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEV-SRENAKVKWFKNGTEIL 6020

Query: 1090 EDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRA 1122
            +  K+ I     V  L I   +P D  TYTC A
Sbjct: 6021 KSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDA 6053



 Score = 44.7 bits (104), Expect = 5e-04
 Identities = 48/210 (22%), Positives = 76/210 (36%), Gaps = 28/210 (13%)

Query: 457   VFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTF-VPDGY 515
             V K E  D+     WY    ++  S++  I++      L + D+   D+G Y   V + Y
Sbjct: 25283 VCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDY 25342

Query: 516   ALSLSAKLNFL----EIKVEYVPK---------------QEPPKIHLDCSGKTSENAIVV 556
                 S    F+    E+   Y  +               + PP+  L    KT+      
Sbjct: 25343 GEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTA------ 25396

Query: 557   VAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSF--VIESAQREDEG 614
               G  +R  V+IT  P P  TW K  +     +   +     D   +   I S   +D+ 
Sbjct: 25397 YVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDA 25456

Query: 615   RYTIKVTNPVGEDVASIFLQVVDVPDPPEA 644
              YT+   N  GED     L V   P P ++
Sbjct: 25457 EYTVVARNKYGEDSCKAKLTVTLHPPPTDS 25486



 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 28/91 (30%), Positives = 42/91 (46%)

Query: 1048 PKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNI 1107
            P F+  L    V  G    L   V G P P V + ++  EI+    F I+    + +L I
Sbjct: 104  PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLI 163

Query: 1108 RRPSPFDAGTYTCRAVNELGEALAECKLEVR 1138
                P D+GTY+  A N +G A +  +L V+
Sbjct: 164  AEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 29/91 (31%), Positives = 38/91 (41%), Gaps = 1/91 (1%)

Query: 1048 PKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKF-LITNYQGVLTLN 1106
            P FL  L       G  A     V G P P V W K   ++     + +I N  G  T  
Sbjct: 3767 PHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFI 3826

Query: 1107 IRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
            +  P   D+G Y C+A N LGE+    +L V
Sbjct: 3827 VNDPQREDSGLYICKAENMLGESTCAAELLV 3857



 Score = 43.1 bits (100), Expect = 0.001
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 2/94 (2%)

Query: 1047 APKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIRED--PKFLITNYQGVLT 1104
            AP F  PL   VV+ G +A     + G P P+V W ++   I     P   I+   G   
Sbjct: 5    APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK 64

Query: 1105 LNIRRPSPFDAGTYTCRAVNELGEALAECKLEVR 1138
            L I   +  ++G Y+ +A N  G+A +  +L V+
Sbjct: 65   LTIPAVTKANSGRYSLKATNGSGQATSTAELLVK 98



 Score = 42.7 bits (99), Expect = 0.002
 Identities = 39/170 (22%), Positives = 75/170 (44%), Gaps = 9/170 (5%)

Query: 553 AIVVVAGNKLRLDVSITGEPPPVATWLK-GDEVFTTTEGRTRIEKRVDCSSFVIESAQRE 611
           ++VV+ G+    +  I+G P P  +W + G  + T+T    +I      +   I +  + 
Sbjct: 14  SVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKA 73

Query: 612 DEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVT 671
           + GRY++K TN  G+  ++  L V     PP  V+        ++ V +         VT
Sbjct: 74  NSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQ-----SMTVRQGSQVRLQVRVT 128

Query: 672 GY---LVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNA 718
           G    +V+  + G++    L+F++  E    S  + E    +   ++VNA
Sbjct: 129 GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNA 178



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 61/285 (21%), Positives = 104/285 (36%), Gaps = 41/285 (14%)

Query: 389  DSFKARYRFKKDGKRHILIFSDVVQEDR-----GRYQVITNGGQCEAELIVEEKQLEVLQ 443
            D++K+    +   +  + I    V+E+R     GR   +T   +  A + +      ++ 
Sbjct: 842  DTYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVS 901

Query: 444  DIADLTVKASEQAVFKCEVSD-EKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRP 502
             + ++TV   E    +C +S     T  WY+   ++  S    I+      +L+I +   
Sbjct: 902  GLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFA 961

Query: 503  EDEGDYTFVPDGYALSLSAKLNFLEIKV-EYVPKQ----------------EPPKIHLDC 545
            ED G +T      A ++S    +L ++V E   K+                E   + +  
Sbjct: 962  EDSGRFTCSAVNEAGTVSTSC-YLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTD 1020

Query: 546  SGKTSENA--------------IV--VVAGNKLRLDVSITGEPPPVATWLKGDEVFTT-T 588
            +  T E A              +V  +V G  +     + G P P   W K     TT  
Sbjct: 1021 TSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGY 1080

Query: 589  EGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFL 633
              +    K+      VI     +D G YTI V N  GE  AS  L
Sbjct: 1081 RYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1125



 Score = 40.4 bits (93), Expect = 0.010
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 3/83 (3%)

Query: 554 IVVVAGNKLRLDVSITGEPPPVATWLKGD-EVFTTTEGRTRIEKRVDCSSFVIESAQRED 612
           + V+ G  + L+  I+G P P  TW + D ++ ++ + +   +  +  +  +I  A  ED
Sbjct: 906 VTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGI--ARLMIREAFAED 963

Query: 613 EGRYTIKVTNPVGEDVASIFLQV 635
            GR+T    N  G    S +L V
Sbjct: 964 SGRFTCSAVNEAGTVSTSCYLAV 986



 Score = 39.3 bits (90), Expect = 0.022
 Identities = 27/104 (25%), Positives = 45/104 (43%), Gaps = 4/104 (3%)

Query: 1036 PFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEI--REDPK 1093
            P ++        P F+  + +  +  G  A L+  V G PKPK+ W  N + +    D K
Sbjct: 3637 PTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYK 3696

Query: 1094 FLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
            F+       L +   +    D G YTC A N+ G+ +    L++
Sbjct: 3697 FVFDGDDHSLIILFTKLE--DEGEYTCMASNDYGKTICSAYLKI 3738



 Score = 38.9 bits (89), Expect = 0.028
 Identities = 19/61 (31%), Positives = 31/61 (50%)

Query: 1078  KVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
             +V W     ++    K+ IT   GV  L ++  +  D GTY C+ VN+ GE  +  +L V
Sbjct: 25294 QVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFV 25353

Query: 1138  R 1138
             +
Sbjct: 25354 K 25354



 Score = 38.1 bits (87), Expect = 0.048
 Identities = 48/197 (24%), Positives = 83/197 (42%), Gaps = 29/197 (14%)

Query: 287 LKWFKNGQEIK----PSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEK----CFTE 338
           + WF++GQ I     P  +  F +   K  LTI   T A+   Y +   +         E
Sbjct: 37  VSWFRDGQVISTSTLPGVQISFSDGRAK--LTIPAVTKANSGRYSLKATNGSGQATSTAE 94

Query: 339 LFVKEP--PVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVM-WMKDGVELTREDSFKARY 395
           L VK    P   V  L+   V  G +V + V V+     V+ + +DG E+     F+   
Sbjct: 95  LLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQ--- 151

Query: 396 RFKKDGKRHILIFSDVVQEDRGRYQV-ITNG---GQCEAELIVEEKQLEVLQDIADLTVK 451
              ++G  + L+ ++   ED G Y V  TN        AEL+V+ ++        ++  K
Sbjct: 152 -ISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEE--------EVPAK 202

Query: 452 ASEQAVFKCEVSDEKVT 468
            ++  V   ++S+ + T
Sbjct: 203 KTKTIVSTAQISESRQT 219



 Score = 37.7 bits (86), Expect = 0.063
 Identities = 28/105 (26%), Positives = 41/105 (39%), Gaps = 14/105 (13%)

Query: 830   TIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVR 889
             T+R +  PP+  LP + +  Y   VGE +   V     P P V W K G         ++
Sbjct: 25377 TMRLLERPPEFTLPLYNKTAY---VGENVRFGVTITVHPEPHVTWYKSGQ-------KIK 25426

Query: 890   TSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAG 934
               D D     +    SD G Y+L++      D A   +    K G
Sbjct: 25427 PGDNDK----KYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYG 25467



 Score = 37.4 bits (85), Expect = 0.082
 Identities = 25/97 (25%), Positives = 41/97 (42%), Gaps = 21/97 (21%)

Query: 237   DLRGMLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEI-SDPDLTLKWFKNGQE 295
             DLRG+ ++L  AK                     G+ IK+ + +   P  T+ W K  Q 
Sbjct: 14761 DLRGIYQKLVIAKA--------------------GDNIKVEIPVLGRPKPTVTWKKGDQI 14800

Query: 296   IKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKD 332
             +K + +  FE      IL IN+C  +D   Y +  ++
Sbjct: 14801 LKQTQRVNFETTATSTILNINECVRSDSGPYPLTARN 14837



 Score = 37.0 bits (84), Expect = 0.11
 Identities = 28/93 (30%), Positives = 40/93 (43%), Gaps = 22/93 (23%)

Query: 1006 VYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSA 1065
            VYT  + G        K +AR+  TGI  K              F++PL D+ V  G +A
Sbjct: 5248 VYTAEVEG-------KKTSARLFVTGIRLK--------------FMSPLEDQTVKEGETA 5286

Query: 1066 ALNCAVRGHPKPKVVWMKNKMEIREDPKFLITN 1098
               C +  H K  VVW KN  ++      LI++
Sbjct: 5287 TFVCEL-SHEKMHVVWFKNDAKLHTSRTVLISS 5318



 Score = 37.0 bits (84), Expect = 0.11
 Identities = 24/82 (29%), Positives = 31/82 (37%), Gaps = 1/82 (1%)

Query: 252   VKKSAAFTKKLDPAYQVDRGNKIKLMVEISD-PDLTLKWFKNGQEIKPSSKYVFENVGKK 310
             V  S     KL     V  G  ++    I   P  T KW  +G EIK    Y  E     
Sbjct: 11201 VPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFS 11260

Query: 311   RILTINKCTLADDAAYEVAVKD 332
              +LTI  C   D   Y++ V +
Sbjct: 11261 SVLTIKNCLRRDTGEYQITVSN 11282



 Score = 36.2 bits (82), Expect = 0.18
 Identities = 57/267 (21%), Positives = 99/267 (37%), Gaps = 40/267 (14%)

Query: 874  WTKGGAPLD-TSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEK 932
            W + G  L  T+ +   +        +      D GEY  + ++   K +A +++  V+ 
Sbjct: 2606 WLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEY--TYKVATSKTSAKLKVEAVKI 2663

Query: 933  AGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCT 992
                 N+ V E       VE   P   G   I    V ++++K    + +  +    S  
Sbjct: 2664 KKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEK----YAISVKGTIYSLR 2719

Query: 993  VSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLT 1052
            + +  + +E    VY   +  L  S  +   T +I+K                  PK +T
Sbjct: 2720 IKNCAIVDE---SVYGFRLGRLGASARLHVETVKIIKK-----------------PKDVT 2759

Query: 1053 PLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSP 1112
             L +  V    S +       H    V W    +EI+   K  + + + V  L ++  SP
Sbjct: 2760 ALENATVAFEVSVS-------HDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISP 2812

Query: 1113 FDAGTYTCRAVNELGEALAECKLEVRV 1139
             DAG YT   V +L     ECK ++ V
Sbjct: 2813 SDAGEYTA-VVGQL-----ECKAKLFV 2833



 Score = 36.2 bits (82), Expect = 0.18
 Identities = 27/97 (27%), Positives = 38/97 (39%), Gaps = 3/97 (3%)

Query: 1043  DFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGV 1102
             D  + P F   L +     G S      V G P P + W K+   +   P   I  ++G+
Sbjct: 25485 DSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEII-HEGL 25543

Query: 1103  --LTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
                 L+IR   P D G Y   A N  G    +  L+V
Sbjct: 25544 DYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 25580



 Score = 34.7 bits (78), Expect = 0.53
 Identities = 33/109 (30%), Positives = 47/109 (43%), Gaps = 8/109 (7%)

Query: 243  KRLKKAKVEVKKSAA--FTKKLDPAYQVDRGNKIKLMVEI-SDPDLTLKWFKNGQEIKPS 299
            K    AK+ V K AA    +K++P  +V  G+  K   EI S P++  +WFK G+EI  S
Sbjct: 4514 KTATSAKLTVVKRAAPVIKRKIEPL-EVALGHLAKFTCEIQSAPNVRFQWFKAGREIYES 4572

Query: 300  SKYVFENVGKKRILTINKCTLADDAAYEVAVKDE----KCFTELFVKEP 344
             K    +      L I +  + D   Y     +E     C   L V  P
Sbjct: 4573 DKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTVP 4621



 Score = 33.5 bits (75), Expect = 1.2
 Identities = 22/92 (23%), Positives = 37/92 (40%), Gaps = 3/92 (3%)

Query: 848 QTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSR---VHVRTSDFDTVFFVRQAAR 904
           Q+ +   G          G P P+V W + G  + TS    V +  SD      +    +
Sbjct: 13  QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTK 72

Query: 905 SDSGEYELSVQIENMKDTATIRIRVVEKAGPP 936
           ++SG Y L     + + T+T  + V  +  PP
Sbjct: 73  ANSGRYSLKATNGSGQATSTAELLVKAETAPP 104



 Score = 32.7 bits (73), Expect = 2.0
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 268   VDRGNKIKLMVEISD-PDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
             V  G  ++L++ I+  P     WF  G +++ S +   E   K   LTI + T+ D   Y
Sbjct: 23445 VPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEY 23504

Query: 327   EVAVKD 332
              + +K+
Sbjct: 23505 TLELKN 23510



 Score = 32.3 bits (72), Expect = 2.6
 Identities = 22/91 (24%), Positives = 39/91 (42%), Gaps = 3/91 (3%)

Query: 873  VWTKGGAPLDTS-RVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVE 931
            VW K G  +  S RVH+       +  +    + D+G Y  ++    +  +  + +  V+
Sbjct: 2341 VWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVD 2400

Query: 932  KAGPPINVMVKEVWGTNALVEWQAPKDDGNS 962
               P  +V V E  GT A++E +    D  S
Sbjct: 2401 VITPLKDVNVIE--GTKAVLECKVSVPDVTS 2429



 Score = 32.0 bits (71), Expect = 3.4
 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 268  VDRGNKIKLMVEI-SDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
            V  G K+ + V   + P  T+ W K+G+E+K S +   +N      L + K   AD   Y
Sbjct: 8093 VIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIY 8152

Query: 327  EVAVKDE 333
             + ++++
Sbjct: 8153 TITLENK 8159



 Score = 31.6 bits (70), Expect = 4.5
 Identities = 31/122 (25%), Positives = 49/122 (40%), Gaps = 6/122 (4%)

Query: 1009 ENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPK-----FLTPLIDRVVVAGY 1063
            +N+C L      ++++A I+   I     E   H F +        F   L D V     
Sbjct: 2085 DNVCELVIRDVTAEDSASIMVKAINIAG-ETSSHAFLLVQAKQLITFTQELQDVVAKEKD 2143

Query: 1064 SAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAV 1123
            + A        P  KV W K+ ME+ E  K+ + + + V  L+I      DA  Y+C  V
Sbjct: 2144 TMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLV 2203

Query: 1124 NE 1125
             +
Sbjct: 2204 ED 2205



 Score = 31.6 bits (70), Expect = 4.5
 Identities = 60/257 (23%), Positives = 100/257 (38%), Gaps = 50/257 (19%)

Query: 45    PTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWFK-GKWLELGSKSGAR 103
             PT      +F +   +   + G+      +V+G  +P  PT+KW K G+ L LG      
Sbjct: 25483 PTDSTLRPMFKRLLANAECQEGQSVCFEIRVSG--IPP-PTLKWEKDGQPLSLGPNI--- 25536

Query: 104   FSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPR-QDASG 162
                 E  +   + Y   LHI   +  D GYYR+         SC  ++ VE  R +    
Sbjct: 25537 ----EIIHEGLDYYA--LHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQEF 25590

Query: 163   QSLESFKRTSEKKSDTAGELDFSGLLKKREVV--EEEKKKKKKDDDDLGIPPEIWELLKG 220
             +S E  +R  +K+ D    L  + +L   E V   +  K+  ++   L  P    + +KG
Sbjct: 25591 KSKEEHERHVQKQIDKT--LRMAEILSGTESVPLTQVAKEALREAAVLYKPAVSTKTVKG 25648

Query: 221   ------AKKSEYEKIAFQYGITDLRGMLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNKI 274
                    +K E  K+   Y + + R    + K+  +E                     +I
Sbjct: 25649 EFRLEIEEKKEERKLRMPYDVPEPR----KYKQTTIE------------------EDQRI 25686

Query: 275   KLMVEISDPDLTLKWFK 291
             K  V +SD    +KW+K
Sbjct: 25687 KQFVPMSD----MKWYK 25699



 Score = 31.2 bits (69), Expect = 5.9
 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 1/67 (1%)

Query: 261  KLDPAYQVDRGNKIKLMVEISD-PDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCT 319
            KL     V  G KI+L   ++  P+  + W K    +K   +   ENV KK  +TI    
Sbjct: 7390 KLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSK 7449

Query: 320  LADDAAY 326
             +D   Y
Sbjct: 7450 RSDTGTY 7456



 Score = 30.8 bits (68), Expect = 7.7
 Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 1/72 (1%)

Query: 1049 KFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIR 1108
            +FL PL D  V     A   C +      KV W K+  EI++  K+ I +   V  L I 
Sbjct: 6070 EFLRPLTDLQVREKEMARFECEL-SRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVIN 6128

Query: 1109 RPSPFDAGTYTC 1120
            +    D   Y+C
Sbjct: 6129 KCLLDDEAEYSC 6140


>gi|110349713 titin isoform novex-1 [Homo sapiens]
          Length = 27051

 Score =  275 bits (704), Expect = 1e-73
 Identities = 222/790 (28%), Positives = 337/790 (42%), Gaps = 43/790 (5%)

Query: 279  EISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTE 338
            ++S     +KW++NG+EIK   KY FE  G    L I  C L D+  Y   V+D K    
Sbjct: 6473 QLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRAR 6532

Query: 339  LFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFK 398
            LFV+E PV I+ P +D     G  V    E++++  +V W+++ + + + D    +++  
Sbjct: 6533 LFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGD----KHQMM 6588

Query: 399  KDGKRHILIFSDVVQEDRGRYQVITNGGQCEA--ELIVEEKQLEVLQDIA-----DLTVK 451
             +GK H L   D+   D+G Y+ I    +  A  EL    K     QD+       LT+ 
Sbjct: 6589 SEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAPKIKTADQDLVVDVGKPLTMV 6648

Query: 452  ASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFV 511
                A  K E        +W+K   E  P    TI          I + +  D+G Y  V
Sbjct: 6649 VPYDAYPKAEA-------EWFK---ENEPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIV 6698

Query: 512  PDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGE 571
                       +N   I V    +        D     +    +   G+K+ +   +   
Sbjct: 6699 LQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKI-IGYVVERR 6757

Query: 572  PPPVATWLKGDEVFTTTEGR-TRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVAS 630
                 TW+   +   + E   T ++K      F + +  R   G   ++  NPV  +  S
Sbjct: 6758 DIKRKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGE-PVETDNPV--EARS 6814

Query: 631  IFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRW---MK 687
             +    DVP PP  V IT V      L WEPP YDGG  +T Y++E + K S RW   M 
Sbjct: 6815 KY----DVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMT 6870

Query: 688  LNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM----PIAPTSEPLHL 743
            +  E  + T    T ++EG  Y  RV A N IGV +PS  T PF+    PI   S P++L
Sbjct: 6871 VRAEDLSATV---TDVVEGQEYSFRVRAQNRIGVGKPSAAT-PFVKVADPIERPSPPVNL 6926

Query: 744  IVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPT 803
               D T ++  LKW PP + G   I GY++E C EG + W+  N + V    + V  L  
Sbjct: 6927 TSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEK 6986

Query: 804  GARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVP 863
            G + L+RV   N AG S+P+ +  P+T  +    P + L        +  V   + ++VP
Sbjct: 6987 GNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVI-VPNPITILVP 7045

Query: 864  FQGKPRPQVVWTKGGAPLDTS-RVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDT 922
              G PRP   W  G   L+T  RV ++T        +  + RSD G Y L ++      +
Sbjct: 7046 STGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTIS 7105

Query: 923  ATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNV 982
              I + V+ +   P  +   ++   +  + W+ P DDG S + GY V+K +     W  V
Sbjct: 7106 GEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV 7165

Query: 983  YERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEH 1042
             +       TV DL+ G EY F+V   N CG  +   V +         +   P   K  
Sbjct: 7166 MDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWR 7225

Query: 1043 DFRMAPKFLT 1052
            D      FLT
Sbjct: 7226 DRTANSIFLT 7235



 Score =  274 bits (701), Expect = 3e-73
 Identities = 167/480 (34%), Positives = 243/480 (50%), Gaps = 13/480 (2%)

Query: 537   EPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEK 596
             EPP+I LD   +     +V+ A   LRL V+I G P P   W K + + T    R +IE 
Sbjct: 18731 EPPEIELDADLR---KVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILTD---RAQIEV 18784

Query: 597   RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAI 656
                 +  VI++  R D GRY + + N  G   A + ++V+D P  P  + I  V +D   
Sbjct: 18785 TSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVT 18844

Query: 657   LVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAV 716
             L WEPP+ DGG  +T Y+VE+++   + +  +     T+TT+    + EG  Y  RV A 
Sbjct: 18845 LSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNC-TKTTFRIENLQEGCSYYFRVLAS 18903

Query: 717   NAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
             N  G+  P+  T+P     P   P  + + DVT  T T+KW  P   G   I GY+VE  
Sbjct: 18904 NEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQ 18963

Query: 777   LEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAE 836
              +GSE+W  +    V+    T+  L  G   +FRV  VN  GRS+P  L  PV  R+I  
Sbjct: 18964 TKGSEKW--STCTQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEI 19021

Query: 837   PPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVRTSDFDT 895
              P + LP H   T+  K  EQL + VPF+G+P+  V W K G  L +T+RV+V +S   T
Sbjct: 19022 KPSVELPFH---TFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVT 19078

Query: 896   VFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQA 955
                +++A++ D G YEL V       T  I I V+++ GPP  + + EV   +  + W  
Sbjct: 19079 SLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPPGPIRIDEVSCDSITISWNP 19138

Query: 956   PKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLS 1015
             P+ DG  +I  Y V+K +  +  W  V +    TS  +  L  G+EY FRV  EN  G S
Sbjct: 19139 PEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKS 19198



 Score =  265 bits (678), Expect = 1e-70
 Identities = 169/568 (29%), Positives = 272/568 (47%), Gaps = 23/568 (4%)

Query: 535   KQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRI 594
             K E P++ LD   +     IVV AG   R+ +   G P P  TW + +  FT    + +I
Sbjct: 17646 KLEAPELDLDSELR---KGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTD---KVQI 17699

Query: 595   EKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDW 654
             EK V+ +   I++  R D G+Y +K+ N  G   A + ++V+D P PP+ + +  V +D 
Sbjct: 17700 EKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDS 17759

Query: 655   AILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVF 714
             A LVWEPP+ DGG  V  Y++++++   + +  ++ +  ++T+++   + EG +Y  RV 
Sbjct: 17760 AFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKC-SKTSFKVENLTEGAIYYFRVM 17818

Query: 715   AVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
             A N  GV  P           P S P  + + DV+ T+ +L W  P   G   + GY+VE
Sbjct: 17819 AENEFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVE 17878

Query: 775   YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREI 834
                +G+E+W       V  C   V  L +G    FRV   N  G+S+P  L  PV  +++
Sbjct: 17879 MQPKGTEKWSIVAESKV--CNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDL 17936

Query: 835   AEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVRTSDF 893
                P ++LP +   TY  + GE L + +P  G+PRP + W K G PL  T+RV+V  +  
Sbjct: 17937 TIQPSLKLPFN---TYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETAT 17993

Query: 894   DTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTNALVE 952
              TV  +++  + D G+Y ++        T  + + V+EK GPP+  V   EV     ++ 
Sbjct: 17994 STVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVSADFVVIS 18053

Query: 953   WQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENIC 1012
             W+ P   G  +I  Y V+K D  T  W  V      T+  ++ L  G EY FR++ EN  
Sbjct: 18054 WEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRY 18113

Query: 1013  GLS---DSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNC 1069
             G S   DS  V        + G    PF       +M  ++  P+ D     G +  +  
Sbjct: 18114 GKSAPLDSKAVIVQYP-FKEPGPPGTPFVTSISKDQMLVQWHEPVND-----GGTKIIGY 18167

Query: 1070  AVRGHPKPKVVWMKNKMEIREDPKFLIT 1097
              +    K  ++W+K      +D KF  T
Sbjct: 18168 HLEQKEKNSILWVKLNKTPIQDTKFKTT 18195



 Score =  261 bits (668), Expect = 2e-69
 Identities = 175/561 (31%), Positives = 269/561 (47%), Gaps = 37/561 (6%)

Query: 471   WYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKV 530
             W+  G ++R S+R+T+    +  KL I +    D G+YT        + S       IKV
Sbjct: 23400 WFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSET-----IKV 23454

Query: 531   EYVPKQEPPK--IHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPV--ATWLKG---DE 583
               + K  PP   I +D    TS               ++I+ EPP +     L G   ++
Sbjct: 23455 IILDKPGPPTGPIKIDEIDATS---------------ITISWEPPELDGGAPLSGYVVEQ 23499

Query: 584   VFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNP--VGEDVASIFLQV---VDV 638
                   G   + + V  S+F        +E  + +  TN   +G  + S  ++    + +
Sbjct: 23500 RDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIECRSSIRI 23559

Query: 639   PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTY 698
             P PPE ++I  V  D   L W PP  DGG  VTGY+VERK+  + RW+++N    T T Y
Sbjct: 23560 PGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRY 23619

Query: 699   ESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTL 755
              ST + EG+ YE RV A+NA G  +PS  +KP +   PIAP  +P +  V D T T+ +L
Sbjct: 23620 RSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSL 23679

Query: 756   KWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVN 815
              W  P   G   + GYL+E       EW   NT P +   +T+ +LP GA   FRV+  N
Sbjct: 23680 AWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACN 23739

Query: 816   IAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWT 875
               G  EPA +   V + E+ E P   L    ++    + G  + L +P +GKP P   WT
Sbjct: 23740 AGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWT 23799

Query: 876   KGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGP 935
             K G  + + R  + TS+  T   +++A R DSG Y+L ++ +  K    I++RV+     
Sbjct: 23800 KEGQDI-SKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIGSPNS 23858

Query: 936   PINVM-VKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVS 994
             P   +   ++   +  V W+ P DDG ++I+GY +++ +     W+ +  R R TS  V 
Sbjct: 23859 PEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVK 23918

Query: 995   DLIVGNEYYFRVYTENICGLS 1015
              L    EY+FRV  EN  G+S
Sbjct: 23919 GLKENVEYHFRVSAENQFGIS 23939



 Score =  252 bits (644), Expect = 1e-66
 Identities = 177/599 (29%), Positives = 286/599 (47%), Gaps = 32/599 (5%)

Query: 448   LTVKASEQAVFKCEVSDEKVTG-KWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG 506
             + VKA E      +++   +    W K+G+E+    R  I        L + D    D G
Sbjct: 19427 IVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTG 19486

Query: 507   DYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDV 566
              Y       A + S  +N      + + K  PP   L+ +G T+E   +  +  + + D 
Sbjct: 19487 QYVLTLKNVAGTRSVAVN-----CKVLDKPGPPAGPLEINGLTAEKCSL--SWGRPQEDG 19539

Query: 567   SITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNP--V 624
                 +   V         +T  EG  ++      +S  +    + +E  + +   N   V
Sbjct: 19540 GADIDYYIVEKRETSHLAWTICEGELQM------TSCKVTKLLKGNEYIFRVTGVNKYGV 19593

Query: 625   GEDVASIFLQVVD---VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKG 681
             GE + S+ ++ +D   VP PP ++ ITSV ++   L W  P  DGG  ++GY++ER++K 
Sbjct: 19594 GEPLESVAIKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSEISGYIIERREKN 19653

Query: 682   SQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM----PIAPT 737
             S RW+++N +   +   +ST + EG  YE RV+A NA G+S PS  T P +    P+   
Sbjct: 19654 SLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPS-ETSPLIRAEDPVFLP 19712

Query: 738   SEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFT 797
             S P    + D   TT T+ W  P   G   I GY VEY      +W   + + +    +T
Sbjct: 19713 SPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDW-KTSIQSLRGTEYT 19771

Query: 798   VKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQ 857
             +  L TGA  +FRV  VN  G S+P+  + P   +E  E P   +   +R+T I K G  
Sbjct: 19772 ISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGAS 19831

Query: 858   LNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIE 917
               + VPF+G+P P V+W+K    L T R +V T+D  T   +  A R+DSG+Y L++Q  
Sbjct: 19832 FTMTVPFRGRPVPNVLWSKPDTDLRT-RAYVDTTDSRTSLTIENANRNDSGKYTLTIQNV 19890

Query: 918   NMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTM 977
                 + T+ ++V++  GPP N+ V++V   +A++ W  P++DG + +  Y ++K +    
Sbjct: 19891 LSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKREASKK 19950

Query: 978   EWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKP 1036
              W +V       S  V++L  G  YYFRV  EN  G+    G+   T   +K  IT KP
Sbjct: 19951 AWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGV----GIPAETKEGVK--ITEKP 20003



 Score =  249 bits (637), Expect = 8e-66
 Identities = 181/600 (30%), Positives = 287/600 (47%), Gaps = 38/600 (6%)

Query: 448   LTVKASEQAVFKCEVSDEKV-TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG 506
             LTVKA         V  + + T  W K+G  ++P++ I ++       L +  V  +D G
Sbjct: 12933 LTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSG 12992

Query: 507   DYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDV 566
             DYT   +  + S SA      IK++ + K  PP                 V  NK+  D 
Sbjct: 12993 DYTITAENSSGSKSAT-----IKLKVLDKPGPP---------------ASVKINKMYSDR 13032

Query: 567   SITGEPPPVA------TWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKV 620
             ++    PP+       T    D+  T+     ++   V  +S  +E      E ++ I  
Sbjct: 13033 AMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICA 13092

Query: 621   TNP--VGEDVASIFLQVVDVPDPP---EAVRITSVGEDWAILVWEPPMYDGGKPVTGYLV 675
              N   VG+ V +      +  DPP   +   I+++ +D   + W+PP  DGG P+TGYL+
Sbjct: 13093 ENKYGVGDPVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLL 13152

Query: 676   ERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM--- 732
             E+++  +  W K+N +   E T ++T + EG  YE RV A+N  G  +PS  +K      
Sbjct: 13153 EKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARD 13212

Query: 733   PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANT-EPV 791
             P  P   P    V D T ++ +L W  P   G   I GYLVE     S+ WV  N  + +
Sbjct: 13213 PQYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNL 13272

Query: 792   ERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYI 851
             ++  F V  L    +  FRV  VN  G S+P+ +      ++I  PP+  L   LR+T I
Sbjct: 13273 QKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLI 13332

Query: 852   RKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVRTSDFDTVFFVRQAARSDSGEY 910
              + G  + L VP +G+P P++ W+K    L D   + ++++DFDT        + D+G+Y
Sbjct: 13333 LRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKY 13392

Query: 911   ELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQ 970
              L+++    K   TI ++V++  GPP+NV VKE+   +A V W+ P  DG S I+ Y VQ
Sbjct: 13393 ILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQ 13452

Query: 971   KADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKT 1030
             K D +   W  V      TS  V++L  G  Y+FRV+ EN  G+ D PG +++  +  +T
Sbjct: 13453 KRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGD-PGETRDAVKASQT 13511



 Score =  246 bits (628), Expect = 9e-65
 Identities = 155/494 (31%), Positives = 245/494 (49%), Gaps = 17/494 (3%)

Query: 530   VEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTE 589
             +E   +   P + LD S +   + IVV AG  +R+   ++G+PPP  TW   +    T  
Sbjct: 10141 IEMKDRLVSPDLQLDASVR---DRIVVHAGGVIRIIAYVSGKPPPTVTWNMNER---TLP 10194

Query: 590   GRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRIT- 648
                 IE     SS VI++ QR  +G Y++   N  GE   +I + V+DVP P     +  
Sbjct: 10195 QEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAH 10254

Query: 649   SVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGIL 708
             ++  +   L W  P  DGG P+T Y++E+++   + W  + + V T        +I+G  
Sbjct: 10255 NLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTV-TRQNATVQGLIQGKA 10313

Query: 709   YEMRVFAVNAIGVSQPSMNTKPFM----PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIG 764
             Y  R+ A N+IG+  P + T   +    PI     P  L V++VT  T TL W PP   G
Sbjct: 10314 YFFRIAAENSIGMG-PFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDG 10372

Query: 765   AGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPAT 824
                I  Y++E  L G+E++     + +    +TVK L  G    +RV  VNI G+ +P+ 
Sbjct: 10373 GSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSF 10432

Query: 825   LAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAP-LDT 883
               +P+T ++   PP + L    R     +VGE   L   + GKP+P+V W K  A  L+ 
Sbjct: 10433 CTKPITCKDELAPPTLHL--DFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLED 10490

Query: 884   SRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVK 942
              R H++T+         +A RSDSG+Y + V+          ++ VV++ GPP+  V   
Sbjct: 10491 DRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFD 10550

Query: 943   EVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEY 1002
             EV     ++ W+ P DDG S+I  Y ++K +     W  V   +  T+C VS L+ G +Y
Sbjct: 10551 EVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDY 10610

Query: 1003  YFRVYTENICGLSD 1016
              FR++ EN+ G+SD
Sbjct: 10611 IFRIHAENLYGISD 10624



 Score =  246 bits (627), Expect = 1e-64
 Identities = 150/488 (30%), Positives = 235/488 (48%), Gaps = 9/488 (1%)

Query: 529   KVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTT 588
             ++E V + E P + L       +  + + AG  LRL VS++G PPPV TW K        
Sbjct: 23062 EIEPVERIEIPDLEL---ADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQG---IDL 23115

Query: 589   EGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRIT 648
               R  I+     S  +++   R D G+YTI+  N  G+  A++ ++V D P P  +V++ 
Sbjct: 23116 ASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVK 23175

Query: 649   SVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGIL 708
              V  D   + WE P  DGG PV  Y+VE K++ + R  K      ++T Y  + ++EG +
Sbjct: 23176 EVSRDSVTITWEIPTIDGGAPVNNYIVE-KREAAMRAFKTVTTKCSKTLYRISGLVEGTM 23234

Query: 709   YEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGI 768
             Y  RV   N  G+ +P   +   +       P  L V DVT +T TL W  P   G   +
Sbjct: 23235 YYFRVLPENIYGIGEPCETSDAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRL 23294

Query: 769   DGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQP 828
              GY++E C  G+E W+   T        TV +L  G + LFR+   N  G SEP      
Sbjct: 23295 TGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTA 23354

Query: 829   VTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVH 887
             VT++++   P I L    ++T     G  + LV+P  G+P P   W   G+ L ++ RV 
Sbjct: 23355 VTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVT 23414

Query: 888   VRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWG 946
             V T        +R+    D+GEY L ++      + TI++ +++K GPP   + + E+  
Sbjct: 23415 VETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDA 23474

Query: 947   TNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRV 1006
             T+  + W+ P+ DG + + GY V++ D     W  V E    ++   + L  GNEY FRV
Sbjct: 23475 TSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRV 23534

Query: 1007  YTENICGL 1014
                N  G+
Sbjct: 23535 AATNRFGI 23542



 Score =  243 bits (620), Expect = 8e-64
 Identities = 162/502 (32%), Positives = 240/502 (47%), Gaps = 27/502 (5%)

Query: 527   EIKVEYVPKQ--EPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEV 584
             E+K    PK+  EPP+I LD S +     ++V AG  +RL   + G P P  TW K    
Sbjct: 12218 ELKEAIKPKEILEPPEIDLDASMR---KLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGID 12274

Query: 585   FTTTEGRTRIEKRVDCSSF-VIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPE 643
                 +G+  +   VD  +F VI ++ R+D G+Y++ + NP GE    + ++V+D P P  
Sbjct: 12275 NVVRKGQVDL---VDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVS 12331

Query: 644   AVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKM 703
              ++++ V +    + W PP  DGG  VT Y+VE+++   + W  +  EV  +T++  T +
Sbjct: 12332 DLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEV-KKTSFHVTNL 12390

Query: 704   IEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSE---PLHLIVEDVTDTTTTLKWRPP 760
             + G  Y  RV AVN  G   P+   KP +   P SE   P  L V ++T  + TL W PP
Sbjct: 12391 VPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPP 12450

Query: 761   NRIGAGGIDGYLVEYCLEGSEEWVPANT----EPVERCGFTVKNLPTGARILFRVVGVNI 816
              R G   IDGY+  Y     EE  PA+       V+     V  L  G +  FRV   N 
Sbjct: 12451 LRDGGAKIDGYITSY----REEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNA 12506

Query: 817   AGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTK 876
              G S P         +E   PPKI +P  +      K G++L +     GKP P   W K
Sbjct: 12507 VGVSLPREAEGVYEAKEQLLPPKILMPEQI----TIKAGKKLRIEAHVYGKPHPTCKWKK 12562

Query: 877   GGAPLDT-SRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGP 935
             G   + T S + V  +D  ++  ++   R DSG Y L+ +  +  DT  I++ V++  GP
Sbjct: 12563 GEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGP 12622

Query: 936   PINVM-VKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVS 994
             P     + ++      + W  P +DG S I  Y V+K D    +W         TSC V 
Sbjct: 12623 PQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVG 12682

Query: 995   DLIVGNEYYFRVYTENICGLSD 1016
              LI G EY FRV  EN  G+S+
Sbjct: 12683 KLIPGQEYIFRVRAENRFGISE 12704



 Score =  239 bits (610), Expect = 1e-62
 Identities = 152/487 (31%), Positives = 236/487 (48%), Gaps = 22/487 (4%)

Query: 535   KQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRI 594
             K E P I LD   +   N   + AG  LRL V I G P P   W K D       G  R 
Sbjct: 16564 KLEAPDIDLDLELRKIIN---IRAGGSLRLFVPIKGRPTPEVKWGKVD-------GEIRD 16613

Query: 595   EKRVDCSS----FVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSV 650
                +D +S     V+++  R D G+YT+ + N  G   A + ++V+D P PP  +++T +
Sbjct: 16614 AAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEI 16673

Query: 651   GEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYE 710
              +D   + WEPP+ DGG  +  Y+VE+++   + +  +      + +++  ++ EG  Y 
Sbjct: 16674 TKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCH-KNSWKIDQLQEGCSYY 16732

Query: 711   MRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDG 770
              RV A N  G+  P+    P         P  + V+DVT  + +L W  P   G   I  
Sbjct: 16733 FRVTAENEYGIGLPAQTADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQ 16792

Query: 771   YLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVT 830
             Y+VE   + SE+W  +    V+     + NL  G   LFRVV VN  GRS+P +LA P+ 
Sbjct: 16793 YIVEMQAKHSEKW--SECARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIV 16850

Query: 831   IREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVR 889
              +++   P +   +    +Y  +VG+ L + VP  G+P+P + WTK G PL  T+R++V 
Sbjct: 16851 AKDLVIEPDV---KPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVT 16907

Query: 890   TSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTN 948
              S   T   +++  + D G+Y ++V     + TA+I I  ++K  PP   V   +V   +
Sbjct: 16908 DSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAES 16967

Query: 949   ALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYT 1008
               + W  P   G  +I  Y VQK D  T  W  V      T+  V+ L  G EY FR++ 
Sbjct: 16968 ITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFA 17027

Query: 1009  ENICGLS 1015
             EN  G S
Sbjct: 17028 ENRYGQS 17034



 Score =  238 bits (607), Expect = 2e-62
 Identities = 178/616 (28%), Positives = 277/616 (44%), Gaps = 39/616 (6%)

Query: 429   EAELIVEEKQLEVLQDIA---DLTVKASEQAVFKCEVSDEK-VTGKWYKNGVEVRPSKRI 484
             EAE + E K+  +   I     +T+KA ++   +  V  +   T KW K   EV  S  +
Sbjct: 12514 EAEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHL 12573

Query: 485   TISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLD 544
              +        L+I DV  +D G Y+   +      S+  +  +IKV  +    PP+   D
Sbjct: 12574 AVHKADSSSILIIKDVTRKDSGYYSLTAEN-----SSGTDTQKIKVVVMDAPGPPQPPFD 12628

Query: 545   CSGKTSENA-----IVVVAGNKLRLDVSITGEPPPVATWLKGDEVF---TTTEGRTRIEK 596
              S   ++       I +  G       +IT          +GD V    + T+   R+ K
Sbjct: 12629 ISDIDADACSLSWHIPLEDGGS-----NITNYIVEKCDVSRGDWVTALASVTKTSCRVGK 12683

Query: 597   RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAI 656
              +    ++        E R+ I       + VA        VP  P+  R+T V +D   
Sbjct: 12684 LIPGQEYIFRVRA---ENRFGISEPLTSPKMVAQF---PFGVPSEPKNARVTKVNKDCIF 12737

Query: 657   LVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAV 716
             + W+ P  DGG P+ GYL+ERK++ S  W+K N  +   T Y    ++EG+ Y  R++A+
Sbjct: 12738 VAWDRPDSDGGSPIIGYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYAL 12797

Query: 717   NAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
             N  G S PS  T+      P   P    V DVT +T +L W  P   G   I GY VE C
Sbjct: 12798 NKAGSSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEAC 12857

Query: 777   LEGSEEWVPANTEP--VERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREI 834
                 ++WV  NT P  + +  +T   L   A+  FR +       S P+  + PVTI   
Sbjct: 12858 KLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAE 12917

Query: 835   AEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGA---PLDTSRVHVRTS 891
               PP+I L   ++     K G  + L     GKP P V W K G    P +  ++ ++ +
Sbjct: 12918 NVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRN 12977

Query: 892   DFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALV 951
                   F     R DSG+Y ++ +  +   +ATI+++V++K GPP +V + +++   A++
Sbjct: 12978 LCTLELF--SVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAML 13035

Query: 952   EWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENI 1011
              W+ P +DG SEI  Y V K +     W  V      TSC+V  LI G+EY FR+  EN 
Sbjct: 13036 SWEPPLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENK 13095

Query: 1012  CGLSD----SPGVSKN 1023
              G+ D     P ++KN
Sbjct: 13096 YGVGDPVFTEPAIAKN 13111



 Score =  238 bits (606), Expect = 3e-62
 Identities = 157/496 (31%), Positives = 232/496 (46%), Gaps = 19/496 (3%)

Query: 537   EPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEK 596
             EPP++ LD +    ++   +  G+ LRL   I G P P  TW K D    T   + RI+ 
Sbjct: 10842 EPPELILDANMAREQH---IKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPT---KARIDV 10895

Query: 597   RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAI 656
                 S   I +A  ED G Y++ V NP G    S+ + V+D P PP  + ++ + +D   
Sbjct: 10896 TPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCY 10955

Query: 657   LVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAV 716
             L W+ P+ DGG  +T Y+VER+   S +W  L+     + ++ +  + EG  Y  RV A 
Sbjct: 10956 LTWKEPLDDGGSVITNYVVERRDVASAQWSPLS-ATSKKKSHFAKHLNEGNQYLFRVAAE 11014

Query: 717   NAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLV 773
             N  G        KP     P+ P   P  L   DV  T  +L W  P+R G   I GYLV
Sbjct: 11015 NQYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLV 11074

Query: 774   EYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIRE 833
             EY  EG+++W+   T     C   V  L  G    FRV   NI G   P T   P+  +E
Sbjct: 11075 EYQEEGTQDWIKFKTVTNLEC--VVTGLQQGKTYRFRVKAENIVGLGLPDTTI-PIECQE 11131

Query: 834   IAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVH-VRTSD 892
                PP + L   L +  + K G  +      +G P P   WT  G+ + T   + V T +
Sbjct: 11132 KLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDN 11191

Query: 893   FDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTNALV 951
             F +V  ++   R D+GEY+++V       T  + + V++  GPP   + + +V   +  +
Sbjct: 11192 FSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTI 11251

Query: 952   EWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENI 1011
              WQ PKDDG S ++ Y V+K D +   W  V   +  T   +  L  G EY FRV  EN 
Sbjct: 11252 SWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENK 11311

Query: 1012  CG----LSDSPGVSKN 1023
              G    L  +P V+K+
Sbjct: 11312 IGVGPPLDSTPTVAKH 11327



 Score =  234 bits (598), Expect = 3e-61
 Identities = 149/496 (30%), Positives = 239/496 (48%), Gaps = 18/496 (3%)

Query: 530   VEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTE 589
             VE V ++  P   LD   + +   +VV AG  +R+ V I G P P  TW K +      +
Sbjct: 14393 VEIVEREMAPDFELDAELRRT---LVVRAGLSIRIFVPIKGRPAPEVTWTKDN---INLK 14446

Query: 590   GRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITS 649
              R  IE     +  +I    R D G++ + + NP G+    + ++V+D P P   +R T 
Sbjct: 14447 NRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTD 14506

Query: 650   VGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILY 709
             + +D   L W+ P+ DGG  +T Y+VE+++   + +     +   + TY+ T + EG  Y
Sbjct: 14507 ITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTKCH-KCTYKVTGLSEGCEY 14565

Query: 710   EMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGID 769
               RV A N  G+ +P+  T+P       S P  L + D+T +T +L W  P   G   I 
Sbjct: 14566 FFRVMAENEYGIGEPTETTEPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKIT 14625

Query: 770   GYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPV 829
             GY++E   +GS++W    T     C   V+NL  G    F+V+ VN AGRS P   ++PV
Sbjct: 14626 GYVIEAQRKGSDQWTHITTVKGLEC--VVRNLTEGEEYTFQVMAVNSAGRSAPRE-SRPV 14682

Query: 830   TIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHV 888
              ++E    P++ L    ++  I K G+ + + +P  G+P+P V W KG   L  T RV+ 
Sbjct: 14683 IVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNF 14742

Query: 889   RTSDFDTVFFVRQAARSDSGEYELSVQ--IENMKDTATIRIRVVEKAGPPIN-VMVKEVW 945
              T+   T+  + +  RSDSG Y L+ +  +  + D  TI++  +   GPP   +   EV 
Sbjct: 14743 ETTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDI--PGPPTGPIKFDEVS 14800

Query: 946   GTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFR 1005
                    W  P++DG   I  Y V+     +  W  +      T+   + L  G EY FR
Sbjct: 14801 SDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGLEYQFR 14860

Query: 1006  VYTENICGLSDSPGVS 1021
             V  +N  G+   PG++
Sbjct: 14861 VKAQNRYGV--GPGIT 14874



 Score =  232 bits (592), Expect = 1e-60
 Identities = 161/551 (29%), Positives = 248/551 (45%), Gaps = 28/551 (5%)

Query: 469   GKWYKNGVEVRPSKRITISHV--GRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFL 526
             G W+K   E     R T++ +  G  +K  +  +    +GD   V               
Sbjct: 21926 GDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTG------------- 21972

Query: 527   EIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFT 586
                ++ V +   P++ +D + K +    VV AG  +RL ++  G P P A W K D   +
Sbjct: 21973 --TIKAVDRLTAPELDIDANFKQTH---VVRAGASIRLFIAYQGRPTPTAVWSKPDSNLS 22027

Query: 587   TTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVR 646
                 R  I      S+  +E+  R D G+YT+ V N  G    +  ++V+D P PP  + 
Sbjct: 22028 L---RADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPIT 22084

Query: 647   ITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEG 706
                V    A L+W+ P+ DGG  +  Y+VE+++   + W  ++ E  T   ++   + EG
Sbjct: 22085 FKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVIS-EKCTRQIFKVNDLAEG 22143

Query: 707   ILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAG 766
             + Y  RV AVN  GV +P    +P +     + P  L V D + ++  L W  P+  G  
Sbjct: 22144 VPYYFRVSAVNEYGVGEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGS 22203

Query: 767   GIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLA 826
              I GYL+E   +GS+ WV A     ++  FTV+ L       FRV   N AG SEP    
Sbjct: 22204 RITGYLLEMRQKGSDFWVEAG--HTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAF 22261

Query: 827   QPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSR 885
               V I+E    P   L     Q    K G    + VP  G+P P+V W      L +T R
Sbjct: 22262 SSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDR 22321

Query: 886   VHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEV 944
             V + T+   T   V+ + R DSG Y L+++      T ++ + V+ + GP    + V  V
Sbjct: 22322 VSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSV 22381

Query: 945   WGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYF 1004
                + ++ W  PKD G +EI  Y V+K +  T  W  V    + T   V+ L    EY F
Sbjct: 22382 SAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSF 22441

Query: 1005  RVYTENICGLS 1015
             RV +EN  G+S
Sbjct: 22442 RVSSENRFGVS 22452



 Score =  231 bits (588), Expect = 4e-60
 Identities = 141/480 (29%), Positives = 230/480 (47%), Gaps = 7/480 (1%)

Query: 551  ENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQR 610
            ++ + V+  N + + V  TG P P ATW  GD+V  T + R +++     +  VI  ++R
Sbjct: 7029 KDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGD-RVKMKTLSAYAELVISPSER 7087

Query: 611  EDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPV 670
             D+G YT+K+ N V      I + V+  P  P+ ++   + +D   L WEPP  DGG P+
Sbjct: 7088 SDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPL 7147

Query: 671  TGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKP 730
            TGY+VE+++   + W K+  +  T+  +    +++G  Y  +V A N  G  +P+   +P
Sbjct: 7148 TGYVVEKREVSRKTWTKV-MDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEP 7206

Query: 731  FMPIAPTS---EPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPAN 787
                 P +    P ++   D T  +  L W PP   G   I GY+VE C  GS++WV   
Sbjct: 7207 VNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACG 7266

Query: 788  TEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLR 847
             EPV      V  L  G    +RV  +N  G S+P+   + +   +  E P+I L   L 
Sbjct: 7267 -EPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLL 7325

Query: 848  QTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVRTSDFDTVFFVRQAARSD 906
                 K G ++ L     GKP P++ WTK    L    R+ +      +   +  + RSD
Sbjct: 7326 AGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSD 7385

Query: 907  SGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMG 966
            +G Y +       + TA + + V++K GPP    + +V   + L+ W  P+DDG S+I  
Sbjct: 7386 TGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITN 7445

Query: 967  YFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTAR 1026
            Y V++    +  W  +    + T+   + LI   EY FRV  EN+ G+ +    S  TA+
Sbjct: 7446 YVVERRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQASPITAK 7505



 Score =  228 bits (581), Expect = 3e-59
 Identities = 138/484 (28%), Positives = 226/484 (46%), Gaps = 11/484 (2%)

Query: 535   KQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRI 594
             ++E P   +D   + +   ++V AG    + V   G P P   W K D   T    R  +
Sbjct: 19808 REEEPLFDIDSEMRKT---LIVKAGASFTMTVPFRGRPVPNVLWSKPD---TDLRTRAYV 19861

Query: 595   EKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDW 654
             +     +S  IE+A R D G+YT+ + N +     ++ ++V+D P PP  + +  V ++ 
Sbjct: 19862 DTTDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKES 19921

Query: 655   AILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVF 714
             A+L W+ P  DGG PV  Y +E+++   + W+ +        +Y+ T + EG +Y  RV 
Sbjct: 19922 AVLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNC-NRLSYKVTNLQEGAIYYFRVS 19980

Query: 715   AVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
               N  GV  P+   +        S P  L V  ++  + +L W  P   G   I  Y+VE
Sbjct: 19981 GENEFGVGIPAETKEGVKITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVE 20040

Query: 775   YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREI 834
                +G + WV       +     V  L   +   FRV   N AG S+P  L  PV I+E 
Sbjct: 20041 ALEKGQKNWVKCAV--AKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQ 20098

Query: 835   AEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLD-TSRVHVRTSDF 893
              EPP+I +      T   + G  L + +P  GKP P+V  ++ G PL  T R +   +  
Sbjct: 20099 LEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAE 20158

Query: 894   DTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTNALVE 952
             +    ++++  +D+G YE++    +    A I I V+++ GPP   V++ ++   +  ++
Sbjct: 20159 NLTINLKESVTADAGRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLK 20218

Query: 953   WQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENIC 1012
             W+ PK DG S++  Y + K +  T  W  V      T   V  L  G EY FR+  EN  
Sbjct: 20219 WEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRF 20278

Query: 1013  GLSD 1016
             G+SD
Sbjct: 20279 GISD 20282



 Score =  226 bits (577), Expect = 7e-59
 Identities = 133/383 (34%), Positives = 202/383 (52%), Gaps = 10/383 (2%)

Query: 638   VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFE-VFTET 696
             VPD P+   +T V +D A++ W  P +DGGKP+T Y++E+++  S+RW ++  + +   T
Sbjct: 10639 VPDAPDQPIVTEVTKDSALVTWNKP-HDGGKPITNYILEKRETMSKRWARVTKDPIHPYT 10697

Query: 697   TYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTT 753
              +    ++EG  YE RV A N IG+  PS  +KP     PIA  S P++    D T  + 
Sbjct: 10698 KFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSV 10757

Query: 754   TLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFT---VKNLPTGARILFR 810
              L W+PP   G   I GY+VEY   G EEW  AN  P E C  T   V  L  G    FR
Sbjct: 10758 DLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTP-ESCPETKYKVTGLRDGQTYKFR 10816

Query: 811   VVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRP 870
             V+ VN AG S+PA + +PV +++  EPP++ L  ++ +    KVG+ L L    +G P P
Sbjct: 10817 VLAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFP 10876

Query: 871   QVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVV 930
             +V W K      T +  +  +   +   +R AA  D G Y L+V+      T ++++ V+
Sbjct: 10877 KVTWKKEDRDAPT-KARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVL 10935

Query: 931   EKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTS 990
             +K GPP ++ V E+   +  + W+ P DDG S I  Y V++ D  + +W  +   ++  S
Sbjct: 10936 DKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKS 10995

Query: 991   CTVSDLIVGNEYYFRVYTENICG 1013
                  L  GN+Y FRV  EN  G
Sbjct: 10996 HFAKHLNEGNQYLFRVAAENQYG 11018



 Score =  225 bits (574), Expect = 2e-58
 Identities = 147/490 (30%), Positives = 230/490 (46%), Gaps = 22/490 (4%)

Query: 534   PKQE----PPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLK--GDEVFTT 587
             PK E    PP+I LD   +     + + A   LRL V I G P P   W +  G+ +   
Sbjct: 15477 PKAEDRMLPPEIELDADLR---KVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESL--- 15530

Query: 588   TEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRI 647
                +  IE     +  ++ +  R D G+Y + V N  G   A + ++V+D P PP+ +++
Sbjct: 15531 --DKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKV 15588

Query: 648   TSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGI 707
               V +    L W+PP+ DGG  +  Y+VE+++   + +  +      +T+++  ++ EG 
Sbjct: 15589 KEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCH-KTSWKVDQLQEGC 15647

Query: 708   LYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGG 767
              Y  RV A N  G+  P+   +          P  + + DVT  + +L W  P   G   
Sbjct: 15648 SYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITLMDVTRNSVSLSWEKPEHDGGSR 15707

Query: 768   IDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQ 827
             I GY+VE   +GS++W    T  V     T+  L  G    FRV   N  G S+P  L+ 
Sbjct: 15708 ILGYIVEMQTKGSDKWATCATVKVTEA--TITGLIQGEEYSFRVSAQNEKGISDPRQLSV 15765

Query: 828   PVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRV 886
             PV  +++  PP  +L   L  T+    GE L + VPF G+P P V W K   PL  T+RV
Sbjct: 15766 PVIAKDLVIPPAFKL---LFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRV 15822

Query: 887   HVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVW 945
             +  +++ +++  ++ A R D G Y + +     +   T+ + V++K GPP   V + EV 
Sbjct: 15823 NAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVT 15882

Query: 946   GTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFR 1005
               +  + W  PK DG S I  Y V+K D  T  W  V      T+     L  G EY FR
Sbjct: 15883 ADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFR 15942

Query: 1006  VYTENICGLS 1015
             +  EN  G S
Sbjct: 15943 IAAENRYGKS 15952



 Score =  219 bits (557), Expect = 2e-56
 Identities = 145/484 (29%), Positives = 237/484 (48%), Gaps = 18/484 (3%)

Query: 538   PPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIE-K 596
             PP+  LD   + +   +++ AG  +RL V + G PPP  TW K +        R  ++ K
Sbjct: 13318 PPEGELDADLRKT---LILRAGVTMRLYVPVKGRPPPKITWSKPN---VNLRDRIGLDIK 13371

Query: 597   RVDCSSFV-IESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWA 655
               D  +F+  E+  + D G+Y + + N  G+   +I ++V+D P PP  V +  + +D A
Sbjct: 13372 STDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSA 13431

Query: 656   ILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFA 715
              + WEPP+ DGG P+  Y+V+++    + W  +  E  ++T++    + EG  Y  RVFA
Sbjct: 13432 YVTWEPPIIDGGSPIINYVVQKRDAERKSWSTVTTEC-SKTSFRVANLEEGKSYFFRVFA 13490

Query: 716   VNAIGVSQPSMNTKPFMPIAPTSEPL-HLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
              N  G+  P   T+  +  + T  P+  L V  V+ ++ ++ W+ P+  G   I GY+V+
Sbjct: 13491 ENEYGIGDPG-ETRDAVKASQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVD 13549

Query: 775   YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREI 834
             +  E ++      +  ++   ++ K+L  G    FRV   N  G   P+ +   V  R+ 
Sbjct: 13550 FLTEENKWQRVMKSLSLQ---YSAKDLTEGKEYTFRVSAENENGEGTPSEIT--VVARDD 13604

Query: 835   AEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDT-SRVHVRTSDF 893
                P + L       Y+ K      L +P +GKP P V W KG  PL T +RV V +S  
Sbjct: 13605 VVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAV 13664

Query: 894   DTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTNALVE 952
             +T   V    +SD+G+Y ++++        TI I+VV K G P   +   EV      ++
Sbjct: 13665 NTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLK 13724

Query: 953   WQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENIC 1012
             W  PKDDG SEI  Y ++K D    +W       + T+  V+ L  G EY FRV  EN  
Sbjct: 13725 WAPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKY 13784

Query: 1013  GLSD 1016
             G+ +
Sbjct: 13785 GVGE 13788



 Score =  218 bits (556), Expect = 2e-56
 Identities = 158/516 (30%), Positives = 233/516 (45%), Gaps = 54/516 (10%)

Query: 529  KVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTT 588
            +++ V  QE P+I LD         + V AG K+ L  ++TG+P P  TW K D +    
Sbjct: 7306 EIQAVDTQEAPEIFLDVKLLAG---LTVKAGTKIELPATVTGKPEPKITWTKADMILKQD 7362

Query: 589  EGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRIT 648
            + R  IE     S+  I  ++R D G Y I+  N  G   A + + V+D P PP A  IT
Sbjct: 7363 K-RITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDIT 7421

Query: 649  SVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGIL 708
             V  +  +L W PP  DGG  +T Y+VER+   S+ W KL+  V  +T +++TK+I    
Sbjct: 7422 DVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTV-KDTNFKATKLIPNKE 7480

Query: 709  YEMRVFAVNAIGVSQPSMNTKPF---MPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGA 765
            Y  RV A N  GV +P +   P        P   P  L   D+T    TL W  P+  G 
Sbjct: 7481 YIFRVAAENMYGVGEP-VQASPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGG 7539

Query: 766  GGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATL 825
              I GY VE     +++WV  N  PV+   + VK L    +  FRV+  N+AG  +P+  
Sbjct: 7540 SPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKS 7599

Query: 826  AQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTK----GGAPL 881
             +P+ I++  +PP                       V   GK   ++ WTK    GGA +
Sbjct: 7600 TEPILIKDPIDPP----------------WPPGKPTVKDVGKTSVRLNWTKPEHDGGAKI 7643

Query: 882  DTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAG------- 934
            ++  + +  +  D   +VR A    + ++ L   +E  +   + R+R V KAG       
Sbjct: 7644 ESYVIEMLKTGTDE--WVRVAEGVPTTQHLLPGLMEGQE--YSFRVRAVNKAGESEPSEP 7699

Query: 935  --------------PPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWF 980
                          PP  + V  +    A ++W  P+ DG S I  Y V+K D +   W 
Sbjct: 7700 SDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQ 7759

Query: 981  NVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
             V    + T CTV+ L  G+ Y FRV  EN  G SD
Sbjct: 7760 TVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSD 7795



 Score =  218 bits (556), Expect = 2e-56
 Identities = 180/670 (26%), Positives = 295/670 (44%), Gaps = 50/670 (7%)

Query: 364   EMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVIT 423
             E  VE   +G Q  W   G+  T E          +  ++ +L F    + ++G    +T
Sbjct: 21124 EYVVERKGKGEQT-WSHAGISKTCE------IEVSQLKEQSVLEFRVFAKNEKGLSDPVT 21176

Query: 424   NGGQCEAELIVEEKQLEVLQDI--ADLTVKASEQAVFKCEVSDE-KVTGKWYKNGVEVRP 480
              G     ELI+  +    L DI  A +TV+       +     + K +  W K+G+ ++ 
Sbjct: 21177 IGPITVKELIITPEV--DLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKE 21234

Query: 481   SKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPK 540
             S+ +  S       L I + + E  G YT + D     ++  +  + +     PK     
Sbjct: 21235 SEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKGP--- 21291

Query: 541   IHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGR--TRIEKRV 598
                             +  ++++ D  I     P      G+    + E R  ++   ++
Sbjct: 21292 ----------------IRFDEIKADSVILSWDVPEDNG-GGEITCYSIEKRETSQTNWKM 21334

Query: 599   DCSS-----FVIESAQREDEGRYTIKVTNPVGED---VASIFL--QVVDVPDPPEAVRIT 648
              CSS     F + +  ++ E ++ ++  N  G     V+SI +      +P PP    I 
Sbjct: 21335 VCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIY 21394

Query: 649   SVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGIL 708
             +V  D   L W+ P+YDGG  VTG+ VE+K++ S  W K+N    +   Y +T ++EG+ 
Sbjct: 21395 NVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLD 21454

Query: 709   YEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGI 768
             Y+ RV+A N+ G+S PS  +K  + ++P   P      DVT  T TLKW PP R G   I
Sbjct: 21455 YQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKI 21514

Query: 769   DGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGR-SEPATLAQ 827
              GY +E   +G+E WV  N   V  C +TV  L  G R  FR++  N  G  S P+  + 
Sbjct: 21515 VGYSIEK-RQGNERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSG 21573

Query: 828   PVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVH 887
              +  R+   PP +          I K GE L +    QG+P P+V W K G  ++  R++
Sbjct: 21574 IIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIE-KRMN 21632

Query: 888   VRTSDF--DTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEV 944
             +  +D    T  FVR A R   G Y +  +  +    A I+++V +  G  +  +    +
Sbjct: 21633 MEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNI 21692

Query: 945   WGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYF 1004
              G    + W AP +DG + I  Y ++K +   + W  + ++    S T   LI GNEY F
Sbjct: 21693 TGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQF 21752

Query: 1005  RVYTENICGL 1014
             RV   N  G+
Sbjct: 21753 RVSAVNKFGV 21762



 Score =  218 bits (555), Expect = 3e-56
 Identities = 160/568 (28%), Positives = 254/568 (44%), Gaps = 31/568 (5%)

Query: 471   WYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKV 530
             W+K+ V ++ + R+          L I D   ED G Y        L+ SA      + V
Sbjct: 15809 WHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVV-----KLTNSAGEAIETLNV 15863

Query: 531   EYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITG-----EPPPVATWLKGDEVF 585
               + K  PP   +     T+++  +     K     SI             TW    ++ 
Sbjct: 15864 IVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTW----QIV 15919

Query: 586   TTTEGRTRIEK---RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPP 642
             + T  RT I+    +  C  +    A     G+ T   + P      ++      VP PP
Sbjct: 15920 SATVARTTIKACRLKTGCE-YQFRIAAENRYGKSTYLNSEP------TVAQYPFKVPGPP 15972

Query: 643   EAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTK 702
                 +T    D   + W  P+ DGG  V GY +ERK++ S  W+KLN     +T +++T 
Sbjct: 15973 GTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTG 16032

Query: 703   MIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNR 762
             + EG+ YE RV A N +G+ +PS  ++ ++   P   P       VT  + TL+W+ P  
Sbjct: 16033 LEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQWKKPTY 16092

Query: 763   IGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAG-RSE 821
              G   I GY+VE        W+ A+   +    F V  L    R  FRV+  N AG  SE
Sbjct: 16093 DGGSKITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSE 16152

Query: 822   PATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL 881
             P+     +T R+  +PP+I +    + T +   GE   +     GKP P + W KG   L
Sbjct: 16153 PSESTGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL 16212

Query: 882   -DTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-V 939
              +T+R+ ++++DF T   V+ A R DSG Y L  +    + + T+ ++V+++ GPP   V
Sbjct: 16213 SNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPV 16272

Query: 940   MVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVG 999
             ++  V      + W+ P  DG S+I+ Y V++ +   + W  V    +  SC V+ L+ G
Sbjct: 16273 VISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEG 16332

Query: 1000  NEYYFRVYTENICG----LSDSPGVSKN 1023
             NEY FR+   N  G    L   P V+KN
Sbjct: 16333 NEYTFRIMAVNKYGVGEPLESEPVVAKN 16360



 Score =  218 bits (554), Expect = 3e-56
 Identities = 167/650 (25%), Positives = 284/650 (43%), Gaps = 55/650 (8%)

Query: 427   QCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKV-TGKWYKNGVEVRPSKRIT 485
             +C+ +L+    +L+V + I  L VKA     F   +    V T KW  +G E++  +  T
Sbjct: 11128 ECQEKLVPPSVELDV-KLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYT 11186

Query: 486   ISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDC 545
             +        L I +    D G+Y       A S +  ++   + V       PP   ++ 
Sbjct: 11187 VETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVP-----GPPTGPINI 11241

Query: 546   SGKTSENAIVVVAGNKLRLDVSITGEPP------PVATWLKGDEVFTTTEGRTRIEKRVD 599
                T E+             ++I+ +PP      PV  ++  ++  T  +    +     
Sbjct: 11242 LDVTPEH-------------MTISWQPPKDDGGSPVINYIV-EKQDTRKDTWGVVSSGSS 11287

Query: 600   CSSFVIESAQREDEGRYTIKVTNPVG-----EDVASIFLQVVDVPDPPEAVRITSVGEDW 654
              +   I   Q+  E  + ++  N +G     +   ++       P PP    +T + E+ 
Sbjct: 11288 KTKLKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENA 11347

Query: 655   AILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVF 714
             A + W  P  DGG P+TGY +ER++  + +W+++N     +  +  T + EG  YE RVF
Sbjct: 11348 ATVSWTLPKSDGGSPITGYYMERREV-TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVF 11406

Query: 715   AVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGY 771
             A N  G+S+PS ++ P     PI P   P++  ++D +  T  L W  P   G   I GY
Sbjct: 11407 AENLAGLSKPSPSSDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGY 11466

Query: 772   LVEYCLEGSEEWVPANT-EPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVT 830
             +VE    G+ +W   N  E + +C F V  L  G    FR+   NI G  EP  LA+ V 
Sbjct: 11467 VVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVI 11526

Query: 831   IREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRT 890
              ++I  PP++ L    R     +VG+ + ++   +G+P P + WTK G  L   +     
Sbjct: 11527 AKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLI 11586

Query: 891   SDFDTV-FFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNA 949
              D   V   +++A R+D G+Y +S +  +     +  + V+++ GP  N+ V  V   N 
Sbjct: 11587 QDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENC 11646

Query: 950   LVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTE 1009
              + W+ P D+G SEI  + V+        W ++   +       ++L+  NEYYFRV  E
Sbjct: 11647 TISWENPLDNGGSEITNFIVEYRKPNQKGW-SIVASDVTKRLIKANLLANNEYYFRVCAE 11705

Query: 1010  NICGLS---------------DSPGVSKNTARILKTGITFKPFEYKEHDF 1044
             N  G+                D PG  +N   I   G TF   +++  D+
Sbjct: 11706 NKVGVGPTIETKTPILAINPIDRPGEPEN-LHIADKGKTFVYLKWRRPDY 11754



 Score =  217 bits (553), Expect = 4e-56
 Identities = 125/382 (32%), Positives = 192/382 (50%), Gaps = 3/382 (0%)

Query: 638   VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETT 697
             VP PP   ++T+V +D   + W  P+ DGG P+ GY VERK++    W  ++  +     
Sbjct: 14886 VPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNI 14945

Query: 698   YESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKW 757
             ++S+ + +GI YE RV A N  G S+PS  ++P + + P   P   +  ++T  T TLKW
Sbjct: 14946 FKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKW 15005

Query: 758   RPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIA 817
               P   G   I  Y+VE     +  W+ AN   +    FTV  L   A   FRV+  N A
Sbjct: 15006 AKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAA 15065

Query: 818   GR-SEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTK 876
             G  S P+  +  +T R+  E PKI++    + T I K GE   L     G+P P + W+K
Sbjct: 15066 GAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSK 15125

Query: 877   GGAPLD-TSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGP 935
              G  L+ T+++ ++ +DF T    + + R DSG Y L+             ++V+++ GP
Sbjct: 15126 DGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGP 15185

Query: 936   PIN-VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVS 994
             P   + V EV     ++ W  P DDG ++I  Y VQK +   + W NV    + T   V+
Sbjct: 15186 PEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVT 15245

Query: 995   DLIVGNEYYFRVYTENICGLSD 1016
              L+ GNEY FRV   N  G+ +
Sbjct: 15246 KLLKGNEYIFRVMAVNKYGVGE 15267



 Score =  217 bits (552), Expect = 6e-56
 Identities = 155/560 (27%), Positives = 257/560 (45%), Gaps = 34/560 (6%)

Query: 537   EPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEK 596
             E P+I LD + +TS   ++  AG  +++ +   G PPP  TW K DE    ++ R  IE 
Sbjct: 20895 EAPEIDLDVALRTS---VIAKAGEDVQVLIPFKGRPPPTVTWRK-DEKNLGSDARYSIEN 20950

Query: 597   RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVAS-IFLQVVDVPDPPEAVRITSVGEDWA 655
                 S   I    R D G+Y + + N VGE  +S + ++V+D P   + +++  V     
Sbjct: 20951 TDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTV 21010

Query: 656   ILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFA 715
              L+W+PP+ DGG P+  Y++E++    + W  ++ +  + T+++   + E   +  RV A
Sbjct: 21011 TLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKC-SSTSFKLIDLSEKTPFFFRVLA 21069

Query: 716   VNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEY 775
              N IG+ +P   T+P       +    L ++D T T+  L W  P+  G   I  Y+VE 
Sbjct: 21070 ENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVER 21129

Query: 776   CLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIA 835
               +G + W  A     + C   V  L   + + FRV   N  G S+P T+  P+T++E+ 
Sbjct: 21130 KGKGEQTWSHAGIS--KTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIG-PITVKELI 21186

Query: 836   EPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSR-VHVRTSDFD 894
               P++ L          ++G  ++L +P++GKP+P + W K G PL  S  V    ++  
Sbjct: 21187 ITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENK 21246

Query: 895   TVFFVRQAARSDSGEYELSVQIENMKDTATIRIRV---VEKAGPPIN----VMVKEVWGT 947
                 ++ A +   G+Y +      + D A  RI V   V   GPP      +   E+   
Sbjct: 21247 ITLSIKNAKKEHGGKYTV------ILDNAVCRIAVPITVITLGPPSKPKGPIRFDEIKAD 21300

Query: 948   NALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVY 1007
             + ++ W  P+D+G  EI  Y ++K +     W  V      T+  V +L+   EY FRV 
Sbjct: 21301 SVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCSSVARTTFKVPNLVKDAEYQFRVR 21360

Query: 1008  TENICGLS----DSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGY 1063
              EN  G+S     S  V+K+  RI   G   KP  Y      M+  +  P+ D     G 
Sbjct: 21361 AENRYGVSQPLVSSIIVAKHQFRI--PGPPGKPVIYNVTSDGMSLTWDAPVYD-----GG 21413

Query: 1064  SAALNCAVRGHPKPKVVWMK 1083
             S      V    +  ++W K
Sbjct: 21414 SEVTGFHVEKKERNSILWQK 21433



 Score =  216 bits (551), Expect = 8e-56
 Identities = 174/617 (28%), Positives = 273/617 (44%), Gaps = 49/617 (7%)

Query: 434   VEEKQLEVLQDIADLTV-KASEQAVFKCEVSDEKV-TGKWYKNGVEVRPSKRITISHVGR 491
             VE  +++V     D  + KA E    + +VS     T +W K+G E+  + ++ I     
Sbjct: 15084 VEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADF 15143

Query: 492   FHKLVIDDVRPEDEGDYTFV---PDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGK 548
                LV  D    D G YT     P G+A  +          V+ + +  PP+  L  +  
Sbjct: 15144 STNLVNKDSTRRDSGAYTLTATNPGGFAKHI--------FNVKVLDRPGPPEGPLAVTEV 15195

Query: 549   TSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVF-----TTTEGRTRIEKRVDCSSF 603
             TSE  +             ++  PP      K D        T+    T +   V  +  
Sbjct: 15196 TSEKCV-------------LSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKL 15242

Query: 604   VIESAQREDEGRYTIKVTNP--VGEDVASIFLQVVDV---PDPPEAVRITSVGEDWAILV 658
              +    + +E  + +   N   VGE + S  +  V+    PDPP+   +T++ +D  ++ 
Sbjct: 15243 KVTKLLKGNEYIFRVMAVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVC 15302

Query: 659   WEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNA 718
             W  P  DGG  +  Y+VER+ K  QRW+K N +  T+  Y+ + + EG  YE R+ A NA
Sbjct: 15303 WGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENA 15362

Query: 719   IGVSQPSMNTKPFMPIAPT----SEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
              G+S PS  T PF     T      P +  V D + ++ ++ W  P   G   I GY+VE
Sbjct: 15363 AGISAPS-PTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVE 15421

Query: 775   YCLEGSEEW-VPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIRE 833
               L   +EW +      ++   +T+  L        R+  +N  G  EPA +       +
Sbjct: 15422 IALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAED 15481

Query: 834   IAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKG-GAPLDTSRVHVRTSD 892
                PP+I L   LR+    +    L L VP +G+P P+V W +  G  LD + +   TS 
Sbjct: 15482 RMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIE-STSS 15540

Query: 893   FDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVE 952
             + T+  V    R DSG+Y L+V+  +   +A + +RV++  GPP ++ VKEV  T+  + 
Sbjct: 15541 Y-TLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLT 15599

Query: 953   WQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENIC 1012
             W  P  DG S+I  Y V+K +     +  V      TS  V  L  G  YYFRV  EN  
Sbjct: 15600 WDPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEY 15659

Query: 1013  GLSDSPGVSKNTARILK 1029
             G+    G+   TA  +K
Sbjct: 15660 GI----GLPAETAESVK 15672



 Score =  215 bits (548), Expect = 2e-55
 Identities = 150/495 (30%), Positives = 223/495 (45%), Gaps = 24/495 (4%)

Query: 536  QEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIE 595
            QEPP + LD S K     I ++AG  LR+   +TG P P   W K  E     + R  I+
Sbjct: 8727 QEPPAVELDVSVK---GGIQIMAGKTLRIPAVVTGRPVPTKVWTK--EEGELDKDRVVID 8781

Query: 596  KRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWA 655
                 S  +I+ A R+D GRY I  TN  G   A+  ++V DVP P   ++         
Sbjct: 8782 NVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMC 8841

Query: 656  ILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTE-TTYESTKMIEGILYEMRVF 714
            +L W  P  DGG  +TG+++ERK      W +    + TE +  + T ++EG  Y+ RV 
Sbjct: 8842 LLNWSDPEDDGGSEITGFIIERKDAKMHTWRQ---PIETERSKCDITGLLEGQEYKFRVI 8898

Query: 715  AVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGY 771
            A N  G   P +   P +   P+ P + P  L   + T +T TL W+ P   G   I GY
Sbjct: 8899 AKNKFGCG-PPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGY 8957

Query: 772  LVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTI 831
            ++E       ++   N        F V+NL       FRV  VN  G SEP +L   V I
Sbjct: 8958 IIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEP-SLPLNVVI 9016

Query: 832  REIAEPPKIRLPRHLRQTYIR-KVGEQLNLVVPFQGKPRPQVVWTKGGA-------PLDT 883
            ++   PP I+L   +R   I+ K GE +++     G P P++ W+K           L  
Sbjct: 9017 QDDEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQI 9076

Query: 884  SRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKE 943
            ++  V  S+  T   + +A R D G Y ++           + + V ++  PP N+ V +
Sbjct: 9077 TKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTD 9136

Query: 944  VWGTNALVEWQAPKDDGNSEIMGYFVQKAD--KKTMEWFNVYERNRHTSCTVSDLIVGNE 1001
            +   +  + W AP D+G SEI  Y + K D  +K  EW  V          +  LI   +
Sbjct: 9137 IKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKRYGIWKLIPNGQ 9196

Query: 1002 YYFRVYTENICGLSD 1016
            Y FRV   N  G+SD
Sbjct: 9197 YEFRVRAVNKYGISD 9211



 Score =  213 bits (543), Expect = 6e-55
 Identities = 157/584 (26%), Positives = 263/584 (45%), Gaps = 34/584 (5%)

Query: 448   LTVKASEQAVFKCEVSDEKVTG-KWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG 506
             L +K+ E    K  V    V    W+K+GVE+     + I+ V     L + D   +  G
Sbjct: 21596 LIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRG 21655

Query: 507   DYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRL-- 564
              YT      + S  A++   ++KV+  P +    I               + G K+ L  
Sbjct: 21656 VYTVEAKNASGSAKAEI---KVKVQDTPGKVVGPIRF-----------TNITGEKMTLWW 21701

Query: 565   DVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTN-- 622
             D  +     P+  ++  ++  T+      IE + +  S+        +E ++ +   N  
Sbjct: 21702 DAPLNDGCAPITHYII-EKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNKF 21760

Query: 623   ----PVGED--VASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVE 676
                 P+  D  VA I   V D P  PE   IT    +   L W  P  DGG  +  Y++E
Sbjct: 21761 GVGRPLDSDPVVAQIQYTVPDAPGIPEPSNITG---NSITLTWARPESDGGSEIQQYILE 21817

Query: 677   RKKKGSQRWMK-LNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM--- 732
             R++K S RW+K ++    +ET ++ T + EG  YE  V A NA GV   S  ++      
Sbjct: 21818 RREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCRE 21877

Query: 733   PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVE 792
             P+ P   P  + V D + TT +L+W  P   G   I GY++E C     +W   N E   
Sbjct: 21878 PVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACV 21937

Query: 793   RCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIR 852
             +  +TV +L  G    FRV  +N AG+ +   +   +   +    P++ +  + +QT++ 
Sbjct: 21938 KTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVV 21997

Query: 853   KVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYEL 912
             + G  + L + +QG+P P  VW+K  + L + R  + T+D  +   V    R+D+G+Y L
Sbjct: 21998 RAGASIRLFIAYQGRPTPTAVWSKPDSNL-SLRADIHTTDSFSTLTVENCNRNDAGKYTL 22056

Query: 913   SVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKA 972
             +V+  +   + T  ++V++  GPP  +  K+V   +A + W AP  DG + I  Y V+K 
Sbjct: 22057 TVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKR 22116

Query: 973   DKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
             +     W  + E+       V+DL  G  YYFRV   N  G+ +
Sbjct: 22117 EASRRSWQVISEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGE 22160



 Score =  213 bits (542), Expect = 8e-55
 Identities = 131/391 (33%), Positives = 192/391 (49%), Gaps = 16/391 (4%)

Query: 639   PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTY 698
             PDPPE   +T V ++   +VW PP YDGGK +TGY +E+K+K S RW+ +N     E   
Sbjct: 12027 PDPPE---VTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRM 12083

Query: 699   ESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTL 755
             +   ++    Y+ RV A N IG+ +PS+ ++P +   PI P   P +  V D T  + TL
Sbjct: 12084 KVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTKHSITL 12143

Query: 756   KWRPPNRIGAGGIDGYLVEYC-----LEGSEEWVPANTEP-VERCGFTVKNLPTGARILF 809
              W  P   G   I GY+VE           E W   N    + R  FTV +L       F
Sbjct: 12144 GWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEF 12203

Query: 810   RVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPR 869
             RV   N  G   PA L + +  +EI EPP+I L   +R+  I + G  + L    +G+P 
Sbjct: 12204 RVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPA 12263

Query: 870   PQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRV 929
             P+V W K G      +  V   D      +  + R DSG+Y L++     +    + +RV
Sbjct: 12264 PKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRV 12323

Query: 930   VEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHT 989
             ++  GP  ++ V +V  T+  V W  P++DG S++  Y V+K +     W  V    + T
Sbjct: 12324 LDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVKKT 12383

Query: 990   SCTVSDLIVGNEYYFRVYTENICGLSDSPGV 1020
             S  V++L+ GNEYYFRV   N  G    PGV
Sbjct: 12384 SFHVTNLVPGNEYYFRVTAVNEYG----PGV 12410



 Score =  211 bits (538), Expect = 2e-54
 Identities = 145/521 (27%), Positives = 236/521 (45%), Gaps = 40/521 (7%)

Query: 536  QEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATW--------LKGDEVFTT 587
            QE P++ +D     +++ +V  AG+++R+   I G P P ++W           D V   
Sbjct: 9433 QEEPEVFIDIG---AQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDI 9489

Query: 588  TEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRI 647
             E   ++E   + S  +I   +R   G+Y+I   N  G+  A+  ++V+DVP PP+ +++
Sbjct: 9490 PED-AQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKV 9548

Query: 648  TSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGI 707
            + +      L W+ P  DGG  + GY++E++    + W K+N +    TT+    ++   
Sbjct: 9549 SDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDC-GSTTFVVPDLLSEQ 9607

Query: 708  LYEMRVFAVNAIGVSQP---SMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIG 764
             Y  RV A N  G+  P      T    PI P   P+ L +  +T  T  L W+PP   G
Sbjct: 9608 QYFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDG 9667

Query: 765  AGGIDGYLVEYCL------EGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAG 818
               +  Y+VE CL         E W   N   VE   FTV++L  G    FRV  VN AG
Sbjct: 9668 GSPVTHYIVE-CLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAG 9726

Query: 819  RSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGG 878
             S+P+    P   +    PP I L   +      + G  +N+V   +G P P + W K  
Sbjct: 9727 VSKPSATVGPCDCQRPDMPPSIDLKEFMEV----EEGTNVNIVAKIKGVPFPTLTWFK-- 9780

Query: 879  AP----------LDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIR 928
            AP          L  + V+    D      + Q+ RSD+G Y ++        +  +R+ 
Sbjct: 9781 APPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLN 9840

Query: 929  VVEKAGPPIN-VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNR 987
            V+ + GPP+  +  + V      + W  PKDDG S+I  Y ++K +     W +V    +
Sbjct: 9841 VLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPK 9900

Query: 988  HTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARIL 1028
              + T+  L+ G+EY FR+  +N  G+ +       TAR L
Sbjct: 9901 ECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNL 9941



 Score =  211 bits (536), Expect = 4e-54
 Identities = 160/614 (26%), Positives = 270/614 (43%), Gaps = 45/614 (7%)

Query: 431   ELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDE-KVTGKWYKNGVEVRPSKRITISHV 489
             +L++E    +V    +  +V+  +    +  +S   K T  W K+G+ ++ + RI ++  
Sbjct: 16853 DLVIEP---DVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDS 16909

Query: 490   GRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKT 549
                  L I +   +D G Y     G  ++         I++  + K +PPK  +     +
Sbjct: 16910 LDLTTLSIKETHKDDGGQY-----GITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVS 16964

Query: 550   SENAIV-----VVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFV 604
             +E+  +     +  G     +  +         W    +V + T  RT ++         
Sbjct: 16965 AESITLSWNPPLYTGGCQITNYIVQKRDTTTTVW----DVVSATVARTTLK--------- 17011

Query: 605   IESAQREDEGRYTIKVTNPVGEDVASIFLQVV-----DVPDPPEAVRITSVGEDWAILVW 659
             +   +   E ++ I   N  G+  A     +V       P PP     T++ +D  ++ W
Sbjct: 17012 VTKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQW 17071

Query: 660   EPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAI 719
               P+ +GG PV GY +ERK++ S  W K+N  +  +T +++  + EGI YE RV+A N +
Sbjct: 17072 HEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIV 17131

Query: 720   GVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
             GV + S N++ ++   P  P   P  ++V+       TL+W  P   G   I GY+VE  
Sbjct: 17132 GVGKASKNSECYVARDPCDPPGTPEPIMVK---RNEITLQWTKPVYDGGSMITGYIVEKR 17188

Query: 777   LEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGR-SEPATLAQPVTIREIA 835
                   W+ A+   V    FTV  L    R  FRV+  N AG  S+P+    P+T ++  
Sbjct: 17189 DLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEV 17248

Query: 836   EPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTS-RVHVRTSDFD 894
             E P+I +    R T +   GE   L     GKP P + W +G   ++ S R  ++ +DF 
Sbjct: 17249 ELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFK 17308

Query: 895   TVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTNALVEW 953
              +  V+ A R D G+Y L         +  + ++V+++ GPP   V V  V      + W
Sbjct: 17309 ALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTW 17368

Query: 954   QAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICG 1013
               P  DG S+I  Y V+K +   + W  V       S  V+ L+ GNEY FR+   N  G
Sbjct: 17369 SPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYG 17428

Query: 1014  ----LSDSPGVSKN 1023
                 L  +P + KN
Sbjct: 17429 VGEPLESAPVLMKN 17442



 Score =  210 bits (535), Expect = 5e-54
 Identities = 152/568 (26%), Positives = 255/568 (44%), Gaps = 40/568 (7%)

Query: 468   TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLE 527
             T +WYK+  E++ +  + + +      ++I D    + G Y         S SA      
Sbjct: 20531 TIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASAT----- 20585

Query: 528   IKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTT 587
             I+V+ + K  PP   ++    T+E              +++   PP      K       
Sbjct: 20586 IRVQILDKPGPPGGPIEFKTVTAEK-------------ITLLWRPPADDGGAKITHYIVE 20632

Query: 588   TEGRTRI------EKRVDCSSFVIESAQ--REDEGRYTIKVTNPVG-----EDVASIFLQ 634
                 +R+      E   +C   +I + +  + +E  + ++  N  G     E  + +   
Sbjct: 20633 KRETSRVVWSMVSEHLEEC---IITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKN 20689

Query: 635   VVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFT 694
                 P PP    +T + ++   +VW  P+ DGG  ++GY +E++ K S  W K+  E   
Sbjct: 20690 AFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIR 20749

Query: 695   ETTYESTKMIEGILYEMRVFAVNAIG---VSQPSMNTKPFMPIAPTSEPLHLIVEDVTDT 751
             +T  + T + E   Y+ RV AVNA G    S+PS   K   PI P   P  + + D T +
Sbjct: 20750 DTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKS 20809

Query: 752   TTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTE-PVERCGFTVKNLPTGARILFR 810
             + TL W  P   G   + GY+VE      EEW   +T+  V    + V NL  G    FR
Sbjct: 20810 SITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFR 20869

Query: 811   VVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRP 870
             V  VN AG+ EP  + +PV  ++I E P+I L   LR + I K GE + +++PF+G+P P
Sbjct: 20870 VSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPP 20929

Query: 871   QVVWTKGGAPLDT-SRVHVRTSDFDTVFFVRQAARSDSGEYELSVQI-ENMKDTATIRIR 928
              V W K    L + +R  +  +D  ++  + Q  R+D+G+Y L+++       ++T+ ++
Sbjct: 20930 TVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVK 20989

Query: 929   VVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRH 988
             V++       + VK V      + W  P  DG S I+ Y ++K D     W  V  +   
Sbjct: 20990 VLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSS 21049

Query: 989   TSCTVSDLIVGNEYYFRVYTENICGLSD 1016
             TS  + DL     ++FRV  EN  G+ +
Sbjct: 21050 TSFKLIDLSEKTPFFFRVLAENEIGIGE 21077



 Score =  209 bits (532), Expect = 1e-53
 Identities = 154/579 (26%), Positives = 261/579 (45%), Gaps = 27/579 (4%)

Query: 448   LTVKASEQAVFKCEVSDEKVTGK-WYKNGVEVRPSK-RITISHVGRFHKLVIDDVRPEDE 505
             + V A E  V + ++  + +    W K+G E+  +  R+ I    +   LV+ D    D 
Sbjct: 18345 IVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDG 18404

Query: 506   GDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLD 565
             G Y        LS       + I V+ + +  PP+  L  +G T+E   +  A N    D
Sbjct: 18405 GQYIL-----KLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYL--AWNPPLQD 18457

Query: 566   VSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNP-- 623
                      ++ ++  ++  T+    T++   V   ++ +      +E  + +   N   
Sbjct: 18458 GGAN-----ISHYII-EKRETSRLSWTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNKYG 18511

Query: 624   VGEDVASIFLQVVDV---PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKK 680
             +GE + S  +   +    P PP    ++++ +D  ++ W  P+ DGG  + GY++E++ K
Sbjct: 18512 IGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDK 18571

Query: 681   GSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGV---SQPSMNTKPFMPIAPT 737
                RW K N +  T+     T + EG  YE RV A NA GV   S+PS+  +    + P 
Sbjct: 18572 EGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPP 18631

Query: 738   SEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCG-- 795
               P +  V D + ++ +L W  P   G   + GY+VE     ++EW    T P    G  
Sbjct: 18632 GPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTC-TPPTGLQGKQ 18690

Query: 796   FTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVG 855
             FTV  L       FR+  +N  G  EPATL   V  +E  EPP+I L   LR+  + +  
Sbjct: 18691 FTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRAS 18750

Query: 856   EQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQ 915
               L L V  +G+P P+V W K    L T R  +  +   T+  +    R DSG Y L+++
Sbjct: 18751 ATLRLFVTIKGRPEPEVKWEKAEGIL-TDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLE 18809

Query: 916   IENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKK 975
               +   TA + +RV++    P+N+ ++EV   +  + W+ P  DG ++I  Y V+K +  
Sbjct: 18810 NNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETT 18869

Query: 976   TMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGL 1014
                +  +      T+  + +L  G  YYFRV   N  G+
Sbjct: 18870 RKAYATITNNCTKTTFRIENLQEGCSYYFRVLASNEYGI 18908



 Score =  208 bits (529), Expect = 3e-53
 Identities = 149/504 (29%), Positives = 229/504 (45%), Gaps = 42/504 (8%)

Query: 554  IVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDE 613
            I+V+ G KL + V     P P  +W K  +    ++  T     +     V +S  R D 
Sbjct: 8024 IIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSV-RADA 8082

Query: 614  GRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGY 673
            G YTI + N +G   ASI ++V+ +P P + ++ + + +    L WEPP +DGG P+  Y
Sbjct: 8083 GIYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHY 8142

Query: 674  LVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM- 732
            ++ER++ G + ++ +      + ++    +I    Y  RV AVN +G  +      P + 
Sbjct: 8143 VLERREAGRRTYIPV-MSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIA 8201

Query: 733  --PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEP 790
              P  P   P+ + V + T    T+ W+PP   G   I GY++E   +G E W   N   
Sbjct: 8202 QDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHL 8261

Query: 791  VERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTY 850
            V    +T K L  G    FRV   N AG SEP+    P    +  + PK+     LR + 
Sbjct: 8262 VPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKV----ILRTSL 8317

Query: 851  IRKVGEQLNLVVPFQGKPRPQVVWTKG------------GAPLD---------------- 882
              K G+++ L     G P P + W K              APL                 
Sbjct: 8318 EVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLP 8377

Query: 883  -TSRVHVRTS-DFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVM 940
             T R+ +  S   ++   VR + R D G Y + V+ ++    A   + V++  GPPIN +
Sbjct: 8378 LTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFV 8437

Query: 941  VKEVWGTNALVEWQAPKDDGNSEIMGYFVQKAD--KKTMEWFNVYERNRHTSCTVSDLIV 998
             +++  T+ L +W+ P DDG SEI+ Y ++K D  K   EW  V    RH   +V+ LI 
Sbjct: 8438 FEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIE 8497

Query: 999  GNEYYFRVYTENICGLSDSPGVSK 1022
            G EY FRV  EN  G    P VSK
Sbjct: 8498 GKEYLFRVRAENRFG-PGPPCVSK 8520



 Score =  205 bits (522), Expect = 2e-52
 Identities = 154/585 (26%), Positives = 255/585 (43%), Gaps = 40/585 (6%)

Query: 448   LTVKASEQAVFKCEVSDEKV-TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG 506
             + V A E    + +V  + + T +W +   E+  S R  I +      L++ D    D G
Sbjct: 17263 IVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGG 17322

Query: 507   DYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDV 566
              Y       A S S  +N     V+ + +  PP+  +  +G TSE               
Sbjct: 17323 QYILRASNVAGSKSFPVN-----VKVLDRPGPPEGPVQVTGVTSEKC------------- 17364

Query: 567   SITGEPP------PVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKV 620
             S+T  PP       ++ ++  ++  T+    T +   V  +S  +      +E  + I  
Sbjct: 17365 SLTWSPPLQDGGSDISHYVV-EKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMA 17423

Query: 621   TNPVG-----EDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLV 675
              N  G     E    +      +P PP+++ +T++ +D   + W  P  DGG  + GY+V
Sbjct: 17424 VNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIV 17483

Query: 676   ERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNT---KPFM 732
             E++ +   RW+K N    T+     T + E   YE RV A NA GV +PS  T   K   
Sbjct: 17484 EKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACD 17543

Query: 733   PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEW---VPANTE 789
             P+     P +  + D T  + TL W  P   G   I GY+VE C    EEW    P    
Sbjct: 17544 PVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGL 17603

Query: 790   PVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQT 849
              V R  F +  L        RV  +N  G  E  ++   V   +  E P++ L   LR+ 
Sbjct: 17604 RVTR--FEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKG 17661

Query: 850   YIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGE 909
              + + G    + +PF+G+P P++ W++      T +V +      T   +    R+D+G+
Sbjct: 17662 IVVRAGGSARIHIPFKGRPTPEITWSREEGEF-TDKVQIEKGVNYTQLSIDNCDRNDAGK 17720

Query: 910   YELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFV 969
             Y L ++  +   +A + ++V++  GPP N+ VKEV   +A + W+ P  DG +++  Y +
Sbjct: 17721 YILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVI 17780

Query: 970   QKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGL 1014
              K +     + NV  +   TS  V +L  G  YYFRV  EN  G+
Sbjct: 17781 DKRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGV 17825



 Score =  205 bits (521), Expect = 2e-52
 Identities = 150/561 (26%), Positives = 249/561 (44%), Gaps = 34/561 (6%)

Query: 471   WYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKV 530
             W K+G  ++ + R+ +        L I +   +D G YT      A + +  L+ + ++ 
Sbjct: 17973 WVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLE- 18031

Query: 531   EYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLD-VSITGEPPPVATWLKGDEVF---- 585
                 K  PP              +  V  +++  D V I+ EPP      +         
Sbjct: 18032 ----KPGPP--------------VGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKR 18073

Query: 586   -TTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGE----DVASIFLQV-VDVP 639
              TTT     +   V  ++  I   +   E ++ I   N  G+    D  ++ +Q     P
Sbjct: 18074 DTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEP 18133

Query: 640   DPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYE 699
              PP    +TS+ +D  ++ W  P+ DGG  + GY +E+K+K S  W+KLN     +T ++
Sbjct: 18134 GPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFK 18193

Query: 700   STKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRP 759
             +T + EG+ YE +V A N +G+ +PS  ++ F+   P   P       +T    TLKW+ 
Sbjct: 18194 TTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKK 18253

Query: 760   PNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGR 819
             P   G   I GY+VE        W+ A+   V    FTV  L    R  FRV+  N AG 
Sbjct: 18254 PAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGN 18313

Query: 820   -SEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGG 878
              SEP+  +  +T R+  + P   L    +   +   GE   L    +GKP P VVW+K G
Sbjct: 18314 FSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDG 18373

Query: 879   APLD--TSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPP 936
               L+   +R+ ++++   T   V+   R+D G+Y L +       +  I ++V+++ GPP
Sbjct: 18374 KELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPP 18433

Query: 937   IN-VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSD 995
                + V  V      + W  P  DG + I  Y ++K +   + W  V    +  +  V+ 
Sbjct: 18434 EGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTK 18493

Query: 996   LIVGNEYYFRVYTENICGLSD 1016
             L+ GNEY FRV   N  G+ +
Sbjct: 18494 LLPGNEYIFRVMAVNKYGIGE 18514



 Score =  204 bits (519), Expect = 4e-52
 Identities = 159/589 (26%), Positives = 267/589 (45%), Gaps = 45/589 (7%)

Query: 448   LTVKASEQAVFKCEVSDEKVTGK--WYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDE 505
             LT+KA +  V        K   K  W K G ++RPS    I+       L I     +D 
Sbjct: 14016 LTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDA 14075

Query: 506   GDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLD 565
             G+YT            K+  +++ V  VP    P   ++ S  ++E A            
Sbjct: 14076 GEYTITATN---PFGTKVEHVKVTVLDVPGPPGP---VEISNVSAEKA------------ 14117

Query: 566   VSITGEPP------PVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIK 619
              ++T  PP      P+ +++  ++  T+    T + + +     V     + +E  + + 
Sbjct: 14118 -TLTWTPPLEDGGSPIKSYIL-EKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFRVS 14175

Query: 620   VTNPVG--EDVASIFLQVVD---VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYL 674
               N  G  E V S  +++VD    P PPE   +++V ++ A + W+ P+ DGG  +TGY 
Sbjct: 14176 AVNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYH 14235

Query: 675   VERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM-- 732
             VER++K S RW++      ++   + T + EG  YE RV A N  G+  PS  +   +  
Sbjct: 14236 VERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMK 14295

Query: 733   ----PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANT 788
                 P  P S P    V D T  + +L W  P+  G   I GY+VE+   G E W+   T
Sbjct: 14296 DAAYPPGPPSNPH---VTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTT 14352

Query: 789   EPVERCG-FTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLR 847
                 R   F V +L T  +  FR+  +N AG  EPA +   V I E    P   L   LR
Sbjct: 14353 GTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPD-VEIVEREMAPDFELDAELR 14411

Query: 848   QTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDS 907
             +T + + G  + + VP +G+P P+V WTK    L  +R ++  ++  T+  + +  R D+
Sbjct: 14412 RTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLK-NRANIENTESFTLLIIPECNRYDT 14470

Query: 908   GEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGY 967
             G++ ++++    K +  + +RV++  GP +N+   ++   +  + W  P  DG S I  Y
Sbjct: 14471 GKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNY 14530

Query: 968   FVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
              V+K +     +     +    +  V+ L  G EY+FRV  EN  G+ +
Sbjct: 14531 IVEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGE 14579



 Score =  203 bits (517), Expect = 7e-52
 Identities = 166/605 (27%), Positives = 260/605 (42%), Gaps = 40/605 (6%)

Query: 448   LTVKASEQAVFKCEVSDEKV-TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG 506
             + V A E      ++  + + T +W K   E+  + R+ I        L + D    D G
Sbjct: 16181 IVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSG 16240

Query: 507   DYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIV-----VVAGNK 561
             +Y       A   S  +N     V+ + +  PP+  +  SG T+E   +     +  G  
Sbjct: 16241 NYILKAKNVAGERSVTVN-----VKVLDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGS 16295

Query: 562   LRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVT 621
               ++  +         W             T ++  V   S  +      +E  + I   
Sbjct: 16296 DIINYIVERRETSRLVW-------------TVVDANVQTLSCKVTKLLEGNEYTFRIMAV 16342

Query: 622   NP--VGEDVAS---IFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVE 676
             N   VGE + S   +      VPD P+A  +T+V +D  I+VWE P  DGG  + GY++E
Sbjct: 16343 NKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVLE 16402

Query: 677   RKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNT---KPFMP 733
             ++ K   RW + +  +  E     T +IE   YE RV A NA G+S+PS  +   K   P
Sbjct: 16403 KRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACDP 16462

Query: 734   IAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEP--V 791
             I     P +  V D+T ++  L W  P   G   I GY+VE C     EW    T P  +
Sbjct: 16463 IYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMC-TPPTGI 16521

Query: 792   ERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYI 851
              +    V+ L       FR+  +N AG  E A +  P+ + E  E P I L   LR+   
Sbjct: 16522 NKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKIIN 16581

Query: 852   RKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYE 911
              + G  L L VP +G+P P+V W K    +  + +   TS F T   +    R DSG+Y 
Sbjct: 16582 IRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSF-TSLVLDNVNRYDSGKYT 16640

Query: 912   LSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQK 971
             L+++  +   +A + +RV++   PP+N+ V E+   +  + W+ P  DG S+I  Y V+K
Sbjct: 16641 LTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEK 16700

Query: 972   ADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTG 1031
              +     +  V       S  +  L  G  YYFRV  EN  G+    G+   TA  +K  
Sbjct: 16701 REATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGI----GLPAQTADPIKVA 16756

Query: 1032  ITFKP 1036
                +P
Sbjct: 16757 EVPQP 16761



 Score =  203 bits (516), Expect = 9e-52
 Identities = 157/575 (27%), Positives = 257/575 (44%), Gaps = 39/575 (6%)

Query: 462   VSDEKVTGK------WYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGY 515
             V D  V GK      W K   E+   +++++ + G+    VI      D G YT      
Sbjct: 22694 VLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNA 22753

Query: 516   ALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPV 575
             +     K   + +KV            LD  G   +  +  V   K  L  S+  E    
Sbjct: 22754 S---GTKAVSVMVKV------------LDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGA 22798

Query: 576   A-TWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQ 634
               T    +   T+      +E      S+V+    + +E  + ++  N  G  V      
Sbjct: 22799 EITHYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEP 22858

Query: 635   VV-----DVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLN 689
             +V      +P PP        G++  I+ W  P  DGG  ++ YLV++++K S RW ++N
Sbjct: 22859 IVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVN 22918

Query: 690   FE-VFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNT------KPFMPIAPTSEPLH 742
              + V  +T  + T ++EG  Y+ RV AVNA G S+PS  +      +P     P S P  
Sbjct: 22919 KDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPR- 22977

Query: 743   LIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEP-VERCGFTVKNL 801
               V D T  + +L W  P   G   I GY++E   + +++W   +T   +    FTV +L
Sbjct: 22978 --VVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDL 23035

Query: 802   PTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLV 861
               G +  FRV  VN+ G SE +     +   E  E P + L   L++T   + G  L L+
Sbjct: 23036 KMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGASLRLM 23095

Query: 862   VPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKD 921
             V   G+P P + W+K G  L  SR  + T++  ++  V +  R D+G+Y +  + ++ K 
Sbjct: 23096 VSVSGRPPPVITWSKQGIDL-ASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKK 23154

Query: 922   TATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFN 981
             +AT+ ++V +  GP  +V VKEV   +  + W+ P  DG + +  Y V+K +     +  
Sbjct: 23155 SATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREAAMRAFKT 23214

Query: 982   VYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
             V  +   T   +S L+ G  YYFRV  ENI G+ +
Sbjct: 23215 VTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGE 23249



 Score =  202 bits (515), Expect = 1e-51
 Identities = 126/404 (31%), Positives = 190/404 (47%), Gaps = 12/404 (2%)

Query: 638   VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETT 697
             VP  P+   ++SV  +   + WE P YDGG PVTGY +E K   S+RW ++N +     T
Sbjct: 9944  VPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMT 10003

Query: 698   ----YESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTD 750
                 Y+ T +IEG  Y+ RV+A+NA GV   S+ + P     PIAP   P   +  D T 
Sbjct: 10004 LGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPGPPFPKVT-DWTK 10062

Query: 751   TTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFR 810
             ++  L+W PP + G   + GY+VEY  EG EEW     + V      V  L  GA   FR
Sbjct: 10063 SSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFR 10122

Query: 811   VVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRP 870
             V  VNIAG  EP  +   + +++    P ++L   +R   +   G  + ++    GKP P
Sbjct: 10123 VRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPP 10182

Query: 871   QVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVV 930
              V W      L      + T+   +   ++   RS  G Y L  + E  +   TI + V+
Sbjct: 10183 TVTWNMNERTL-PQEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVL 10241

Query: 931   EKAGP-PINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHT 989
             +  GP     +   +   +  + W +P+DDG S I  Y ++K +     W  V       
Sbjct: 10242 DVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQ 10301

Query: 990   SCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGIT 1033
             + TV  LI G  Y+FR+  EN  G+   P V  + A +++  IT
Sbjct: 10302 NATVQGLIQGKAYFFRIAAENSIGM--GPFVETSEALVIREPIT 10343



 Score =  201 bits (510), Expect = 4e-51
 Identities = 227/907 (25%), Positives = 363/907 (40%), Gaps = 108/907 (11%)

Query: 267  QVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
            +V    ++    E++      KWF+N + I  SSKY+         L I    L D A Y
Sbjct: 6278 RVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANY 6337

Query: 327  EVAVKDE-----KCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKD 381
             V++ +      K    L V+E  + IV PL+D +      V    +V+     + W K+
Sbjct: 6338 NVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKN 6397

Query: 382  GVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEV 441
            G E+     F  R  ++ D  +H+L   D    D G Y V     +  AEL++ E   E 
Sbjct: 6398 GEEVP----FDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEF 6453

Query: 442  LQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVR 501
            ++ + D TV   + AVF C++S EK   KWY+NG E++  K+      G  H+L+I D R
Sbjct: 6454 VEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCR 6513

Query: 502  PEDEGDYTF-VPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGN 560
             +DE +Y   V D  +    A+L   EI VE +    PP+  L+  G    + + +   N
Sbjct: 6514 LDDECEYACGVEDRKS---RARLFVEEIPVEII---RPPQDILEAPG---ADVVFLAELN 6564

Query: 561  KLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKV 620
            K +++V        V   ++GD+    +EG  +I +   C        +  D+G Y    
Sbjct: 6565 KDKVEVQWLRNNMVV---VQGDKHQMMSEG--KIHRLQIC------DIKPRDQGEYRFIA 6613

Query: 621  TNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYL-VERKK 679
                 +  A   L++   P      +I +  +D  +        D GKP+T  +  +   
Sbjct: 6614 K----DKEARAKLELAAAP------KIKTADQDLVV--------DVGKPLTMVVPYDAYP 6655

Query: 680  KGSQRWMKLNFEVFT---ETTYEST--KMIE---GILYEMRVFAVNAIGVSQPSMNTKPF 731
            K    W K N  + T   +TT E T  +++E   G     ++   N  G ++  +N K  
Sbjct: 6656 KAEAEWFKENEPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVI 6715

Query: 732  MPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPV 791
                P     +L V +  D   +L W  P   G   I GY+VE      + WV A T+  
Sbjct: 6716 DVPGPVR---NLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLA-TDRA 6771

Query: 792  ERCGFTVKNLPT-GARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTY 850
            E C FTV  L   G   LFRV   N  G  EP     PV  R   + P    P ++  T 
Sbjct: 6772 ESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVP--GPPLNVTITD 6829

Query: 851  IRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSD---FDTVFFVRQAARS-- 905
            + + G  L    P             GGA +    + +R      +DT   VR    S  
Sbjct: 6830 VNRFGVSLTWEPPEY----------DGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSAT 6879

Query: 906  -----DSGEYELSVQIEN-----MKDTATIRIRV---VEKAGPPINVMVKEVWGTNALVE 952
                 +  EY   V+ +N         AT  ++V   +E+  PP+N+   +   ++  ++
Sbjct: 6880 VTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLK 6939

Query: 953  WQAPKDDGNSEIMGYFVQKADKKTMEWFNV-YERNRHTSCTVSDLIVGNEYYFRVYTENI 1011
            W+ P  DG S I+GY +++ ++    W     +     +  V+ L  GN+Y +RV  EN 
Sbjct: 6940 WEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENK 6999

Query: 1012 CGLSD-SPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCA 1070
             G+SD S  +   TA       T     +K+    + P  +T L+               
Sbjct: 7000 AGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPST------------ 7047

Query: 1071 VRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEAL 1130
              G+P+P   W      +    +  +        L I      D G YT +  N +    
Sbjct: 7048 --GYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTIS 7105

Query: 1131 AECKLEV 1137
             E  + V
Sbjct: 7106 GEIDVNV 7112



 Score =  201 bits (510), Expect = 4e-51
 Identities = 147/489 (30%), Positives = 221/489 (45%), Gaps = 29/489 (5%)

Query: 538   PPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKR 597
             PP++ LD    T  + I V  G  +R+   + G P P  TW K  +V          EKR
Sbjct: 11533 PPEVELDV---TCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVR-------EKR 11582

Query: 598   VDCSSFV------IESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVG 651
             VD    +      I+ A R D G+Y I   N  G    S  + V+D P P + +++T+V 
Sbjct: 11583 VDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVT 11642

Query: 652   EDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEM 711
             ++   + WE P+ +GG  +T ++VE +K   + W  +  +V          ++    Y  
Sbjct: 11643 KENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLI--KANLLANNEYYF 11700

Query: 712   RVFAVNAIGVSQPSMNTK-PFMPIAPTS---EPLHLIVEDVTDTTTTLKWRPPNRIGAGG 767
             RV A N +GV  P++ TK P + I P     EP +L + D   T   LKWR P+  G   
Sbjct: 11701 RVCAENKVGVG-PTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSP 11759

Query: 768   IDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQ 827
                Y VE  L+GS++W   +   ++   + V          FRV   N  G S+     +
Sbjct: 11760 NLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDWVK-TE 11818

Query: 828   PVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSR-- 885
              V ++E  + P + L   L      K G+ + L    +GKP P+V WTK     D +R  
Sbjct: 11819 EVVVKEDLQKPVLDLK--LSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSP 11876

Query: 886   -VHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEV 944
              V + T    + F + +A RSD G+Y ++         A   + V++K GP  N+ + +V
Sbjct: 11877 RVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKIVDV 11936

Query: 945   WGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYF 1004
                   V W  P+DDG  EI  Y ++K + K M W            TV+ LI GNEY F
Sbjct: 11937 SSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIEGNEYIF 11996

Query: 1005  RVYTENICG 1013
             RV  EN  G
Sbjct: 11997 RVRAENKIG 12005



 Score =  200 bits (508), Expect = 7e-51
 Identities = 148/582 (25%), Positives = 254/582 (43%), Gaps = 35/582 (6%)

Query: 450   VKASEQAVFKCEVSDE-KVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDY 508
             VKA EQ           + T  W K+G  ++ + R+ +S       L I +   ED G Y
Sbjct: 19034 VKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTY 19093

Query: 509   TFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSI 568
                    A S++  +                 I LD  G      I  V+ +     ++I
Sbjct: 19094 ELCVSNSAGSITVPITI---------------IVLDRPGPPGPIRIDEVSCDS----ITI 19134

Query: 569   TGEPPP------VATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTN 622
             +  PP       ++ ++   +  T+T     + + V  +S  I       E ++ +   N
Sbjct: 19135 SWNPPEYDGGCQISNYIVEKKETTSTTWHI-VSQAVARTSIKIVRLTTGSEYQFRVCAEN 19193

Query: 623   PVGEDVASIFLQVV-----DVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVER 677
               G+   S    VV       P PP   ++    +   ++ W+ P+ DGG  V GY +E 
Sbjct: 19194 RYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEY 19253

Query: 678   KKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPT 737
             K++ S  W K N  +  +T  + + + EG++YE RV+A N  G+ + S + +P     P 
Sbjct: 19254 KERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPC 19313

Query: 738   SEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFT 797
               P    V ++T  + +LKW  P+  G   I GY+VE        W+  N   ++   F 
Sbjct: 19314 DPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQETYFE 19373

Query: 798   VKNLPTGARILFRVVGVNIAGR-SEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGE 856
             V  L    R  FRV   N A   SEP+    P+ +++  EPP++ +    R   + K GE
Sbjct: 19374 VTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGE 19433

Query: 857   QLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQ 915
              L +     G+P P + W K G  + + +R  + ++D  T+  V+   R D+G+Y L+++
Sbjct: 19434 VLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLK 19493

Query: 916   IENMKDTATIRIRVVEKAGPPINVM-VKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADK 974
                   +  +  +V++K GPP   + +  +      + W  P++DG ++I  Y V+K + 
Sbjct: 19494 NVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRET 19553

Query: 975   KTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
               + W       + TSC V+ L+ GNEY FRV   N  G+ +
Sbjct: 19554 SHLAWTICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGE 19595



 Score =  198 bits (504), Expect = 2e-50
 Identities = 117/410 (28%), Positives = 204/410 (49%), Gaps = 22/410 (5%)

Query: 638  VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTET- 696
            +P PP   ++ +  +   ++ W PP+ +GG P+TGY +E++++GS  W +++    T+  
Sbjct: 9226 LPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVG 9285

Query: 697  ----TYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVT 749
                 +   +++EG+ Y+ R  A+NA G+  PS  + P +   PI P   P    V+D T
Sbjct: 9286 LKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPPGPPSCPEVKDKT 9345

Query: 750  DTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEP---VERCGFTVKNLPTGAR 806
             ++ +L W+PP + G   I GY+VE   EG+ +W   N EP   +  C   V NL    +
Sbjct: 9346 KSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVN-EPDKLITTCECVVPNLKELRK 9404

Query: 807  ILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQG 866
              FRV  VN AG SEP+     +   +I E P++ +    +   + K G Q+ +    +G
Sbjct: 9405 YRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKG 9464

Query: 867  KPRPQVVWTKGGAPLDTSR--VH-------VRTSDFDTVFFVRQAARSDSGEYELSVQIE 917
            +P P+  W   G      +  VH       + T++  +V  + +  RS +G+Y ++ + +
Sbjct: 9465 RPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHTGKYSITAKNK 9524

Query: 918  NMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTM 977
              + TA  R++V++  GPP ++ V ++   +  + W+ P DDG   I GY ++K      
Sbjct: 9525 AGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGK 9584

Query: 978  EWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDS-PGVSKNTAR 1026
             W  V      T+  V DL+   +Y+FRV  EN  G+      + + TAR
Sbjct: 9585 AWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQRTTAR 9634



 Score =  198 bits (503), Expect = 3e-50
 Identities = 169/622 (27%), Positives = 268/622 (43%), Gaps = 40/622 (6%)

Query: 430   AELIVEEKQLEVLQDIADLT-----VKASEQAVFKCEVSDE---KVTGKWYKNGVEVRPS 481
             + +I++E Q+E   D+  +T      KA         +S     KVT  W    + ++ +
Sbjct: 22262 SSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVT--WKLEEMRLKET 22319

Query: 482   KRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKI 541
              R++I+       L + D    D G Y        L  +A +    + V  + +  P   
Sbjct: 22320 DRVSITTTKDRTTLTVKDSMRGDSGRYFLT-----LENTAGVKTFSVTVVVIGRPGPVTG 22374

Query: 542   HLDCSGKTSENAIVVVAGNKLRLDVSITG------EPPPVATWLKGDEVFTTTEGRTRIE 595
              ++ S  ++E+ ++     K      IT       E    A  L    V  T    T + 
Sbjct: 22375 PIEVSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLT 22434

Query: 596   KRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWA 655
             K ++ S F + S  R         V+ P+ E    I       P  P    +  V  +  
Sbjct: 22435 KYMEYS-FRVSSENR-------FGVSKPL-ESAPIIAEHPFVPPSAPTRPEVYHVSANAM 22485

Query: 656   ILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFA 715
              + WE P +DGG  + GY VE+K++ +  W+K N     E  Y+ T ++EG+ Y+ R +A
Sbjct: 22486 SIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYA 22545

Query: 716   VNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE- 774
             +NA GVS+ S  ++P M   P   P    V DVT +T +L W  P   G   + GY++E 
Sbjct: 22546 LNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRSTVSLIWSAPAYDGGSKVVGYIIER 22605

Query: 775   --YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAG-RSEPATLAQPVTI 831
                   G   W+  N   V    FTV  L  G    FRV+  N AG  S+ +    PVT 
Sbjct: 22606 KPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTC 22665

Query: 832   REIAEPPKIRLPRHLRQTYIR-KVGEQLNLVVPFQGKPRPQVVWTKGGAPLD-TSRVHVR 889
             R+   PPK  L   L    +  + G  L L     GKP P+++WTKG   LD   +V ++
Sbjct: 22666 RDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQ 22725

Query: 890   TSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNA 949
              +       ++   RSDSG+Y L+V+  +     ++ ++V++  GP   + V  V     
Sbjct: 22726 YTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKC 22785

Query: 950   LVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTE 1009
              + W  P++DG +EI  Y V++ +   + W  V       S  V+ LI  NEY FRV   
Sbjct: 22786 TLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAV 22845

Query: 1010  NICG----LSDSPGVSKNTARI 1027
             N  G    +   P V++N+  I
Sbjct: 22846 NKYGPGVPVESEPIVARNSFTI 22867



 Score =  197 bits (501), Expect = 5e-50
 Identities = 164/594 (27%), Positives = 258/594 (43%), Gaps = 46/594 (7%)

Query: 442   LQDIADLTVKASEQAVFKCEVSDEKVTGK------WYKNGVEVRPSKRITISHVGRFHKL 495
             L+ + DL   A E + F+ ++    + GK      W K    +    R+++        L
Sbjct: 13612 LKGLPDLCYLAKENSNFRLKIP---IKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTL 13668

Query: 496   VIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIV 555
             ++ D +  D G YT      A     K   + IKV  V K   P   +     T+E    
Sbjct: 13669 IVYDCQKSDAGKYTITLKNVA---GTKEGTISIKV--VGKPGIPTGPIKFDEVTAEA--- 13720

Query: 556   VVAGNKLRLDVSITGEPPPVATWLKGDEVFT-TTEGRTRIEKR-VDCSSFVIESA---QR 610
                       +++   PP       G E+     E R  +  + V C+S V ++     R
Sbjct: 13721 ----------MTLKWAPPKDDG---GSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTR 13767

Query: 611   EDEG-RYTIKVTNP----VGEDVAS---IFLQVVDVPDPPEAVRITSVGEDWAILVWEPP 662
               EG  YT +V+      VGE + S   +     DVPD P    I  V  D   L W  P
Sbjct: 13768 LHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDP 13827

Query: 663   MYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVS 722
                GG P+TGY +E K++ S  W + N        ++ T + EG+ YE RV A+N  GV 
Sbjct: 13828 KKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVG 13887

Query: 723   QPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEE 782
             +PS+ ++P + + P   P    V ++T  + TL W  P   G   + GY+VE     S+ 
Sbjct: 13888 KPSLPSEPVVALDPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKS 13947

Query: 783   WVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGR-SEPATLAQPVTIREIAEPPKIR 841
             W+ AN   V  C FTV +L  G +  FR+   N AG  S P+   + +  ++  E P I 
Sbjct: 13948 WMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIV 14007

Query: 842   LPRHLRQTYIRKVGEQLNL-VVPFQGKPRPQVVWTKGGAPLDTSRV-HVRTSDFDTVFFV 899
             L   ++     K G+ + L  +   GKP P+  W+K G  +  S +  + ++   ++  +
Sbjct: 14008 LDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTI 14067

Query: 900   RQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDD 959
             + A R D+GEY ++           +++ V++  GPP  V +  V    A + W  P +D
Sbjct: 14068 KYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLED 14127

Query: 960   GNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICG 1013
             G S I  Y ++K +   + W  V E  +      + LI GNEY FRV   N  G
Sbjct: 14128 GGSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYG 14181



 Score =  192 bits (489), Expect = 1e-48
 Identities = 116/380 (30%), Positives = 190/380 (50%), Gaps = 8/380 (2%)

Query: 639  PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTY 698
            P PP A+ +  V +    L WEPP  DGG+P+  Y++E+K++   RW+K       +  +
Sbjct: 7812 PGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNF 7871

Query: 699  ESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTL 755
              T +IEG   + +V A N  GV  PS  T+      P +P S PL L V D       +
Sbjct: 7872 RVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAI 7931

Query: 756  KWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTV-KNLPTGARILFRVVGV 814
             W+PP + G   I GY VE C  G+E+W+  N+ P++   F V + +      + RV  V
Sbjct: 7932 AWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAV 7991

Query: 815  NIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVW 874
            N  G SEP+ +++ V  ++    P I L  H     I   GE+L++ VPF+  P P V W
Sbjct: 7992 NAIGVSEPSEISENVVAKDPDCKPTIDLETH---DIIVIEGEKLSIPVPFRAVPVPTVSW 8048

Query: 875  TKGGAPLDTS-RVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKA 933
             K G  +  S R+ ++         V ++ R+D+G Y ++++ +    TA+I ++V+   
Sbjct: 8049 HKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLP 8108

Query: 934  GPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTV 993
            GP  ++   ++  ++  + W+ P+ DG + I+ Y +++ +     +  V       S TV
Sbjct: 8109 GPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTV 8168

Query: 994  SDLIVGNEYYFRVYTENICG 1013
             DLI   EY+FRV   N  G
Sbjct: 8169 KDLIPNGEYFFRVKAVNKVG 8188



 Score =  191 bits (485), Expect = 3e-48
 Identities = 127/440 (28%), Positives = 205/440 (46%), Gaps = 10/440 (2%)

Query: 586   TTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGE----DVASIFLQV-VDVPD 640
             T+T   T +   V  +   +      +E ++ IK  N  G     D A + +++    P 
Sbjct: 20240 TSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPG 20299

Query: 641   PPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYES 700
             PP    +T+V  +   + W  P+ +GG  V GY +E K + S  W K N  V   T ++ 
Sbjct: 20300 PPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKV 20359

Query: 701   TKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPP 760
             T +  G++YE RV+A NA GV +PS  ++P + I     P ++ + D++  + +L W+ P
Sbjct: 20360 TTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQP 20419

Query: 761   NRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGR- 819
                G   I GY+VE        W  A+   V    F +  L   ++  FRV   N  G  
Sbjct: 20420 AFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSI 20479

Query: 820   SEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGA 879
             S P+ +  P+T  +    P I LP    +    + G  + L     GKP P + W K   
Sbjct: 20480 SNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDK 20539

Query: 880   PLDTSRVHV--RTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPI 937
              L T+ +     T+D  ++  ++ A R +SG YEL ++      +ATIR+++++K GPP 
Sbjct: 20540 ELQTNALVCVENTTDLASI-LIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPG 20598

Query: 938   N-VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDL 996
               +  K V      + W+ P DDG ++I  Y V+K +   + W  V E       T + +
Sbjct: 20599 GPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECIITTTKI 20658

Query: 997   IVGNEYYFRVYTENICGLSD 1016
             I GNEY FRV   N  G+ +
Sbjct: 20659 IKGNEYIFRVRAVNKYGIGE 20678



 Score =  189 bits (480), Expect = 1e-47
 Identities = 117/378 (30%), Positives = 174/378 (46%), Gaps = 7/378 (1%)

Query: 639  PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTY 698
            PD P+   +  V  +  ++ W  P  D G P+ GY +E+++  S  W ++N  +      
Sbjct: 8531 PDAPDKPIVEDVTSNSMLVKWNEPK-DNGSPILGYWLEKREVNSTHWSRVNKSLLNALKA 8589

Query: 699  ESTKMIEGILYEMRVFAVNAIG---VSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTL 755
                ++EG+ Y  RV A NA G    S PS       PI+P   P+  +  D + TT  L
Sbjct: 8590 NVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIPRVT-DTSSTTIEL 8648

Query: 756  KWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVN 815
            +W PP   G G I GY V+  L G+ EW     + ++   +TVK +  GA    RV  VN
Sbjct: 8649 EWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVN 8708

Query: 816  IAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWT 875
             AG   P    QPVT+ E  EPP + L   ++       G+ L +     G+P P  VWT
Sbjct: 8709 AAGEGPPGE-TQPVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWT 8767

Query: 876  KGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGP 935
            K    LD  RV +      +   ++ A R D G Y ++         A  R+ V +  GP
Sbjct: 8768 KEEGELDKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGP 8827

Query: 936  PINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSD 995
             +++          L+ W  P+DDG SEI G+ +++ D K   W    E  R + C ++ 
Sbjct: 8828 VLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETER-SKCDITG 8886

Query: 996  LIVGNEYYFRVYTENICG 1013
            L+ G EY FRV  +N  G
Sbjct: 8887 LLEGQEYKFRVIAKNKFG 8904



 Score =  171 bits (432), Expect = 5e-42
 Identities = 168/618 (27%), Positives = 263/618 (42%), Gaps = 61/618 (9%)

Query: 429  EAELIVEEKQLEVLQDI---ADLTVKASEQAVFKCEVS---DEKVTGKWYKNGVEVRPSK 482
            E + +  ++  E+  D+   A LTVKA  +      V+   + K+T  W K  + ++  K
Sbjct: 7306 EIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKIT--WTKADMILKQDK 7363

Query: 483  RITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIH 542
            RITI +V +   + I D +  D G Y       A+++  +   + ++V  + K  PP   
Sbjct: 7364 RITIENVPKKSTVTIVDSKRSDTGTYII----EAVNVCGRATAV-VEVNVLDKPGPPAA- 7417

Query: 543  LDCSGKTSENAIVV------VAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEK 596
             D +  T+E+ ++         G+K+  +  +         W K     T  +   +  K
Sbjct: 7418 FDITDVTNESCLLTWNPPRDDGGSKI-TNYVVERRATDSEVWHKLSS--TVKDTNFKATK 7474

Query: 597  RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAI 656
             +    ++   A     G     V  PV     +   Q  D P PP  +  + + +D   
Sbjct: 7475 LIPNKEYIFRVAAENMYG-----VGEPVQASPITAKYQ-FDPPGPPTRLEPSDITKDAVT 7528

Query: 657  LVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAV 716
            L W  P  DGG P+TGY VER    + +W++ N     +TTY    +     Y  RV A 
Sbjct: 7529 LTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAE 7588

Query: 717  NAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLV 773
            N  G  +PS +T+P +   PI P   P    V+DV  T+  L W  P   G   I+ Y++
Sbjct: 7589 NLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVI 7648

Query: 774  EYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIRE 833
            E    G++EWV    E V      +  L  G    FRV  VN AG SEP+  + PV  RE
Sbjct: 7649 EMLKTGTDEWVRV-AEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCRE 7707

Query: 834  IAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQ--GKP------RPQVVWTKGGAPLDT-- 883
               PP    PR L    I K    L   VP +  G P        + V  KG   +DT  
Sbjct: 7708 KLYPPS--PPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTV 7765

Query: 884  --SRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIEN---MKDTATIRIRVVEKAGPPIN 938
              ++  V      +++  R AA +  G+ + + +IE+    KDT T         GPP  
Sbjct: 7766 KDTKCTVTPLTEGSLYVFRVAAENAIGQSDYT-EIEDSVLAKDTFT-------TPGPPYA 7817

Query: 939  VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCT--VSDL 996
            + V +V   +  ++W+ PK+DG   I  Y ++K ++    W     +     C   V+D+
Sbjct: 7818 LAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKA-GKTAGPDCNFRVTDV 7876

Query: 997  IVGNEYYFRVYTENICGL 1014
            I G E  F+V  EN  G+
Sbjct: 7877 IEGTEVQFQVRAENEAGV 7894



 Score =  169 bits (427), Expect = 2e-41
 Identities = 134/515 (26%), Positives = 221/515 (42%), Gaps = 40/515 (7%)

Query: 441   VLQDIADLTVKASEQAVFKCEVSDEKVTG-KWYKNGVEVRPSKRITISHVGRFHKLVIDD 499
             + +++ D+T K  E A   C++    +   KWY+ G E+  S++  +S  GR H L +  
Sbjct: 24163 IRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMT 24222

Query: 500   VRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAG 559
                EDEG YT +       +      L         Q  P+ H    G   +       G
Sbjct: 24223 EEQEDEGVYTCIATNEVGEVETSSKLL--------LQATPQFH---PGYPLKEKYYGAVG 24271

Query: 560   NKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDE-GRYTI 618
             + LRL V   G P P  TW  G ++   +E  T IE     +  V+++ QR+   G+Y +
Sbjct: 24272 STLRLHVMYIGRPVPAMTWFHGQKLLQNSENIT-IENTEHYTHLVMKNVQRKTHAGKYKV 24330

Query: 619   KVTNPVGEDVASIFLQVVDVPDPPEA-VRITSVGEDWAILVWEPPMYDGGKPVTGYLVER 677
             +++N  G   A + +++ D PD P   + I ++ ++ A++ W+PP  DGG  +T Y+VE+
Sbjct: 24331 QLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEK 24390

Query: 678   -KKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQP----------SM 726
              + K    W  ++  + + TT     + E   Y  RV A N  G+S P          S 
Sbjct: 24391 CEAKEGAEWQLVSSAI-SVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSP 24449

Query: 727   NTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPA 786
               KP  P  PT       +  VT  +  + W+PP   G   I  Y +E   +   +W+  
Sbjct: 24450 FEKPGAPGKPT-------ITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISV 24502

Query: 787   NTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHL 846
              TE +    F+VKNL  G    FRV   N+ G SE + +++P+T +             L
Sbjct: 24503 TTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEEL 24562

Query: 847   RQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVF---FVRQAA 903
             R   +R       LV    G P+P V W + G  +    +  R  +F   +    +    
Sbjct: 24563 RNLNVR-YQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVT 24621

Query: 904   RSDSGEYELSV--QIENMKDTATIRIRVVEKAGPP 936
               D+  Y++    Q  ++  TA++ + V  K   P
Sbjct: 24622 DDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLP 24656



 Score =  156 bits (395), Expect = 9e-38
 Identities = 95/314 (30%), Positives = 153/314 (48%), Gaps = 13/314 (4%)

Query: 530   VEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTE 589
             V  + +  PP+I L  + K+    + V AG  + LD ++ G+P P  +W K   +    E
Sbjct: 12912 VTILAENVPPRIDLSVAMKS---LLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAE 12968

Query: 590   GRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITS 649
             G     +R  C +  + S  R+D G YTI   N  G   A+I L+V+D P PP +V+I  
Sbjct: 12969 GIKMAMQRNLC-TLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINK 13027

Query: 650   VGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILY 709
             +  D A+L WEPP+ DGG  +T Y+V++++     W +++  V   T+    K+IEG  Y
Sbjct: 13028 MYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVSATV-PITSCSVEKLIEGHEY 13086

Query: 710   EMRVFAVNAIGV-----SQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIG 764
             + R+ A N  GV     ++P++   P+ P      P   ++ ++T    T+ W+PP   G
Sbjct: 13087 QFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDPP---VISNITKDHMTVSWKPPADDG 13143

Query: 765   AGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPAT 824
                I GYL+E     +  W   N +P+         L  G    FRV  +N AG  +P+ 
Sbjct: 13144 GSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSD 13203

Query: 825   LAQPVTIREIAEPP 838
              ++    R+   PP
Sbjct: 13204 ASKAAYARDPQYPP 13217



 Score =  154 bits (388), Expect = 6e-37
 Identities = 221/934 (23%), Positives = 348/934 (37%), Gaps = 146/934 (15%)

Query: 271  GNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAV 330
            G  +  + E++   + ++W +N   +    K+   + GK   L I      D   Y    
Sbjct: 6554 GADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIA 6613

Query: 331  KDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSE-EGAQVMWMKDGVELTRE- 388
            KD++   +L +   P  I T  +D  V VG  + M V       A+  W K+   L+ + 
Sbjct: 6614 KDKEARAKLELAAAPK-IKTADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKT 6672

Query: 389  -DSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIAD 447
             D+   +  F+           +  + D+GRY+++      +AE  +  K ++V   + +
Sbjct: 6673 IDTTAEQTSFR---------ILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRN 6723

Query: 448  LTVKASEQAVFKCEVS---DEKVT---GKWYKNGVEVRPSKRITISHVGRFHKLVIDDVR 501
            L V  +    F  EVS   +E +T    K     VE R  KR T         ++  D  
Sbjct: 6724 LEVTET----FDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTW--------VLATDRA 6771

Query: 502  PEDEGDYTFVPDG---YALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVA 558
               E   T +  G   Y   +SA+      +          +   D  G      I  V 
Sbjct: 6772 ESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVN 6831

Query: 559  GNKLRLDVSITGEPPP------VATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQRED 612
                R  VS+T EPP       +  ++      T+    T +  R +  S  +       
Sbjct: 6832 ----RFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQ 6887

Query: 613  EGRYTIKVTNPVG---EDVASIFLQVVDV---PDPPEAVRITSVGEDWAILVWEPPMYDG 666
            E  + ++  N +G      A+ F++V D    P PP  +  +   +    L WEPP+ DG
Sbjct: 6888 EYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDG 6947

Query: 667  GKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSM 726
            G P+ GY++ER ++G   W++ N ++  E TY+ T + +G  Y  RV A N  GVS PS 
Sbjct: 6948 GSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSE 7007

Query: 727  NTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPA 786
               P        EP      D++     L+   PN I                    VP+
Sbjct: 7008 ILGPLTADDAFVEP----TMDLSAFKDGLEVIVPNPITI-----------------LVPS 7046

Query: 787  N--TEPVERCGFTVKNLPTGARILFRVVG------VNIAGRSEPA-----------TLAQ 827
                 P     F  K L TG R+  + +       ++ + RS+             T++ 
Sbjct: 7047 TGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISG 7106

Query: 828  PVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLD----- 882
             + +  IA P     P+ L+   I K    L    P             GG+PL      
Sbjct: 7107 EIDVNVIARPSA---PKELKFGDITKDSVHLTWEPPDDD----------GGSPLTGYVVE 7153

Query: 883  ----TSRVHVRTSDFDT-------------VFFVRQAARSDSGEYELSVQIE--NMKDTA 923
                + +   +  DF T              +  +  AR+  G  E +   E  NM   A
Sbjct: 7154 KREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPA 7213

Query: 924  TIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVY 983
            T+         PP NV  ++    +  + W  PK+DG S I GY V++  + + +W    
Sbjct: 7214 TV-------PDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACG 7266

Query: 984  ERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHD 1043
            E    T   V+ L  G  Y +RV   N  G S     S+ T  I        P      +
Sbjct: 7267 EPVAETKMEVTGLEEGKWYAYRVKALNRQGASKP---SRPTEEIQAVDTQEAP------E 7317

Query: 1044 FRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVL 1103
              +  K L  L    V AG    L   V G P+PK+ W K  M +++D +  I N     
Sbjct: 7318 IFLDVKLLAGL---TVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKS 7374

Query: 1104 TLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
            T+ I      D GTY   AVN  G A A  ++ V
Sbjct: 7375 TVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 7408



 Score =  152 bits (385), Expect = 1e-36
 Identities = 103/305 (33%), Positives = 150/305 (49%), Gaps = 8/305 (2%)

Query: 537   EPPKIHLDCSGKTSENAIVVVAGNKLRLD-VSITGEPPPVATWLKGDEVFTTTEGRTRIE 595
             E P I LD    T ++ + + AG+ + L+ +SI G+P P ++W K  +    ++  T+I 
Sbjct: 14002 EAPTIVLD---PTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSD-ITQIT 14057

Query: 596   KRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWA 655
                  S   I+ A R+D G YTI  TNP G  V  + + V+DVP PP  V I++V  + A
Sbjct: 14058 STPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPPGPVEISNVSAEKA 14117

Query: 656   ILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFA 715
              L W PP+ DGG P+  Y++E+++     W  ++ E      + +TK+I+G  Y  RV A
Sbjct: 14118 TLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVS-EDIQSCRHVATKLIQGNEYIFRVSA 14176

Query: 716   VNAIGVSQP--SMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLV 773
             VN  G  +P  S   K      P   P    V +VT  T T+ W+ P   G   I GY V
Sbjct: 14177 VNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHV 14236

Query: 774   EYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIRE 833
             E   + S  WV A   PV      V  L  G+   FRV   N AG   P+  +  V +++
Sbjct: 14237 ERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKD 14296

Query: 834   IAEPP 838
              A PP
Sbjct: 14297 AAYPP 14301



 Score =  150 bits (378), Expect = 9e-36
 Identities = 188/818 (22%), Positives = 320/818 (39%), Gaps = 114/818 (13%)

Query: 277   MVEISDPDLTLKWFK----NGQEI-------KPSSKYVFENVGKKRI----LTINKCTLA 321
             ++ IS   +TL+W K     G+EI       + S    ++   K+RI     TI     A
Sbjct: 24067 ILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEA 24126

Query: 322   DDAAYEVAVKDEKCF-----------TELFVKEPPVLIVTPLEDQQVFVGDRVEMAVE-V 369
              +  + V  ++E              T+L   E P  I   ++D    +G+  +++ + V
Sbjct: 24127 TEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPG-IRKEMKDVTTKLGEAAQLSCQIV 24185

Query: 370   SEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCE 429
                   + W + G EL +      +Y+   DG+ H L      QED G Y  I      E
Sbjct: 24186 GRPLPDIKWYRFGKELIQS----RKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGE 24241

Query: 430   AE-----LIVEEKQLEVLQDIADLTVKA--SEQAVFKCEVSDEKVTGKWYKNGVEVRPSK 482
              E     L+    Q      + +    A  S   +    +        W+     ++ S+
Sbjct: 24242 VETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSE 24301

Query: 483   RITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIH 542
              ITI +   +  LV+ +V+ +           Y + LS     ++  ++   + +P K  
Sbjct: 24302 NITIENTEHYTHLVMKNVQRKTHAGK------YKVQLSNVFGTVDAILDVEIQDKPDK-- 24353

Query: 543   LDCSGKTSENAIVVVAGNKLRLDVSITGEPPPV--ATWLKGDEVFTTTEGRTRIEKRVDC 600
                        IV+ A   L+    I+ +PP     +W+  + V    E +   E ++  
Sbjct: 24354 -------PTGPIVIEA--LLKNSAVISWKPPADDGGSWIT-NYVVEKCEAKEGAEWQLVS 24403

Query: 601   SSFVIESAQ----REDEGRY-------TIKVTNPVGEDVASIFLQVVDVPDPPEAVRITS 649
             S+  + + +     E+ G Y       T  +++P+      I     + P  P    IT+
Sbjct: 24404 SAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITA 24463

Query: 650   VGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILY 709
             V +D  ++ W+PP  DGG  +  Y +E+++K   +W+ +  E   ET +    +IEG+ Y
Sbjct: 24464 VTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEY 24523

Query: 710   EMRVFAVNAIGVSQPSMNTKPFMPIAPT--------SEPLHLIVEDVTDTTTTLK----- 756
             E RV   N  G S+ S  ++P  P +           E  +L V   ++ T   K     
Sbjct: 24524 EFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHP 24583

Query: 757   ------WRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFR 810
                   +R    I A G+  Y ++    G  + + A+    +   + V+    G  +   
Sbjct: 24584 KPIVKWYRQGKEIIADGLK-YRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSV--- 24639

Query: 811   VVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKV--GEQLNLVVPFQGKP 868
                      S  A+L       E+  P KI LP+ L          GE +++ +PF GKP
Sbjct: 24640 ---------SGTASL-------EVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKP 24683

Query: 869   RPQVVWTKGGAPLDTSRVH--VRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIR 926
              P + W KG   +D +  +  + T  F ++ F     R D+G Y +  +     D  T+ 
Sbjct: 24684 DPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVE 24743

Query: 927   IRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN 986
             + V +   PP  V V +V   +  + W  P  DG S+I  Y V+K       W  V +  
Sbjct: 24744 LDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQA- 24802

Query: 987   RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNT 1024
             R T  TV +L     Y FRV  EN  GLS     S+ T
Sbjct: 24803 RETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPT 24840



 Score =  149 bits (375), Expect = 2e-35
 Identities = 110/360 (30%), Positives = 159/360 (44%), Gaps = 37/360 (10%)

Query: 268  VDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYE 327
            V  G       E+S  D+ ++W+  G++++PS K V  + GK   LT+    L D    +
Sbjct: 5835 VTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQ 5894

Query: 328  VAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTR 387
            +  KD K    LFVKEPPV    PLEDQ V  G    +  EVS E A+V W K+G E+ +
Sbjct: 5895 LTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILK 5954

Query: 388  EDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIAD 447
                  +Y    DG+   L+  D   ED   Y       +    L V    +E L+ + D
Sbjct: 5955 ----SKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTD 6010

Query: 448  LTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGD 507
            L V+  E A F+CE+S E    KW+K+G E++  K+  I   G    LVI+    +DE +
Sbjct: 6011 LQVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAE 6070

Query: 508  YTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVS 567
            Y+   +      S  L  LE +  +             + + SE   +     KL  +VS
Sbjct: 6071 YSC--EVRTARTSGMLTVLEEEAVFTKNL--------ANIEVSETDTI-----KLVCEVS 6115

Query: 568  ITGEPPPVATWLKGDEVF-------TTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKV 620
               +P     W KGDE           TEGR RI         VI++A  ED G Y  ++
Sbjct: 6116 ---KPGAEVIWYKGDEEIIETGRYEILTEGRKRI--------LVIQNAHLEDAGNYNCRL 6164



 Score =  149 bits (375), Expect = 2e-35
 Identities = 101/318 (31%), Positives = 146/318 (45%), Gaps = 14/318 (4%)

Query: 528   IKVEYVPKQEP---PKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKG-DE 583
             +K E V  +E    P + L  SG      + V AG+ +RL+  + G+P P   W K  D 
Sbjct: 11815 VKTEEVVVKEDLQKPVLDLKLSG-----VLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDA 11869

Query: 584   VFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPE 643
                T   R +I+ R D S F +  A+R D G+Y +  TN  G  VA   + V+D P P  
Sbjct: 11870 TDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVR 11929

Query: 644   AVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKM 703
              ++I  V  D   + W+PP  DGG  +  Y++E+ +     W   +  V T  T   T++
Sbjct: 11930 NLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGT-TVTRL 11988

Query: 704   IEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTT---TTLKWRPP 760
             IEG  Y  RV A N IG   P+  +KP +      +P      +VT  +    T+ W PP
Sbjct: 11989 IEGNEYIFRVRAENKIGTGPPT-ESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPP 12047

Query: 761   NRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRS 820
                G   I GY +E   + S  WVP N   +      V+NL       FRV   N  G  
Sbjct: 12048 EYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIG 12107

Query: 821   EPATLAQPVTIREIAEPP 838
             EP+  ++PV  ++  EPP
Sbjct: 12108 EPSLPSRPVVAKDPIEPP 12125



 Score =  145 bits (366), Expect = 2e-34
 Identities = 135/522 (25%), Positives = 214/522 (40%), Gaps = 46/522 (8%)

Query: 636  VDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTE 695
            +D P PP    +  VG+    L W  P +DGG  +  Y++E  K G+  W+++   V T 
Sbjct: 7609 IDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPT- 7667

Query: 696  TTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTT 752
            T +    ++EG  Y  RV AVN  G S+PS  + P +    + P S P  L V ++T  T
Sbjct: 7668 TQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNT 7727

Query: 753  TTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVV 812
              LKW  P + G   I  Y+VE      + W   +T  V+    TV  L  G+  +FRV 
Sbjct: 7728 ADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTT-VKDTKCTVTPLTEGSLYVFRVA 7786

Query: 813  GVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQ--GKPRP 870
              N  G+S+   +   V  ++    P    P  L    + K    L    P    G+P  
Sbjct: 7787 AENAIGQSDYTEIEDSVLAKDTFTTPGP--PYALAVVDVTKRHVDLKWEPPKNDGGRPIQ 7844

Query: 871  QVV----------WTKGG---APLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIE 917
            + V          W K G    P    RV       +  F VR    +  G      +I 
Sbjct: 7845 RYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEIL 7904

Query: 918  NMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTM 977
            +++D  +          PP+++ V +    +  + W+ P+ +G S I+GY V+     T 
Sbjct: 7905 SIEDPTS-------PPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTE 7957

Query: 978  EWFNVYERN-RHTSCTVSDLIVGN-EYYFRVYTENICGLSDSPGVSKNTARILKTGITFK 1035
            +W  V  R  +     V + +V + EY  RV   N  G+S+   +S+N   + K      
Sbjct: 7958 KWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENV--VAKDPDCKP 8015

Query: 1036 PFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFL 1095
              + + HD              +V+ G   ++    R  P P V W K+  E++   +  
Sbjct: 8016 TIDLETHDI-------------IVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLT 8062

Query: 1096 ITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
            + N      L + +    DAG YT    N+LG A A   ++V
Sbjct: 8063 MKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKV 8104



 Score =  137 bits (345), Expect = 6e-32
 Identities = 141/569 (24%), Positives = 234/569 (41%), Gaps = 50/569 (8%)

Query: 68   DAVVVAKVNGKELPDKPTIKWFKGKWL----ELGSKSG--ARFSFKESHNSASNVY---T 118
            + V  A+V GK+   +  +   + K++    +   K G  A F  + SH     V+    
Sbjct: 5179 EGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKND 5238

Query: 119  VELHIGKVVL--GDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLESFKRTSEKKS 176
             +LH  + VL   +   ++LE+K     D       V+     A  + LE+    + K  
Sbjct: 5239 AKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLH 5298

Query: 177  D-TAGELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGI 235
            D TA E D   L  K EV ++   K  KD +++   P+      G ++    K A     
Sbjct: 5299 DKTAVEKDEITL--KCEVSKDVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKA----- 5351

Query: 236  TDLRGMLKRL-----KKAKVEVKKSAAFTKKLDPAYQVDR--GNKIKLMVEISDPDLTLK 288
             DL+   + +      K K  V   A   K   P Y V+   G      +E+S+PD+  +
Sbjct: 5352 -DLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEPDVHGQ 5410

Query: 289  WFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLI 348
            W   GQ +  S        GKK IL ++ C L           + K    L VKE P++ 
Sbjct: 5411 WKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLIF 5470

Query: 349  VTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIF 408
            +TPL D +VF  D  +   EVS E     W+K   E+T +D    R+   KDG +H ++ 
Sbjct: 5471 ITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDD----RFELIKDGTKHSMVI 5526

Query: 409  SDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVT 468
                 ED  +Y           +LI+E  +L+ L  + D+T K  E AVF  E+S + + 
Sbjct: 5527 KSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIR 5586

Query: 469  GKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEI 528
             KW+KN   +  ++ +++   G+ H +   D+  +D        +   +S  AKL  LE 
Sbjct: 5587 VKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRV--EAMGMSSEAKLTVLEG 5644

Query: 529  KVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTT 588
               +  K +      D +G   +  I         L   I+    PV  +  G E+  + 
Sbjct: 5645 DPYFTGKLQ------DYTGVEKDEVI---------LQCEISKADAPVKWFKDGKEIKPSK 5689

Query: 589  EGRTRIEKRVDCSSFVIESAQREDEGRYT 617
                + + +      +++ A + D G+YT
Sbjct: 5690 NAVIKADGKK--RMLILKKALKSDIGQYT 5716



 Score =  136 bits (342), Expect = 1e-31
 Identities = 97/354 (27%), Positives = 155/354 (43%), Gaps = 30/354 (8%)

Query: 551   ENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQR 610
             ++ IVV AG    L+  I G+P P   W K  +    T  R  I+  +  ++ V++   R
Sbjct: 18342 KDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIR 18401

Query: 611   EDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEA-VRITSVGEDWAILVWEPPMYDGGKP 669
              D G+Y +K++N  G     I ++V+D P PPE  +++T V  +   L W PP+ DGG  
Sbjct: 18402 TDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGAN 18461

Query: 670   VTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMN-- 727
             ++ Y++E+++     W +++ EV     Y+ TK++ G  Y  RV AVN  G+ +P  +  
Sbjct: 18462 ISHYIIEKRETSRLSWTQVSTEV-QALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESGP 18520

Query: 728   ---TKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWV 784
                  P+ P  P S P    V  +T  +  + W  P   G   I+GY++E   +    W 
Sbjct: 18521 VTACNPYKPPGPPSTPE---VSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWT 18577

Query: 785   PANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPR 844
               N + +      V  L  G    FRV   N AG  EP+  +      +   PP      
Sbjct: 18578 KCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPP------ 18631

Query: 845   HLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTK----GGAPLDTSRVHVRTSDFD 894
                       G   N  V    +    + W+K    GGAP+    V V+ +  D
Sbjct: 18632 ----------GPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAAD 18675



 Score =  134 bits (338), Expect = 4e-31
 Identities = 118/428 (27%), Positives = 186/428 (43%), Gaps = 39/428 (9%)

Query: 430   AELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKW----YKNGVEV-RPSKRI 484
             +E +V  + + V +   DL VK         EV+   VT  W    Y  G E+       
Sbjct: 10333 SEALVIREPITVPERPEDLEVK---------EVTKNTVTLTWNPPKYDGGSEIINYVLES 10383

Query: 485   TISHVGRFHKLVIDD-------VRPEDEGD-YTFVPDGYALSLSAKLNFLEIKVEYVPKQ 536
              +    +FHK+  D+       V+   EGD Y +      +    K +F    +    + 
Sbjct: 10384 RLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDEL 10443

Query: 537   EPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEK 596
              PP +HLD   K     + +  G    L    +G+P P  +W K DE     + RT I+ 
Sbjct: 10444 APPTLHLDFRDK-----LTIRVGEAFALTGRYSGKPKPKVSWFK-DEADVLEDDRTHIKT 10497

Query: 597   RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEA-VRITSVGEDWA 655
                  +     A+R D G+Y + V N  G       + VVD P PP   V    V +D+ 
Sbjct: 10498 TPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYM 10557

Query: 656   ILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFA 715
             ++ W+PP+ DGG  +T Y++E+K+ G   WM +      +TT + +K++EG  Y  R+ A
Sbjct: 10558 VISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVT-SASAKTTCKVSKLLEGKDYIFRIHA 10616

Query: 716   VNAIGVSQP----SMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGY 771
              N  G+S P    SM  K    +     P   IV +VT  +  + W  P+  G   I  Y
Sbjct: 10617 ENLYGISDPLVSDSMKAKDRFRV--PDAPDQPIVTEVTKDSALVTWNKPHD-GGKPITNY 10673

Query: 772   LVEYCLEGSEEWVPANTEPVE-RCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVT 830
             ++E     S+ W     +P+     F V +L  G +  FRV   N  G  +P+  ++PV 
Sbjct: 10674 ILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVF 10733

Query: 831   IRE-IAEP 837
              ++ IA+P
Sbjct: 10734 AKDPIAKP 10741



 Score =  130 bits (326), Expect = 9e-30
 Identities = 119/457 (26%), Positives = 183/457 (40%), Gaps = 38/457 (8%)

Query: 470   KWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIK 529
             KW K G ++  SKR  I+      +LVI +    D G Y  V +        K  +++++
Sbjct: 23797 KWTKEGQDI--SKRAMIATSETHTELVIKEADRGDSGTYDLVLEN---KCGKKAVYIKVR 23851

Query: 530   VEYVPKQEPPKIHLDC----SGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVF 585
             V   P      +  D     S + S        G  + L   +     P A W       
Sbjct: 23852 VIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADI-LGYILERREVPKAAWYT----- 23905

Query: 586   TTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTN------PVGEDVASIFLQVVDVP 639
                     I+ RV  +S V++  +   E  + +   N      P+  +        ++ P
Sbjct: 23906 --------IDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPP 23957

Query: 640   DPPE-AVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTY 698
             +PP     +  V +    L W  P  DGG  VTGY +ERK+  + +W++ N    T T Y
Sbjct: 23958 EPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMY 24017

Query: 699   ESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTL 755
               T ++    Y+ R+ A N +G+S+ S  ++P +   P    S+P  L +  ++  + TL
Sbjct: 24018 TVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTL 24077

Query: 756   KWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVN 815
             +W  P   G   I GY VEY   G   W  +N E ++   FT+  L       FRV   N
Sbjct: 24078 QWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAEN 24137

Query: 816   IAGRSEPATLAQPV-TIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVW 874
               G S P   A  + T     E P IR      +    K+GE   L     G+P P + W
Sbjct: 24138 ETGLSRPRRTAMSIKTKLTSGEAPGIRKE---MKDVTTKLGEAAQLSCQIVGRPLPDIKW 24194

Query: 875   TKGGAPLDTSRVHVRTSDFDT-VFFVRQAARSDSGEY 910
              + G  L  SR +  +SD  T    V    + D G Y
Sbjct: 24195 YRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVY 24231



 Score =  126 bits (316), Expect = 1e-28
 Identities = 97/360 (26%), Positives = 157/360 (43%), Gaps = 24/360 (6%)

Query: 258  FTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINK 317
            FT KL     V++ +++ L  EIS  D  +KWFK+G+EIKPS   V +  GKKR+L + K
Sbjct: 5648 FTGKLQDYTGVEK-DEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKK 5706

Query: 318  CTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVM 377
               +D   Y      +K   +L +++  + +V PL   +V   +      E+SE+     
Sbjct: 5707 ALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLHSVEVMETETARFETEISEDDIHAN 5766

Query: 378  WMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEK 437
            W   G  L +    +     K++GK H L+  +   +  G         +  A L V+ +
Sbjct: 5767 WKLKGEALLQTPDCE----IKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPR 5822

Query: 438  QLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVI 497
             + +L+ + D+TV A E A F CE+S E +  +WY  G ++ PS ++     G+ H L +
Sbjct: 5823 VIGLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTL 5882

Query: 498  DDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVV 557
             DV+ ED G+       +     A L   E  VE+    E   +         E A  V 
Sbjct: 5883 RDVKLEDAGEVQLTAKDF--KTHANLFVKEPPVEFTKPLEDQTV--------EEGATAV- 5931

Query: 558  AGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYT 617
                  L+  ++ E   V  +  G E+  + +     + RV     VI     ED   YT
Sbjct: 5932 ------LECEVSRENAKVKWFKNGTEILKSKKYEIVADGRV--RKLVIHDCTPEDIKTYT 5983



 Score =  126 bits (316), Expect = 1e-28
 Identities = 95/335 (28%), Positives = 146/335 (43%), Gaps = 33/335 (9%)

Query: 526  LEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVF 585
            L + V     + PP I L  S +   + I V AG  + +   +TG P P   W K + V 
Sbjct: 9010 LPLNVVIQDDEVPPTIKLRLSVRG--DTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVI 9067

Query: 586  T--------TTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVD 637
                     T E  +R E + + S   I  A RED+G YT+  +N +G    ++ ++V D
Sbjct: 9068 EKPTDALQITKEEVSRSEAKTELS---IPKAVREDKGTYTVTASNRLGSVFRNVHVEVYD 9124

Query: 638  VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETT 697
             P PP  + +T +  +   L W+ P+ +GG  +T Y+++++    +   K  +E  T T 
Sbjct: 9125 RPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRK---KAEWEEVTNTA 9181

Query: 698  YEST----KMIEGILYEMRVFAVNAIGVSQPSMNTK-----PFMPIAPTSEPLHLIVEDV 748
             E      K+I    YE RV AVN  G+S    + K     P+    P  +P  L     
Sbjct: 9182 VEKRYGIWKLIPNGQYEFRVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLA---R 9238

Query: 749  TDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCG-----FTVKNLPT 803
            T  +  + W PP   G   I GY +E   EGS  W   +  P+ + G     F V  L  
Sbjct: 9239 TKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLE 9298

Query: 804  GARILFRVVGVNIAGRSEPATLAQPVTIREIAEPP 838
            G +  FR + +N AG   P+  + P    +   PP
Sbjct: 9299 GVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPP 9333



 Score =  124 bits (311), Expect = 5e-28
 Identities = 98/378 (25%), Positives = 161/378 (42%), Gaps = 25/378 (6%)

Query: 274  IKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDE 333
            I   V ++   ++ KW KNG EIK + K           L I      D A Y       
Sbjct: 2940 ITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKA 2999

Query: 334  KCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKA 393
                 L+V+   +     ++D +V    R     EVSE    V WMKD  EL   D    
Sbjct: 3000 TSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITD---- 3055

Query: 394  RYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKAS 453
            R + +K+   H L+       D G+Y V+  G    A+L VE + + +     ++ V   
Sbjct: 3056 RIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEK 3115

Query: 454  EQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHV--GRFHKLVIDDVRPEDEGDYTFV 511
            ++AV + EV+++ V   WYK+G+E+    +    +V   R H++ I + R  D G+YTFV
Sbjct: 3116 QRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFV 3175

Query: 512  PDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGE 571
                  S++           YV   EPP++  +         + V +G   R    I+G 
Sbjct: 3176 AGRNRSSVTL----------YVNAPEPPQVLQEL------QPVTVQSGKPARFCAVISGR 3219

Query: 572  PPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVG--EDVA 629
            P P  +W K +++ +T      +    + +  +IE A  ED   YT +  N  G     A
Sbjct: 3220 PQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIE-AFPEDAAVYTCEAKNDYGVATTSA 3278

Query: 630  SIFLQVVDVPDPPEAVRI 647
            S+ ++V +V  P + + +
Sbjct: 3279 SLSVEVPEVVSPDQEMPV 3296



 Score =  124 bits (310), Expect = 7e-28
 Identities = 96/374 (25%), Positives = 160/374 (42%), Gaps = 24/374 (6%)

Query: 267  QVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
            QV      +   E+S  +  +KWFK+G EIK   KY   + G  RIL INKC L D+A Y
Sbjct: 6012 QVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEY 6071

Query: 327  EVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELT 386
               V+  +    L V E   +    L + +V   D +++  EVS+ GA+V+W K   E+ 
Sbjct: 6072 SCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEII 6131

Query: 387  REDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIA 446
                   RY    +G++ IL+  +   ED G Y       + + ++ V E   E +    
Sbjct: 6132 E----TGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQ 6187

Query: 447  DLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG 506
            +L +   E+A F C +S E    +W ++   +    +  +   G+   LV+ D   +D G
Sbjct: 6188 NLEILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMG 6247

Query: 507  DYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDV 566
             Y  +    A   +A L  +E     VP ++          +  E   VV        +V
Sbjct: 6248 TYVVMVG--AARAAAHLTVIEKLRIVVPLKDT---------RVKEQQEVV-----FNCEV 6291

Query: 567  SITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGE 626
            +  G     A W + +E    +     ++K +   +  I  A  +D+  Y + +TN  GE
Sbjct: 6292 NTEGAK---AKWFRNEEAIFDSSKYIILQKDL-VYTLRIRDAHLDDQANYNVSLTNHRGE 6347

Query: 627  DVASIFLQVVDVPD 640
            +V S    +V+  D
Sbjct: 6348 NVKSAANLIVEEED 6361



 Score =  123 bits (309), Expect = 9e-28
 Identities = 99/374 (26%), Positives = 159/374 (42%), Gaps = 25/374 (6%)

Query: 250  VEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGK 309
            V+ K+   FT++L      ++        E S+P + +KW+K+G E+    KY   +  K
Sbjct: 2122 VQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRK 2181

Query: 310  KRILTINKCTLADDAAYE-VAVKDE--KCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMA 366
               L+I     +D   Y  V V+DE  K   +L V+   V  V  L+D +V      E+ 
Sbjct: 2182 VHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELE 2241

Query: 367  VEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGG 426
              VS E  +  W  + VEL        +Y       R  L   DV +ED+G Y  + +G 
Sbjct: 2242 CIVSPENIEGKWYHNDVELKSN----GKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGK 2297

Query: 427  QCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITI 486
            +   +L ++ + + +LQ ++D  V   +    + +VS E V G W K+G EV+PS R+ I
Sbjct: 2298 KTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHI 2357

Query: 487  SHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCS 546
                + H L+I+D+  ED G+Y+F      LS S +++   + V                
Sbjct: 2358 VIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDV---------------- 2401

Query: 547  GKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIE 606
              T    + V+ G K  L+  ++        W   DE     +    I K       VI 
Sbjct: 2402 -ITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTK-QRLVIN 2459

Query: 607  SAQREDEGRYTIKV 620
                 DEG Y + V
Sbjct: 2460 RTHASDEGPYKLIV 2473



 Score =  121 bits (303), Expect = 4e-27
 Identities = 99/330 (30%), Positives = 138/330 (41%), Gaps = 46/330 (13%)

Query: 553  AIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTR------------------- 593
            ++ V  G+++ LD SI+G P P  TW+K + V    E + R                   
Sbjct: 8316 SLEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFV 8375

Query: 594  --IEKRVDC-------SSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPP-- 642
              + +R+         S   +  + R D G Y IKV N  G   A   + V+D P PP  
Sbjct: 8376 LPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPIN 8435

Query: 643  ---EAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVER--KKKGSQRWMKLNFEVFTETT 697
               E +R TSV     +  WEPP+ DGG  +  Y +E+  K K    W+ +         
Sbjct: 8436 FVFEDIRKTSV-----LCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVT-STLRHCK 8489

Query: 698  YESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTT 754
            Y  TK+IEG  Y  RV A N  G   P + +KP +   P  P   P   IVEDVT  +  
Sbjct: 8490 YSVTKLIEGKEYLFRVRAENRFGPGPPCV-SKPLVAKDPFGPPDAPDKPIVEDVTSNSML 8548

Query: 755  LKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGV 814
            +KW  P   G+  I GY +E     S  W   N   +      V  L  G   +FRV   
Sbjct: 8549 VKWNEPKDNGS-PILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAE 8607

Query: 815  NIAGRSEPATLAQPVTIREIAEPPKIRLPR 844
            N AG  + +  + P T  +   PP   +PR
Sbjct: 8608 NAAGPGKFSPPSDPKTAHDPISPPGPPIPR 8637



 Score =  120 bits (302), Expect = 6e-27
 Identities = 88/295 (29%), Positives = 136/295 (46%), Gaps = 15/295 (5%)

Query: 558   AGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYT 617
             AG  ++L   I+G+P P   W K D+   T      +E   D +S +I+ A R + G Y 
Sbjct: 20514 AGTSVKLRAGISGKPAPTIEWYKDDKELQTN-ALVCVENTTDLASILIKDADRLNSGCYE 20572

Query: 618   IKVTNPVGEDVASIFLQVVDVPDPPEA-VRITSVGEDWAILVWEPPMYDGGKPVTGYLVE 676
             +K+ N +G   A+I +Q++D P PP   +   +V  +   L+W PP  DGG  +T Y+VE
Sbjct: 20573 LKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVE 20632

Query: 677   RKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQP-----SMNTKPF 731
             +++     W  ++ E   E    +TK+I+G  Y  RV AVN  G+ +P      +    F
Sbjct: 20633 KRETSRVVWSMVS-EHLEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAF 20691

Query: 732   MPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPV 791
             +   P   P    V  +T  + T+ W  P   G   I GY +E   + S  W     E +
Sbjct: 20692 VTPGPPGIP---EVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETI 20748

Query: 792   ERCGFTVKNLPTGARILFRVVGVNIAGR---SEPATLAQPVTIREIAEPP-KIRL 842
                   V  L   +   +RV  VN AG+   SEP+   +     +   PP KIR+
Sbjct: 20749 RDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRI 20803



 Score =  120 bits (300), Expect = 1e-26
 Identities = 87/326 (26%), Positives = 140/326 (42%), Gaps = 29/326 (8%)

Query: 523   LNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGD 582
             L+ +  K  +VP   P ++ +  +G+    A    AG+KLR    +T             
Sbjct: 23368 LSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVT------------- 23414

Query: 583   EVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPP 642
                        +E     +   I      D G YT+++ N  G    +I + ++D P PP
Sbjct: 23415 -----------VETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPP 23463

Query: 643   EA-VRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYEST 701
                ++I  +      + WEPP  DGG P++GY+VE++      W+ ++ E  T +T++ T
Sbjct: 23464 TGPIKIDEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVS-ESVTRSTFKFT 23522

Query: 702   KMIEGILYEMRVFAVNAIGVSQ--PSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRP 759
             ++ EG  Y  RV A N  G+     S   +    I     P  L + DV+    TL W P
Sbjct: 23523 RLTEGNEYVFRVAATNRFGIGSYLQSEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYP 23582

Query: 760   PNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGR 819
             P   G   + GY+VE     ++ WV  N  PV    +    L  G     RV  +N  G 
Sbjct: 23583 PEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGS 23642

Query: 820   SEPATLAQPVTIRE-IAEPPKIRLPR 844
              +P+  ++P+   + IA P K + PR
Sbjct: 23643 GKPSRPSKPIVAMDPIAPPGKPQNPR 23668



 Score =  117 bits (294), Expect = 5e-26
 Identities = 129/529 (24%), Positives = 197/529 (37%), Gaps = 82/529 (15%)

Query: 636   VDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTE 695
             V +P PP   +I   G+    + W  P++DGG P+TGY VE KK     W K + +    
Sbjct: 19709 VFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDW-KTSIQSLRG 19767

Query: 696   TTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLH---------LIVE 746
             T Y  + +  G  Y  RV +VN +G S PS ++ P +      EPL          LIV+
Sbjct: 19768 TEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVK 19827

Query: 747   DVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGAR 806
                  T T+ +R           G  V   L     W   +T+   R      +  T   
Sbjct: 19828 AGASFTMTVPFR-----------GRPVPNVL-----WSKPDTDLRTRAYVDTTDSRTSLT 19871

Query: 807   ILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQG 866
             I         A R++       +TI+ +     + L   +  T     G   N+ V    
Sbjct: 19872 I-------ENANRNDSGKYT--LTIQNVLSAASLTLVVKVLDT----PGPPTNITVQDVT 19918

Query: 867   KPRPQVVW----TKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDT 922
             K    + W      GGAP+    +  R +       V            LS ++ N+++ 
Sbjct: 19919 KESAVLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCN------RLSYKVTNLQEG 19972

Query: 923   ATIRIRV--------------------VEKAGPPINVMVKEVWGTNALVEWQAPKDDGNS 962
             A    RV                     EK  PP  + V  +   +  + W  P+ DG S
Sbjct: 19973 AIYYFRVSGENEFGVGIPAETKEGVKITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGS 20032

Query: 963   EIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSK 1022
              I+ Y V+  +K    W       + T   VS L   +EY+FRV+ EN  GLSD      
Sbjct: 20033 RIVHYVVEALEKGQKNWVKCAVA-KSTHHVVSGLRENSEYFFRVFAENQAGLSDP----- 20086

Query: 1023  NTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWM 1082
                 +L   +  +  E  E D +  P          V AG +  ++  + G P PKV   
Sbjct: 20087 --RELLLPVLIKEQLEPPEIDMKNFPSHTV-----YVRAGSNLKVDIPISGKPLPKVTLS 20139

Query: 1083  KNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALA 1131
             ++ + ++   +F        LT+N++     DAG Y   A N  G   A
Sbjct: 20140 RDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKA 20188



 Score =  117 bits (293), Expect = 6e-26
 Identities = 120/486 (24%), Positives = 203/486 (41%), Gaps = 48/486 (9%)

Query: 279  EISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTE 338
            E+S  ++   W KNG EI+ S K+     GK   L I   +  D A Y     +++    
Sbjct: 2858 EVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSAT 2917

Query: 339  LFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFK 398
            L V   P++I + L+D      D +   V V+ EG    W+K+GVE+   D  K + R K
Sbjct: 2918 LTVT--PIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTD--KCQMRTK 2973

Query: 399  KDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVF 458
            K    H L   +V   D   Y  +       A L VE + +E  + I D+ V   ++A+F
Sbjct: 2974 K--LTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMF 3031

Query: 459  KCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALS 518
            +CEVS+  +T +W K+  E++ + RI I      H+L+I   R  D G YT V  G   +
Sbjct: 3032 ECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVST 3091

Query: 519  LSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATW 578
                +   ++++  + K+E   I         + A+V    N+  +D          A W
Sbjct: 3092 AKLFVEGRDVRIRSI-KKEVQVIE-------KQRAVVEFEVNEDDVD----------AHW 3133

Query: 579  LK-GDEVFTTTEGRTR--IEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQV 635
             K G E+    + R +  +E+R+      I   ++ D G YT       G + +S+ L  
Sbjct: 3134 YKDGIEINFQVQERHKYVVERRI--HRMFISETRQSDAGEYTF----VAGRNRSSVTL-Y 3186

Query: 636  VDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVT-GYLVERKKKGSQRWMKLNFEVFT 694
            V+ P+PP+ ++             +P     GKP     ++  + +    W K   E   
Sbjct: 3187 VNAPEPPQVLQ-----------ELQPVTVQSGKPARFCAVISGRPQPKISWYK--EEQLL 3233

Query: 695  ETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTT 754
             T ++   + +G  Y + +        +  +   K    +A TS  L + V +V      
Sbjct: 3234 STGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQE 3293

Query: 755  LKWRPP 760
            +   PP
Sbjct: 3294 MPVYPP 3299



 Score =  117 bits (293), Expect = 6e-26
 Identities = 130/526 (24%), Positives = 205/526 (38%), Gaps = 68/526 (12%)

Query: 639   PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNF--EVFTET 696
             P  PEA+  T    D   L W+PP +DGG  + GY+VE +K G + W + N   E   ET
Sbjct: 10744 PVNPEAIDTTCNSVD---LTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPET 10800

Query: 697   TYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLK 756
              Y+ T + +G  Y+ RV AVNA G S P+   +P + +    EP  LI++        +K
Sbjct: 10801 KYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVL-VKDRLEPPELILDANMAREQHIK 10859

Query: 757   WRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFR------ 810
                  R+ A      +++        W   + +   +    V   P G+++  R      
Sbjct: 10860 VGDTLRLSA------IIKGVPFPKVTWKKEDRDAPTKARIDVT--PVGSKLEIRNAAHED 10911

Query: 811   --VVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPF---- 864
               +  + +   +   T++  V + +   PP     R L  + IRK    L    P     
Sbjct: 10912 GGIYSLTVENPAGSKTVSVKVLVLDKPGPP-----RDLEVSEIRKDSCYLTWKEPLDDGG 10966

Query: 865   --------QGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQI 916
                     + +      W+   A         +  +    +  R AA +  G       +
Sbjct: 10967 SVITNYVVERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPF---V 11023

Query: 917   ENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKT 976
             E  K    +    +   GPP ++   +V  T   + W  P  DG S I GY V+  ++ T
Sbjct: 11024 ETPKPIKALD--PLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGT 11081

Query: 977   MEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKP 1036
              +W   ++   +  C V+ L  G  Y FRV  ENI GL    G+   T           P
Sbjct: 11082 QDWIK-FKTVTNLECVVTGLQQGKTYRFRVKAENIVGL----GLPDTTI----------P 11126

Query: 1037  FEYKEHDFRMAPKFLTPLIDRVVV-AGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFL 1095
              E +E     + +    LI+ +VV AG +      +RG P P   W  +  EI+ D  + 
Sbjct: 11127 IECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYT 11186

Query: 1096  I--TNYQGVLTLN--IRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
             +   N+  VLT+   +RR    D G Y     N  G       L V
Sbjct: 11187 VETDNFSSVLTIKNCLRR----DTGEYQITVSNAAGSKTVAVHLTV 11228



 Score =  117 bits (293), Expect = 6e-26
 Identities = 82/297 (27%), Positives = 135/297 (45%), Gaps = 18/297 (6%)

Query: 552   NAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQRE 611
             + +++ +G  LR+   + G P P  TW K D V         I   +  +S  +  A R+
Sbjct: 21594 DGLIIKSGESLRIKALVQGRPVPRVTWFK-DGVEIEKRMNMEITDVLGSTSLFVRDATRD 21652

Query: 612   DEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEA-VRITSVGEDWAILVWEPPMYDGGKPV 670
               G YT++  N  G   A I ++V D P      +R T++  +   L W+ P+ DG  P+
Sbjct: 21653 HRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPI 21712

Query: 671   TGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKP 730
             T Y++E+++     W  +  +   + +Y + K+I G  Y+ RV AVN  GV +P +++ P
Sbjct: 21713 THYIIEKRETSRLAWALIEDKCEAQ-SYTAIKLINGNEYQFRVSAVNKFGVGRP-LDSDP 21770

Query: 731   F-------MPIAP-TSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEE 782
                     +P AP   EP      ++T  + TL W  P   G   I  Y++E   + S  
Sbjct: 21771 VVAQIQYTVPDAPGIPEP-----SNITGNSITLTWARPESDGGSEIQQYILERREKKSTR 21825

Query: 783   WVPA-NTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPP 838
             WV   +  P+    F V  L  G    F V+  N AG    + +++ +  RE   PP
Sbjct: 21826 WVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPP 21882



 Score =  117 bits (292), Expect = 8e-26
 Identities = 112/425 (26%), Positives = 166/425 (39%), Gaps = 46/425 (10%)

Query: 729   KPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANT 788
             KP +P  P         ++VT    TLKW PP   G   I  Y++E     + +WV    
Sbjct: 13703 KPGIPTGPIK------FDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTC-A 13755

Query: 789   EPVERCGFTVKNLPTGARILFRVVGVNIAG-----RSEPATLAQPVTIREIAEPPKIRLP 843
               V++  F V  L  G    FRV   N  G     +SEP     P  + +   PP I   
Sbjct: 13756 SAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIVDV 13815

Query: 844   RH----LRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFV 899
             RH    L  T  +K G         + K R  ++W +       ++  +R  DF      
Sbjct: 13816 RHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRA------NKTPIRMRDF------ 13863

Query: 900   RQAARSDSGEYELSVQIENMKDTA-----TIRIRVVEKAGPPINVMVKEVWGTNALVEWQ 954
             +    ++  EYE  V   N+         +  +  ++   PP    V  +   +  + W 
Sbjct: 13864 KVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITRNSVTLIWT 13923

Query: 955   APKDDGNSEIMGYFVQKADKKTMEWFNVYERN-RHTSCTVSDLIVGNEYYFRVYTENICG 1013
              PK DG  ++ GY V+K D  +  W      N    + TV+DL+ G +Y FR+  +N  G
Sbjct: 13924 EPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAG 13983

Query: 1014  LSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNC-AVR 1072
                +P  S  T  I K        EY+     + P     L    + AG +  LN  ++ 
Sbjct: 13984 AISAPSESTETI-ICKD-------EYEAPTIVLDPTIKDGL---TIKAGDTIVLNAISIL 14032

Query: 1073  GHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAE 1132
             G P PK  W K   +IR      IT+      L I+  +  DAG YT  A N  G  +  
Sbjct: 14033 GKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEH 14092

Query: 1133  CKLEV 1137
              K+ V
Sbjct: 14093 VKVTV 14097



 Score =  115 bits (287), Expect = 3e-25
 Identities = 132/509 (25%), Positives = 215/509 (42%), Gaps = 64/509 (12%)

Query: 159  DASGQSLESFKRTSEK---KSDTAGELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPEIW 215
            + S +    FKR +E+   ++ TA EL      +K++   EE  +K KD        E+ 
Sbjct: 1946 EESEELRSKFKRRTEEGYYEAITAVELKS----RKKDESYEELLRKTKD--------ELL 1993

Query: 216  ELLKGAKKSEYEKIAFQYGITDLRGMLKRLKKAKVEVKKSAAFTKKLD--PAYQVDRGNK 273
               K   + E + +A +  IT     +   K  K+E+  S    K  +   +  V +G+ 
Sbjct: 1994 HWTKELTEEEKKALAEEGKIT-----IPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSD 2048

Query: 274  IKLMVEI-SDPDLTLKWFKNGQEIKPSSKYVF----ENVGKKRILTINKCTLADDAAYEV 328
                V +   PD   +W+KNG +I+ S +  +    +NV +   L I   T  D A+  V
Sbjct: 2049 AHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCE---LVIRDVTAEDSASIMV 2105

Query: 329  A---VKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAV---EVSEEGAQVMWMKDG 382
                +  E       + +   LI    E Q V   ++  MA    E SE   +V W KDG
Sbjct: 2106 KAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDG 2165

Query: 383  VELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVI---TNGGQCEAELIVEEKQL 439
            +E+   D    +YR   D K H L    +   D   Y  +       +  A+LIVE   +
Sbjct: 2166 MEVHEGD----KYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVV 2221

Query: 440  EVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDD 499
            E ++++ D+ V  S     +C VS E + GKWY N VE++ + + TI+       L + D
Sbjct: 2222 EFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKD 2281

Query: 500  VRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAG 559
            V  ED+G+Y+FV DG   +   K+           K  P  I    S +       V  G
Sbjct: 2282 VTKEDQGEYSFVIDGKKTTCKLKM-----------KPRPIAILQGLSDQK------VCEG 2324

Query: 560  NKLRLDVSITGEPPPVATWLK-GDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTI 618
            + ++L+V ++ E      W+K G EV  +      I+K+      +IE   +ED G Y+ 
Sbjct: 2325 DIVQLEVKVSLESVE-GVWMKDGQEVQPSDRVHIVIDKQ--SHMLLIEDMTKEDAGNYSF 2381

Query: 619  KVTNPVGEDVASIFLQVVDVPDPPEAVRI 647
             +          + +  VDV  P + V +
Sbjct: 2382 TIPALGLSTSGRVSVYSVDVITPLKDVNV 2410



 Score =  114 bits (286), Expect = 4e-25
 Identities = 137/562 (24%), Positives = 213/562 (37%), Gaps = 62/562 (11%)

Query: 586   TTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGE-DVASIFLQVVDV---PDP 641
             T T+ R R+    +  S+    A     G         VGE    S+F +  D    P P
Sbjct: 18583 TLTDLRLRVTGLTEGHSYEFRVAAENAAG---------VGEPSEPSVFYRACDALYPPGP 18633

Query: 642   PEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTE-TTYES 700
             P   ++T        L W  P+YDGG PV GY+VE K+  +  W         +   +  
Sbjct: 18634 PSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTV 18693

Query: 701   TKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTS-EP--------LHLIVEDVTDT 751
             TK+ E   Y  R+ A+N+ GV +P+  T P   +A    EP        L  +V      
Sbjct: 18694 TKLKENTEYNFRICAINSEGVGEPA--TLPGSVVAQERIEPPEIELDADLRKVVVLRASA 18751

Query: 752   T----TTLKWRPPNRIGAGGIDGYLVEYC-LEGSEEWVPANTEPVERCGFTVKNLPTGAR 806
             T     T+K RP   +     +G L +   +E +  +     + V R      NL     
Sbjct: 18752 TLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENN 18811

Query: 807   ILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQG 866
                +   VN+     P+     +TIRE+    K  +        I    +  N +V  + 
Sbjct: 18812 SGSKTAFVNVRVLDSPSAPVN-LTIREVK---KDSVTLSWEPPLIDGGAKITNYIVEKRE 18867

Query: 867   KPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIR 926
               R             T R+          F V       S EY + +  E      T  
Sbjct: 18868 TTRKAYATITNNCTKTTFRIENLQEGCSYYFRVLA-----SNEYGIGLPAET-----TEP 18917

Query: 927   IRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN 986
             ++V E   PP  V + +V    A ++W+ P+ DG S+I GY V+   K + +W +   + 
Sbjct: 18918 VKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKW-STCTQV 18976

Query: 987   RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKP-FEYKEHDFR 1045
             +    T+S L  G EY FRV   N  G SD   +      ++   I  KP  E   H F 
Sbjct: 18977 KTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLG---VPVIARDIEIKPSVELPFHTFN 19033

Query: 1046  MAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTL 1105
                          V A     ++   +G P+  V W K+   ++E  +  +++ + V +L
Sbjct: 19034 -------------VKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSL 19080

Query: 1106  NIRRPSPFDAGTYTCRAVNELG 1127
             +I+  S  D GTY     N  G
Sbjct: 19081 SIKEASKEDVGTYELCVSNSAG 19102



 Score =  111 bits (277), Expect = 4e-24
 Identities = 74/266 (27%), Positives = 120/266 (45%), Gaps = 9/266 (3%)

Query: 247  KAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLT-LKWFKNGQEIKPSSKYVFE 305
            K   ++K  A   KK      V         VE++ P++  ++W KNG  ++ + KY   
Sbjct: 2651 KTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAIS 2710

Query: 306  NVGKKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEM 365
              G    L I  C + D++ Y   +        L V+   V I+   +D        V  
Sbjct: 2711 VKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVET--VKIIKKPKDVTALENATVAF 2768

Query: 366  AVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNG 425
             V VS +   V W    VE+   D    ++R   + K H L+  ++   D G Y  +   
Sbjct: 2769 EVSVSHDTVPVKWFHKSVEIKPSD----KHRLVSERKVHKLMLQNISPSDAGEYTAVVGQ 2824

Query: 426  GQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRIT 485
             +C+A+L VE   L + + + ++ V  ++ A F+CEVS   V   W KNGVE+  S++  
Sbjct: 2825 LECKAKLFVET--LHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFK 2882

Query: 486  ISHVGRFHKLVIDDVRPEDEGDYTFV 511
            I   G+ H+L+I +   ED  +YTFV
Sbjct: 2883 IVVQGKLHQLIIMNTSTEDSAEYTFV 2908



 Score =  108 bits (271), Expect = 2e-23
 Identities = 107/416 (25%), Positives = 166/416 (39%), Gaps = 37/416 (8%)

Query: 735   APTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERC 794
             +P S    L  +D+   +  + WRPP   G   I GY++E        W   ++  V   
Sbjct: 23855 SPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSR-VRGT 23913

Query: 795   GFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPK--IRLPRHLRQT--- 849
                VK L       FRV   N  G S+P    +PVT +    PP+     P  L  T   
Sbjct: 23914 SLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSS 23973

Query: 850   ----YIRKVGEQLNLVVPF--QGKPRPQVVWTKGGAPLDTSRVHVRTSDF-DTVFFVRQA 902
                 + R   +  + V  +  + K      W +      T+ ++  T    D  +  R  
Sbjct: 23974 VSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRII 24033

Query: 903   ARSDSGEYELSVQIENM--KDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDG 960
             A++D G  E S   E +  KD         +K   P  + +  +   +  ++W+ P+ DG
Sbjct: 24034 AQNDVGLSETSPASEPVVCKDP-------FDKPSQPGELEILSISKDSVTLQWEKPECDG 24086

Query: 961   NSEIMGYFVQKADKKTMEWFNVY-ERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPG 1019
               EI+GY+V+        W     ER +    T+  L+   EY FRV+ EN  GLS    
Sbjct: 24087 GKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRP-- 24144

Query: 1020  VSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKV 1079
               + TA  +KT +T             AP     + D     G +A L+C + G P P +
Sbjct: 24145 --RRTAMSIKTKLTSGE----------APGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDI 24192

Query: 1080  VWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKL 1135
              W +   E+ +  K+ +++     TL +      D G YTC A NE+GE     KL
Sbjct: 24193 KWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKL 24248



 Score =  107 bits (266), Expect = 8e-23
 Identities = 121/519 (23%), Positives = 189/519 (36%), Gaps = 75/519 (14%)

Query: 639   PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNF-EVFTETT 697
             P PP   ++         L W  P YDGG P+ GYLVE K+  S  W++ N  +   +T 
Sbjct: 13217 PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTR 13276

Query: 698   YESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTT----- 752
             +E T ++E   Y+ RV+AVN IG S PS       P      P   +  D+  T      
Sbjct: 13277 FEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAG 13336

Query: 753   ------TTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGAR 806
                     +K RPP +I                   W   N    +R G  +K+      
Sbjct: 13337 VTMRLYVPVKGRPPPKI------------------TWSKPNVNLRDRIGLDIKSTDFDTF 13378

Query: 807   ILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQG 866
             +    V    AG+    TL      +E     K+          +   G  +N+ V    
Sbjct: 13379 LRCENVNKYDAGKYI-LTLENSCGKKEYTIVVKV----------LDTPGPPVNVTVKEIS 13427

Query: 867   KPRPQVVWTK----GGAPLDTSRVHVRTSDFDTVFFV---------RQAARSDSGEYELS 913
             K    V W      GG+P+    V  R ++  +   V         R A   +   Y   
Sbjct: 13428 KDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFR 13487

Query: 914   VQIEN---MKDTATIR--IRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYF 968
             V  EN   + D    R  ++  +  GP +++ V+ V  ++  + W+ P  DG S I+GY 
Sbjct: 13488 VFAENEYGIGDPGETRDAVKASQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYV 13547

Query: 969   VQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARIL 1028
             V    ++  +W  V  ++     +  DL  G EY FRV  EN     +  G       + 
Sbjct: 13548 VDFLTEEN-KWQRVM-KSLSLQYSAKDLTEGKEYTFRVSAEN----ENGEGTPSEITVVA 13601

Query: 1029  KTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEI 1088
             +  +     + K            P +  +     +  L   ++G P P V W K +  +
Sbjct: 13602 RDDVVAPDLDLKG----------LPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPL 13651

Query: 1089  REDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELG 1127
               D +  + +     TL +      DAG YT    N  G
Sbjct: 13652 ATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAG 13690



 Score =  107 bits (266), Expect = 8e-23
 Identities = 108/487 (22%), Positives = 190/487 (39%), Gaps = 42/487 (8%)

Query: 667   GKPVTGYLVERKKKGSQRWMKLNFEVFTET-TYESTKMIEGILYEMRVFAVNAIGVSQPS 725
             GKP+    + R     +  M+ N E+  E  T    + +        + A N+ G ++  
Sbjct: 20130 GKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAF 20189

Query: 726   MNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVP 785
             +N        P + P+  ++ D+T+ + TLKW PP   G   +  Y++      +  W  
Sbjct: 20190 INIVVLDRPGPPTGPV--VISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTE 20247

Query: 786   ANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIR---EIAEPPKIRL 842
              +   V R    V  L TG    FR+   N  G S+    A  VT++       PP    
Sbjct: 20248 VSAT-VARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSAC-VTVKLPYTTPGPPSTPW 20305

Query: 843   PRHLRQTYI-----RKVGEQLNLVVPF--QGKPRPQVVWTKGGA-PLDTSRVHVRTSDFD 894
               ++ +  I       V    + VV +  + K R  ++W K     + T+   V T    
Sbjct: 20306 VTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAG 20365

Query: 895   TVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQ 954
              ++  R  A + +G  + S   E         +  ++   PP NV + ++   +  + WQ
Sbjct: 20366 LIYEFRVYAENAAGVGKPSHPSEP--------VLAIDACEPPRNVRITDISKNSVSLSWQ 20417

Query: 955   APKDDGNSEIMGYFVQKADKKTMEWFNVYERN-RHTSCTVSDLIVGNEYYFRVYTENICG 1013
              P  DG S+I GY V++ D     W      N   T   +S L   ++Y FRV+  N  G
Sbjct: 20418 QPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVG 20477

Query: 1014  LSDSPGVSKNTARILKT---GITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCA 1070
                +P         + +    +   P EY E       K+          AG S  L   
Sbjct: 20478 SISNPSEVVGPITCIDSYGGPVIDLPLEYTE-----VVKYR---------AGTSVKLRAG 20523

Query: 1071  VRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEAL 1130
             + G P P + W K+  E++ +    + N   + ++ I+     ++G Y  +  N +G A 
Sbjct: 20524 ISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSAS 20583

Query: 1131  AECKLEV 1137
             A  ++++
Sbjct: 20584 ATIRVQI 20590



 Score =  106 bits (265), Expect = 1e-22
 Identities = 114/409 (27%), Positives = 180/409 (44%), Gaps = 52/409 (12%)

Query: 279  EISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTE 338
            EIS+ D+  +W   G+ ++PS     +  G KR LT++K  L  D A EV  +     T 
Sbjct: 5047 EISEADIPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKL--DQAGEVLYQALNAITT 5104

Query: 339  --LFVKEPPVLIVTPLEDQQVFVGDRVEMAVE-VSEEGAQVMWMKDGVELTREDSFKARY 395
              L VKE  +    PL+D  V V +R +   E V    A V+W K    +   D F    
Sbjct: 5105 AILTVKEIELDFAVPLKD--VTVPERRQARFECVLTREANVIWSKGPDIIKSSDKFD--- 5159

Query: 396  RFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQ 455
                DGK+HIL+ +D   +D G Y     G +  A L V   +L+ +  + D TVK  E 
Sbjct: 5160 -IIADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVKEGET 5218

Query: 456  AVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGY 515
            A F CE+S EK+   W+KN  ++  S+ + IS  G+ HKL + +V  +D           
Sbjct: 5219 ATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQ--IKAQVK 5276

Query: 516  ALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPV 575
             LS +A+L  LE           P   +    KT+      V  +++ L   ++ + P  
Sbjct: 5277 ELSSTAQLKVLE---------ADPYFTVKLHDKTA------VEKDEITLKCEVSKDVP-- 5319

Query: 576  ATWLK-GDEVFTT------TEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDV 628
              W K G+E+  +       +G  RI K        I+ A  +D+G Y         +  
Sbjct: 5320 VKWFKDGEEIVPSPKYSIKADGLRRILK--------IKKADLKDKGEYVCDCGTDKTKAN 5371

Query: 629  ASIFLQVVDVPDPPEAVRITSVGE--DWAILVWEPPMYD----GGKPVT 671
             ++  +++ V  P   V +  VGE   + I + EP ++      G+P+T
Sbjct: 5372 VTVEARLIKVEKPLYGVEV-FVGETAHFEIELSEPDVHGQWKLKGQPLT 5419



 Score =  103 bits (256), Expect = 1e-21
 Identities = 109/405 (26%), Positives = 177/405 (43%), Gaps = 35/405 (8%)

Query: 249  KVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVG 308
            KV+V + AA         ++  G K + +  IS     ++W ++ + ++   KY     G
Sbjct: 6172 KVKVHELAAEFISKPQNLEILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIADG 6231

Query: 309  KKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVE 368
            KKR+L +   TL D   Y V V   +    L V E  + IV PL+D +V     V    E
Sbjct: 6232 KKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIE-KLRIVVPLKDTRVKEQQEVVFNCE 6290

Query: 369  VSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQV-ITN--- 424
            V+ EGA+  W ++  E    DS  ++Y   +    + L   D   +D+  Y V +TN   
Sbjct: 6291 VNTEGAKAKWFRN--EEAIFDS--SKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRG 6346

Query: 425  -GGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKR 483
               +  A LIVEE+ L +++ + D+     +   F C+V+   VT KW KNG EV    R
Sbjct: 6347 ENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNR 6406

Query: 484  ITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHL 543
            ++       H L I D    DEG+Y  V  G   S+ A+L  +E   E+V        HL
Sbjct: 6407 VSYRVDKYKHMLTIKDCGFPDEGEY-IVTAGQDKSV-AELLIIEAPTEFVE-------HL 6457

Query: 544  DCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRT-RIEKRVDCSS 602
            +    T  +  V            ++ E   V  +  G E+    EG+  + EK      
Sbjct: 6458 EDQTVTEFDDAV--------FSCQLSREKANVKWYRNGREI---KEGKKYKFEKDGSIHR 6506

Query: 603  FVIESAQREDEGRYTIKVTNPVGEDVASIFLQ--VVDVPDPPEAV 645
             +I+  + +DE  Y   V +   +  A +F++   V++  PP+ +
Sbjct: 6507 LIIKDCRLDDECEYACGVED--RKSRARLFVEEIPVEIIRPPQDI 6549



 Score =  102 bits (254), Expect = 2e-21
 Identities = 114/516 (22%), Positives = 191/516 (37%), Gaps = 76/516 (14%)

Query: 636   VDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTE 695
             +D P PP  +RI    +    L W  P+YDGG  VTGY+VE ++   + W  ++ +    
Sbjct: 20792 IDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVR 20851

Query: 696   TT-YESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMP-------------------IA 735
             TT Y  + +  G+ Y  RV AVN  G  +P    +P                      IA
Sbjct: 20852 TTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIA 20911

Query: 736   PTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTE-PVERC 794
                E + +++        T+ WR   +   G    Y +E     S   +P  T     + 
Sbjct: 20912 KAGEDVQVLIPFKGRPPPTVTWRKDEK-NLGSDARYSIENTDSSSLLTIPQVTRNDTGKY 20970

Query: 795   GFTVKN---LPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYI 851
               T++N    P  + +  +V+    A +          T+  + +PP I     +    I
Sbjct: 20971 ILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVI 21030

Query: 852   RKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYE 911
              K             +   +  W+       ++   +      T FF R  A ++ G  E
Sbjct: 21031 EK-------------RDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGE 21077

Query: 912   LSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQK 971
                  E +K          E   P  ++ +K+   T+ ++ W  P  DG S I  Y V++
Sbjct: 21078 PCETTEPVK--------AAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVER 21129

Query: 972   ADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTG 1031
               K    W +    ++     VS L   +   FRV+ +N  GLSD               
Sbjct: 21130 KGKGEQTWSHA-GISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDP-------------- 21174

Query: 1032  ITFKPFEYKEHDFRMAPKFLTPLIDR--------VVVAGYSAALNCAVRGHPKPKVVWMK 1083
             +T  P   KE         +TP +D          V  G++  L    +G PKP + W+K
Sbjct: 21175 VTIGPITVKE-------LIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLK 21227

Query: 1084  NKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYT 1119
             + + ++E      +  +  +TL+I+       G YT
Sbjct: 21228 DGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYT 21263



 Score = 99.8 bits (247), Expect = 1e-20
 Identities = 71/264 (26%), Positives = 127/264 (48%), Gaps = 11/264 (4%)

Query: 268  VDRGNKIKLMVEISDPDLT-LKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
            V  G K  L  ++S PD+T +KW+ N ++IKP  +      G K+ L IN+   +D+  Y
Sbjct: 2410 VIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPY 2469

Query: 327  EVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMW-MKDGVEL 385
            ++ V   +    L V++  + I+  L D        V   VE+S  G  V+W  KD    
Sbjct: 2470 KLIVGRVETNCNLSVEK--IKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKD---- 2523

Query: 386  TREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDI 445
             +E    ++Y+ +  GK + L   +++++D G+Y           +L V    +   + +
Sbjct: 2524 -KEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAIS--KPL 2580

Query: 446  ADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDE 505
             D TV  S++AVF+CEV++    G+W ++G  +  +  I     G   +L+I   + +D 
Sbjct: 2581 TDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDI 2640

Query: 506  GDYTFVPDGYALSLSAKLNFLEIK 529
            G+YT+       S   K+  ++IK
Sbjct: 2641 GEYTYKVATSKTSAKLKVEAVKIK 2664



 Score = 99.0 bits (245), Expect = 2e-20
 Identities = 109/513 (21%), Positives = 188/513 (36%), Gaps = 49/513 (9%)

Query: 639   PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEV-FTETT 697
             P PP   ++  +      L W  P+YDGG  + GY+VE+       W          +T 
Sbjct: 16466 PGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTN 16525

Query: 698   YESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEP---LHLIVEDVTDTTT- 753
              E  K++E   Y  R+ A+N  GV + +    P +       P   L L +  + +    
Sbjct: 16526 IEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAG 16585

Query: 754   -------TLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGAR 806
                     +K RP   +  G +DG + +  +      +   +         V    +G  
Sbjct: 16586 GSLRLFVPIKGRPTPEVKWGKVDGEIRDAAI------IDVTSSFTSLVLDNVNRYDSGKY 16639

Query: 807   ILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPF-Q 865
              L           +   T +  VT+R +  P     P +L+ T I K    +    P   
Sbjct: 16640 TLTL--------ENSSGTKSAFVTVRVLDTPSP---PVNLKVTEITKDSVSITWEPPLLD 16688

Query: 866   GKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIE---NMKDT 922
             G  + +    +       S   V T+     + + Q     S  + ++ + E    +   
Sbjct: 16689 GGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQ 16748

Query: 923   ATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNV 982
                 I+V E   PP  + V +V   +  + W  P+ DG S+I+ Y V+   K + +W   
Sbjct: 16749 TADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSEC 16808

Query: 983   YERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEH 1042
               R +     +++L  G EY FRV   N  G SD         R L   I  K       
Sbjct: 16809 -ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDP--------RSLAVPIVAK------- 16852

Query: 1043  DFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGV 1102
             D  + P          V  G    +   + G PKP + W K+ + +++  +  +T+   +
Sbjct: 16853 DLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDL 16912

Query: 1103  LTLNIRRPSPFDAGTYTCRAVNELGEALAECKL 1135
              TL+I+     D G Y     N +G+  A  ++
Sbjct: 16913 TTLSIKETHKDDGGQYGITVANVVGQKTASIEI 16945



 Score = 98.6 bits (244), Expect = 3e-20
 Identities = 128/541 (23%), Positives = 199/541 (36%), Gaps = 74/541 (13%)

Query: 639  PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTY 698
            P PP    +    +    L W+PP  DGG P+ GY+VE +++G+  W ++N      TT 
Sbjct: 9333 PGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTC 9392

Query: 699  EST--KMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTT--- 753
            E     + E   Y  RV AVN  G S+PS  T          EP   I     D      
Sbjct: 9393 ECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKA 9452

Query: 754  --------TLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGA 805
                     +K RP  +  +   DG   +   +G  + +P + +       +V  +P   
Sbjct: 9453 GSQIRIPAVIKGRPTPK-SSWEFDGKAKKAMKDGVHD-IPEDAQLETAENSSVIIIPECK 9510

Query: 806  RILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVP-- 863
            R       +    ++   T    V + ++  PPK      L+ + I +   +L+  +P  
Sbjct: 9511 RSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPK-----DLKVSDITRGSCRLSWKMPDD 9565

Query: 864  ----------FQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELS 913
                       + +      WTK      ++   V     +  +F R  A +  G   + 
Sbjct: 9566 DGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFG---IG 9622

Query: 914  VQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQ--- 970
              +E ++ T T R  +     PPI + +  +      + W+ PK+DG S +  Y V+   
Sbjct: 9623 PPVETIQRT-TARDPIYPP-DPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLA 9680

Query: 971  --KADKKTMEWFNVYERN-RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARI 1027
                  K   W    +R+      TV DL+ G EY FRV   N  G+S            
Sbjct: 9681 WDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVS------------ 9728

Query: 1028 LKTGITFKPFEYKEHDFRMAPKFLTPLID----RVVVAGYSAALNCAVRGHPKPKVVWMK 1083
             K   T  P + +  D       + P ID      V  G +  +   ++G P P + W K
Sbjct: 9729 -KPSATVGPCDCQRPD-------MPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPTLTWFK 9780

Query: 1084 -------NKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLE 1136
                   NK  +  D            TL I +    D G YT  AVN LG A  E +L 
Sbjct: 9781 APPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLN 9840

Query: 1137 V 1137
            V
Sbjct: 9841 V 9841



 Score = 97.4 bits (241), Expect = 7e-20
 Identities = 101/436 (23%), Positives = 166/436 (38%), Gaps = 41/436 (9%)

Query: 717   NAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
             N+ G +  ++N        P + P+ +  ++VT  + TL W PP   G   I+ Y+VE  
Sbjct: 15852 NSAGEAIETLNVIVLDKPGPPTGPVKM--DEVTADSITLSWGPPKYDGGSSINNYIVEKR 15909

Query: 777   LEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRS-----EPATLAQPVTI 831
                +  W   +   V R       L TG    FR+   N  G+S     EP     P  +
Sbjct: 15910 DTSTTTWQIVSAT-VARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKV 15968

Query: 832   REIAEPPKIRLPRH--LRQTYIRKVGEQLNLVVPF--QGKPRPQVVWTKGGAPLDTSRVH 887
                   P + L     +   +   + +  + V+ +  + K R  ++W K       ++  
Sbjct: 15969 PGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVK------LNKTP 16022

Query: 888   VRTSDFDTVFFVRQAARSDSGEYELSVQIENM----KDTATIRIRVV-EKAGPPINVMVK 942
             +  + F T          +  EYE  V  EN+    K +      V  +   PP      
Sbjct: 16023 IPQTKFKTT------GLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAI 16076

Query: 943   EVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNR-HTSCTVSDLIVGNE 1001
              V   +  ++W+ P  DG S+I GY V+K +     W      N   T   V+ L+  + 
Sbjct: 16077 IVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHR 16136

Query: 1002  YYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVA 1061
             Y FRV   N  G+   P  S        TG      E       M PK+   +   VV A
Sbjct: 16137 YEFRVIARNAAGVFSEPSES--------TGAITARDEVDPPRISMDPKYKDTI---VVHA 16185

Query: 1062  GYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCR 1121
             G S  ++  + G P P + W+K   E+    +  I +     +L+++     D+G Y  +
Sbjct: 16186 GESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILK 16245

Query: 1122  AVNELGEALAECKLEV 1137
             A N  GE      ++V
Sbjct: 16246 AKNVAGERSVTVNVKV 16261



 Score = 95.5 bits (236), Expect = 3e-19
 Identities = 116/453 (25%), Positives = 166/453 (36%), Gaps = 51/453 (11%)

Query: 694   TETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTT 753
             T  + + T   +G  Y + V   N +G    S+         P   P+    +DV+  + 
Sbjct: 16913 TTLSIKETHKDDGGQYGITV--ANVVGQKTASIEIVTLDKPDPPKGPVKF--DDVSAESI 16968

Query: 754   TLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVG 813
             TL W PP   G   I  Y+V+     +  W   +   V R    V  L TG    FR+  
Sbjct: 16969 TLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSAT-VARTTLKVTKLKTGTEYQFRIFA 17027

Query: 814   VNIAGRS---EPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLN------LVVPF 864
              N  G+S   E   +      +E   P         + + + +  E +N      +    
Sbjct: 17028 ENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHL 17087

Query: 865   QGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSG-EYELSVQIENM---- 919
             + K R  ++WTK    ++ + +H      DT F   +A   + G EYE  V  EN+    
Sbjct: 17088 ERKERNSILWTK----VNKTIIH------DTQF---KAQNLEEGIEYEFRVYAENIVGVG 17134

Query: 920   ----KDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKK 975
                      +     +  G P  +MVK        ++W  P  DG S I GY V+K D  
Sbjct: 17135 KASKNSECYVARDPCDPPGTPEPIMVKR---NEITLQWTKPVYDGGSMITGYIVEKRDLP 17191

Query: 976   TMEWFNVYERNR-HTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITF 1034
                W      N   T  TVS L     Y FRV  +N  G    P  S        TG   
Sbjct: 17192 DGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDS--------TGPIT 17243

Query: 1035  KPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKF 1094
                E +     M PKF   +   VV AG +  L   V G P P + W++   EI E  + 
Sbjct: 17244 AKDEVELPRISMDPKFRDTI---VVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARC 17300

Query: 1095  LITNYQGVLTLNIRRPSPFDAGTYTCRAVNELG 1127
              I N      L ++     D G Y  RA N  G
Sbjct: 17301 EIKNTDFKALLIVKDAIRIDGGQYILRASNVAG 17333



 Score = 94.4 bits (233), Expect = 6e-19
 Identities = 72/213 (33%), Positives = 98/213 (46%), Gaps = 16/213 (7%)

Query: 931   EKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNV-YERNRHT 989
             EK G P    +  V   + +V W+ P  DG ++I  Y+++K +KK  +W +V  E  R T
Sbjct: 24451 EKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRET 24510

Query: 990   SCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPK 1049
               +V +LI G EY FRV  EN+ G S+   +S             +P   K      AP 
Sbjct: 24511 VFSVKNLIEGLEYEFRVKCENLGGESEWSEIS-------------EPITPKSDVPIQAPH 24557

Query: 1050  FLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDP-KFLITNYQ-GVLTLNI 1107
             F   L +  V    +A L C V GHPKP V W +   EI  D  K+ I  ++ G   L I
Sbjct: 24558 FKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLII 24617

Query: 1108  RRPSPFDAGTYTCRAVNELGEALAECKLEVRVP 1140
                +  DA  Y  RA N+ G       LEV VP
Sbjct: 24618 ASVTDDDATVYQVRATNQGGSVSGTASLEVEVP 24650



 Score = 94.0 bits (232), Expect = 7e-19
 Identities = 95/391 (24%), Positives = 171/391 (43%), Gaps = 37/391 (9%)

Query: 240  GMLKRLKKAKVEVKK-SAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQ-EIK 297
            G  ++   AK+ V++    F K L+    V +G  + L  E++  +  + W K+G+  ++
Sbjct: 4823 GNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSCELNK-ERDVVWRKDGKIVVE 4881

Query: 298  PSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFT-ELFVKEPPVL---IVTPLE 353
               + V   +G  R LTIN     D   Y V V++         VK   V+   +V P+ 
Sbjct: 4882 KPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIR 4941

Query: 354  DQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQ 413
            DQ V        A +++++   + W K   E+  E + K      +DG    L   + + 
Sbjct: 4942 DQHVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTE--ILRDGNHLYLKIKNAMP 4999

Query: 414  EDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYK 473
            ED   Y V   G +  A+L + E+++E+L+ I D+T+   E A F  E+S+  + G+W  
Sbjct: 5000 EDIAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKL 5059

Query: 474  NGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEY- 532
             G  +RPS    I   G    L +  V+ +  G+  +         +A L   EI++++ 
Sbjct: 5060 KGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLY--QALNAITTAILTVKEIELDFA 5117

Query: 533  VPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRT 592
            VP ++                + V    + R +  +T E   +  W KG ++  +++   
Sbjct: 5118 VPLKD----------------VTVPERRQARFECVLTREANVI--WSKGPDIIKSSDKFD 5159

Query: 593  RI---EKRVDCSSFVIESAQREDEGRYTIKV 620
             I   +K +     VI  +Q +DEG YT +V
Sbjct: 5160 IIADGKKHI----LVINDSQFDDEGVYTAEV 5186



 Score = 92.8 bits (229), Expect = 2e-18
 Identities = 113/454 (24%), Positives = 174/454 (38%), Gaps = 76/454 (16%)

Query: 717   NAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
             NA G    S+  K      P  +   L V  VT    TL W  P   G   I  Y+VE  
Sbjct: 22752 NASGTKAVSVMVKVLDSPGPCGK---LTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERR 22808

Query: 777   LEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIRE--- 833
                   WV    E      + V  L      +FRV  VN  G   P   ++P+  R    
Sbjct: 22809 ETSRLNWVIVEGE-CPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVE-SEPIVARNSFT 22866

Query: 834   IAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTK----GGAPLDTSRVHVR 889
             I  PP I            +VG          GK    + WTK    GG  +    V  R
Sbjct: 22867 IPSPPGIP----------EEVGT---------GKEHIIIQWTKPESDGGNEISNYLVDKR 22907

Query: 890   TSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVE------------------ 931
                  ++ + R     D   Y+  +++ ++ +    + RV                    
Sbjct: 22908 EKK--SLRWTR--VNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISC 22963

Query: 932   -----KAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN 986
                    GPP    V +    +  + W  P  DG ++I+GY ++  +K T +W+ V+   
Sbjct: 22964 REPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNA 23023

Query: 987   --RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKE-HD 1043
               R+T  TV DL +G +Y FRV   N+ G+S+    S++ A I       +P E  E  D
Sbjct: 23024 TIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSE---YSESIAEI-------EPVERIEIPD 23073

Query: 1044  FRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVL 1103
               +A      +  R   AG S  L  +V G P P + W K  +++    + +I   +   
Sbjct: 23074 LELADDLKKTVTIR---AGASLRLMVSVSGRPPPVITWSKQGIDLAS--RAIIDTTESYS 23128

Query: 1104  TLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
              L + + + +DAG YT  A N+ G+  A   ++V
Sbjct: 23129 LLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKV 23162



 Score = 91.7 bits (226), Expect = 4e-18
 Identities = 62/245 (25%), Positives = 116/245 (47%), Gaps = 7/245 (2%)

Query: 267  QVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
            +V  G+ ++L V++S   +   W K+GQE++PS +       +  +L I   T  D   Y
Sbjct: 2320 KVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNY 2379

Query: 327  EVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVS-EEGAQVMWMKDGVEL 385
               +      T   V    V ++TPL+D  V  G +  +  +VS  +   V W  +  ++
Sbjct: 2380 SFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQI 2439

Query: 386  TREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDI 445
              +D  +A  +    G +  L+ +     D G Y++I    +    L VE+  +++++ +
Sbjct: 2440 KPDDRVQAIVK----GTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVEK--IKIIRGL 2493

Query: 446  ADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDE 505
             DLT   ++  VF+ E+S   +   W     E++PS +  I   G+ +KL + ++  +DE
Sbjct: 2494 RDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDE 2553

Query: 506  GDYTF 510
            G YTF
Sbjct: 2554 GKYTF 2558



 Score = 91.3 bits (225), Expect = 5e-18
 Identities = 106/430 (24%), Positives = 163/430 (37%), Gaps = 59/430 (13%)

Query: 734   IAPTSEPLHLI-VEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVE 792
             + P S+P   I  +++   +  L W  P   G G I  Y +E        W    +  V 
Sbjct: 21282 LGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCSS-VA 21340

Query: 793   RCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIR 852
             R  F V NL   A   FRV   N  G      ++QP+    I    + R+P    +  I 
Sbjct: 21341 RTTFKVPNLVKDAEYQFRVRAENRYG------VSQPLVSSIIVAKHQFRIPGPPGKPVIY 21394

Query: 853   KV---GEQLNLVVPF------------QGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVF 897
              V   G  L    P             + K R  ++W K    ++TS +  R        
Sbjct: 21395 NVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQK----VNTSPISGRE------- 21443

Query: 898   FVRQAARSDSGEYELSVQIENMKDTA--------TIRIRVVEKAGPPINVMVKEVWGTNA 949
               R     +  +Y+  V  EN    +        T+ +  V+  G P  +   +V     
Sbjct: 21444 -YRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYI---DVTRETI 21499

Query: 950   LVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNV-YERNRHTSCTVSDLIVGNEYYFRVYT 1008
              ++W  P  DG S+I+GY ++K       W    +        TV+ L  G+ Y FR+  
Sbjct: 21500 TLKWNPPLRDGGSKIVGYSIEKRQGNE-RWVRCNFTDVSECQYTVTGLSPGDRYEFRIIA 21558

Query: 1009  ENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALN 1068
              N  G    P  S        +GI     E         P++   LI   + +G S  + 
Sbjct: 21559 RNAVGTISPPSQS--------SGIIMTRDENVPPIVEFGPEYFDGLI---IKSGESLRIK 21607

Query: 1069  CAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGE 1128
               V+G P P+V W K+ +EI +     IT+  G  +L +R  +    G YT  A N  G 
Sbjct: 21608 ALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGS 21667

Query: 1129  ALAECKLEVR 1138
             A AE K++V+
Sbjct: 21668 AKAEIKVKVQ 21677



 Score = 90.1 bits (222), Expect = 1e-17
 Identities = 92/433 (21%), Positives = 171/433 (39%), Gaps = 41/433 (9%)

Query: 248  AKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENV 307
            AK+ V+      + +    QV    +  +  E+++ D+   W+K+G EI    +   + V
Sbjct: 3092 AKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYV 3151

Query: 308  GKKRI--LTINKCTLADDAAYEVAVKDEKCFTELFVKEP-PVLIVTPLEDQQVFVGDRVE 364
             ++RI  + I++   +D   Y       +    L+V  P P  ++  L+   V  G    
Sbjct: 3152 VERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPAR 3211

Query: 365  MAVEVS-EEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQED-------- 415
                +S     ++ W K+  E      FK +  F  DG+ + L+  +   ED        
Sbjct: 3212 FCAVISGRPQPKISWYKE--EQLLSTGFKCK--FLHDGQEYTLLLIEAFPEDAAVYTCEA 3267

Query: 416  RGRYQVITNGGQCEAEL---IVEEKQLEV-----LQDIADLTVKASEQAVFKCEVSDEKV 467
            +  Y V T       E+   +  ++++ V     +  + D      + A F+C VS   +
Sbjct: 3268 KNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDL 3327

Query: 468  TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNF-L 526
               WY    +++PS+   ++     ++L I +  PEDEG YTFV       +S+  N  L
Sbjct: 3328 KVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSL 3387

Query: 527  EIKVEYVPKQEPPKIHLDCSGKTSE-------------NAIVVVAGNKLRLDVSITGEPP 573
            E   ++       + H+  S    +             +++ V  G  +R    ++G P 
Sbjct: 3388 EGFSKFEENTSNSQWHVSLSVSFKKEPLGQKPSFIQPLSSLRVHNGETVRFHARVSGIPK 3447

Query: 574  PVATWLKGDEVFTTTEGRT-RIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIF 632
            P   W    ++   T+      E+    +  +I  A  E  G+Y+ K  N  GE   +  
Sbjct: 3448 PEIQWFHNQQLILPTKDVVFHFEESTGMALMLIVDAYSEHAGQYSCKAANSAGEATCAAT 3507

Query: 633  LQVVDVPDPPEAV 645
            L V   P  PE++
Sbjct: 3508 LTV--TPKAPESI 3518



 Score = 90.1 bits (222), Expect = 1e-17
 Identities = 105/434 (24%), Positives = 163/434 (37%), Gaps = 37/434 (8%)

Query: 710   EMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGID 769
             E ++   NA G    +++        P + P++++  DVT    T+ W+PP   G   + 
Sbjct: 11208 EYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINIL--DVTPEHMTISWQPPKDDGGSPVI 11265

Query: 770   GYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPV 829
              Y+VE      + W   ++    +    + +L  G   +FRV   N  G   P      V
Sbjct: 11266 NYIVEKQDTRKDTWGVVSSGS-SKTKLKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPTV 11324

Query: 830   TIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVR 889
                + + P     P     T I +    ++  +P      P   +      +    V V 
Sbjct: 11325 AKHKFSPPSP---PGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVN 11381

Query: 890   TSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIR--------IRVVEKAGPPINVMV 941
              +    + F R     +   YE  V  EN+   +            R ++  GPPIN  +
Sbjct: 11382 KTPIADLKF-RVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKPPGPPINPKL 11440

Query: 942   KEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEW--FNVYERNRHTSCTVSDLIVG 999
             K+     A + W  P  DG S I+GY V+     T +W   N  E  R  +  V  LI G
Sbjct: 11441 KDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEG 11500

Query: 1000  NEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVV 1059
             NEY FR+   NI G        +   R L   +  K       D    P+    +  R V
Sbjct: 11501 NEYRFRIKAANIVG--------EGEPRELAESVIAK-------DILHPPEVELDVTCRDV 11545

Query: 1060  VA---GYSAALNCAVRGHPKPKVVWMK-NKMEIREDPKFLITNYQGVLTLNIRRPSPFDA 1115
             +    G +  +   V+G P+P + W K  K+ +RE    LI +   V  L I+     D 
Sbjct: 11546 ITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRV-ELQIKEAVRADH 11604

Query: 1116  GTYTCRAVNELGEA 1129
             G Y   A N  G A
Sbjct: 11605 GKYIISAKNSSGHA 11618



 Score = 89.4 bits (220), Expect = 2e-17
 Identities = 103/435 (23%), Positives = 167/435 (38%), Gaps = 40/435 (9%)

Query: 709   YEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGI 768
             YE+++   NA+G +  ++  +      P   P+    + VT    TL WRPP   G   I
Sbjct: 20571 YELKLR--NAMGSASATIRVQILDKPGPPGGPIEF--KTVTAEKITLLWRPPADDGGAKI 20626

Query: 769   DGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQP 828
               Y+VE        W   + E +E C  T   +  G   +FRV  VN  G  EP      
Sbjct: 20627 THYIVEKRETSRVVWSMVS-EHLEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSV 20685

Query: 829   VTIREIAEPPKIRLPRHLRQT-------YIRKVGEQLNLVVPF--QGKPRPQVVWTKG-G 878
             V       P    +P   + T       + R + +  + +  +  + + +  + W K   
Sbjct: 20686 VAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLK 20745

Query: 879   APLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN 938
               +  +R  V     ++ +  R  A + +G+   S   E  K    I     +  GPP  
Sbjct: 20746 ETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPI-----DPPGPPAK 20800

Query: 939   VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN--RHTSCTVSDL 996
             + + +   ++  + W  P  DG S + GY V+    +  EW  V  +   R T   VS+L
Sbjct: 20801 IRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNL 20860

Query: 997   IVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLID 1056
               G  YYFRV   N  G  +   +++             P + K  D   AP+    +  
Sbjct: 20861 KPGVNYYFRVSAVNCAGQGEPIEMNE-------------PVQAK--DILEAPEIDLDVAL 20905

Query: 1057  RVVV---AGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPF 1113
             R  V   AG    +    +G P P V W K++  +  D ++ I N      L I + +  
Sbjct: 20906 RTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRN 20965

Query: 1114  DAGTYTCRAVNELGE 1128
             D G Y     N +GE
Sbjct: 20966 DTGKYILTIENGVGE 20980



 Score = 89.4 bits (220), Expect = 2e-17
 Identities = 134/655 (20%), Positives = 251/655 (38%), Gaps = 101/655 (15%)

Query: 23    KEAPPKEAPAEAPKEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPD 82
             K++  K   +   ++  P+   P + +P  V +      +V +   A    K  G+    
Sbjct: 26453 KKSDQKTTESTVTRKTEPKAPEPISSKP--VIVTGLQDTTVSSDSVAKFAVKATGEP--- 26507

Query: 83    KPTIKWFK-GKWLELGSKSGARFSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAK 141
             +PT  W K GK +  G K      +K S                    D+G + LE+   
Sbjct: 26508 RPTAIWTKDGKAITQGGK------YKLSE-------------------DKGGFFLEIHKT 26542

Query: 142   DTCDSCGFNIDVEAPRQDASGQ---SLESFKRTSEKKSDTAGELDFSGLLKKREVVEEE- 197
             DT DS  +   V+      S     ++++ K T  +K  T    + +   +K+ VV+EE 
Sbjct: 26543 DTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITP--QKKAVVQEEI 26600

Query: 198   ----------KKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGITDLRGMLKRLKK 247
                       K  + K  + L +  E  ++L   +  +    + +  I  +   + +  +
Sbjct: 26601 SQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSI--VHEEITKTSQ 26658

Query: 248   AKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENV 307
             A  EV+  A   K       ++ G ++ L   I+     +KW  NG E+  S +Y +   
Sbjct: 26659 ASEEVRTHAEI-KAFSTQMSINEGQRLVLKANIAGA-TDVKWVLNGVELTNSEEYRYGVS 26716

Query: 308   GKKRILTINKCTLADDAAYEVAVKDE----KCFTELF----VKEPPVLIVTPLEDQQVFV 359
             G  + LTI + +  D+       K +    KC  +L     + + P  I  P   Q +  
Sbjct: 26717 GSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQP-RSQNINE 26775

Query: 360   GDRVEMAVEVS-EEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGR 418
             G  V    E+S E   ++ W K+ + +    S  +     +    + L   +    D G+
Sbjct: 26776 GQNVLFTCEISGEPSPEIEWFKNNLPI----SISSNVSISRSRNVYSLEIRNASVSDSGK 26831

Query: 419   YQVITNG--GQCEAEL------IVEEKQLE-VLQDIADLTVKAS------EQAVFKCEVS 463
             Y +      GQC A        +VEE   E VL+   D +++ S      + +  K E S
Sbjct: 26832 YTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEAS 26891

Query: 464   DEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG--DYTFVPDGYALSLSA 521
                 +     +  E++ +  ++   +    +  ++       G  + T +    +  L A
Sbjct: 26892 FSSFSSSSASSMTEMKFAS-MSAQSMSSMQESFVEMSSSSFMGISNMTQLESSTSKMLKA 26950

Query: 522   KLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATW-LK 580
              +  +  K+E +P                   I +  G  L +  + TGEP P  TW   
Sbjct: 26951 GIRGIPPKIEALPSD-----------------ISIDEGKVLTVACAFTGEPTPEVTWSCG 26993

Query: 581   GDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQV 635
             G ++ +  +GR  IE   D ++ +I   Q++D G YT+ + N  G D A++ + +
Sbjct: 26994 GRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 27048



 Score = 88.2 bits (217), Expect = 4e-17
 Identities = 106/434 (24%), Positives = 168/434 (38%), Gaps = 44/434 (10%)

Query: 713   VFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYL 772
             + AVN +G +   M         P   P+    E V+    TL W PP   G   I  Y+
Sbjct: 9824  ITAVNNLGTASKEMRLNVLGRPGPPVGPIKF--ESVSADQMTLSWFPPKDDGGSKITNYV 9881

Query: 773   VEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIR 832
             +E      + WV  ++EP E C +T+  L  G   +FR++  N  G  EP   ++P T R
Sbjct: 9882  IEKREANRKTWVHVSSEPKE-CTYTIPKLLEGHEYVFRIMAQNKYGIGEPLD-SEPETAR 9939

Query: 833   EIAEPPKIRLPRHLRQTYIRKVGEQLNLVVP-FQGKPRPQVVWTKGGAPLDTSRVHVRTS 891
              +   P    P     + + +    +N   P + G       W +     DT+    +  
Sbjct: 9940  NLFSVPGA--PDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLE---MKDTTSKRWKRV 9994

Query: 892   DFDTVFFV------RQAARSDSGEYELSVQIENM---------KDTATIRIRVVEKAGPP 936
             + D +  +      +     +  +Y+  V   N           D AT R  +    GPP
Sbjct: 9995  NRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPP-GPP 10053

Query: 937   INVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN-RHTSCTVSD 995
                 V +   ++A +EW  P  DG S++ GY V+  ++   EW    ++  R T   V+ 
Sbjct: 10054 FP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTG 10112

Query: 996   LIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLI 1055
             L  G  Y FRV   NI G+ + PG   +              E K+       +    + 
Sbjct: 10113 LKEGAFYKFRVRAVNIAGIGE-PGEVTDV------------IEMKDRLVSPDLQLDASVR 10159

Query: 1056  DRVVV-AGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFD 1114
             DR+VV AG    +   V G P P V W  N+  + ++     T      ++ I+      
Sbjct: 10160 DRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISS--SMVIKNCQRSH 10217

Query: 1115  AGTYTCRAVNELGE 1128
              G Y+  A NE GE
Sbjct: 10218 QGVYSLLAKNEAGE 10231



 Score = 88.2 bits (217), Expect = 4e-17
 Identities = 118/461 (25%), Positives = 169/461 (36%), Gaps = 66/461 (14%)

Query: 704   IEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRI 763
             I+G  Y +R  A N  G     +N K      P   P+   V  VT    +L W PP + 
Sbjct: 17319 IDGGQYILR--ASNVAGSKSFPVNVKVLDRPGPPEGPVQ--VTGVTSEKCSLTWSPPLQD 17374

Query: 764   GAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPA 823
             G   I  Y+VE        W    +E V      V  L  G   +FR++ VN  G  EP 
Sbjct: 17375 GGSDISHYVVEKRETSRLAWTVVASEVVTN-SLKVTKLLEGNEYVFRIMAVNKYGVGEPL 17433

Query: 824   TLAQPVTIREIAEPPKIRLPRHLRQTYIRKVG--------------EQLNLVVPFQGKPR 869
               A  +       P     P+ L  T I K                E +  +V  + + R
Sbjct: 17434 ESAPVLMKNPFVLPGP---PKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIV--EKRDR 17488

Query: 870   PQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDT-----AT 924
               + W K     +  R+        T   +R    ++  EYE  V  EN         AT
Sbjct: 17489 SGIRWIK----CNKRRI--------TDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPAT 17536

Query: 925   IRIRVVE---KAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQ--KADKKTMEW 979
             +  +  +   K GPP N  + +    +  + W  P  DG SEI+GY V+  KAD++  + 
Sbjct: 17537 VYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQI 17596

Query: 980   FNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEY 1039
                    R T   +S L    EY  RV   N  GL ++  V               P   
Sbjct: 17597 VTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSV---------------PGTV 17641

Query: 1040  KEHDFRMAPKFLTPLIDR---VVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLI 1096
             K  D   AP+       R   VV AG SA ++   +G P P++ W + + E  +  K  I
Sbjct: 17642 KPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTD--KVQI 17699

Query: 1097  TNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
                     L+I      DAG Y  +  N  G   A   ++V
Sbjct: 17700 EKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKV 17740



 Score = 87.4 bits (215), Expect = 7e-17
 Identities = 103/433 (23%), Positives = 161/433 (37%), Gaps = 50/433 (11%)

Query: 715   AVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
             A N  G    ++N K      P   P+  ++  VT    TL W+PP + G   I  Y+VE
Sbjct: 16246 AKNVAGERSVTVNVKVLDRPGPPEGPV--VISGVTAEKCTLAWKPPLQDGGSDIINYIVE 16303

Query: 775   YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAG-----RSEPATLAQPV 829
                     W   +   V+     V  L  G    FR++ VN  G      SEP     P 
Sbjct: 16304 RRETSRLVWTVVDAN-VQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPF 16362

Query: 830   TIREIAEPPKIRLPRHLRQTYI----RKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSR 885
              + +  + P++          +       G    L    + + +  + WT         R
Sbjct: 16363 VVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWT---------R 16413

Query: 886   VHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIR--------IRVVEKAGPPI 937
              H R         +R     ++ +YE  V  EN    +              + K GPP 
Sbjct: 16414 CHKRLIG---ELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPN 16470

Query: 938   NVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN--RHTSCTVSD 995
             N  V ++  ++  + W  P  DG  EI GY V+K D    EW           T+  V  
Sbjct: 16471 NPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEK 16530

Query: 996   LIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLI 1055
             L+  +EY FR+   N  G+ +   V           I  +  E  + D  +    L  +I
Sbjct: 16531 LLEKHEYNFRICAINKAGVGEHADVPGPI-------IVEEKLEAPDIDLDLE---LRKII 16580

Query: 1056  DRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLIT-NYQGVLTLNIRRPSPFD 1114
             +  + AG S  L   ++G P P+V W K   EIR+     +T ++  ++  N+ R   +D
Sbjct: 16581 N--IRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTSLVLDNVNR---YD 16635

Query: 1115  AGTYTCRAVNELG 1127
             +G YT    N  G
Sbjct: 16636 SGKYTLTLENSSG 16648



 Score = 87.4 bits (215), Expect = 7e-17
 Identities = 98/404 (24%), Positives = 147/404 (36%), Gaps = 63/404 (15%)

Query: 713   VFAVNAIGVSQPSMNT----KPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGI 768
             V A N+ G +  +++     KP  P+ P         ++V+     + W PP   G   I
Sbjct: 18012 VTATNSAGTATENLSVIVLEKPGPPVGPVR------FDEVSADFVVISWEPPAYTGGCQI 18065

Query: 769   DGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQP 828
               Y+VE     +  W   +   V R    +  L TG    FR+   N  G+S P      
Sbjct: 18066 SNYIVEKRDTTTTTWHMVSAT-VARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAV 18124

Query: 829   VTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLV---------------VPFQGKPRPQVV 873
             +      EP     P      ++  + +   LV                  + K +  ++
Sbjct: 18125 IVQYPFKEPGPPGTP------FVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSIL 18178

Query: 874   WTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSG-EYELSVQIENM----KDTATIRIR 928
             W K       ++  ++ + F T          D G EYE  V  EN+    K +      
Sbjct: 18179 WVK------LNKTPIQDTKFKTTGL-------DEGLEYEFKVSAENIVGIGKPSKVSECF 18225

Query: 929   VV-EKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN- 986
             V  +   PP       +   N  ++W+ P  DG S+I GY V+K D     W      N 
Sbjct: 18226 VARDPCDPPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNV 18285

Query: 987   RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRM 1046
               T  TVS L+    Y FRV   N  G    P  S          IT +  E    +  +
Sbjct: 18286 LETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGA-------ITARD-EIDAPNASL 18337

Query: 1047  APKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIRE 1090
              PK+   +   VV AG +  L   +RG P P VVW K+  E+ E
Sbjct: 18338 DPKYKDVI---VVHAGETFVLEADIRGKPIPDVVWSKDGKELEE 18378



 Score = 86.7 bits (213), Expect = 1e-16
 Identities = 91/398 (22%), Positives = 151/398 (37%), Gaps = 28/398 (7%)

Query: 633   LQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEV 692
             L  +D P  P  + IT        L W  P Y GG  +T Y+VE++   + RW+K NF  
Sbjct: 14982 LDPIDPPGKPVPLNIT---RHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSN 15038

Query: 693   FTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTT 752
               E  +  + + E   YE RV A NA G   P       +      E   + V+     T
Sbjct: 15039 ILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDT 15098

Query: 753   TTLKWRPPNRIGA--GGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFR 810
               LK     R+ A   G     +E+  +G E    A  E ++   F+   +   +    R
Sbjct: 15099 VILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLE-IKIADFSTNLVNKDS--TRR 15155

Query: 811   VVGVNIAGRSEPATLAQPV-TIREIAEPPKIRLPRHLRQTYIRKV-----------GEQL 858
               G      + P   A+ +  ++ +  P     P  + +    K            G ++
Sbjct: 15156 DSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKI 15215

Query: 859   NLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIEN 918
             +  +  Q +   ++ WT   + +  +++ V        +  R  A +  G        E 
Sbjct: 15216 DHYI-VQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVG------EP 15268

Query: 919   MKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTME 978
             ++    + +       PP N  V  +   + +V W  P  DG SEI+ Y V++ DK    
Sbjct: 15269 LESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQR 15328

Query: 979   WFNVYERN-RHTSCTVSDLIVGNEYYFRVYTENICGLS 1015
             W    ++        VS L  G+EY FR+  EN  G+S
Sbjct: 15329 WIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGIS 15366



 Score = 86.7 bits (213), Expect = 1e-16
 Identities = 227/1140 (19%), Positives = 382/1140 (33%), Gaps = 202/1140 (17%)

Query: 83    KPT--IKWF-KGKWLELGSK------SGA-RFSFKESHNSASNVYTVELHIGKVVLGDRG 132
             KPT  +KW+  G  L+  SK      SG       + H   S  Y       K    D  
Sbjct: 26028 KPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASD-- 26085

Query: 133   YYRLEVKAKDTCDSCGFNIDVEAPRQ------DASGQSLESFKRTSEKKSDTAGELDFSG 186
             Y  L+V   D         D E PR            ++ SFK+TSE ++ ++     S 
Sbjct: 26086 YATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQ 26145

Query: 187   LLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGITDLRGMLKRLK 246
             + + RE +   +     +     +  +  E     +KS   KI      T    +L + +
Sbjct: 26146 MTETRESLSSYEHSASAEMKSAALEEKSLE-----EKSTTRKIK----TTLAARILTKPR 26196

Query: 247   KAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFEN 306
                V   +SA F+   D                  +P  T+ W + GQ +  S+++    
Sbjct: 26197 SMTVYEGESARFSCDTD-----------------GEPVPTVTWLRKGQVLSTSARHQVTT 26239

Query: 307   VGKKRILTINKCTLADDAAYEVAV-----KDEKCFTELFVKEPPVLIVTPLEDQQVFVGD 361
                K    I+    +D+  Y V V     K E  FT    K         + ++ V    
Sbjct: 26240 TKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQK-------ARVTEKAVTSPP 26292

Query: 362   RVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQV 421
             RV+                    +   ++ K+  R K     H    S    +     +V
Sbjct: 26293 RVKSPEP---------------RVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKV 26337

Query: 422   ITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPS 481
                      + I +  + E  ++IA LT       +   EV+       WYK+G +++ +
Sbjct: 26338 QHLPVSAPPK-ITQFLKAEASKEIAKLTCVVESSVLRAKEVT-------WYKDGKKLKEN 26389

Query: 482   KRITISH-VGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLE----------IKV 530
                   +     ++L I+++   D+G+Y     G   +    L F+            K+
Sbjct: 26390 GHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKI 26449

Query: 531   EYVPKQEPPKIHLDCSGKTSENAI-------VVVAG---------NKLRLDVSITGEPPP 574
                 K +        + KT   A        V+V G         +  +  V  TGEP P
Sbjct: 26450 SETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRP 26509

Query: 575   VATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQ 634
              A W K  +  T   G+ ++ +        I      D G YT  V N  G   +S  L 
Sbjct: 26510 TAIWTKDGKAITQG-GKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLT 26568

Query: 635   VVDVPDPPEAVRITS------VGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKL 688
             +  + D  EA ++++        +  A++  E       K +    ++  +  SQ  + L
Sbjct: 26569 IKAIKDT-EAQKVSTQKTSEITPQKKAVVQEEISQ----KALRSEEIKMSEAKSQEKLAL 26623

Query: 689   NFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNT------KPFMPIAPTSEPLH 742
               E       E  K       E  +        SQ S         K F      +E   
Sbjct: 26624 KEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQR 26683

Query: 743   LIVEDVTDTTTTLKW---------RPPNRIGAGGIDGYLV----EYCLEGSEEWVPANTE 789
             L+++      T +KW             R G  G D  L      +  EG    +    E
Sbjct: 26684 LVLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKE 26743

Query: 790   PVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQT 849
              + +C + +    T ++ L             PA ++QP                  R  
Sbjct: 26744 GIVKCQYDL----TLSKEL----------SDAPAFISQP------------------RSQ 26771

Query: 850   YIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLD-TSRVHVRTSDFDTVFFVRQAARSDSG 908
              I + G+ +       G+P P++ W K   P+  +S V +  S       +R A+ SDSG
Sbjct: 26772 NINE-GQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSG 26830

Query: 909   EYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYF 968
             +Y +  +    + +AT  + V+     P   +V    G  +L                  
Sbjct: 26831 KYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSL----------QGSFSSQS 26880

Query: 969   VQKADKKTMEWFNVYERNRHTSCT--------VSDLIVGNEYYFRVYTENICGLSDSPGV 1020
             VQ +  K    F+ +  +  +S T           +    E +  + + +  G+S+   +
Sbjct: 26881 VQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQL 26940

Query: 1021  SKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVV 1080
               +T+++LK GI   P           PK      D  +  G    + CA  G P P+V 
Sbjct: 26941 ESSTSKMLKAGIRGIP-----------PKIEALPSDISIDEGKVLTVACAFTGEPTPEVT 26989

Query: 1081  WM--KNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVR 1138
             W     K+  +E  +F I N   + TL I      D G YT    NE G   A   + +R
Sbjct: 26990 WSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIR 27049



 Score = 84.7 bits (208), Expect = 4e-16
 Identities = 109/433 (25%), Positives = 158/433 (36%), Gaps = 52/433 (12%)

Query: 717   NAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
             N  G    ++N K      P + PL   +  +T    +L W  P   G   ID Y+VE  
Sbjct: 19494 NVAGTRSVAVNCKVLDKPGPPAGPLE--INGLTAEKCSLSWGRPQEDGGADIDYYIVEKR 19551

Query: 777   LEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAE 836
                   W     E ++     V  L  G   +FRV GVN  G  EP    + V I+ +  
Sbjct: 19552 ETSHLAWTICEGE-LQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPL---ESVAIKALDP 19607

Query: 837   PPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSD---- 892
                   P  L  T + K  E + L        RP+   + GG+ +    +  R  +    
Sbjct: 19608 FTVPSPPTSLEITSVTK--ESMTLCWS-----RPE---SDGGSEISGYIIERREKNSLRW 19657

Query: 893   --------FDTVFFVRQAARSDSGEYELSVQIEN-----MKDTATIRIRVVEKA---GPP 936
                     +D    V+     +  EYE  V  EN     +    +  IR  +      PP
Sbjct: 19658 VRVNKKPVYD--LRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPP 19715

Query: 937   INVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDL 996
                 + +   T   + W  P  DG + I GY V+       +W    +  R T  T+S L
Sbjct: 19716 SKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTSIQSLRGTEYTISGL 19775

Query: 997   IVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLID 1056
               G EY FRV + N  G SD    S    +I K          +E  F +  +    LI 
Sbjct: 19776 TTGAEYVFRVKSVNKVGASDPSDSSD--PQIAKE-------REEEPLFDIDSEMRKTLI- 19825

Query: 1057  RVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAG 1116
               V AG S  +    RG P P V+W K   ++R   +  +       +L I   +  D+G
Sbjct: 19826 --VKAGASFTMTVPFRGRPVPNVLWSKPDTDLR--TRAYVDTTDSRTSLTIENANRNDSG 19881

Query: 1117  TYTCRAVNELGEA 1129
              YT    N L  A
Sbjct: 19882 KYTLTIQNVLSAA 19894



 Score = 84.3 bits (207), Expect = 6e-16
 Identities = 200/926 (21%), Positives = 340/926 (36%), Gaps = 134/926 (14%)

Query: 286  TLKWFK-NGQEIKPSSKYVFENV--GKKRILTINKCTLADDAAYEVAVKDEKCFTELFV- 341
            T KW + N + IK     V E V   K+ +L +        A   + V +    +E  V 
Sbjct: 7956 TEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVR-------AVNAIGVSEPSEISENVVA 8008

Query: 342  KEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQV---MWMKDGVELTREDSFKARYRFK 398
            K+P       LE   + V +  ++++ V      V    W KDG E+   D    R   K
Sbjct: 8009 KDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASD----RLTMK 8064

Query: 399  KDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVF 458
             D     L     V+ D G Y +        A   +  K + +     D  +KAS+    
Sbjct: 8065 NDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKD--IKASDITKS 8122

Query: 459  KCEVSDEKVTGKWYKNGVEV--------RPSKRITISHVGRFHKL--VIDDVRPEDEGDY 508
             C+++ E      +  G  +           +R  I  +   +KL   + D+ P   G+Y
Sbjct: 8123 SCKLTWEPPE---FDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPN--GEY 8177

Query: 509  TFVPDGYALSLSAKLNFLEIKVEYV---PKQEP-PKIHLDCSGKTSENAIVVVAGNKLRL 564
             F     A++      ++E+K   +   PKQ P P + ++    T+E             
Sbjct: 8178 FFRVK--AVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEA------------ 8223

Query: 565  DVSITGEPPPV--ATWLKGDEVFTTTEGRTRI----EKRVDCSSFVIESAQREDEGRYTI 618
             ++IT +PP     + + G  +    +G  R     E  V   ++  +  +   E ++ +
Sbjct: 8224 -MTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRV 8282

Query: 619  KVTNPVG---EDVASIFLQVVDVPDPPEAVRITSV---------------GEDWAILVWE 660
            +  N  G      A+   + VD  D P+ +  TS+               G  +  + W 
Sbjct: 8283 RAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYPTITWI 8342

Query: 661  PP----MYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGIL-------- 708
                  + +  K     LV R+K   Q        +    + +++K  E  L        
Sbjct: 8343 KDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRP 8402

Query: 709  ----YEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIG 764
                Y ++V   N  G+++            P   P++ + ED+  T+   KW PP   G
Sbjct: 8403 DHGLYMIKV--ENDHGIAKAPCTVSVLDTPGP---PINFVFEDIRKTSVLCKWEPPLDDG 8457

Query: 765  AGGIDGYLVEYC--LEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEP 822
               I  Y +E     +   EW+   T  +  C ++V  L  G   LFRV   N  G   P
Sbjct: 8458 GSEIINYTLEKKDKTKPDSEWIVV-TSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPP 8516

Query: 823  ATLAQPVTIREIAEPP----KIRLPRHLRQTYIRKVGEQLNLVVPFQG-----KPRPQVV 873
              +++P+  ++   PP    K  +      + + K  E  +   P  G     +      
Sbjct: 8517 C-VSKPLVAKDPFGPPDAPDKPIVEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTH 8575

Query: 874  WTK-GGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEK 932
            W++   + L+  + +V        +  R  A + +G  + S       D  T     +  
Sbjct: 8576 WSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPP----SDPKTAH-DPISP 8630

Query: 933  AGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN-RHTSC 991
             GPPI   V +   T   +EW+ P  +G  EI+GYFV K    T EW    E+  +    
Sbjct: 8631 PGPPIP-RVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQY 8689

Query: 992  TVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFL 1051
            TV ++  G +Y  RV   N  G    PG ++            +P E    +  ++ K  
Sbjct: 8690 TVKEIREGADYKLRVSAVNAAG-EGPPGETQPVT-------VAEPQEPPAVELDVSVKGG 8741

Query: 1052 TPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPS 1111
                   ++AG +  +   V G P P  VW K + E+ +D + +I N      L I+   
Sbjct: 8742 IQ-----IMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKD-RVVIDNVGTKSELIIKDAL 8795

Query: 1112 PFDAGTYTCRAVNELGEALAECKLEV 1137
              D G Y   A N  G   A  ++EV
Sbjct: 8796 RKDHGRYVITATNSCGSKFAAARVEV 8821



 Score = 84.3 bits (207), Expect = 6e-16
 Identities = 117/447 (26%), Positives = 169/447 (37%), Gaps = 58/447 (12%)

Query: 715   AVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
             A N  G ++   N K      P   PL   V +VT     L W PP   G   ID Y+V+
Sbjct: 15164 ATNPGGFAKHIFNVKVLDRPGPPEGPL--AVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQ 15221

Query: 775   YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREI 834
                     W    +E V+     V  L  G   +FRV+ VN  G  EP   ++PV     
Sbjct: 15222 KRETSRLAWTNVASE-VQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLE-SEPVLAVNP 15279

Query: 835   AEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFD 894
               PP    P++   T I K     + +V   G P      + GG+ +    V  R     
Sbjct: 15280 YGPPDP--PKNPEVTTITK-----DSMVVCWGHPD-----SDGGSEIINYIVERRDKAGQ 15327

Query: 895   ----------TVFFVRQAARSDSGEYELSVQIENMKDTATIR--------IRVVEKAGPP 936
                       T    + +  ++  EYE  +  EN    +              V K GPP
Sbjct: 15328 RWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFKPGPP 15387

Query: 937   INVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN--RHTSCTVS 994
              N  V +   ++  + W  P  DG SEI GY V+ A  +  EW  V      + TS T++
Sbjct: 15388 GNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTIT 15447

Query: 995   DLIVGNEYYFRVYTENICGLSDS---PGVSKNTARILKTGITFKPFEYKEHDFRMAPKFL 1051
              L    EY  R+Y  N  GL +    PG  K   R+L   I        + D R   K +
Sbjct: 15448 GLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIEL------DADLR---KVV 15498

Query: 1052  TPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLIT-NYQGVLTLNIRRP 1110
             T      + A  +  L   ++G P P+V W ++  E  +      T +Y  ++  N+ R 
Sbjct: 15499 T------IRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIESTSSYTLLIVGNVNR- 15551

Query: 1111  SPFDAGTYTCRAVNELGEALAECKLEV 1137
               FD+G Y     N  G   A   + V
Sbjct: 15552 --FDSGKYILTVENSSGSKSAFVNVRV 15576



 Score = 84.3 bits (207), Expect = 6e-16
 Identities = 106/412 (25%), Positives = 143/412 (34%), Gaps = 70/412 (16%)

Query: 747   DVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGAR 806
             ++T    TL W  P   G   I  Y++E        W     +  E   +T   L  G  
Sbjct: 21691 NITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIE-DKCEAQSYTAIKLINGNE 21749

Query: 807   ILFRVVGVNIAGRSEPATLAQPVTIR---EIAEPPKIRLPRHLRQTYIRKV--------G 855
               FRV  VN  G   P   + PV  +    + + P I  P ++    I           G
Sbjct: 21750 YQFRVSAVNKFGVGRPLD-SDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGG 21808

Query: 856   EQLNLVVPFQGKPRPQVVWTK--GGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELS 913
              ++   +  + + +    W K     P+  +R  V                ++  EYE  
Sbjct: 21809 SEIQQYI-LERREKKSTRWVKVISKRPISETRFKV-------------TGLTEGNEYEFH 21854

Query: 914   VQIENMKDTAT-------IRIRV-VEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIM 965
             V  EN             I+ R  V   GPP  V V +   T   +EW  P  DG  EI+
Sbjct: 21855 VMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEII 21914

Query: 966   GYFVQKADKKTMEWFNVY-ERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDS------- 1017
             GY ++       +W  V  E    T  TV+DL  G EY FRV   N  G  DS       
Sbjct: 21915 GYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTI 21974

Query: 1018  PGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKP 1077
               V + TA  L     FK                      VV AG S  L  A +G P P
Sbjct: 21975 KAVDRLTAPELDIDANFKQ-------------------THVVRAGASIRLFIAYQGRPTP 22015

Query: 1078  KVVWMK--NKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELG 1127
               VW K  + + +R D    I       TL +   +  DAG YT    N  G
Sbjct: 22016 TAVWSKPDSNLSLRAD----IHTTDSFSTLTVENCNRNDAGKYTLTVENNSG 22063



 Score = 84.0 bits (206), Expect = 8e-16
 Identities = 108/447 (24%), Positives = 166/447 (37%), Gaps = 71/447 (15%)

Query: 720   GVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEG 779
             G  Q ++  +P  P+ P S       ++VT     + W+PP   G   I  Y++E    G
Sbjct: 10530 GFCQVNVVDRPGPPVGPVS------FDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEVG 10583

Query: 780   SEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPK 839
              + W+P  T    +    V  L  G   +FR+   N+ G S+P      +    +    +
Sbjct: 10584 KDVWMPV-TSASAKTTCKVSKLLEGKDYIFRIHAENLYGISDP------LVSDSMKAKDR 10636

Query: 840   IRLPRHLRQTYIRKVGEQLNLVV---PFQG-KPRPQVV------WTKGGAPLDTSRVHVR 889
              R+P    Q  + +V +   LV    P  G KP    +       +K  A +    +H  
Sbjct: 10637 FRVPDAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKRETMSKRWARVTKDPIHPY 10696

Query: 890   TSDFDTVFFVRQAARSDSGEYELSVQIEN---MKDTATIRIRV-----VEKAGPPINVMV 941
             T         R     +  +YE  V  EN   + D +     V     + K  PP+N   
Sbjct: 10697 TK-------FRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEA 10749

Query: 942   KEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHT--SCT-----VS 994
              +    +  + WQ P+ DG S+I+GY V+       EW     R  HT  SC      V+
Sbjct: 10750 IDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEW----RRANHTPESCPETKYKVT 10805

Query: 995   DLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFL--- 1051
              L  G  Y FRV   N  G SD   V +             P   K+   R+ P  L   
Sbjct: 10806 GLRDGQTYKFRVLAVNAAGESDPAHVPE-------------PVLVKD---RLEPPELILD 10849

Query: 1052  -TPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRP 1110
                  ++ +  G +  L+  ++G P PKV W K   +     +  +T       L IR  
Sbjct: 10850 ANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGS--KLEIRNA 10907

Query: 1111  SPFDAGTYTCRAVNELGEALAECKLEV 1137
             +  D G Y+    N  G      K+ V
Sbjct: 10908 AHEDGGIYSLTVENPAGSKTVSVKVLV 10934



 Score = 84.0 bits (206), Expect = 8e-16
 Identities = 61/234 (26%), Positives = 102/234 (43%), Gaps = 24/234 (10%)

Query: 896   VFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQA 955
             +++ R  A ++ G   + V +E +       ++  E   PP  V + +V  T+A + W+ 
Sbjct: 17812 IYYFRVMAENEFG---VGVPVETVD-----AVKAAEPPSPPGKVTLTDVSQTSASLMWEK 17863

Query: 956   PKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLS 1015
             P+ DG S ++GY V+   K T +W  V E ++  +  V+ L  G EY FRV   N  G S
Sbjct: 17864 PEHDGGSRVLGYVVEMQPKGTEKWSIVAE-SKVCNAVVTGLSSGQEYQFRVKAYNEKGKS 17922

Query: 1016  DSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHP 1075
             D         R+L   +  K       D  + P    P     + AG    +   V G P
Sbjct: 17923 DP--------RVLGVPVIAK-------DLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRP 17967

Query: 1076  KPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEA 1129
             +P + W+K+   +++  +  +        L+I+  +  D G YT  A N  G A
Sbjct: 17968 RPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTA 18021



 Score = 82.8 bits (203), Expect = 2e-15
 Identities = 100/415 (24%), Positives = 149/415 (35%), Gaps = 52/415 (12%)

Query: 745   VEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTG 804
             + D+     +L W  P   G   I  Y+VE C     +WV A    V +    V  L  G
Sbjct: 12629 ISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALAS-VTKTSCRVGKLIPG 12687

Query: 805   ARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKV---------- 854
                +FRV   N  G SEP T  + V       P +   P++ R T + K           
Sbjct: 12688 QEYIFRVRAENRFGISEPLTSPKMVAQFPFGVPSE---PKNARVTKVNKDCIFVAWDRPD 12744

Query: 855   --GEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYEL 912
               G    +    + K R  ++W K    L      VR++++     V      +  EY  
Sbjct: 12745 SDGGSPIIGYLIERKERNSLLWVKANDTL------VRSTEYPCAGLV------EGLEYSF 12792

Query: 913   SVQIENM-------KDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIM 965
              +   N        K T  +  R+     PP    V +V  +   + W  PK DG S+I+
Sbjct: 12793 RIYALNKAGSSPPSKPTEYVTARM--PVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKII 12850

Query: 966   GYFVQKADKKTMEWFNVYERNRHT---SCTVSDLIVGNEYYFRVYTENICGLSDSPGVSK 1022
             GYFV+       +W               T + L    +Y FR        +S  P    
Sbjct: 12851 GYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISP-PSEPS 12909

Query: 1023  NTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWM 1082
             +   IL   +          D  +A K L       V AG +  L+  V G P P V W 
Sbjct: 12910 DPVTILAENVP------PRIDLSVAMKSLL-----TVKAGTNVCLDATVFGKPMPTVSWK 12958

Query: 1083  KNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
             K+   ++      +   + + TL +   +  D+G YT  A N  G   A  KL+V
Sbjct: 12959 KDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKV 13013



 Score = 82.8 bits (203), Expect = 2e-15
 Identities = 92/405 (22%), Positives = 156/405 (38%), Gaps = 35/405 (8%)

Query: 745   VEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTG 804
             +++V+  + T+ W PP   G   I  Y+VE     S  W   + + V R    +  L TG
Sbjct: 19124 IDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVS-QAVARTSIKIVRLTTG 19182

Query: 805   ARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQT-------YIRKVGEQ 857
             +   FRV   N  G+S  +  +  V     + P     P+ +  T       +   V + 
Sbjct: 19183 SEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDG 19242

Query: 858   LNLVVPF--QGKPRPQVVWTKGGAPLDT-SRVHVRTSDFDTVFFVRQAARSDSGEYELSV 914
              + V+ +  + K R  ++W+K    L   +++ V   D   ++  R  A + +G  + S 
Sbjct: 19243 GSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSK 19302

Query: 915   QIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADK 974
               E         +   +   PP    V  +   +  ++W  P  DG ++I GY V++ + 
Sbjct: 19303 SCEP--------VPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERREL 19354

Query: 975   KTMEWFNV-YERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGIT 1033
                 W    Y   + T   V++L     Y FRV+  N       P  S++T  I+     
Sbjct: 19355 PDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEP--SESTGPIIVKDDV 19412

Query: 1034  FKPFEYKEHDFRMAPKFLTPLIDRVVV-AGYSAALNCAVRGHPKPKVVWMKNKMEIREDP 1092
               P    +  FR          D +VV AG    +N  + G P P + W K+ +EI E  
Sbjct: 19413 EPPRVMMDVKFR----------DVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERA 19462

Query: 1093  KFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELG--EALAECKL 1135
             +  I +      L ++     D G Y     N  G       CK+
Sbjct: 19463 RTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKV 19507



 Score = 77.8 bits (190), Expect = 5e-14
 Identities = 95/402 (23%), Positives = 156/402 (38%), Gaps = 45/402 (11%)

Query: 745   VEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTG 804
             + +V+    TL W PP   G   I  Y++E        W   + E ++ C      L  G
Sbjct: 14109 ISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVS-EDIQSCRHVATKLIQG 14167

Query: 805   ARILFRVVGVNIAGRSEPATLAQPVTIREIAEPP----KIRLPRHLRQT----YIRKVGE 856
                +FRV  VN  G+ EP   ++PV + +   PP    K  +    + T    + R V +
Sbjct: 14168 NEYIFRVSAVNHYGKGEPVQ-SEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDD 14226

Query: 857   QLNLVVPF--QGKPRPQVVWTKG-GAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELS 913
               + +  +  + + +  + W +    P+   R  V      + +  R +A + +G    S
Sbjct: 14227 GGSEITGYHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPS 14286

Query: 914   VQIEN--MKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQK 971
                ++  MKD A          GPP N  V +    +A + W  P  DG  EI GY V+ 
Sbjct: 14287 EASDSVLMKDAAY-------PPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEH 14339

Query: 972   ADKKTMEWFNVYERN--RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILK 1029
                    W         R T   V DL    +Y FR+   N  G+ + P V  +   + +
Sbjct: 14340 QKVGDEAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGE-PAVIPDVEIVER 14398

Query: 1030  TGITFKPFEYKEHDFRMAPKF-LTPLIDRVVV--AGYSAALNCAVRGHPKPKVVWMKNKM 1086
                             MAP F L   + R +V  AG S  +   ++G P P+V W K+ +
Sbjct: 14399 ---------------EMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNI 14443

Query: 1087  EIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGE 1128
              ++   +  I N +    L I   + +D G +     N  G+
Sbjct: 14444 NLKN--RANIENTESFTLLIIPECNRYDTGKFVMTIENPAGK 14483



 Score = 77.4 bits (189), Expect = 7e-14
 Identities = 77/267 (28%), Positives = 117/267 (43%), Gaps = 21/267 (7%)

Query: 289  WFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAV----KDEKCFTELFVKEP 344
            W K+G  I+ S K+ F   GK R L I    L+D   Y   +    K++    +L V+E 
Sbjct: 4779 WMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEEL 4838

Query: 345  PVLIVTPLEDQQVFV-GDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKR 403
            PV  V  LE++   V G  + ++ E+++E   V+W KDG  +  +     R      G  
Sbjct: 4839 PVRFVKTLEEEVTVVKGQPLYLSCELNKE-RDVVWRKDGKIVVEK---PGRIVPGVIGLM 4894

Query: 404  HILIFSDVVQEDRGRYQV-ITNGGQCEAELIVEEKQLEVLQD-----IADLTVKASEQAV 457
              L  +D    D G Y V + N    E    V  K +EV++D     I D  VK    A+
Sbjct: 4895 RALTINDADDTDAGTYTVTVENANNLECSSCV--KVVEVIRDWLVKPIRDQHVKPKGTAI 4952

Query: 458  FKCEVSDEKVTGKWYKNGVEV--RPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGY 515
            F C+++ +    KW+K   E+   P+ +  I   G    L I +  PED  +Y    +G 
Sbjct: 4953 FACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEG- 5011

Query: 516  ALSLSAKLNFLEIKVEYVPKQEPPKIH 542
                 AKL   E +VE +   E   I+
Sbjct: 5012 -KRYPAKLTLGEREVELLKPIEDVTIY 5037



 Score = 77.4 bits (189), Expect = 7e-14
 Identities = 139/622 (22%), Positives = 222/622 (35%), Gaps = 82/622 (13%)

Query: 563   RLDVSITGEPPPVATWLKGDEVFTTTEGRTRI-----EKRVDCSSFVIESAQRED----- 612
             RLDV  T +   V  WLK D      +G +RI     E R   S F +E+   +      
Sbjct: 22179 RLDVVDTSKSSAVLAWLKPDH-----DGGSRITGYLLEMRQKGSDFWVEAGHTKQLTFTV 22233

Query: 613   -------EGRYTIKVTNPVG-----EDVASIFLQVVDVPDPPEAVRITS------VGEDW 654
                    E  + +K  N  G     E  +S+ ++   +    +   IT+       G  +
Sbjct: 22234 ERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPF 22293

Query: 655   AILVWEPPMYDGGKP---VTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEM 711
              I V   P+   G+P   VT  L E + K + R      +  T  T + +   +   Y +
Sbjct: 22294 TIDV---PI--SGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFL 22348

Query: 712   RVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGY 771
              +   N  GV   S+         P + P+   V  V+  +  L W  P   G   I  Y
Sbjct: 22349 TL--ENTAGVKTFSVTVVVIGRPGPVTGPIE--VSSVSAESCVLSWGEPKDGGGTEITNY 22404

Query: 772   LVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTI 831
             +VE    G+  W   N+  V+R    V +L       FRV   N  G S+P   A P+  
Sbjct: 22405 IVEKRESGTTAWQLVNSS-VKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESA-PIIA 22462

Query: 832   REIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPF------------QGKPRPQVVWTKGGA 879
                  PP    P      ++      +    P+            + K R  ++W K   
Sbjct: 22463 EHPFVPPSA--PTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVK--- 22517

Query: 880   PLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINV 939
                 ++V     ++     V +        Y L+    +    A+  I        P   
Sbjct: 22518 ---ENKVPCLECNYKVTGLV-EGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRP 22573

Query: 940   MVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTM---EWFNV-YERNRHTSCTVSD 995
              V +V  +   + W AP  DG S+++GY +++     +    W    Y        TV+ 
Sbjct: 22574 EVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTA 22633

Query: 996   LIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLI 1055
             L  G+ Y FRV  +N  G+     +SK +     TG      EY      +  +    L+
Sbjct: 22634 LSEGDTYEFRVLAKNAAGV-----ISKGSE---STGPVTCRDEYAPPKAELDARLHGDLV 22685

Query: 1056  DRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDA 1115
                + AG    L+ AV G P+PK++W K   E+    K  +       T  I+     D+
Sbjct: 22686 --TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDS 22743

Query: 1116  GTYTCRAVNELGEALAECKLEV 1137
             G YT    N  G       ++V
Sbjct: 22744 GKYTLTVKNASGTKAVSVMVKV 22765



 Score = 77.0 bits (188), Expect = 9e-14
 Identities = 53/204 (25%), Positives = 88/204 (43%), Gaps = 16/204 (7%)

Query: 927   IRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN 986
             ++  E+  PP  + + +V   +  + W+ P+ DG S I+GY V+   K + +W       
Sbjct: 15671 VKASERPLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATC-ATV 15729

Query: 987   RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRM 1046
             + T  T++ LI G EY FRV  +N  G+SD         R L   +  K       D  +
Sbjct: 15730 KVTEATITGLIQGEEYSFRVSAQNEKGISDP--------RQLSVPVIAK-------DLVI 15774

Query: 1047  APKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLN 1106
              P F        V+AG    ++    G P P V W K+ + +++  +    + +    L 
Sbjct: 15775 PPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLT 15834

Query: 1107  IRRPSPFDAGTYTCRAVNELGEAL 1130
             I+     D G Y  +  N  GEA+
Sbjct: 15835 IKDACREDVGHYVVKLTNSAGEAI 15858



 Score = 74.7 bits (182), Expect = 5e-13
 Identities = 97/436 (22%), Positives = 155/436 (35%), Gaps = 49/436 (11%)

Query: 713   VFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYL 772
             + A N+ G    ++  K      P   P  + +  +      L W PP   G   I  Y+
Sbjct: 12996 ITAENSSGSKSATIKLKVLDKPGP---PASVKINKMYSDRAMLSWEPPLEDGGSEITNYI 13052

Query: 773   VEYCLEGSEEWVPAN-TEPVERCGFTVKNLPTGARILFRVVGVNIAGR-----SEPATLA 826
             V+        W   + T P+  C  +V+ L  G    FR+   N  G      +EPA   
Sbjct: 13053 VDKRETSRPNWAQVSATVPITSC--SVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAK 13110

Query: 827   QPVTIREIAEPPKIR--LPRHLRQTYIRKVGEQLNLVVPF--QGKPRPQVVWTKGGAPLD 882
              P       +PP I      H+  ++     +  + +  +  + +    V WTK    ++
Sbjct: 13111 NPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTK----VN 13166

Query: 883   TSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMK--------DTATIRIRVVEKAG 934
                +  RT        ++     +  EYE  V   N            A          G
Sbjct: 13167 RKPIIERT--------LKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPG 13218

Query: 935   PPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQ--KADKKTMEWFNVYERNRHTSCT 992
             PP    V +   ++  + W  P  DG S I+GY V+  +AD       N+ +  + T   
Sbjct: 13219 PPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFE 13278

Query: 993   VSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLT 1052
             V+ L+   +Y FRVY  N  G SD   V     +     I   P    + D R       
Sbjct: 13279 VTGLMEDTQYQFRVYAVNKIGYSDPSDVPD---KHYPKDILIPPEGELDADLRKT----- 13330

Query: 1053  PLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSP 1112
                  ++ AG +  L   V+G P PK+ W K  + +R+     I +      L     + 
Sbjct: 13331 ----LILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNK 13386

Query: 1113  FDAGTYTCRAVNELGE 1128
             +DAG Y     N  G+
Sbjct: 13387 YDAGKYILTLENSCGK 13402



 Score = 73.6 bits (179), Expect = 1e-12
 Identities = 105/414 (25%), Positives = 152/414 (36%), Gaps = 56/414 (13%)

Query: 742   HLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNL 801
             +L + DV+    T+ W PP   G   I  Y++E C      W    +  V   G TV  L
Sbjct: 11930 NLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVW-STYSATVLTPGTTVTRL 11988

Query: 802   PTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLV 861
               G   +FRV   N  G   P T ++PV  +   + P    P       + KV ++   V
Sbjct: 11989 IEGNEYIFRVRAENKIGTGPP-TESKPVIAKTKYDKPGRPDPPE-----VTKVSKEEMTV 12042

Query: 862   V----PFQG-----------KPRPQVVWT---KGGAPLDTSRVHVRTSDFDTVFFVRQAA 903
             V     + G           K +    W    K   P    +V     D +  F V+   
Sbjct: 12043 VWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAEN 12102

Query: 904   RSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSE 963
                 GE  L  +    KD        +E  GPP N  V +    +  + W  P  DG + 
Sbjct: 12103 EIGIGEPSLPSRPVVAKDP-------IEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAP 12155

Query: 964   IMGYFVQK----ADKKTMEWF---NVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
             I+GY V+     AD    E +   N   +      TV+ L    EY FRV  +N  G+  
Sbjct: 12156 IIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGR 12215

Query: 1017  SPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPK 1076
                + +            KP E  E         +  L+  +V AG    L   VRG P 
Sbjct: 12216 PAELKE----------AIKPKEILEPPEIDLDASMRKLV--IVRAGCPIRLFAIVRGRPA 12263

Query: 1077  PKVVWMKNKME--IREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGE 1128
             PKV W K  ++  +R+    L+     ++  N  R    D+G Y+   VN  GE
Sbjct: 12264 PKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRD---DSGKYSLTLVNPAGE 12314



 Score = 73.6 bits (179), Expect = 1e-12
 Identities = 101/421 (23%), Positives = 155/421 (36%), Gaps = 60/421 (14%)

Query: 743   LIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLP 802
             L V  VT     L W PP + G   I  Y++E        W   +TE V+   + V  L 
Sbjct: 18437 LKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTE-VQALNYKVTKLL 18495

Query: 803   TGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPP--------KIRLPRHLRQTYIRKV 854
              G   +FRV+ VN  G  EP   + PVT     +PP               +  T+ R V
Sbjct: 18496 PGNEYIFRVMAVNKYGIGEPLE-SGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPV 18554

Query: 855   GEQLNLVVPF--QGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYEL 912
              +    +  +  + + +  V WTK      T               +R    ++   YE 
Sbjct: 18555 DDGGTEIEGYILEKRDKEGVRWTKCNKKTLTD------------LRLRVTGLTEGHSYEF 18602

Query: 913   SVQIENMKDTA-----TIRIRVVEKA---GPPINVMVKEVWGTNALVEWQAPKDDGNSEI 964
              V  EN          ++  R  +     GPP N  V +   ++  + W  P  DG + +
Sbjct: 18603 RVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPV 18662

Query: 965   MGYFVQKADKKTMEWFNVYERN--RHTSCTVSDLIVGNEYYFRVYTENICGLSDS---PG 1019
              GY V+  +    EW         +    TV+ L    EY FR+   N  G+ +    PG
Sbjct: 18663 KGYVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPG 18722

Query: 1020  VSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNC--AVRGHPKP 1077
                   RI    I        + D R           +VVV   SA L     ++G P+P
Sbjct: 18723 SVVAQERIEPPEIEL------DADLR-----------KVVVLRASATLRLFVTIKGRPEP 18765

Query: 1078  KVVWMKNKMEIREDPKFLITNYQGVLTL-NIRRPSPFDAGTYTCRAVNELGEALAECKLE 1136
             +V W K +  + +  +  +T+   +L + N+ R   FD+G Y     N  G   A   + 
Sbjct: 18766 EVKWEKAEGILTDRAQIEVTSSFTMLVIDNVTR---FDSGRYNLTLENNSGSKTAFVNVR 18822

Query: 1137  V 1137
             V
Sbjct: 18823 V 18823



 Score = 70.1 bits (170), Expect = 1e-11
 Identities = 61/232 (26%), Positives = 96/232 (41%), Gaps = 25/232 (10%)

Query: 905   SDSGEYELSVQIENM-----KDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDD 959
             S+  EY   V  EN          T  ++  E   PP ++ + ++  +   + W  PK D
Sbjct: 14560 SEGCEYFFRVMAENEYGIGEPTETTEPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKHD 14619

Query: 960   GNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPG 1019
             G S+I GY ++   K + +W ++    +   C V +L  G EY F+V   N  G S +P 
Sbjct: 14620 GGSKITGYVIEAQRKGSDQWTHI-TTVKGLECVVRNLTEGEEYTFQVMAVNSAGRS-APR 14677

Query: 1020  VSKNTARILKTGITFKPFEYKEHDFRMAPKF-LTPLIDRVVVA--GYSAALNCAVRGHPK 1076
              S+             P   KE    M P+  L  +  ++V+A  G +  +   V G PK
Sbjct: 14678 ESR-------------PVIVKEQT--MLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPK 14722

Query: 1077  PKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGE 1128
             P V W K    +++  +           LNI      D+G Y   A N +GE
Sbjct: 14723 PTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGE 14774



 Score = 69.7 bits (169), Expect = 1e-11
 Identities = 70/279 (25%), Positives = 111/279 (39%), Gaps = 31/279 (11%)

Query: 470   KWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIK 529
             KW K   E+R +  I ++    F  LV+D+V   D G YT   +    S   K  F+ ++
Sbjct: 16603 KWGKVDGEIRDAAIIDVT--SSFTSLVLDNVNRYDSGKYTLTLEN---SSGTKSAFVTVR 16657

Query: 530   VEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTE 589
             V   P    P ++L  +  T ++             VSIT EPP +    K         
Sbjct: 16658 VLDTPS---PPVNLKVTEITKDS-------------VSITWEPPLLDGGSKIKNYIVEKR 16701

Query: 590   GRTR-----IEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIF---LQVVDVPDP 641
               TR     +      +S+ I+  Q      + +   N  G  + +     ++V +VP P
Sbjct: 16702 EATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQP 16761

Query: 642   PEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYEST 701
             P  + +  V  +   L W  P +DGG  +  Y+VE + K S++W +       +     T
Sbjct: 16762 PGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVI--T 16819

Query: 702   KMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEP 740
              + +G  Y  RV AVN  G S P     P +      EP
Sbjct: 16820 NLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEP 16858



 Score = 69.3 bits (168), Expect = 2e-11
 Identities = 81/305 (26%), Positives = 128/305 (41%), Gaps = 40/305 (13%)

Query: 429   EAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISH 488
             E EL  + +++ VL+  A L +  + +   + EV  EK  G           + R  I  
Sbjct: 18734 EIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGIL---------TDRAQIEV 18784

Query: 489   VGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGK 548
                F  LVID+V   D G Y    +    +  +K  F+ ++V            LD    
Sbjct: 18785 TSSFTMLVIDNVTRFDSGRYNLTLEN---NSGSKTAFVNVRV------------LD---- 18825

Query: 549   TSENAIVVVAGNKLRLD-VSITGEPPPVATWLK-----GDEVFTTTEGRTRIEKRVDCSS 602
              S +A V +   +++ D V+++ EPP +    K      ++  TT +    I      ++
Sbjct: 18826 -SPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKTT 18884

Query: 603   FVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDV---PDPPEAVRITSVGEDWAILVW 659
             F IE+ Q      + +  +N  G  + +   + V V   P PP  V +  V  + A + W
Sbjct: 18885 FRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKW 18944

Query: 660   EPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAI 719
             E P  DGG  +TGY+VE + KGS++W         E T     +  G  Y  RV AVN  
Sbjct: 18945 EKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATISG--LTAGEEYVFRVAAVNEK 19002

Query: 720   GVSQP 724
             G S P
Sbjct: 19003 GRSDP 19007



 Score = 68.2 bits (165), Expect = 4e-11
 Identities = 79/289 (27%), Positives = 122/289 (42%), Gaps = 32/289 (11%)

Query: 340  FVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKK 399
            FVKE   +I+T  E    FVG        VS   A   WMKDG  +        ++RF  
Sbjct: 4745 FVKEIKDIILTESE----FVGSSAIFECLVSPSTAITTWMKDGSNIRE----SPKHRFIA 4796

Query: 400  DGKRHILIFSDVVQEDRGRYQVITNGGQCE----AELIVEEKQLEVLQDI-ADLTVKASE 454
            DGK   L   DV   D G Y  +   G  E    A+L+VEE  +  ++ +  ++TV   +
Sbjct: 4797 DGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQ 4856

Query: 455  QAVFKCEVSDEKVTGKWYKNG-VEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTF-VP 512
                 CE++ E+    W K+G + V    RI    +G    L I+D    D G YT  V 
Sbjct: 4857 PLYLSCELNKERDV-VWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVE 4915

Query: 513  DGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEP 572
            +   L  S+ +  +E+  +++ K  P +   D   K    AI          D++   + 
Sbjct: 4916 NANNLECSSCVKVVEVIRDWLVK--PIR---DQHVKPKGTAI-------FACDIA---KD 4960

Query: 573  PPVATWLKG-DEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKV 620
             P   W KG DE+      +T I +  +     I++A  ED   Y +++
Sbjct: 4961 TPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEI 5009



 Score = 68.2 bits (165), Expect = 4e-11
 Identities = 106/473 (22%), Positives = 165/473 (34%), Gaps = 51/473 (10%)

Query: 679   KKGSQ---RWMKLNFEVF-TETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPI 734
             KKG Q   +  ++NFE   T T     + +        + A N +G     +  +     
Sbjct: 14728 KKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIP 14787

Query: 735   APTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERC 794
              P + P+    ++V+    T  W PP   G   I  Y+VE     S  WV   T  + R 
Sbjct: 14788 GPPTGPIKF--DEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTVI-RT 14844

Query: 795   GFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKV 854
              +    L TG    FRV   N  G     T A  V       P     P+    T + K 
Sbjct: 14845 TYKATRLTTGLEYQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTPQ---VTAVTKD 14901

Query: 855   GEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFF------------VRQA 902
                ++   P           + GG+P+     HV   + + + +             + +
Sbjct: 14902 SMTISWHEPL----------SDGGSPI--LGYHVERKERNGILWQTVSKALVPGNIFKSS 14949

Query: 903   ARSDSGEYELSVQIENMKDTA-----TIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPK 957
               +D   YE  V  ENM   +     +  +  ++   PP   +   +      ++W  P+
Sbjct: 14950 GLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKWAKPE 15009

Query: 958   DDGNSEIMGYFVQKADKKTMEWFNVYERN-RHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
               G  +I  Y V+K D     W      N      TVS L     Y FRV  +N  G   
Sbjct: 15010 YTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAIS 15069

Query: 1017  SPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPK 1076
              P    +        IT +  + +    ++  KF   +I   + AG +  L   V G P 
Sbjct: 15070 PPSEPSDA-------ITCRD-DVEAPKIKVDVKFKDTVI---LKAGEAFRLEADVSGRPP 15118

Query: 1077  PKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEA 1129
             P + W K+  E+    K  I        L  +  +  D+G YT  A N  G A
Sbjct: 15119 PTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFA 15171



 Score = 67.0 bits (162), Expect = 1e-10
 Identities = 58/205 (28%), Positives = 84/205 (40%), Gaps = 19/205 (9%)

Query: 936   PINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHT-SCTVS 994
             P ++ VKEV      + W  PK DG SEI+ Y ++     T ++  V   N  +   TV 
Sbjct: 10348 PEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVK 10407

Query: 995   DLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFL-TP 1053
              L  G+ Y +RV   NI G               K     KP   K+    +AP  L   
Sbjct: 10408 GLKEGDTYEYRVSAVNIVGQG-------------KPSFCTKPITCKDE---LAPPTLHLD 10451

Query: 1054  LIDRVVV-AGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSP 1112
               D++ +  G + AL     G PKPKV W K++ ++ ED +  I      L L   +   
Sbjct: 10452 FRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKR 10511

Query: 1113  FDAGTYTCRAVNELGEALAECKLEV 1137
              D+G Y     N  G     C++ V
Sbjct: 10512 SDSGKYCVVVENSTGSRKGFCQVNV 10536



 Score = 65.9 bits (159), Expect = 2e-10
 Identities = 242/1196 (20%), Positives = 419/1196 (35%), Gaps = 189/1196 (15%)

Query: 41   EDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKS 100
            E+Q+   E     F+ KP    +  G   V   +V G     KP + W K      G   
Sbjct: 1025 EEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNP---KPHVYWKKS-----GVPL 1076

Query: 101  GARFSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDA 160
               + +K S+N  +     +L I      D G Y + V+ K    S   ++  EA  +  
Sbjct: 1077 TTGYRYKVSYNKQTG--ECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELL 1134

Query: 161  SGQSLESFKRTS-------EKKSDTAGELDFSGLLKKREVVEEE-KKKKKKDDDDLGIPP 212
                 E   +T         K  +TA    +S   K+ E  +   +KK  KD   +    
Sbjct: 1135 MKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYV 1194

Query: 213  EIWEL-LKGAKKSEYEKIAFQYGITDLRGMLKR--LKKAKVEVKKSAAFTKKLDPA---Y 266
            E  E  +   ++   ++I ++   T L  +L+    +K  V++ +S A     D     Y
Sbjct: 1195 EDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNY 1254

Query: 267  QVDRGNKIKLMVEISDPDLT-LKWFKNGQEIKPSSKYVFENVGKKRI-LTINKCTLADDA 324
            ++  G  +    ++S   L  + W+K+G+ IK   +Y  + +   R  L I      D+ 
Sbjct: 1255 RILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEG 1314

Query: 325  AYEVAVKDEK----CFTELFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMK 380
             Y     + K    C  +L+V EP   +  P     +    R+      S   + +    
Sbjct: 1315 IYTAFASNIKGNAICSGKLYV-EPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSP 1373

Query: 381  DGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLE 440
              +   R    +        G+R        ++E                    +E QLE
Sbjct: 1374 ARMSPARMSPARMSPARMSPGRR--------LEE-------------------TDESQLE 1406

Query: 441  VLQDIADLTVKASEQAVFKCEVS-----DEKVTGK------WYKNGVEVRP--SKRITIS 487
             L       V   +   FKC        D KV G+      W+ +G ++    + ++ I 
Sbjct: 1407 RLYK----PVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIK 1462

Query: 488  HVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSG 547
              G    L+I    P D G++T V    A   S  +    + VE V  Q  P        
Sbjct: 1463 EDGT-QSLIIVPATPSDSGEWTVVAQNRAGRSSISVI---LTVEAVEHQVKPMFVEKLKN 1518

Query: 548  KTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTE-GRTRIEKRVDCSSFVIE 606
                  + +  G++L + V  TG P P   WLK  ++    +  + RIE     ++  I+
Sbjct: 1519 ------VNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKID 1572

Query: 607  SAQREDEGRYTIKVTNPVGEDVASIFLQV-VDVPDP-PEAVRITSVGEDWAILVWEPPMY 664
            S   +D   YT    N  G D     + V V+  +P PE   I   G   A  +  P + 
Sbjct: 1573 STVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPEL- 1631

Query: 665  DGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQP 724
               +P+        + G ++W                   EG LY+              
Sbjct: 1632 ---EPL------HLRYGQEQWE------------------EGDLYDKEKQQKPFFKKKLT 1664

Query: 725  SMNTKPFMP------IAPTSEPLHLI--VEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
            S+  K F P      + P  +P  ++  + D        + R  N  G   +D Y V Y 
Sbjct: 1665 SLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLD-YGVAYS 1723

Query: 777  LE------------GSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPAT 824
             +            G++          E+       LP G + L R+  +      E A 
Sbjct: 1724 RDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAH-EGAL 1782

Query: 825  LAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTS 884
                   +E  +P  +  P  +R       GE         G P+P+V W   G  +  S
Sbjct: 1783 TGVTTDQKEKQKPDIVLYPEPVRVL----EGETARFRCRVTGYPQPKVNWYLNGQLIRKS 1838

Query: 885  R--------VH----VRTSDFDTVFFVRQAARSDSG--EYELSVQIENMKDTATIRIRV- 929
            +        +H    V    +DT   V+  A +  G  E+++ ++I+  +D  ++  R  
Sbjct: 1839 KRFRVRYDGIHYLDIVDCKSYDT-GEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAP 1897

Query: 930  -----------------VEKAGPPINVM----VKEVWGTNALVEWQAPKDDGNSEIMGYF 968
                             V+K   P++      V ++     +   + P++  + E+   F
Sbjct: 1898 EPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEE--SEELRSKF 1955

Query: 969  VQKADKKTMEWFNVYE-RNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARI 1027
             ++ ++   E     E ++R    +  +L+   +     +T+ +     +    K  A  
Sbjct: 1956 KRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKEL-----TEEEKKALAEE 2010

Query: 1028 LKTGI-TFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKM 1086
             K  I TFKP + +      APK    +  + V  G  A     V G P P+  W KN +
Sbjct: 2011 GKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGV 2070

Query: 1087 EI-REDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVRVPQ 1141
            +I R D  +       V  L IR  +  D+ +   +A+N  GE  +   L V+  Q
Sbjct: 2071 KIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQ 2126



 Score = 65.9 bits (159), Expect = 2e-10
 Identities = 95/416 (22%), Positives = 157/416 (37%), Gaps = 83/416 (19%)

Query: 267  QVDRGNKIKLMVEISD-PDLTLKWFKNGQEIKPSSKYVF---ENVGKKRILTINKCTLAD 322
            +V  G  ++    +S  P   ++WF N Q I P+   VF   E+ G   +L ++      
Sbjct: 3429 RVHNGETVRFHARVSGIPKPEIQWFHNQQLILPTKDVVFHFEESTGMALMLIVD------ 3482

Query: 323  DAAYEVAVKDEKCFTELFVKEPP---VLIVTPLEDQQVFVGDRVEMAVEVS--------- 370
              AY        C       E      L VTP   + + + +R+E  +E+          
Sbjct: 3483 --AYSEHAGQYSCKAANSAGEATCAATLTVTPKAPESI-LHERIEQEIEMEMKEFSSSFL 3539

Query: 371  ---EEGA-----QVMWMKDGVELTREDS-FKARYRFKKDGKRHILIFSDVVQEDRGRYQV 421
               EEG      Q+  + + +EL  E   +  ++  +K+G   I I  +V   D      
Sbjct: 3540 SAEEEGLHSAELQLSKINETLELLSESPVYPTKFDSEKEGTGPIFI-KEVSNAD------ 3592

Query: 422  ITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPS 481
            I+ G                  D+A L+V           +   K   +W+ NGV + PS
Sbjct: 3593 ISMG------------------DVATLSVTV---------IGIPKPKIQWFFNGVLLTPS 3625

Query: 482  KRITISHVGRFHKLVIDDVRPEDEGDYT-FVPDGYALSLSA---KLN-----FLEIKVEY 532
                    G  H L+I   + EDEG+YT    + Y  ++ +   K+N       + + E 
Sbjct: 3626 ADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETES 3685

Query: 533  VPKQEPPKIHLDCSGKTSENA--IVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEG 590
               +   K+   C     +    I    G     + ++ GEP P  TW K ++   T+  
Sbjct: 3686 AVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVY 3745

Query: 591  RTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVAS----IFLQVVDVPDPP 642
             T I       +F++   QRED G Y  K  N +GE   +    + L+  D+ D P
Sbjct: 3746 YTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLLEDTDMTDTP 3801



 Score = 65.9 bits (159), Expect = 2e-10
 Identities = 51/203 (25%), Positives = 82/203 (40%), Gaps = 17/203 (8%)

Query: 927   IRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERN 986
             I   E+  PP  + V +   ++A++ W  P  DG S I GY ++   K +  W       
Sbjct: 22168 IVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEA-GHT 22226

Query: 987   RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRM 1046
             +  + TV  L+   EY FRV  +N  G S+                 F     KE     
Sbjct: 22227 KQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREA-------------FSSVIIKEPQIEP 22273

Query: 1047  APKFLTPLIDRVVV--AGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLT 1104
                 LT + ++++   AG    ++  + G P PKV W   +M ++E  +  IT  +   T
Sbjct: 22274 TAD-LTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTT 22332

Query: 1105  LNIRRPSPFDAGTYTCRAVNELG 1127
             L ++     D+G Y     N  G
Sbjct: 22333 LTVKDSMRGDSGRYFLTLENTAG 22355



 Score = 65.5 bits (158), Expect = 3e-10
 Identities = 33/94 (35%), Positives = 46/94 (48%)

Query: 1048 PKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNI 1107
            P  ++ L +  V+ G S  L C + G+P P V W +   +I     F IT   G+  L I
Sbjct: 897  PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMI 956

Query: 1108 RRPSPFDAGTYTCRAVNELGEALAECKLEVRVPQ 1141
            R     D+G +TC AVNE G     C L V+V +
Sbjct: 957  REAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSE 990



 Score = 65.5 bits (158), Expect = 3e-10
 Identities = 55/219 (25%), Positives = 95/219 (43%), Gaps = 18/219 (8%)

Query: 922   TATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFN 981
             T  + I  +++ G P N+ + +   T   ++W+ P  DG S  + Y V++  K + +W  
Sbjct: 11718 TPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWER 11777

Query: 982   VYERNRHTSCTVSDLIVGNEYY-FRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYK 1040
             V++ +   +  + D  V N+ Y FRV T+N  G SD     K    ++K  +     + K
Sbjct: 11778 VHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDWV---KTEEVVVKEDLQKPVLDLK 11834

Query: 1041  EHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNK--MEIREDPKFLITN 1098
                       L+ ++   V AG +  L   VRG P P+V W K+K   ++   P+  I  
Sbjct: 11835 ----------LSGVL--TVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDT 11882

Query: 1099  YQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
                    ++ +    D G Y   A N  G  +A   + V
Sbjct: 11883 RADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNV 11921



 Score = 65.1 bits (157), Expect = 4e-10
 Identities = 75/317 (23%), Positives = 124/317 (39%), Gaps = 50/317 (15%)

Query: 269   DRGNKIKLMVEISDPDLTLK--WFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
             + G  +K + +I + D + +  W+   ++++ S KY         IL +   T  DD  Y
Sbjct: 25208 EEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTY 25267

Query: 327   EVAV----KDEKCFTELFVK---------------------------EPPVLIVTPLEDQ 355
                V     ++  + ELFVK                           E P     PL ++
Sbjct: 25268 RCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNK 25327

Query: 356   QVFVGDRVEMAVEVS-EEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQE 414
               +VG+ V   V ++      V W K G ++   D+ K +Y F+ D   + L  + V  +
Sbjct: 25328 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDK-KYTFESDKGLYQLTINSVTTD 25386

Query: 415   DRGRYQVITNG----GQCEAELIV------EEKQLEVL--QDIADLTVKASEQAVFKCEV 462
             D   Y V+         C+A+L V       +  L  +  + +A+   +  +   F+  V
Sbjct: 25387 DDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRV 25446

Query: 463   SD-EKVTGKWYKNGVEVRPSKRITISHVG-RFHKLVIDDVRPEDEGDYTFVPDGYALSLS 520
             S     T KW K+G  +     I I H G  ++ L I D  PED G Y       A S S
Sbjct: 25447 SGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTS 25506

Query: 521   AKLNFLEIKVEYVPKQE 537
              + +    ++ Y  KQE
Sbjct: 25507 CQAHLQVERLRY-KKQE 25522



 Score = 60.5 bits (145), Expect = 9e-09
 Identities = 50/196 (25%), Positives = 78/196 (39%), Gaps = 19/196 (9%)

Query: 936   PINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYE-RNRHTSCTVS 994
             P  + V +V  +   + W+ P  DG S + GY ++     T  W  V   +      TV+
Sbjct: 23266 PAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVT 23325

Query: 995   DLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKF-LTP 1053
              L  G +Y FR+  +N  G+S+         R   T +T +       D R+ P   L+ 
Sbjct: 23326 SLNEGEQYLFRIRAQNEKGVSEP--------RETVTAVTVQ-------DLRVLPTIDLST 23370

Query: 1054  LIDRV--VVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPS 1111
             +  +   V AG    L   + G P P   W     ++RE  +  +  +  V  L IR  +
Sbjct: 23371 MPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETT 23430

Query: 1112  PFDAGTYTCRAVNELG 1127
               D G YT    N  G
Sbjct: 23431 IRDTGEYTLELKNVTG 23446



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 69/295 (23%), Positives = 117/295 (39%), Gaps = 27/295 (9%)

Query: 348   IVTPLEDQQVFVGDRVEMAVEV-SEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHIL 406
             I   +   +V  G      + V S+  A+V W  +GVEL  ++S K  Y     G   + 
Sbjct: 26004 ITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVEL--QESSKIHYT-NTSGVLTLE 26060

Query: 407   IFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEK 466
             I  D   +D G Y+ +    + EA             D A L V   +   +  +  DE+
Sbjct: 26061 IL-DCHTDDSGTYRAVCTNYKGEAS------------DYATLDVTGGDYTTYASQRRDEE 26107

Query: 467   VTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDG---YALSLSAKL 523
             V    +    E+  ++   +S   +  ++       E +   T   +    Y  S SA++
Sbjct: 26108 VPRSVFP---ELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEM 26164

Query: 524   NFLEIKVEYVP-KQEPPKIHLDCSGK--TSENAIVVVAGNKLRLDVSITGEPPPVATWLK 580
                 ++ + +  K    KI    + +  T   ++ V  G   R      GEP P  TWL+
Sbjct: 26165 KSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLR 26224

Query: 581   GDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQV 635
               +V +T+  R ++      S+F I S Q  DEG Y++ V N  G+  A   L +
Sbjct: 26225 KGQVLSTS-ARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTI 26278



 Score = 59.3 bits (142), Expect = 2e-08
 Identities = 58/222 (26%), Positives = 88/222 (39%), Gaps = 31/222 (13%)

Query: 439  LEVLQDIADLTVKASE----QAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHK 494
            L+ +++I D+ +  SE     A+F+C VS       W K+G  +R S +      G+  K
Sbjct: 4743 LKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRK 4802

Query: 495  LVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAI 554
            L I DV+  D G+YT V     L    K +  ++ VE +P +           KT E  +
Sbjct: 4803 LHIIDVQLSDAGEYTCV---LRLGNKEKTSTAKLVVEELPVR---------FVKTLEEEV 4850

Query: 555  VVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEG 614
             VV G  L L   +  E   V  W K  ++     GR          +  I  A   D G
Sbjct: 4851 TVVKGQPLYLSCELNKERDVV--WRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAG 4908

Query: 615  RYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAI 656
             YT+ V N    + +S              V++  V  DW +
Sbjct: 4909 TYTVTVENANNLECSS-------------CVKVVEVIRDWLV 4937



 Score = 59.3 bits (142), Expect = 2e-08
 Identities = 118/608 (19%), Positives = 216/608 (35%), Gaps = 90/608 (14%)

Query: 6     PAAKKAPKGKDAPKGAPKEAPPKEAPAEAPKEAPPEDQSPTAEEPT------GVFLKKPD 59
             P   K+P+    P+    EA       ++P+ + P+  SPT  +PT       + +  P 
Sbjct: 26291 PPRVKSPE----PRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPP 26346

Query: 60    SVS----VETGKDAVVVAKVNGKELPDKPTIKWFK-GKWLELGSKSGARFSFKESHNSAS 114
              ++     E  K+   +  V    +     + W+K GK L    K    F F   H SA 
Sbjct: 26347 KITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKL----KENGHFQF---HYSAD 26399

Query: 115   NVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEA-----PRQDASGQSLESFK 169
               Y  EL I  +   D+G Y  E+  +            +A      +     ++ +S +
Sbjct: 26400 GTY--ELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQ 26457

Query: 170   RTSEKKSDTAGELDFSGLLKKREVVEEEKKKKKKDDDDLG----------IPPEIWELLK 219
             +T+E       E      +  + V+    +      D +            P  IW    
Sbjct: 26458 KTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIW---- 26513

Query: 220   GAKKSEYEKIAFQYGITDLRGMLKRLKKAKVEVKKSAAFTKKL-DPAYQVDRGNKIKLMV 278
               K  +      +Y +++ +G    L+  K +   S  +T  + + A  V    K+ +  
Sbjct: 26514 -TKDGKAITQGGKYKLSEDKGGF-FLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKA 26571

Query: 279   EISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTE 338
              I D +      +   EI P  K V +    ++ L   +  +++  + E     E+    
Sbjct: 26572 -IKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKV 26630

Query: 339   LFVKEPPVLIVTPLE---------------------------DQQVFVGDRVEMAVEVSE 371
             L  +E      T LE                             Q+ + +   + ++ + 
Sbjct: 26631 LISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANI 26690

Query: 372   EGA-QVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVI--TNGG-- 426
              GA  V W+ +GVELT  +     YR+   G    L        D G    I  T  G  
Sbjct: 26691 AGATDVKWVLNGVELTNSE----EYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIV 26746

Query: 427   QCEAELIVEEKQLEV---LQDIADLTVKASEQAVFKCEVSDEKVTG-KWYKNGVEVRPSK 482
             +C+ +L + ++  +    +       +   +  +F CE+S E     +W+KN + +  S 
Sbjct: 26747 KCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISS 26806

Query: 483   RITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIH 542
              ++IS     + L I +    D G YT     +    SA  + + + +   P +E   + 
Sbjct: 26807 NVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSRE---VV 26863

Query: 543   LDCSGKTS 550
             L  SG TS
Sbjct: 26864 LRTSGDTS 26871



 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 34/133 (25%), Positives = 59/133 (44%), Gaps = 12/133 (9%)

Query: 605   IESAQREDEGRYTIKVTNPVGEDVAS------IFLQVVDVPDPPEAVRITSVGEDWAILV 658
             +++   + E ++ +K  N +G    S      +    ++ P PP   R+    +    L 
Sbjct: 12085 VQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTKHSITLG 12144

Query: 659   WEPPMYDGGKPVTGYLVERKKK-----GSQRWMKLNFEV-FTETTYESTKMIEGILYEMR 712
             W  P+YDGG P+ GY+VE + K       + W + N         +  T + E   YE R
Sbjct: 12145 WGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFR 12204

Query: 713   VFAVNAIGVSQPS 725
             V A N +G+ +P+
Sbjct: 12205 VCAQNQVGIGRPA 12217



 Score = 56.2 bits (134), Expect = 2e-07
 Identities = 50/208 (24%), Positives = 85/208 (40%), Gaps = 25/208 (12%)

Query: 935   PPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQ-KADKKTMEWFNVYERNRHTSCTV 993
             PP  + V E+   +A + W  P  DG ++I GY    + +++  + +  Y   +  S  V
Sbjct: 12429 PPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYSVVKDLSLVV 12488

Query: 994   SDLIVGNEYYFRVYTENICGLS---DSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKF 1050
             + L  G +Y FRV   N  G+S   ++ GV                  Y+  +  + PK 
Sbjct: 12489 TGLKEGKKYKFRVAARNAVGVSLPREAEGV------------------YEAKEQLLPPKI 12530

Query: 1051  LTPLIDRVVV-AGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRR 1109
             L P  +++ + AG    +   V G P P   W K + E+       +        L I+ 
Sbjct: 12531 LMP--EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKD 12588

Query: 1110  PSPFDAGTYTCRAVNELGEALAECKLEV 1137
              +  D+G Y+  A N  G    + K+ V
Sbjct: 12589 VTRKDSGYYSLTAENSSGTDTQKIKVVV 12616



 Score = 55.1 bits (131), Expect = 4e-07
 Identities = 53/239 (22%), Positives = 92/239 (38%), Gaps = 24/239 (10%)

Query: 907  SGEYELSVQIENMKDTATIRIR-----VVEKAGPPINVMVKEVWGTNALVEWQAPKDDGN 961
            S E E S      ++ AT++I+     ++++ GP I+  + +       +          
Sbjct: 4335 SEEKEESSSESGTEEVATVKIQEAEGGLIKEDGPMIHTPLVDTVSEEGDIVHLTTSITNA 4394

Query: 962  SEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVS 1021
             E+  YF  K      ++  + ++N +T   V D +   ++      E +C   +  G +
Sbjct: 4395 KEVNWYFENKLVPSDEKFKCLQDQNTYT--LVIDKVNTEDHQ----GEYVCEALNDSGKT 4448

Query: 1022 KNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVW 1081
              +A++                 R AP     +    V  G+ A   C ++  P  +  W
Sbjct: 4449 ATSAKLTVVK-------------RAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQW 4495

Query: 1082 MKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVRVP 1140
             K   EI E  K  I + + + +L I R    D G YTC+A NE G       L V VP
Sbjct: 4496 FKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTVP 4554



 Score = 55.1 bits (131), Expect = 4e-07
 Identities = 59/225 (26%), Positives = 87/225 (38%), Gaps = 30/225 (13%)

Query: 927  IRVVEKAGPPIN---VMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVY 983
            I  V+  GPP +   +   E   +   ++W+ P+ +G S I GY ++K      ++  V 
Sbjct: 8914 ILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVN 8973

Query: 984  ERN-RHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEH 1042
            +R    TS  V +L     Y FRV   N  G S+ P +               P      
Sbjct: 8974 KRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESE-PSL---------------PLNVVIQ 9017

Query: 1043 DFRMAPKFLTPLIDR----VVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFL--- 1095
            D  + P     L  R     V AG    +   V G P PK+ W KN+  I +    L   
Sbjct: 9018 DDEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQIT 9077

Query: 1096 ---ITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
               ++  +    L+I +    D GTYT  A N LG       +EV
Sbjct: 9078 KEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEV 9122



 Score = 55.1 bits (131), Expect = 4e-07
 Identities = 72/327 (22%), Positives = 125/327 (38%), Gaps = 24/327 (7%)

Query: 518   SLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVAT 577
             +L  +  + EI     PK + P I      +   N  V    N   L   +TG P P+  
Sbjct: 24531 NLGGESEWSEISEPITPKSDVP-IQAPHFKEELRNLNVRYQSNAT-LVCKVTGHPKPIVK 24588

Query: 578   WLKGDEVFTTTEGRTRIEK-RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQV- 635
             W +  +       + RI++ +      +I S   +D   Y ++ TN  G    +  L+V 
Sbjct: 24589 WYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVE 24648

Query: 636   ----VDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFE 691
                 + +P   E +          + +  P     GKP    ++  +K         +++
Sbjct: 24649 VPAKIHLPKTLEGMGAVHALRGEVVSIKIP---FSGKPDP--VITWQKGQDLIDNNGHYQ 24703

Query: 692   VFTETTYESTKMIEGILYEMRVFAV----NAIGVSQPSMNTKPFMPIAPTSEPLHLI-VE 746
             V    ++ S     G+  +   F V    N  G+ Q ++     + +A   +P   + V 
Sbjct: 24704 VIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVE----LDVADVPDPPRGVKVS 24759

Query: 747   DVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGAR 806
             DV+  +  L W  P   G   I  Y+VE C   +E W+        R  +TV NL     
Sbjct: 24760 DVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQARETR--YTVINLFGKTS 24817

Query: 807   ILFRVVGVNIAGRSEPATLAQPVTIRE 833
               FRV+  N  G S+P+  ++P   +E
Sbjct: 24818 YQFRVIAENKFGLSKPSEPSEPTITKE 24844



 Score = 51.2 bits (121), Expect = 5e-06
 Identities = 68/310 (21%), Positives = 115/310 (37%), Gaps = 56/310 (18%)

Query: 367   VEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQ--VITN 424
             +E  ++  QV W     +L   + ++  Y   +DG   IL   D+ + D G Y+  V+ +
Sbjct: 25219 IENYDQSTQVTWYFGVRQLENSEKYEITY---EDGVA-ILYVKDITKLDDGTYRCKVVND 25274

Query: 425   GGQCE--AELIVE---------------------------EKQLEVLQDIADLTVKASEQ 455
              G+    AEL V+                           E+  E    + + T    E 
Sbjct: 25275 YGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGEN 25334

Query: 456   AVFKCEVS---DEKVTGKWYKNGVEVRPS---KRITISHVGRFHKLVIDDVRPEDEGDYT 509
               F   ++   +  VT  WYK+G +++P    K+ T       ++L I+ V  +D+ +YT
Sbjct: 25335 VRFGVTITVHPEPHVT--WYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYT 25392

Query: 510   FVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVA----GNKLRLD 565
              V        S K          V    PP    D + +     ++  A    G  +  +
Sbjct: 25393 VVARNKYGEDSCKAKLT------VTLHPPPT---DSTLRPMFKRLLANAECQEGQSVCFE 25443

Query: 566   VSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVG 625
             + ++G PPP   W K  +  +       I + +D  +  I     ED G Y +  TN  G
Sbjct: 25444 IRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAG 25503

Query: 626   EDVASIFLQV 635
                    LQV
Sbjct: 25504 STSCQAHLQV 25513



 Score = 49.3 bits (116), Expect = 2e-05
 Identities = 49/204 (24%), Positives = 86/204 (42%), Gaps = 17/204 (8%)

Query: 443 QDIADLTVKASEQAVFKCEVSDEKVTG-KWYKNGVEVRPSKR--ITISHVGRFHKLVIDD 499
           Q +  + V     A F+  +S   V    W+++G  +  S    + IS      KL I  
Sbjct: 10  QPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPA 69

Query: 500 VRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAG 559
           V   + G Y+      +   ++    L +K E  P     ++           ++ V  G
Sbjct: 70  VTKANSGRYSLKATNGSGQATSTAELL-VKAETAPPNFVQRLQ----------SMTVRQG 118

Query: 560 NKLRLDVSITGEPPPVATWLK-GDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTI 618
           +++RL V +TG P PV  + + G E+ ++ +   +I +  D  S +I  A  ED G Y++
Sbjct: 119 SQVRLQVRVTGIPTPVVKFYRDGAEIQSSLD--FQISQEGDLYSLLIAEAYPEDSGTYSV 176

Query: 619 KVTNPVGEDVASIFLQVVDVPDPP 642
             TN VG   ++  L V    + P
Sbjct: 177 NATNSVGRATSTAELLVQGEEEVP 200



 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 46/167 (27%), Positives = 77/167 (46%), Gaps = 10/167 (5%)

Query: 351 PLEDQQVFVGDRVEMAVEVSEEGA-QVMWMKDGVELTREDSFKARYRFKKDGKRHILIFS 409
           PL+   V  G        +S     +V W +DG  ++       +  F  DG+  + I +
Sbjct: 11  PLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFS-DGRAKLTIPA 69

Query: 410 DVVQEDRGRYQV-ITNG-GQCE--AELIVEEKQL--EVLQDIADLTVKASEQAVFKCEVS 463
            V + + GRY +  TNG GQ    AEL+V+ +      +Q +  +TV+   Q   +  V+
Sbjct: 70  -VTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVT 128

Query: 464 DEKV-TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYT 509
                  K+Y++G E++ S    IS  G  + L+I +  PED G Y+
Sbjct: 129 GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYS 175



 Score = 48.5 bits (114), Expect = 4e-05
 Identities = 29/94 (30%), Positives = 40/94 (42%)

Query: 1048 PKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNI 1107
            P+ L  L    V +G  A     + G P+PK+ W K +  +    K    +     TL +
Sbjct: 3193 PQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLL 3252

Query: 1108 RRPSPFDAGTYTCRAVNELGEALAECKLEVRVPQ 1141
                P DA  YTC A N+ G A     L V VP+
Sbjct: 3253 IEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPE 3286



 Score = 48.5 bits (114), Expect = 4e-05
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 3/93 (3%)

Query: 1048  PKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIR---EDPKFLITNYQGVLT 1104
             P+F  PL ++    G +      +  HP+P V W K+  +I+    D K+   + +G+  
Sbjct: 25318 PEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQ 25377

Query: 1105  LNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
             L I   +  D   YT  A N+ GE   + KL V
Sbjct: 25378 LTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 25410



 Score = 48.5 bits (114), Expect = 4e-05
 Identities = 76/332 (22%), Positives = 117/332 (35%), Gaps = 51/332 (15%)

Query: 243   KRLKKAKVEVKKSAAFTKKLDP-------AYQVDRGNKIKLMVEI-SDPDLTLKWFKNGQ 294
             ++  + K EV     FT    P       +++V  G   + ++ + S P   +KW+ NG 
Sbjct: 25981 QKTSERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGV 26040

Query: 295   EIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTPLED 354
             E++ SSK  + N      L I  C   D   Y     + K     +      L VT    
Sbjct: 26041 ELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYA----TLDVTG--- 26093

Query: 355   QQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGK-------RHILI 407
                  GD    A +  +E           ELTR +++ A   FKK  +       R +  
Sbjct: 26094 -----GDYTTYASQRRDEEVPRSVFP---ELTRTEAY-AVSSFKKTSEMEASSSVREVKS 26144

Query: 408   FSDVVQEDRGRYQVITNGGQCEAELIVEEKQLE---------------VLQDIADLTVKA 452
                  +E    Y+   +     A L  EEK LE               +L     +TV  
Sbjct: 26145 QMTETRESLSSYEHSASAEMKSAAL--EEKSLEEKSTTRKIKTTLAARILTKPRSMTVYE 26202

Query: 453   SEQAVFKCEVSDEKV-TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFV 511
              E A F C+   E V T  W + G  +  S R  ++         I  V+  DEG+Y+ V
Sbjct: 26203 GESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVV 26262

Query: 512   PDGYALSLSAKLNFLEIKVEYVPK--QEPPKI 541
              +       A+      K     K    PP++
Sbjct: 26263 VENSEGKQEAEFTLTIQKARVTEKAVTSPPRV 26294



 Score = 47.8 bits (112), Expect = 6e-05
 Identities = 29/90 (32%), Positives = 39/90 (43%), Gaps = 1/90 (1%)

Query: 1048 PKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNI 1107
            P  +TPL D V   G  A   C V G    KV W     +I+    F +T ++    L I
Sbjct: 3299 PAIITPLQDTVTSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQLEI 3357

Query: 1108 RRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
                P D GTYT  A N +G+  +   L +
Sbjct: 3358 AEAYPEDEGTYTFVASNAVGQVSSTANLSL 3387



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 30/101 (29%), Positives = 43/101 (42%), Gaps = 2/101 (1%)

Query: 1039 YKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEI--REDPKFLI 1096
            +K+      P F+ PL    V  G +   +  V G PKP++ W  N+  I   +D  F  
Sbjct: 3410 FKKEPLGQKPSFIQPLSSLRVHNGETVRFHARVSGIPKPEIQWFHNQQLILPTKDVVFHF 3469

Query: 1097 TNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
                G+  + I       AG Y+C+A N  GEA     L V
Sbjct: 3470 EESTGMALMLIVDAYSEHAGQYSCKAANSAGEATCAATLTV 3510



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 30/91 (32%), Positives = 40/91 (43%)

Query: 1047  APKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLN 1106
             AP+    +    V  G +      V+  P  +V W  N +E++E  K   TN  GVLTL 
Sbjct: 26001 APRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLE 26060

Query: 1107  IRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
             I      D+GTY     N  GEA     L+V
Sbjct: 26061 ILDCHTDDSGTYRAVCTNYKGEASDYATLDV 26091



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 47/176 (26%), Positives = 78/176 (44%), Gaps = 12/176 (6%)

Query: 341  VKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKD 400
            +KE   +I TPL D     GD V +   ++    +V W  +   +  ++ FK      +D
Sbjct: 4363 IKEDGPMIHTPLVDTVSEEGDIVHLTTSITN-AKEVNWYFENKLVPSDEKFKCL----QD 4417

Query: 401  GKRHILIFSDVVQED-RGRY--QVITNGGQC--EAELIVEEKQLEVLQ-DIADLTVKASE 454
               + L+   V  ED +G Y  + + + G+    A+L V ++   V++  I  L V    
Sbjct: 4418 QNTYTLVIDKVNTEDHQGEYVCEALNDSGKTATSAKLTVVKRAAPVIKRKIEPLEVALGH 4477

Query: 455  QAVFKCEV-SDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYT 509
             A F CE+ S   V  +W+K G E+  S + +I        L I   +  D G+YT
Sbjct: 4478 LAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYT 4533



 Score = 45.4 bits (106), Expect = 3e-04
 Identities = 34/93 (36%), Positives = 43/93 (46%), Gaps = 3/93 (3%)

Query: 1032 ITFKPFEYKEHDFRMAP--KFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIR 1089
            +T K F+   + F   P  +F  PL D+ V  G +A L C V      KV W KN  EI 
Sbjct: 5895 LTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEV-SRENAKVKWFKNGTEIL 5953

Query: 1090 EDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRA 1122
            +  K+ I     V  L I   +P D  TYTC A
Sbjct: 5954 KSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDA 5986



 Score = 44.7 bits (104), Expect = 5e-04
 Identities = 48/210 (22%), Positives = 76/210 (36%), Gaps = 28/210 (13%)

Query: 457   VFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTF-VPDGY 515
             V K E  D+     WY    ++  S++  I++      L + D+   D+G Y   V + Y
Sbjct: 25216 VCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDY 25275

Query: 516   ALSLSAKLNFL----EIKVEYVPK---------------QEPPKIHLDCSGKTSENAIVV 556
                 S    F+    E+   Y  +               + PP+  L    KT+      
Sbjct: 25276 GEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTA------ 25329

Query: 557   VAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSF--VIESAQREDEG 614
               G  +R  V+IT  P P  TW K  +     +   +     D   +   I S   +D+ 
Sbjct: 25330 YVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDA 25389

Query: 615   RYTIKVTNPVGEDVASIFLQVVDVPDPPEA 644
              YT+   N  GED     L V   P P ++
Sbjct: 25390 EYTVVARNKYGEDSCKAKLTVTLHPPPTDS 25419



 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 28/91 (30%), Positives = 42/91 (46%)

Query: 1048 PKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNI 1107
            P F+  L    V  G    L   V G P P V + ++  EI+    F I+    + +L I
Sbjct: 104  PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLI 163

Query: 1108 RRPSPFDAGTYTCRAVNELGEALAECKLEVR 1138
                P D+GTY+  A N +G A +  +L V+
Sbjct: 164  AEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 29/91 (31%), Positives = 38/91 (41%), Gaps = 1/91 (1%)

Query: 1048 PKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKF-LITNYQGVLTLN 1106
            P FL  L       G  A     V G P P V W K   ++     + +I N  G  T  
Sbjct: 3700 PHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFI 3759

Query: 1107 IRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
            +  P   D+G Y C+A N LGE+    +L V
Sbjct: 3760 VNDPQREDSGLYICKAENMLGESTCAAELLV 3790



 Score = 43.1 bits (100), Expect = 0.001
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 2/94 (2%)

Query: 1047 APKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIRED--PKFLITNYQGVLT 1104
            AP F  PL   VV+ G +A     + G P P+V W ++   I     P   I+   G   
Sbjct: 5    APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK 64

Query: 1105 LNIRRPSPFDAGTYTCRAVNELGEALAECKLEVR 1138
            L I   +  ++G Y+ +A N  G+A +  +L V+
Sbjct: 65   LTIPAVTKANSGRYSLKATNGSGQATSTAELLVK 98



 Score = 42.7 bits (99), Expect = 0.002
 Identities = 39/170 (22%), Positives = 75/170 (44%), Gaps = 9/170 (5%)

Query: 553 AIVVVAGNKLRLDVSITGEPPPVATWLK-GDEVFTTTEGRTRIEKRVDCSSFVIESAQRE 611
           ++VV+ G+    +  I+G P P  +W + G  + T+T    +I      +   I +  + 
Sbjct: 14  SVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKA 73

Query: 612 DEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVT 671
           + GRY++K TN  G+  ++  L V     PP  V+        ++ V +         VT
Sbjct: 74  NSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQ-----SMTVRQGSQVRLQVRVT 128

Query: 672 GY---LVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNA 718
           G    +V+  + G++    L+F++  E    S  + E    +   ++VNA
Sbjct: 129 GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNA 178



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 61/285 (21%), Positives = 104/285 (36%), Gaps = 41/285 (14%)

Query: 389  DSFKARYRFKKDGKRHILIFSDVVQEDR-----GRYQVITNGGQCEAELIVEEKQLEVLQ 443
            D++K+    +   +  + I    V+E+R     GR   +T   +  A + +      ++ 
Sbjct: 842  DTYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVS 901

Query: 444  DIADLTVKASEQAVFKCEVSD-EKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRP 502
             + ++TV   E    +C +S     T  WY+   ++  S    I+      +L+I +   
Sbjct: 902  GLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFA 961

Query: 503  EDEGDYTFVPDGYALSLSAKLNFLEIKV-EYVPKQ----------------EPPKIHLDC 545
            ED G +T      A ++S    +L ++V E   K+                E   + +  
Sbjct: 962  EDSGRFTCSAVNEAGTVSTSC-YLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTD 1020

Query: 546  SGKTSENA--------------IV--VVAGNKLRLDVSITGEPPPVATWLKGDEVFTT-T 588
            +  T E A              +V  +V G  +     + G P P   W K     TT  
Sbjct: 1021 TSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGY 1080

Query: 589  EGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFL 633
              +    K+      VI     +D G YTI V N  GE  AS  L
Sbjct: 1081 RYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1125



 Score = 40.4 bits (93), Expect = 0.010
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 3/83 (3%)

Query: 554 IVVVAGNKLRLDVSITGEPPPVATWLKGD-EVFTTTEGRTRIEKRVDCSSFVIESAQRED 612
           + V+ G  + L+  I+G P P  TW + D ++ ++ + +   +  +  +  +I  A  ED
Sbjct: 906 VTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGI--ARLMIREAFAED 963

Query: 613 EGRYTIKVTNPVGEDVASIFLQV 635
            GR+T    N  G    S +L V
Sbjct: 964 SGRFTCSAVNEAGTVSTSCYLAV 986



 Score = 39.3 bits (90), Expect = 0.022
 Identities = 27/104 (25%), Positives = 45/104 (43%), Gaps = 4/104 (3%)

Query: 1036 PFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEI--REDPK 1093
            P ++        P F+  + +  +  G  A L+  V G PKPK+ W  N + +    D K
Sbjct: 3570 PTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYK 3629

Query: 1094 FLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
            F+       L +   +    D G YTC A N+ G+ +    L++
Sbjct: 3630 FVFDGDDHSLIILFTKLE--DEGEYTCMASNDYGKTICSAYLKI 3671



 Score = 38.9 bits (89), Expect = 0.028
 Identities = 19/61 (31%), Positives = 31/61 (50%)

Query: 1078  KVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
             +V W     ++    K+ IT   GV  L ++  +  D GTY C+ VN+ GE  +  +L V
Sbjct: 25227 QVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFV 25286

Query: 1138  R 1138
             +
Sbjct: 25287 K 25287



 Score = 38.1 bits (87), Expect = 0.048
 Identities = 48/197 (24%), Positives = 83/197 (42%), Gaps = 29/197 (14%)

Query: 287 LKWFKNGQEIK----PSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEK----CFTE 338
           + WF++GQ I     P  +  F +   K  LTI   T A+   Y +   +         E
Sbjct: 37  VSWFRDGQVISTSTLPGVQISFSDGRAK--LTIPAVTKANSGRYSLKATNGSGQATSTAE 94

Query: 339 LFVKEP--PVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVM-WMKDGVELTREDSFKARY 395
           L VK    P   V  L+   V  G +V + V V+     V+ + +DG E+     F+   
Sbjct: 95  LLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQ--- 151

Query: 396 RFKKDGKRHILIFSDVVQEDRGRYQV-ITNG---GQCEAELIVEEKQLEVLQDIADLTVK 451
              ++G  + L+ ++   ED G Y V  TN        AEL+V+ ++        ++  K
Sbjct: 152 -ISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEE--------EVPAK 202

Query: 452 ASEQAVFKCEVSDEKVT 468
            ++  V   ++S+ + T
Sbjct: 203 KTKTIVSTAQISESRQT 219



 Score = 37.7 bits (86), Expect = 0.063
 Identities = 28/105 (26%), Positives = 41/105 (39%), Gaps = 14/105 (13%)

Query: 830   TIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVR 889
             T+R +  PP+  LP + +  Y   VGE +   V     P P V W K G         ++
Sbjct: 25310 TMRLLERPPEFTLPLYNKTAY---VGENVRFGVTITVHPEPHVTWYKSGQ-------KIK 25359

Query: 890   TSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAG 934
               D D     +    SD G Y+L++      D A   +    K G
Sbjct: 25360 PGDNDK----KYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYG 25400



 Score = 37.4 bits (85), Expect = 0.082
 Identities = 25/97 (25%), Positives = 41/97 (42%), Gaps = 21/97 (21%)

Query: 237   DLRGMLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEI-SDPDLTLKWFKNGQE 295
             DLRG+ ++L  AK                     G+ IK+ + +   P  T+ W K  Q 
Sbjct: 14694 DLRGIYQKLVIAKA--------------------GDNIKVEIPVLGRPKPTVTWKKGDQI 14733

Query: 296   IKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKD 332
             +K + +  FE      IL IN+C  +D   Y +  ++
Sbjct: 14734 LKQTQRVNFETTATSTILNINECVRSDSGPYPLTARN 14770



 Score = 37.0 bits (84), Expect = 0.11
 Identities = 28/93 (30%), Positives = 40/93 (43%), Gaps = 22/93 (23%)

Query: 1006 VYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSA 1065
            VYT  + G        K +AR+  TGI  K              F++PL D+ V  G +A
Sbjct: 5181 VYTAEVEG-------KKTSARLFVTGIRLK--------------FMSPLEDQTVKEGETA 5219

Query: 1066 ALNCAVRGHPKPKVVWMKNKMEIREDPKFLITN 1098
               C +  H K  VVW KN  ++      LI++
Sbjct: 5220 TFVCEL-SHEKMHVVWFKNDAKLHTSRTVLISS 5251



 Score = 37.0 bits (84), Expect = 0.11
 Identities = 24/82 (29%), Positives = 31/82 (37%), Gaps = 1/82 (1%)

Query: 252   VKKSAAFTKKLDPAYQVDRGNKIKLMVEISD-PDLTLKWFKNGQEIKPSSKYVFENVGKK 310
             V  S     KL     V  G  ++    I   P  T KW  +G EIK    Y  E     
Sbjct: 11134 VPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFS 11193

Query: 311   RILTINKCTLADDAAYEVAVKD 332
              +LTI  C   D   Y++ V +
Sbjct: 11194 SVLTIKNCLRRDTGEYQITVSN 11215



 Score = 36.2 bits (82), Expect = 0.18
 Identities = 57/267 (21%), Positives = 99/267 (37%), Gaps = 40/267 (14%)

Query: 874  WTKGGAPLD-TSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEK 932
            W + G  L  T+ +   +        +      D GEY  + ++   K +A +++  V+ 
Sbjct: 2606 WLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEY--TYKVATSKTSAKLKVEAVKI 2663

Query: 933  AGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCT 992
                 N+ V E       VE   P   G   I    V ++++K    + +  +    S  
Sbjct: 2664 KKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEK----YAISVKGTIYSLR 2719

Query: 993  VSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLT 1052
            + +  + +E    VY   +  L  S  +   T +I+K                  PK +T
Sbjct: 2720 IKNCAIVDE---SVYGFRLGRLGASARLHVETVKIIKK-----------------PKDVT 2759

Query: 1053 PLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSP 1112
             L +  V    S +       H    V W    +EI+   K  + + + V  L ++  SP
Sbjct: 2760 ALENATVAFEVSVS-------HDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISP 2812

Query: 1113 FDAGTYTCRAVNELGEALAECKLEVRV 1139
             DAG YT   V +L     ECK ++ V
Sbjct: 2813 SDAGEYTA-VVGQL-----ECKAKLFV 2833



 Score = 36.2 bits (82), Expect = 0.18
 Identities = 27/97 (27%), Positives = 38/97 (39%), Gaps = 3/97 (3%)

Query: 1043  DFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGV 1102
             D  + P F   L +     G S      V G P P + W K+   +   P   I  ++G+
Sbjct: 25418 DSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEII-HEGL 25476

Query: 1103  --LTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEV 1137
                 L+IR   P D G Y   A N  G    +  L+V
Sbjct: 25477 DYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 25513



 Score = 34.7 bits (78), Expect = 0.53
 Identities = 33/109 (30%), Positives = 47/109 (43%), Gaps = 8/109 (7%)

Query: 243  KRLKKAKVEVKKSAA--FTKKLDPAYQVDRGNKIKLMVEI-SDPDLTLKWFKNGQEIKPS 299
            K    AK+ V K AA    +K++P  +V  G+  K   EI S P++  +WFK G+EI  S
Sbjct: 4447 KTATSAKLTVVKRAAPVIKRKIEPL-EVALGHLAKFTCEIQSAPNVRFQWFKAGREIYES 4505

Query: 300  SKYVFENVGKKRILTINKCTLADDAAYEVAVKDE----KCFTELFVKEP 344
             K    +      L I +  + D   Y     +E     C   L V  P
Sbjct: 4506 DKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTVP 4554



 Score = 33.5 bits (75), Expect = 1.2
 Identities = 22/92 (23%), Positives = 37/92 (40%), Gaps = 3/92 (3%)

Query: 848 QTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSR---VHVRTSDFDTVFFVRQAAR 904
           Q+ +   G          G P P+V W + G  + TS    V +  SD      +    +
Sbjct: 13  QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTK 72

Query: 905 SDSGEYELSVQIENMKDTATIRIRVVEKAGPP 936
           ++SG Y L     + + T+T  + V  +  PP
Sbjct: 73  ANSGRYSLKATNGSGQATSTAELLVKAETAPP 104



 Score = 32.7 bits (73), Expect = 2.0
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 268   VDRGNKIKLMVEISD-PDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
             V  G  ++L++ I+  P     WF  G +++ S +   E   K   LTI + T+ D   Y
Sbjct: 23378 VPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEY 23437

Query: 327   EVAVKD 332
              + +K+
Sbjct: 23438 TLELKN 23443



 Score = 32.3 bits (72), Expect = 2.6
 Identities = 22/91 (24%), Positives = 39/91 (42%), Gaps = 3/91 (3%)

Query: 873  VWTKGGAPLDTS-RVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVE 931
            VW K G  +  S RVH+       +  +    + D+G Y  ++    +  +  + +  V+
Sbjct: 2341 VWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVD 2400

Query: 932  KAGPPINVMVKEVWGTNALVEWQAPKDDGNS 962
               P  +V V E  GT A++E +    D  S
Sbjct: 2401 VITPLKDVNVIE--GTKAVLECKVSVPDVTS 2429



 Score = 32.0 bits (71), Expect = 3.4
 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 268  VDRGNKIKLMVEI-SDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAY 326
            V  G K+ + V   + P  T+ W K+G+E+K S +   +N      L + K   AD   Y
Sbjct: 8026 VIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIY 8085

Query: 327  EVAVKDE 333
             + ++++
Sbjct: 8086 TITLENK 8092



 Score = 31.6 bits (70), Expect = 4.5
 Identities = 31/122 (25%), Positives = 49/122 (40%), Gaps = 6/122 (4%)

Query: 1009 ENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPK-----FLTPLIDRVVVAGY 1063
            +N+C L      ++++A I+   I     E   H F +        F   L D V     
Sbjct: 2085 DNVCELVIRDVTAEDSASIMVKAINIAG-ETSSHAFLLVQAKQLITFTQELQDVVAKEKD 2143

Query: 1064 SAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAV 1123
            + A        P  KV W K+ ME+ E  K+ + + + V  L+I      DA  Y+C  V
Sbjct: 2144 TMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLV 2203

Query: 1124 NE 1125
             +
Sbjct: 2204 ED 2205



 Score = 31.6 bits (70), Expect = 4.5
 Identities = 60/257 (23%), Positives = 100/257 (38%), Gaps = 50/257 (19%)

Query: 45    PTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWFK-GKWLELGSKSGAR 103
             PT      +F +   +   + G+      +V+G  +P  PT+KW K G+ L LG      
Sbjct: 25416 PTDSTLRPMFKRLLANAECQEGQSVCFEIRVSG--IPP-PTLKWEKDGQPLSLGPNI--- 25469

Query: 104   FSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPR-QDASG 162
                 E  +   + Y   LHI   +  D GYYR+         SC  ++ VE  R +    
Sbjct: 25470 ----EIIHEGLDYYA--LHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQEF 25523

Query: 163   QSLESFKRTSEKKSDTAGELDFSGLLKKREVV--EEEKKKKKKDDDDLGIPPEIWELLKG 220
             +S E  +R  +K+ D    L  + +L   E V   +  K+  ++   L  P    + +KG
Sbjct: 25524 KSKEEHERHVQKQIDKT--LRMAEILSGTESVPLTQVAKEALREAAVLYKPAVSTKTVKG 25581

Query: 221   ------AKKSEYEKIAFQYGITDLRGMLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNKI 274
                    +K E  K+   Y + + R    + K+  +E                     +I
Sbjct: 25582 EFRLEIEEKKEERKLRMPYDVPEPR----KYKQTTIE------------------EDQRI 25619

Query: 275   KLMVEISDPDLTLKWFK 291
             K  V +SD    +KW+K
Sbjct: 25620 KQFVPMSD----MKWYK 25632



 Score = 31.2 bits (69), Expect = 5.9
 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 1/67 (1%)

Query: 261  KLDPAYQVDRGNKIKLMVEISD-PDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCT 319
            KL     V  G KI+L   ++  P+  + W K    +K   +   ENV KK  +TI    
Sbjct: 7323 KLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSK 7382

Query: 320  LADDAAY 326
             +D   Y
Sbjct: 7383 RSDTGTY 7389



 Score = 30.8 bits (68), Expect = 7.7
 Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 1/72 (1%)

Query: 1049 KFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIR 1108
            +FL PL D  V     A   C +      KV W K+  EI++  K+ I +   V  L I 
Sbjct: 6003 EFLRPLTDLQVREKEMARFECEL-SRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVIN 6061

Query: 1109 RPSPFDAGTYTC 1120
            +    D   Y+C
Sbjct: 6062 KCLLDDEAEYSC 6073


>gi|110349715 titin isoform N2-B [Homo sapiens]
          Length = 26926

 Score =  275 bits (704), Expect = 1e-73
 Identities = 222/790 (28%), Positives = 337/790 (42%), Gaps = 43/790 (5%)

Query: 279  EISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTE 338
            ++S     +KW++NG+EIK   KY FE  G    L I  C L D+  Y   V+D K    
Sbjct: 6348 QLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRAR 6407

Query: 339  LFVKEPPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFK 398
            LFV+E PV I+ P +D     G  V    E++++  +V W+++ + + + D    +++  
Sbjct: 6408 LFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGD----KHQMM 6463

Query: 399  KDGKRHILIFSDVVQEDRGRYQVITNGGQCEA--ELIVEEKQLEVLQDIA-----DLTVK 451
             +GK H L   D+   D+G Y+ I    +  A  EL    K     QD+       LT+ 
Sbjct: 6464 SEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAPKIKTADQDLVVDVGKPLTMV 6523

Query: 452  ASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFV 511
                A  K E        +W+K   E  P    TI          I + +  D+G Y  V
Sbjct: 6524 VPYDAYPKAEA-------EWFK---ENEPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIV 6573

Query: 512  PDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGE 571
                       +N   I V    +        D     +    +   G+K+ +   +   
Sbjct: 6574 LQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKI-IGYVVERR 6632

Query: 572  PPPVATWLKGDEVFTTTEGR-TRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVAS 630
                 TW+   +   + E   T ++K      F + +  R   G   ++  NPV  +  S
Sbjct: 6633 DIKRKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGE-PVETDNPV--EARS 6689

Query: 631  IFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRW---MK 687
             +    DVP PP  V IT V      L WEPP YDGG  +T Y++E + K S RW   M 
Sbjct: 6690 KY----DVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMT 6745

Query: 688  LNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM----PIAPTSEPLHL 743
            +  E  + T    T ++EG  Y  RV A N IGV +PS  T PF+    PI   S P++L
Sbjct: 6746 VRAEDLSATV---TDVVEGQEYSFRVRAQNRIGVGKPSAAT-PFVKVADPIERPSPPVNL 6801

Query: 744  IVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPT 803
               D T ++  LKW PP + G   I GY++E C EG + W+  N + V    + V  L  
Sbjct: 6802 TSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEK 6861

Query: 804  GARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVP 863
            G + L+RV   N AG S+P+ +  P+T  +    P + L        +  V   + ++VP
Sbjct: 6862 GNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVI-VPNPITILVP 6920

Query: 864  FQGKPRPQVVWTKGGAPLDTS-RVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDT 922
              G PRP   W  G   L+T  RV ++T        +  + RSD G Y L ++      +
Sbjct: 6921 STGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTIS 6980

Query: 923  ATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNV 982
              I + V+ +   P  +   ++   +  + W+ P DDG S + GY V+K +     W  V
Sbjct: 6981 GEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV 7040

Query: 983  YERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKPFEYKEH 1042
             +       TV DL+ G EY F+V   N CG  +   V +         +   P   K  
Sbjct: 7041 MDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWR 7100

Query: 1043 DFRMAPKFLT 1052
            D      FLT
Sbjct: 7101 DRTANSIFLT 7110



 Score =  274 bits (701), Expect = 3e-73
 Identities = 167/480 (34%), Positives = 243/480 (50%), Gaps = 13/480 (2%)

Query: 537   EPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEK 596
             EPP+I LD   +     +V+ A   LRL V+I G P P   W K + + T    R +IE 
Sbjct: 18606 EPPEIELDADLR---KVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILTD---RAQIEV 18659

Query: 597   RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAI 656
                 +  VI++  R D GRY + + N  G   A + ++V+D P  P  + I  V +D   
Sbjct: 18660 TSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVT 18719

Query: 657   LVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAV 716
             L WEPP+ DGG  +T Y+VE+++   + +  +     T+TT+    + EG  Y  RV A 
Sbjct: 18720 LSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNC-TKTTFRIENLQEGCSYYFRVLAS 18778

Query: 717   NAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
             N  G+  P+  T+P     P   P  + + DVT  T T+KW  P   G   I GY+VE  
Sbjct: 18779 NEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQ 18838

Query: 777   LEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAE 836
              +GSE+W  +    V+    T+  L  G   +FRV  VN  GRS+P  L  PV  R+I  
Sbjct: 18839 TKGSEKW--STCTQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEI 18896

Query: 837   PPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVRTSDFDT 895
              P + LP H   T+  K  EQL + VPF+G+P+  V W K G  L +T+RV+V +S   T
Sbjct: 18897 KPSVELPFH---TFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVT 18953

Query: 896   VFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQA 955
                +++A++ D G YEL V       T  I I V+++ GPP  + + EV   +  + W  
Sbjct: 18954 SLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPPGPIRIDEVSCDSITISWNP 19013

Query: 956   PKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLS 1015
             P+ DG  +I  Y V+K +  +  W  V +    TS  +  L  G+EY FRV  EN  G S
Sbjct: 19014 PEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKS 19073



 Score =  265 bits (678), Expect = 1e-70
 Identities = 169/568 (29%), Positives = 272/568 (47%), Gaps = 23/568 (4%)

Query: 535   KQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRI 594
             K E P++ LD   +     IVV AG   R+ +   G P P  TW + +  FT    + +I
Sbjct: 17521 KLEAPELDLDSELR---KGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTD---KVQI 17574

Query: 595   EKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDW 654
             EK V+ +   I++  R D G+Y +K+ N  G   A + ++V+D P PP+ + +  V +D 
Sbjct: 17575 EKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDS 17634

Query: 655   AILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVF 714
             A LVWEPP+ DGG  V  Y++++++   + +  ++ +  ++T+++   + EG +Y  RV 
Sbjct: 17635 AFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKC-SKTSFKVENLTEGAIYYFRVM 17693

Query: 715   AVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
             A N  GV  P           P S P  + + DV+ T+ +L W  P   G   + GY+VE
Sbjct: 17694 AENEFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVE 17753

Query: 775   YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREI 834
                +G+E+W       V  C   V  L +G    FRV   N  G+S+P  L  PV  +++
Sbjct: 17754 MQPKGTEKWSIVAESKV--CNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDL 17811

Query: 835   AEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVRTSDF 893
                P ++LP +   TY  + GE L + +P  G+PRP + W K G PL  T+RV+V  +  
Sbjct: 17812 TIQPSLKLPFN---TYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETAT 17868

Query: 894   DTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTNALVE 952
              TV  +++  + D G+Y ++        T  + + V+EK GPP+  V   EV     ++ 
Sbjct: 17869 STVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVSADFVVIS 17928

Query: 953   WQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENIC 1012
             W+ P   G  +I  Y V+K D  T  W  V      T+  ++ L  G EY FR++ EN  
Sbjct: 17929 WEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRY 17988

Query: 1013  GLS---DSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNC 1069
             G S   DS  V        + G    PF       +M  ++  P+ D     G +  +  
Sbjct: 17989 GKSAPLDSKAVIVQYP-FKEPGPPGTPFVTSISKDQMLVQWHEPVND-----GGTKIIGY 18042

Query: 1070  AVRGHPKPKVVWMKNKMEIREDPKFLIT 1097
              +    K  ++W+K      +D KF  T
Sbjct: 18043 HLEQKEKNSILWVKLNKTPIQDTKFKTT 18070



 Score =  261 bits (668), Expect = 2e-69
 Identities = 175/561 (31%), Positives = 269/561 (47%), Gaps = 37/561 (6%)

Query: 471   WYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKV 530
             W+  G ++R S+R+T+    +  KL I +    D G+YT        + S       IKV
Sbjct: 23275 WFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSET-----IKV 23329

Query: 531   EYVPKQEPPK--IHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPV--ATWLKG---DE 583
               + K  PP   I +D    TS               ++I+ EPP +     L G   ++
Sbjct: 23330 IILDKPGPPTGPIKIDEIDATS---------------ITISWEPPELDGGAPLSGYVVEQ 23374

Query: 584   VFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNP--VGEDVASIFLQV---VDV 638
                   G   + + V  S+F        +E  + +  TN   +G  + S  ++    + +
Sbjct: 23375 RDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIECRSSIRI 23434

Query: 639   PDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTY 698
             P PPE ++I  V  D   L W PP  DGG  VTGY+VERK+  + RW+++N    T T Y
Sbjct: 23435 PGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRY 23494

Query: 699   ESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTL 755
              ST + EG+ YE RV A+NA G  +PS  +KP +   PIAP  +P +  V D T T+ +L
Sbjct: 23495 RSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSL 23554

Query: 756   KWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVN 815
              W  P   G   + GYL+E       EW   NT P +   +T+ +LP GA   FRV+  N
Sbjct: 23555 AWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACN 23614

Query: 816   IAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWT 875
               G  EPA +   V + E+ E P   L    ++    + G  + L +P +GKP P   WT
Sbjct: 23615 AGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWT 23674

Query: 876   KGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGP 935
             K G  + + R  + TS+  T   +++A R DSG Y+L ++ +  K    I++RV+     
Sbjct: 23675 KEGQDI-SKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIGSPNS 23733

Query: 936   PINVM-VKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVS 994
             P   +   ++   +  V W+ P DDG ++I+GY +++ +     W+ +  R R TS  V 
Sbjct: 23734 PEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVK 23793

Query: 995   DLIVGNEYYFRVYTENICGLS 1015
              L    EY+FRV  EN  G+S
Sbjct: 23794 GLKENVEYHFRVSAENQFGIS 23814



 Score =  252 bits (644), Expect = 1e-66
 Identities = 177/599 (29%), Positives = 286/599 (47%), Gaps = 32/599 (5%)

Query: 448   LTVKASEQAVFKCEVSDEKVTG-KWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG 506
             + VKA E      +++   +    W K+G+E+    R  I        L + D    D G
Sbjct: 19302 IVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTG 19361

Query: 507   DYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDV 566
              Y       A + S  +N      + + K  PP   L+ +G T+E   +  +  + + D 
Sbjct: 19362 QYVLTLKNVAGTRSVAVN-----CKVLDKPGPPAGPLEINGLTAEKCSL--SWGRPQEDG 19414

Query: 567   SITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNP--V 624
                 +   V         +T  EG  ++      +S  +    + +E  + +   N   V
Sbjct: 19415 GADIDYYIVEKRETSHLAWTICEGELQM------TSCKVTKLLKGNEYIFRVTGVNKYGV 19468

Query: 625   GEDVASIFLQVVD---VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKG 681
             GE + S+ ++ +D   VP PP ++ ITSV ++   L W  P  DGG  ++GY++ER++K 
Sbjct: 19469 GEPLESVAIKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSEISGYIIERREKN 19528

Query: 682   SQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM----PIAPT 737
             S RW+++N +   +   +ST + EG  YE RV+A NA G+S PS  T P +    P+   
Sbjct: 19529 SLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPS-ETSPLIRAEDPVFLP 19587

Query: 738   SEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFT 797
             S P    + D   TT T+ W  P   G   I GY VEY      +W   + + +    +T
Sbjct: 19588 SPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDW-KTSIQSLRGTEYT 19646

Query: 798   VKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQ 857
             +  L TGA  +FRV  VN  G S+P+  + P   +E  E P   +   +R+T I K G  
Sbjct: 19647 ISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGAS 19706

Query: 858   LNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIE 917
               + VPF+G+P P V+W+K    L T R +V T+D  T   +  A R+DSG+Y L++Q  
Sbjct: 19707 FTMTVPFRGRPVPNVLWSKPDTDLRT-RAYVDTTDSRTSLTIENANRNDSGKYTLTIQNV 19765

Query: 918   NMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTM 977
                 + T+ ++V++  GPP N+ V++V   +A++ W  P++DG + +  Y ++K +    
Sbjct: 19766 LSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKREASKK 19825

Query: 978   EWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFKP 1036
              W +V       S  V++L  G  YYFRV  EN  G+    G+   T   +K  IT KP
Sbjct: 19826 AWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGV----GIPAETKEGVK--ITEKP 19878



 Score =  249 bits (637), Expect = 8e-66
 Identities = 181/600 (30%), Positives = 287/600 (47%), Gaps = 38/600 (6%)

Query: 448   LTVKASEQAVFKCEVSDEKV-TGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEG 506
             LTVKA         V  + + T  W K+G  ++P++ I ++       L +  V  +D G
Sbjct: 12808 LTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSG 12867

Query: 507   DYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDV 566
             DYT   +  + S SA      IK++ + K  PP                 V  NK+  D 
Sbjct: 12868 DYTITAENSSGSKSAT-----IKLKVLDKPGPP---------------ASVKINKMYSDR 12907

Query: 567   SITGEPPPVA------TWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKV 620
             ++    PP+       T    D+  T+     ++   V  +S  +E      E ++ I  
Sbjct: 12908 AMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICA 12967

Query: 621   TNP--VGEDVASIFLQVVDVPDPP---EAVRITSVGEDWAILVWEPPMYDGGKPVTGYLV 675
              N   VG+ V +      +  DPP   +   I+++ +D   + W+PP  DGG P+TGYL+
Sbjct: 12968 ENKYGVGDPVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLL 13027

Query: 676   ERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM--- 732
             E+++  +  W K+N +   E T ++T + EG  YE RV A+N  G  +PS  +K      
Sbjct: 13028 EKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARD 13087

Query: 733   PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANT-EPV 791
             P  P   P    V D T ++ +L W  P   G   I GYLVE     S+ WV  N  + +
Sbjct: 13088 PQYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNL 13147

Query: 792   ERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYI 851
             ++  F V  L    +  FRV  VN  G S+P+ +      ++I  PP+  L   LR+T I
Sbjct: 13148 QKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLI 13207

Query: 852   RKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVRTSDFDTVFFVRQAARSDSGEY 910
              + G  + L VP +G+P P++ W+K    L D   + ++++DFDT        + D+G+Y
Sbjct: 13208 LRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKY 13267

Query: 911   ELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQ 970
              L+++    K   TI ++V++  GPP+NV VKE+   +A V W+ P  DG S I+ Y VQ
Sbjct: 13268 ILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQ 13327

Query: 971   KADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKT 1030
             K D +   W  V      TS  V++L  G  Y+FRV+ EN  G+ D PG +++  +  +T
Sbjct: 13328 KRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGD-PGETRDAVKASQT 13386



 Score =  246 bits (628), Expect = 9e-65
 Identities = 155/494 (31%), Positives = 245/494 (49%), Gaps = 17/494 (3%)

Query: 530   VEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTE 589
             +E   +   P + LD S +   + IVV AG  +R+   ++G+PPP  TW   +    T  
Sbjct: 10016 IEMKDRLVSPDLQLDASVR---DRIVVHAGGVIRIIAYVSGKPPPTVTWNMNER---TLP 10069

Query: 590   GRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRIT- 648
                 IE     SS VI++ QR  +G Y++   N  GE   +I + V+DVP P     +  
Sbjct: 10070 QEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAH 10129

Query: 649   SVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGIL 708
             ++  +   L W  P  DGG P+T Y++E+++   + W  + + V T        +I+G  
Sbjct: 10130 NLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTV-TRQNATVQGLIQGKA 10188

Query: 709   YEMRVFAVNAIGVSQPSMNTKPFM----PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIG 764
             Y  R+ A N+IG+  P + T   +    PI     P  L V++VT  T TL W PP   G
Sbjct: 10189 YFFRIAAENSIGMG-PFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDG 10247

Query: 765   AGGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPAT 824
                I  Y++E  L G+E++     + +    +TVK L  G    +RV  VNI G+ +P+ 
Sbjct: 10248 GSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSF 10307

Query: 825   LAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAP-LDT 883
               +P+T ++   PP + L    R     +VGE   L   + GKP+P+V W K  A  L+ 
Sbjct: 10308 CTKPITCKDELAPPTLHL--DFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLED 10365

Query: 884   SRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVK 942
              R H++T+         +A RSDSG+Y + V+          ++ VV++ GPP+  V   
Sbjct: 10366 DRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFD 10425

Query: 943   EVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEY 1002
             EV     ++ W+ P DDG S+I  Y ++K +     W  V   +  T+C VS L+ G +Y
Sbjct: 10426 EVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDY 10485

Query: 1003  YFRVYTENICGLSD 1016
              FR++ EN+ G+SD
Sbjct: 10486 IFRIHAENLYGISD 10499



 Score =  246 bits (627), Expect = 1e-64
 Identities = 150/488 (30%), Positives = 235/488 (48%), Gaps = 9/488 (1%)

Query: 529   KVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTT 588
             ++E V + E P + L       +  + + AG  LRL VS++G PPPV TW K        
Sbjct: 22937 EIEPVERIEIPDLEL---ADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQG---IDL 22990

Query: 589   EGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRIT 648
               R  I+     S  +++   R D G+YTI+  N  G+  A++ ++V D P P  +V++ 
Sbjct: 22991 ASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVK 23050

Query: 649   SVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGIL 708
              V  D   + WE P  DGG PV  Y+VE K++ + R  K      ++T Y  + ++EG +
Sbjct: 23051 EVSRDSVTITWEIPTIDGGAPVNNYIVE-KREAAMRAFKTVTTKCSKTLYRISGLVEGTM 23109

Query: 709   YEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGI 768
             Y  RV   N  G+ +P   +   +       P  L V DVT +T TL W  P   G   +
Sbjct: 23110 YYFRVLPENIYGIGEPCETSDAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRL 23169

Query: 769   DGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQP 828
              GY++E C  G+E W+   T        TV +L  G + LFR+   N  G SEP      
Sbjct: 23170 TGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTA 23229

Query: 829   VTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVH 887
             VT++++   P I L    ++T     G  + LV+P  G+P P   W   G+ L ++ RV 
Sbjct: 23230 VTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVT 23289

Query: 888   VRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWG 946
             V T        +R+    D+GEY L ++      + TI++ +++K GPP   + + E+  
Sbjct: 23290 VETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDA 23349

Query: 947   TNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRV 1006
             T+  + W+ P+ DG + + GY V++ D     W  V E    ++   + L  GNEY FRV
Sbjct: 23350 TSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRV 23409

Query: 1007  YTENICGL 1014
                N  G+
Sbjct: 23410 AATNRFGI 23417



 Score =  243 bits (620), Expect = 8e-64
 Identities = 162/502 (32%), Positives = 240/502 (47%), Gaps = 27/502 (5%)

Query: 527   EIKVEYVPKQ--EPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEV 584
             E+K    PK+  EPP+I LD S +     ++V AG  +RL   + G P P  TW K    
Sbjct: 12093 ELKEAIKPKEILEPPEIDLDASMR---KLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGID 12149

Query: 585   FTTTEGRTRIEKRVDCSSF-VIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPE 643
                 +G+  +   VD  +F VI ++ R+D G+Y++ + NP GE    + ++V+D P P  
Sbjct: 12150 NVVRKGQVDL---VDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVS 12206

Query: 644   AVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKM 703
              ++++ V +    + W PP  DGG  VT Y+VE+++   + W  +  EV  +T++  T +
Sbjct: 12207 DLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEV-KKTSFHVTNL 12265

Query: 704   IEGILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSE---PLHLIVEDVTDTTTTLKWRPP 760
             + G  Y  RV AVN  G   P+   KP +   P SE   P  L V ++T  + TL W PP
Sbjct: 12266 VPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPP 12325

Query: 761   NRIGAGGIDGYLVEYCLEGSEEWVPANT----EPVERCGFTVKNLPTGARILFRVVGVNI 816
              R G   IDGY+  Y     EE  PA+       V+     V  L  G +  FRV   N 
Sbjct: 12326 LRDGGAKIDGYITSY----REEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNA 12381

Query: 817   AGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTK 876
              G S P         +E   PPKI +P  +      K G++L +     GKP P   W K
Sbjct: 12382 VGVSLPREAEGVYEAKEQLLPPKILMPEQI----TIKAGKKLRIEAHVYGKPHPTCKWKK 12437

Query: 877   GGAPLDT-SRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGP 935
             G   + T S + V  +D  ++  ++   R DSG Y L+ +  +  DT  I++ V++  GP
Sbjct: 12438 GEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGP 12497

Query: 936   PINVM-VKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVS 994
             P     + ++      + W  P +DG S I  Y V+K D    +W         TSC V 
Sbjct: 12498 PQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVG 12557

Query: 995   DLIVGNEYYFRVYTENICGLSD 1016
              LI G EY FRV  EN  G+S+
Sbjct: 12558 KLIPGQEYIFRVRAENRFGISE 12579



 Score =  239 bits (610), Expect = 1e-62
 Identities = 152/487 (31%), Positives = 236/487 (48%), Gaps = 22/487 (4%)

Query: 535   KQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRI 594
             K E P I LD   +   N   + AG  LRL V I G P P   W K D       G  R 
Sbjct: 16439 KLEAPDIDLDLELRKIIN---IRAGGSLRLFVPIKGRPTPEVKWGKVD-------GEIRD 16488

Query: 595   EKRVDCSS----FVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSV 650
                +D +S     V+++  R D G+YT+ + N  G   A + ++V+D P PP  +++T +
Sbjct: 16489 AAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEI 16548

Query: 651   GEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYE 710
              +D   + WEPP+ DGG  +  Y+VE+++   + +  +      + +++  ++ EG  Y 
Sbjct: 16549 TKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCH-KNSWKIDQLQEGCSYY 16607

Query: 711   MRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDG 770
              RV A N  G+  P+    P         P  + V+DVT  + +L W  P   G   I  
Sbjct: 16608 FRVTAENEYGIGLPAQTADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQ 16667

Query: 771   YLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVT 830
             Y+VE   + SE+W  +    V+     + NL  G   LFRVV VN  GRS+P +LA P+ 
Sbjct: 16668 YIVEMQAKHSEKW--SECARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIV 16725

Query: 831   IREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVR 889
              +++   P +   +    +Y  +VG+ L + VP  G+P+P + WTK G PL  T+R++V 
Sbjct: 16726 AKDLVIEPDV---KPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVT 16782

Query: 890   TSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTN 948
              S   T   +++  + D G+Y ++V     + TA+I I  ++K  PP   V   +V   +
Sbjct: 16783 DSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAES 16842

Query: 949   ALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYT 1008
               + W  P   G  +I  Y VQK D  T  W  V      T+  V+ L  G EY FR++ 
Sbjct: 16843 ITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFA 16902

Query: 1009  ENICGLS 1015
             EN  G S
Sbjct: 16903 ENRYGQS 16909



 Score =  238 bits (607), Expect = 2e-62
 Identities = 178/616 (28%), Positives = 277/616 (44%), Gaps = 39/616 (6%)

Query: 429   EAELIVEEKQLEVLQDIA---DLTVKASEQAVFKCEVSDEK-VTGKWYKNGVEVRPSKRI 484
             EAE + E K+  +   I     +T+KA ++   +  V  +   T KW K   EV  S  +
Sbjct: 12389 EAEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHL 12448

Query: 485   TISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLD 544
              +        L+I DV  +D G Y+   +      S+  +  +IKV  +    PP+   D
Sbjct: 12449 AVHKADSSSILIIKDVTRKDSGYYSLTAEN-----SSGTDTQKIKVVVMDAPGPPQPPFD 12503

Query: 545   CSGKTSENA-----IVVVAGNKLRLDVSITGEPPPVATWLKGDEVF---TTTEGRTRIEK 596
              S   ++       I +  G       +IT          +GD V    + T+   R+ K
Sbjct: 12504 ISDIDADACSLSWHIPLEDGGS-----NITNYIVEKCDVSRGDWVTALASVTKTSCRVGK 12558

Query: 597   RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAI 656
              +    ++        E R+ I       + VA        VP  P+  R+T V +D   
Sbjct: 12559 LIPGQEYIFRVRA---ENRFGISEPLTSPKMVAQF---PFGVPSEPKNARVTKVNKDCIF 12612

Query: 657   LVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAV 716
             + W+ P  DGG P+ GYL+ERK++ S  W+K N  +   T Y    ++EG+ Y  R++A+
Sbjct: 12613 VAWDRPDSDGGSPIIGYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYAL 12672

Query: 717   NAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYC 776
             N  G S PS  T+      P   P    V DVT +T +L W  P   G   I GY VE C
Sbjct: 12673 NKAGSSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEAC 12732

Query: 777   LEGSEEWVPANTEP--VERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREI 834
                 ++WV  NT P  + +  +T   L   A+  FR +       S P+  + PVTI   
Sbjct: 12733 KLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAE 12792

Query: 835   AEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGA---PLDTSRVHVRTS 891
               PP+I L   ++     K G  + L     GKP P V W K G    P +  ++ ++ +
Sbjct: 12793 NVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRN 12852

Query: 892   DFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALV 951
                   F     R DSG+Y ++ +  +   +ATI+++V++K GPP +V + +++   A++
Sbjct: 12853 LCTLELF--SVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAML 12910

Query: 952   EWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENI 1011
              W+ P +DG SEI  Y V K +     W  V      TSC+V  LI G+EY FR+  EN 
Sbjct: 12911 SWEPPLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENK 12970

Query: 1012  CGLSD----SPGVSKN 1023
              G+ D     P ++KN
Sbjct: 12971 YGVGDPVFTEPAIAKN 12986



 Score =  238 bits (606), Expect = 3e-62
 Identities = 157/496 (31%), Positives = 232/496 (46%), Gaps = 19/496 (3%)

Query: 537   EPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEK 596
             EPP++ LD +    ++   +  G+ LRL   I G P P  TW K D    T   + RI+ 
Sbjct: 10717 EPPELILDANMAREQH---IKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPT---KARIDV 10770

Query: 597   RVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAI 656
                 S   I +A  ED G Y++ V NP G    S+ + V+D P PP  + ++ + +D   
Sbjct: 10771 TPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCY 10830

Query: 657   LVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAV 716
             L W+ P+ DGG  +T Y+VER+   S +W  L+     + ++ +  + EG  Y  RV A 
Sbjct: 10831 LTWKEPLDDGGSVITNYVVERRDVASAQWSPLS-ATSKKKSHFAKHLNEGNQYLFRVAAE 10889

Query: 717   NAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLV 773
             N  G        KP     P+ P   P  L   DV  T  +L W  P+R G   I GYLV
Sbjct: 10890 NQYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLV 10949

Query: 774   EYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIRE 833
             EY  EG+++W+   T     C   V  L  G    FRV   NI G   P T   P+  +E
Sbjct: 10950 EYQEEGTQDWIKFKTVTNLEC--VVTGLQQGKTYRFRVKAENIVGLGLPDTTI-PIECQE 11006

Query: 834   IAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVH-VRTSD 892
                PP + L   L +  + K G  +      +G P P   WT  G+ + T   + V T +
Sbjct: 11007 KLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDN 11066

Query: 893   FDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTNALV 951
             F +V  ++   R D+GEY+++V       T  + + V++  GPP   + + +V   +  +
Sbjct: 11067 FSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTI 11126

Query: 952   EWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENI 1011
              WQ PKDDG S ++ Y V+K D +   W  V   +  T   +  L  G EY FRV  EN 
Sbjct: 11127 SWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENK 11186

Query: 1012  CG----LSDSPGVSKN 1023
              G    L  +P V+K+
Sbjct: 11187 IGVGPPLDSTPTVAKH 11202



 Score =  234 bits (598), Expect = 3e-61
 Identities = 149/496 (30%), Positives = 239/496 (48%), Gaps = 18/496 (3%)

Query: 530   VEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTE 589
             VE V ++  P   LD   + +   +VV AG  +R+ V I G P P  TW K +      +
Sbjct: 14268 VEIVEREMAPDFELDAELRRT---LVVRAGLSIRIFVPIKGRPAPEVTWTKDN---INLK 14321

Query: 590   GRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITS 649
              R  IE     +  +I    R D G++ + + NP G+    + ++V+D P P   +R T 
Sbjct: 14322 NRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTD 14381

Query: 650   VGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILY 709
             + +D   L W+ P+ DGG  +T Y+VE+++   + +     +   + TY+ T + EG  Y
Sbjct: 14382 ITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTKCH-KCTYKVTGLSEGCEY 14440

Query: 710   EMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGID 769
               RV A N  G+ +P+  T+P       S P  L + D+T +T +L W  P   G   I 
Sbjct: 14441 FFRVMAENEYGIGEPTETTEPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKIT 14500

Query: 770   GYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPV 829
             GY++E   +GS++W    T     C   V+NL  G    F+V+ VN AGRS P   ++PV
Sbjct: 14501 GYVIEAQRKGSDQWTHITTVKGLEC--VVRNLTEGEEYTFQVMAVNSAGRSAPRE-SRPV 14557

Query: 830   TIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHV 888
              ++E    P++ L    ++  I K G+ + + +P  G+P+P V W KG   L  T RV+ 
Sbjct: 14558 IVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNF 14617

Query: 889   RTSDFDTVFFVRQAARSDSGEYELSVQ--IENMKDTATIRIRVVEKAGPPIN-VMVKEVW 945
              T+   T+  + +  RSDSG Y L+ +  +  + D  TI++  +   GPP   +   EV 
Sbjct: 14618 ETTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDI--PGPPTGPIKFDEVS 14675

Query: 946   GTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFR 1005
                    W  P++DG   I  Y V+     +  W  +      T+   + L  G EY FR
Sbjct: 14676 SDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGLEYQFR 14735

Query: 1006  VYTENICGLSDSPGVS 1021
             V  +N  G+   PG++
Sbjct: 14736 VKAQNRYGV--GPGIT 14749



 Score =  232 bits (592), Expect = 1e-60
 Identities = 161/551 (29%), Positives = 248/551 (45%), Gaps = 28/551 (5%)

Query: 469   GKWYKNGVEVRPSKRITISHV--GRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFL 526
             G W+K   E     R T++ +  G  +K  +  +    +GD   V               
Sbjct: 21801 GDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTG------------- 21847

Query: 527   EIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFT 586
                ++ V +   P++ +D + K +    VV AG  +RL ++  G P P A W K D   +
Sbjct: 21848 --TIKAVDRLTAPELDIDANFKQTH---VVRAGASIRLFIAYQGRPTPTAVWSKPDSNLS 21902

Query: 587   TTEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVR 646
                 R  I      S+  +E+  R D G+YT+ V N  G    +  ++V+D P PP  + 
Sbjct: 21903 L---RADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPIT 21959

Query: 647   ITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEG 706
                V    A L+W+ P+ DGG  +  Y+VE+++   + W  ++ E  T   ++   + EG
Sbjct: 21960 FKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVIS-EKCTRQIFKVNDLAEG 22018

Query: 707   ILYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAG 766
             + Y  RV AVN  GV +P    +P +     + P  L V D + ++  L W  P+  G  
Sbjct: 22019 VPYYFRVSAVNEYGVGEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGS 22078

Query: 767   GIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLA 826
              I GYL+E   +GS+ WV A     ++  FTV+ L       FRV   N AG SEP    
Sbjct: 22079 RITGYLLEMRQKGSDFWVEAG--HTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAF 22136

Query: 827   QPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSR 885
               V I+E    P   L     Q    K G    + VP  G+P P+V W      L +T R
Sbjct: 22137 SSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDR 22196

Query: 886   VHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEV 944
             V + T+   T   V+ + R DSG Y L+++      T ++ + V+ + GP    + V  V
Sbjct: 22197 VSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSV 22256

Query: 945   WGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYF 1004
                + ++ W  PKD G +EI  Y V+K +  T  W  V    + T   V+ L    EY F
Sbjct: 22257 SAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSF 22316

Query: 1005  RVYTENICGLS 1015
             RV +EN  G+S
Sbjct: 22317 RVSSENRFGVS 22327



 Score =  231 bits (588), Expect = 4e-60
 Identities = 141/480 (29%), Positives = 230/480 (47%), Gaps = 7/480 (1%)

Query: 551  ENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFVIESAQR 610
            ++ + V+  N + + V  TG P P ATW  GD+V  T + R +++     +  VI  ++R
Sbjct: 6904 KDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGD-RVKMKTLSAYAELVISPSER 6962

Query: 611  EDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPV 670
             D+G YT+K+ N V      I + V+  P  P+ ++   + +D   L WEPP  DGG P+
Sbjct: 6963 SDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPL 7022

Query: 671  TGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKP 730
            TGY+VE+++   + W K+  +  T+  +    +++G  Y  +V A N  G  +P+   +P
Sbjct: 7023 TGYVVEKREVSRKTWTKV-MDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEP 7081

Query: 731  FMPIAPTS---EPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPAN 787
                 P +    P ++   D T  +  L W PP   G   I GY+VE C  GS++WV   
Sbjct: 7082 VNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACG 7141

Query: 788  TEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLR 847
             EPV      V  L  G    +RV  +N  G S+P+   + +   +  E P+I L   L 
Sbjct: 7142 -EPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLL 7200

Query: 848  QTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRVHVRTSDFDTVFFVRQAARSD 906
                 K G ++ L     GKP P++ WTK    L    R+ +      +   +  + RSD
Sbjct: 7201 AGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSD 7260

Query: 907  SGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMG 966
            +G Y +       + TA + + V++K GPP    + +V   + L+ W  P+DDG S+I  
Sbjct: 7261 TGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITN 7320

Query: 967  YFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTAR 1026
            Y V++    +  W  +    + T+   + LI   EY FRV  EN+ G+ +    S  TA+
Sbjct: 7321 YVVERRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQASPITAK 7380



 Score =  228 bits (581), Expect = 3e-59
 Identities = 138/484 (28%), Positives = 226/484 (46%), Gaps = 11/484 (2%)

Query: 535   KQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRI 594
             ++E P   +D   + +   ++V AG    + V   G P P   W K D   T    R  +
Sbjct: 19683 REEEPLFDIDSEMRKT---LIVKAGASFTMTVPFRGRPVPNVLWSKPD---TDLRTRAYV 19736

Query: 595   EKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDW 654
             +     +S  IE+A R D G+YT+ + N +     ++ ++V+D P PP  + +  V ++ 
Sbjct: 19737 DTTDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKES 19796

Query: 655   AILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVF 714
             A+L W+ P  DGG PV  Y +E+++   + W+ +        +Y+ T + EG +Y  RV 
Sbjct: 19797 AVLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNC-NRLSYKVTNLQEGAIYYFRVS 19855

Query: 715   AVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
               N  GV  P+   +        S P  L V  ++  + +L W  P   G   I  Y+VE
Sbjct: 19856 GENEFGVGIPAETKEGVKITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVE 19915

Query: 775   YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREI 834
                +G + WV       +     V  L   +   FRV   N AG S+P  L  PV I+E 
Sbjct: 19916 ALEKGQKNWVKCAV--AKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQ 19973

Query: 835   AEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLD-TSRVHVRTSDF 893
              EPP+I +      T   + G  L + +P  GKP P+V  ++ G PL  T R +   +  
Sbjct: 19974 LEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAE 20033

Query: 894   DTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTNALVE 952
             +    ++++  +D+G YE++    +    A I I V+++ GPP   V++ ++   +  ++
Sbjct: 20034 NLTINLKESVTADAGRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLK 20093

Query: 953   WQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENIC 1012
             W+ PK DG S++  Y + K +  T  W  V      T   V  L  G EY FR+  EN  
Sbjct: 20094 WEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRF 20153

Query: 1013  GLSD 1016
             G+SD
Sbjct: 20154 GISD 20157



 Score =  226 bits (577), Expect = 7e-59
 Identities = 133/383 (34%), Positives = 202/383 (52%), Gaps = 10/383 (2%)

Query: 638   VPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFE-VFTET 696
             VPD P+   +T V +D A++ W  P +DGGKP+T Y++E+++  S+RW ++  + +   T
Sbjct: 10514 VPDAPDQPIVTEVTKDSALVTWNKP-HDGGKPITNYILEKRETMSKRWARVTKDPIHPYT 10572

Query: 697   TYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFM---PIAPTSEPLHLIVEDVTDTTT 753
              +    ++EG  YE RV A N IG+  PS  +KP     PIA  S P++    D T  + 
Sbjct: 10573 KFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSV 10632

Query: 754   TLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCGFT---VKNLPTGARILFR 810
              L W+PP   G   I GY+VEY   G EEW  AN  P E C  T   V  L  G    FR
Sbjct: 10633 DLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTP-ESCPETKYKVTGLRDGQTYKFR 10691

Query: 811   VVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRP 870
             V+ VN AG S+PA + +PV +++  EPP++ L  ++ +    KVG+ L L    +G P P
Sbjct: 10692 VLAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFP 10751

Query: 871   QVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVV 930
             +V W K      T +  +  +   +   +R AA  D G Y L+V+      T ++++ V+
Sbjct: 10752 KVTWKKEDRDAPT-KARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVL 10810

Query: 931   EKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTS 990
             +K GPP ++ V E+   +  + W+ P DDG S I  Y V++ D  + +W  +   ++  S
Sbjct: 10811 DKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKS 10870

Query: 991   CTVSDLIVGNEYYFRVYTENICG 1013
                  L  GN+Y FRV  EN  G
Sbjct: 10871 HFAKHLNEGNQYLFRVAAENQYG 10893



 Score =  225 bits (574), Expect = 2e-58
 Identities = 147/490 (30%), Positives = 230/490 (46%), Gaps = 22/490 (4%)

Query: 534   PKQE----PPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLK--GDEVFTT 587
             PK E    PP+I LD   +     + + A   LRL V I G P P   W +  G+ +   
Sbjct: 15352 PKAEDRMLPPEIELDADLR---KVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESL--- 15405

Query: 588   TEGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRI 647
                +  IE     +  ++ +  R D G+Y + V N  G   A + ++V+D P PP+ +++
Sbjct: 15406 --DKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKV 15463

Query: 648   TSVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGI 707
               V +    L W+PP+ DGG  +  Y+VE+++   + +  +      +T+++  ++ EG 
Sbjct: 15464 KEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCH-KTSWKVDQLQEGC 15522

Query: 708   LYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGG 767
              Y  RV A N  G+  P+   +          P  + + DVT  + +L W  P   G   
Sbjct: 15523 SYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITLMDVTRNSVSLSWEKPEHDGGSR 15582

Query: 768   IDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQ 827
             I GY+VE   +GS++W    T  V     T+  L  G    FRV   N  G S+P  L+ 
Sbjct: 15583 ILGYIVEMQTKGSDKWATCATVKVTEA--TITGLIQGEEYSFRVSAQNEKGISDPRQLSV 15640

Query: 828   PVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPL-DTSRV 886
             PV  +++  PP  +L   L  T+    GE L + VPF G+P P V W K   PL  T+RV
Sbjct: 15641 PVIAKDLVIPPAFKL---LFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRV 15697

Query: 887   HVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVW 945
             +  +++ +++  ++ A R D G Y + +     +   T+ + V++K GPP   V + EV 
Sbjct: 15698 NAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVT 15757

Query: 946   GTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFR 1005
               +  + W  PK DG S I  Y V+K D  T  W  V      T+     L  G EY FR
Sbjct: 15758 ADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFR 15817

Query: 1006  VYTENICGLS 1015
             +  EN  G S
Sbjct: 15818 IAAENRYGKS 15827



 Score =  219 bits (557), Expect = 2e-56
 Identities = 145/484 (29%), Positives = 237/484 (48%), Gaps = 18/484 (3%)

Query: 538   PPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIE-K 596
             PP+  LD   + +   +++ AG  +RL V + G PPP  TW K +        R  ++ K
Sbjct: 13193 PPEGELDADLRKT---LILRAGVTMRLYVPVKGRPPPKITWSKPN---VNLRDRIGLDIK 13246

Query: 597   RVDCSSFV-IESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWA 655
               D  +F+  E+  + D G+Y + + N  G+   +I ++V+D P PP  V +  + +D A
Sbjct: 13247 STDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSA 13306

Query: 656   ILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFA 715
              + WEPP+ DGG P+  Y+V+++    + W  +  E  ++T++    + EG  Y  RVFA
Sbjct: 13307 YVTWEPPIIDGGSPIINYVVQKRDAERKSWSTVTTEC-SKTSFRVANLEEGKSYFFRVFA 13365

Query: 716   VNAIGVSQPSMNTKPFMPIAPTSEPL-HLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVE 774
              N  G+  P   T+  +  + T  P+  L V  V+ ++ ++ W+ P+  G   I GY+V+
Sbjct: 13366 ENEYGIGDPG-ETRDAVKASQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVD 13424

Query: 775   YCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREI 834
             +  E ++      +  ++   ++ K+L  G    FRV   N  G   P+ +   V  R+ 
Sbjct: 13425 FLTEENKWQRVMKSLSLQ---YSAKDLTEGKEYTFRVSAENENGEGTPSEIT--VVARDD 13479

Query: 835   AEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDT-SRVHVRTSDF 893
                P + L       Y+ K      L +P +GKP P V W KG  PL T +RV V +S  
Sbjct: 13480 VVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAV 13539

Query: 894   DTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEVWGTNALVE 952
             +T   V    +SD+G+Y ++++        TI I+VV K G P   +   EV      ++
Sbjct: 13540 NTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLK 13599

Query: 953   WQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENIC 1012
             W  PKDDG SEI  Y ++K D    +W       + T+  V+ L  G EY FRV  EN  
Sbjct: 13600 WAPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKY 13659

Query: 1013  GLSD 1016
             G+ +
Sbjct: 13660 GVGE 13663



 Score =  218 bits (556), Expect = 2e-56
 Identities = 158/516 (30%), Positives = 233/516 (45%), Gaps = 54/516 (10%)

Query: 529  KVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTT 588
            +++ V  QE P+I LD         + V AG K+ L  ++TG+P P  TW K D +    
Sbjct: 7181 EIQAVDTQEAPEIFLDVKLLAG---LTVKAGTKIELPATVTGKPEPKITWTKADMILKQD 7237

Query: 589  EGRTRIEKRVDCSSFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRIT 648
            + R  IE     S+  I  ++R D G Y I+  N  G   A + + V+D P PP A  IT
Sbjct: 7238 K-RITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDIT 7296

Query: 649  SVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGIL 708
             V  +  +L W PP  DGG  +T Y+VER+   S+ W KL+  V  +T +++TK+I    
Sbjct: 7297 DVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTV-KDTNFKATKLIPNKE 7355

Query: 709  YEMRVFAVNAIGVSQPSMNTKPF---MPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGA 765
            Y  RV A N  GV +P +   P        P   P  L   D+T    TL W  P+  G 
Sbjct: 7356 YIFRVAAENMYGVGEP-VQASPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGG 7414

Query: 766  GGIDGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATL 825
              I GY VE     +++WV  N  PV+   + VK L    +  FRV+  N+AG  +P+  
Sbjct: 7415 SPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKS 7474

Query: 826  AQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTK----GGAPL 881
             +P+ I++  +PP                       V   GK   ++ WTK    GGA +
Sbjct: 7475 TEPILIKDPIDPP----------------WPPGKPTVKDVGKTSVRLNWTKPEHDGGAKI 7518

Query: 882  DTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAG------- 934
            ++  + +  +  D   +VR A    + ++ L   +E  +   + R+R V KAG       
Sbjct: 7519 ESYVIEMLKTGTDE--WVRVAEGVPTTQHLLPGLMEGQE--YSFRVRAVNKAGESEPSEP 7574

Query: 935  --------------PPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWF 980
                          PP  + V  +    A ++W  P+ DG S I  Y V+K D +   W 
Sbjct: 7575 SDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQ 7634

Query: 981  NVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSD 1016
             V    + T CTV+ L  G+ Y FRV  EN  G SD
Sbjct: 7635 TVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSD 7670



 Score =  218 bits (556), Expect = 2e-56
 Identities = 180/670 (26%), Positives = 295/670 (44%), Gaps = 50/670 (7%)

Query: 364   EMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVIT 423
             E  VE   +G Q  W   G+  T E          +  ++ +L F    + ++G    +T
Sbjct: 20999 EYVVERKGKGEQT-WSHAGISKTCE------IEVSQLKEQSVLEFRVFAKNEKGLSDPVT 21051

Query: 424   NGGQCEAELIVEEKQLEVLQDI--ADLTVKASEQAVFKCEVSDE-KVTGKWYKNGVEVRP 480
              G     ELI+  +    L DI  A +TV+       +     + K +  W K+G+ ++ 
Sbjct: 21052 IGPITVKELIITPEV--DLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKE 21109

Query: 481   SKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPK 540
             S+ +  S       L I + + E  G YT + D     ++  +  + +     PK     
Sbjct: 21110 SEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKGP--- 21166

Query: 541   IHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGR--TRIEKRV 598
                             +  ++++ D  I     P      G+    + E R  ++   ++
Sbjct: 21167 ----------------IRFDEIKADSVILSWDVPEDNG-GGEITCYSIEKRETSQTNWKM 21209

Query: 599   DCSS-----FVIESAQREDEGRYTIKVTNPVGED---VASIFL--QVVDVPDPPEAVRIT 648
              CSS     F + +  ++ E ++ ++  N  G     V+SI +      +P PP    I 
Sbjct: 21210 VCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIY 21269

Query: 649   SVGEDWAILVWEPPMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGIL 708
             +V  D   L W+ P+YDGG  VTG+ VE+K++ S  W K+N    +   Y +T ++EG+ 
Sbjct: 21270 NVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLD 21329

Query: 709   YEMRVFAVNAIGVSQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGI 768
             Y+ RV+A N+ G+S PS  +K  + ++P   P      DVT  T TLKW PP R G   I
Sbjct: 21330 YQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKI 21389

Query: 769   DGYLVEYCLEGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGR-SEPATLAQ 827
              GY +E   +G+E WV  N   V  C +TV  L  G R  FR++  N  G  S P+  + 
Sbjct: 21390 VGYSIEK-RQGNERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSG 21448

Query: 828   PVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVH 887
              +  R+   PP +          I K GE L +    QG+P P+V W K G  ++  R++
Sbjct: 21449 IIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIE-KRMN 21507

Query: 888   VRTSDF--DTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPIN-VMVKEV 944
             +  +D    T  FVR A R   G Y +  +  +    A I+++V +  G  +  +    +
Sbjct: 21508 MEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNI 21567

Query: 945   WGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYF 1004
              G    + W AP +DG + I  Y ++K +   + W  + ++    S T   LI GNEY F
Sbjct: 21568 TGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQF 21627

Query: 1005  RVYTENICGL 1014
             RV   N  G+
Sbjct: 21628 RVSAVNKFGV 21637



 Score =  218 bits (555), Expect = 3e-56
 Identities = 160/568 (28%), Positives = 254/568 (44%), Gaps = 31/568 (5%)

Query: 471   WYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKV 530
             W+K+ V ++ + R+          L I D   ED G Y