Guide to the Human Genome
Home | Table of Contents | Search text | Search genes | Search sequences | Purchase | FAQ | Blog | Help

Search of human proteins with 253970427

BLASTP 2.2.11 [Jun-05-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|253970427 immunoglobulin superfamily, member 22 [Homo
sapiens]
         (1326 letters)

Database: hs.faa 
           37,866 sequences; 18,247,518 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|253970427 immunoglobulin superfamily, member 22 [Homo sapiens]    2662   0.0  
gi|148839296 immunoglobulin-like and fibronectin type III domain...   579   e-165
gi|110349719 titin isoform N2-A [Homo sapiens]                        423   e-118
gi|110349717 titin isoform novex-2 [Homo sapiens]                     423   e-118
gi|110349713 titin isoform novex-1 [Homo sapiens]                     423   e-118
gi|110349715 titin isoform N2-B [Homo sapiens]                        423   e-118
gi|133908641 myosin binding protein C, fast type [Homo sapiens]       310   8e-84
gi|46049110 myosin binding protein C, slow type isoform 4 [Homo ...   303   6e-82
gi|46049125 myosin binding protein C, slow type isoform 2 [Homo ...   303   6e-82
gi|45976288 myosin binding protein C, slow type isoform 1 [Homo ...   303   6e-82
gi|46049119 myosin binding protein C, slow type isoform 3 [Homo ...   291   4e-78
gi|148596957 myosin binding protein C, cardiac [Homo sapiens]         278   2e-74
gi|110349721 titin isoform novex-3 [Homo sapiens]                     201   3e-51
gi|140560917 myomesin 1 isoform b [Homo sapiens]                      190   7e-48
gi|55956914 myosin binding protein H [Homo sapiens]                   186   1e-46
gi|140560919 myomesin 1 isoform a [Homo sapiens]                      170   7e-42
gi|156104903 myomesin 2 [Homo sapiens]                                168   3e-41
gi|58331253 obscurin, cytoskeletal calmodulin and titin-interact...   165   3e-40
gi|148833506 obscurin, cytoskeletal calmodulin and titin-interac...   165   3e-40
gi|155969693 myomesin family, member 3 [Homo sapiens]                 164   7e-40
gi|144226847 obscurin-like 1 [Homo sapiens]                           145   3e-34
gi|194018539 myosin binding protein H-like [Homo sapiens]             127   5e-29
gi|116008194 myosin light chain kinase isoform 3A [Homo sapiens]      123   1e-27
gi|116008192 myosin light chain kinase isoform 1 [Homo sapiens]       123   1e-27
gi|20127422 Down syndrome cell adhesion molecule isoform CHD2-42...   121   4e-27
gi|83281200 protogenin [Homo sapiens]                                 120   7e-27
gi|110431348 deleted in colorectal carcinoma [Homo sapiens]           120   1e-26
gi|33519481 neural cell adhesion molecule 2 precursor [Homo sapi...   119   1e-26
gi|157311649 neogenin homolog 1 [Homo sapiens]                        112   2e-24
gi|7657361 contactin 6 [Homo sapiens]                                 109   2e-23

>gi|253970427 immunoglobulin superfamily, member 22 [Homo sapiens]
          Length = 1326

 Score = 2662 bits (6900), Expect = 0.0
 Identities = 1326/1326 (100%), Positives = 1326/1326 (100%)

Query: 1    MTTIHSRQMLQEHVSMEFSSSTTHVQTFSQTTKIVGEEVVRRKSSSIVEFFSLVTRSSNI 60
            MTTIHSRQMLQEHVSMEFSSSTTHVQTFSQTTKIVGEEVVRRKSSSIVEFFSLVTRSSNI
Sbjct: 1    MTTIHSRQMLQEHVSMEFSSSTTHVQTFSQTTKIVGEEVVRRKSSSIVEFFSLVTRSSNI 60

Query: 61   PAGDSVPEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSIN 120
            PAGDSVPEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSIN
Sbjct: 61   PAGDSVPEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSIN 120

Query: 121  KEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPKK 180
            KEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPKK
Sbjct: 121  KEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPKK 180

Query: 181  KQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVEVEAIRILKPL 240
            KQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVEVEAIRILKPL
Sbjct: 181  KQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVEVEAIRILKPL 240

Query: 241  EDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNV 300
            EDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNV
Sbjct: 241  EDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNV 300

Query: 301  NMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVW 360
            NMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVW
Sbjct: 301  NMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVW 360

Query: 361  KFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPIK 420
            KFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPIK
Sbjct: 361  KFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPIK 420

Query: 421  FVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDA 480
            FVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDA
Sbjct: 421  FVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDA 480

Query: 481  QLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDE 540
            QLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDE
Sbjct: 481  QLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDE 540

Query: 541  KVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIAD 600
            KVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIAD
Sbjct: 541  KVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIAD 600

Query: 601  PPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGE 660
            PPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGE
Sbjct: 601  PPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGE 660

Query: 661  DQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHM 720
            DQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHM
Sbjct: 661  DQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHM 720

Query: 721  KWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVN 780
            KWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVN
Sbjct: 721  KWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVN 780

Query: 781  SEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVER 840
            SEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVER
Sbjct: 781  SEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVER 840

Query: 841  RKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPV 900
            RKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPV
Sbjct: 841  RKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPV 900

Query: 901  KPPGLVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCY 960
            KPPGLVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCY
Sbjct: 901  KPPGLVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCY 960

Query: 961  TVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGT 1020
            TVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGT
Sbjct: 961  TVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGT 1020

Query: 1021 ALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNE 1080
            ALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNE
Sbjct: 1021 ALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNE 1080

Query: 1081 FGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTA 1140
            FGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTA
Sbjct: 1081 FGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTA 1140

Query: 1141 TWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAK 1200
            TWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAK
Sbjct: 1141 TWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAK 1200

Query: 1201 LKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFW 1260
            LKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFW
Sbjct: 1201 LKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFW 1260

Query: 1261 YNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASITESLQK 1320
            YNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASITESLQK
Sbjct: 1261 YNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASITESLQK 1320

Query: 1321 KSKHLM 1326
            KSKHLM
Sbjct: 1321 KSKHLM 1326


>gi|148839296 immunoglobulin-like and fibronectin type III domain
            containing 1 [Homo sapiens]
          Length = 868

 Score =  579 bits (1492), Expect = e-165
 Identities = 301/791 (38%), Positives = 447/791 (56%), Gaps = 8/791 (1%)

Query: 519  GMSDVHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPE 578
            G++D+    G  A L   L  +   G W KDG ++T   G+   + G VH L    +   
Sbjct: 78   GLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGT 137

Query: 579  HEGKYTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPK 638
              G+YTF A   +SEA++ + D PTI P V E L    + VK G    +K+PF+     +
Sbjct: 138  QAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLR-EPLVVKAGKPVIVKIPFQSHLPIQ 196

Query: 639  VTWYKDGMEV--TEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLS 696
              W KDG EV  + +    ++ G+    L + +  R+D G   + L+++ GS  A L L 
Sbjct: 197  AAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQ 256

Query: 697  VLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDG 756
            V+D+P PPQG +E  +   + V ++W+ P+DNGGR V  ++VERR  G+ +W+K+GE   
Sbjct: 257  VIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPA 316

Query: 757  KVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKE 816
              T F+   VE G+ Y FR+ AV SEG  + LE+EE+    P   P   S P +   + +
Sbjct: 317  DSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQ 375

Query: 817  AVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRV 876
             +T+TW AP   G A +LGY++ERRKKGSN W  VN  P+   + TV  + +  +YEFRV
Sbjct: 376  GITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRV 435

Query: 877  IAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREP--AEGDPPSG 934
             AV  +GPG+P  PS +V A+DP++PPGLV++L V+D SN+SI+L+W  P   EGD   G
Sbjct: 436  TAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQG 495

Query: 935  YILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVR 994
            Y++E+ + D+ +W  C    +  T YT  GL   + YF R+ AVNE G  +P  LD  V+
Sbjct: 496  YVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQ 555

Query: 995  AMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKS 1054
            AMP    PKF + +  K  + V+ G  + +  +F   P P+V W KDG+P   R      
Sbjct: 556  AMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTK 615

Query: 1055 KNHSQFLINSTKRSDSGVYRILLQNEFG-EARYDIHVRVADFPRPPTNLRLFEEVPNTVT 1113
               +Q LI     SDSG+Y ++L+   G E  +   +RVA  P+ P  + L E VP TVT
Sbjct: 616  DGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVT 675

Query: 1114 LTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARN 1173
              W  SPD  +D   HY +  R ++   W+ AA+R+ +N++T+ G+LPG +Y+FRVVA+N
Sbjct: 676  AEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKN 735

Query: 1174 EIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMT 1233
            E+G S+P D+   W I + Q    + K   Y + D    PRF+  L+ H + +G +C M+
Sbjct: 736  ELGASKPSDTSQPWCIPR-QRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMS 794

Query: 1234 CAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGK 1293
            CA  G+PRP VT +K D ++  N   +     GVC+L IP+ + KDSG+Y  + EN LG+
Sbjct: 795  CAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQ 854

Query: 1294 DRSSCTLTVYD 1304
              S+ TL V +
Sbjct: 855  AVSTATLIVIE 865



 Score =  137 bits (346), Expect = 5e-32
 Identities = 137/551 (24%), Positives = 214/551 (38%), Gaps = 50/551 (9%)

Query: 389 KDARLSDSGEFSAEAGNLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVT 448
           +DA  S +  +    G+  + AQ  +      F   L ++ V+    A L C LTS    
Sbjct: 47  RDATRSSTSRYKPGTGSFSKDAQGPMGH----FSQGLADMEVQPGEAATLSCTLTSDLGP 102

Query: 449 LRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVT 508
             W KDG  L          +G    L I   Q +  G YT VA   GD     S A +T
Sbjct: 103 GTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVA---GD---QQSEATLT 156

Query: 509 VEERLATVKSGMSD-----VHAATGSPAELCVVLNDE-KVEGVWLKDGKEITDLPG--MQ 560
           V++   T+   +++     +    G P  + +       ++  W KDG E+        Q
Sbjct: 157 VQDS-PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQ 215

Query: 561 IVKQGAVHKLIFPSMGPEHEGKY--TFRAKG--TESEASVFIADPPTIDPSVLEALAAHA 616
           +       +L  PS G +  G+Y  T R++G   ++E ++ + D P      +E    H 
Sbjct: 216 VDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHR 275

Query: 617 ITVKV---------GHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTI 667
             V +         G T    V  R +   + TW K G           E   D    T 
Sbjct: 276 AGVCLRWRPPRDNGGRTVECYVVER-RQAGRSTWLKVG-----------EAPADSTTFTD 323

Query: 668 SNCVREDSGLILLKLKNDHGSATATLHLSVL----DRPKPPQGRVEFLELSGSCVHMKWK 723
           ++          ++     G+  A     +L      PK P      L  S   + + W 
Sbjct: 324 AHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPA-ILSASSQGITLTWT 382

Query: 724 APKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEG 783
           AP+  G   +  +++ERR  G  +W  + +       ++   V +G  Y+FR+ AV   G
Sbjct: 383 APRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSG 442

Query: 784 VSDP-LETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRK 842
             +P   ++ VFA +P+ PPG     QVTD +  ++T++W  P    G    GY+VE   
Sbjct: 443 PGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCS 502

Query: 843 KGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKP 902
             S  W+P +   +  T  T  GL     Y  RV AVN+ G  QPS   + V A      
Sbjct: 503 SDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVC 562

Query: 903 PGLVQDLHVSD 913
           P  + D    D
Sbjct: 563 PKFLVDSSTKD 573



 Score = 91.7 bits (226), Expect = 4e-18
 Identities = 164/784 (20%), Positives = 276/784 (35%), Gaps = 92/784 (11%)

Query: 360  WKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPI 419
            W  +G +L   D   +   +DGL H+L I   + + +G ++  AG+   +A LT+   P 
Sbjct: 105  WFKDGVKLTTQDG--VIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPT 162

Query: 420  KFVSNLKNVR----VKERSRACLECELTSK-DVTLRWKKDGQLLMHGT--KYSMNHEGKR 472
                  + +R    VK      ++    S   +   W+KDG  ++  +  +  ++     
Sbjct: 163  IAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGY 222

Query: 473  AELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAA------ 526
              L +  A   D G+Y+V    +G   +   T  V  +         + D H A      
Sbjct: 223  TRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRW 282

Query: 527  ------TGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHE 580
                   G   E  VV   +     WLK G+   D                F     E  
Sbjct: 283  RPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPAD-------------STTFTDAHVEPG 329

Query: 581  GKYTFRAKGTES-------EASVFIADPPTID-----PSVLEALAAHAITV-----KVGH 623
             KYTFR +   S       E+   +  P  +      P++L A ++  IT+     +   
Sbjct: 330  RKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSA-SSQGITLTWTAPRGPG 388

Query: 624  TAHI-KVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKL 682
            +AHI       +     TW     +   E R ++                  SG      
Sbjct: 389  SAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSG------ 442

Query: 683  KNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRA 742
              + G  +  +      RP      ++  + S + + + W  P    G     ++VE  +
Sbjct: 443  PGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCS 502

Query: 743  VGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEP- 801
                 W+        VT ++   +  G+ Y  R+ AVN  G S P   + +    P+   
Sbjct: 503  SDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVC 562

Query: 802  PGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNL---WVPVNKDPIQG 858
            P F       D+    V  T   P      P+    V   K G  L    V V KD +  
Sbjct: 563  PKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPE--VTWLKDGLPLPKRSVTVTKDGLTQ 620

Query: 859  TKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSS 918
                V GL +   Y      V +   G+    S  +      + PG    +H+ ++   +
Sbjct: 621  LLIPVAGLSDSGLY----TVVLRTLQGKEVAHSFRIRVAACPQAPG---PIHLQENVPGT 673

Query: 919  ISLAWR-EPAEG-DPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIR 976
            ++  W   P E  D P  Y +  R+     W +     I    +T+ G++   +Y FR+ 
Sbjct: 674  VTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAAD-RIHTNRFTLLGILPGHEYHFRVV 732

Query: 977  AVNEAGVGEP--------VELDKGVRAMPPPAAPKFDLSAR------LKSHMVVRAGTAL 1022
            A NE G  +P        +   +    +  P   + DLS +      L+SH++ + G   
Sbjct: 733  AKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQ-GCEC 791

Query: 1023 CIHAAFSGSPPPDVIWQKDGVPTKGRETI--TKSKNHSQFLINSTKRSDSGVYRILLQNE 1080
            C+  A  GSP P V W K+    +G   +  T         I S    DSG Y+ + +N 
Sbjct: 792  CMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENT 851

Query: 1081 FGEA 1084
             G+A
Sbjct: 852  LGQA 855



 Score = 40.8 bits (94), Expect = 0.009
 Identities = 22/93 (23%), Positives = 44/93 (47%), Gaps = 1/93 (1%)

Query: 67  PEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLK 126
           P F+   +    P+G +      VQG+ +PH++W +     ++ +  ++   +     L 
Sbjct: 774 PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDR-SLEGNPAVYSTDLLGVCSLT 832

Query: 127 LEPLTSDDSDNYKCIASNDHADAIYTVSLLVTE 159
           +  ++  DS  YK +A N    A+ T +L+V E
Sbjct: 833 IPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865



 Score = 38.1 bits (87), Expect = 0.056
 Identities = 42/143 (29%), Positives = 65/143 (45%), Gaps = 17/143 (11%)

Query: 287 KQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEP------LKFLGEMKPVKVT 340
           KQ G  + L I++V    AG Y+   GD++  A LTV D P       + L E  P+ V 
Sbjct: 121 KQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLRE--PLVVK 178

Query: 341 ERQTAVFEIRLSKKEP-NFVWKFNGKELKRDDKYEITVS-EDGLTHTLKIKDARLSDSGE 398
             +  + +I      P    W+ +G E+      E  V   DG T  L +  A   D G+
Sbjct: 179 AGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTR-LCLPSAGRKDCGQ 237

Query: 399 FS----AEAGNLVQKAQLTIDRI 417
           +S    +E G++  +A+LT+  I
Sbjct: 238 YSVTLRSEGGSV--QAELTLQVI 258



 Score = 33.9 bits (76), Expect = 1.1
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 1266 GVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDD 1307
            G   L +P+   KD G YSV + +E G  ++  TL V DK D
Sbjct: 221  GYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPD 262


>gi|110349719 titin isoform N2-A [Homo sapiens]
          Length = 33423

 Score =  423 bits (1087), Expect = e-118
 Identities = 299/1086 (27%), Positives = 497/1086 (45%), Gaps = 54/1086 (4%)

Query: 121   KEHVLKLEPLTSDDSDNYKCIASNDHADAIYTV------------SLLVTEGQEKMDFKK 168
             ++ +L ++    +D+ NY C   +   D    V            +L + EG EK +F  
Sbjct: 12515 RKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEG-EKAEFVC 12573

Query: 169   MLKKRAPPAPKKKQKKVANEKEMLEILSKVPKKDF---EKVCMEYG-FTDFRGLLRKLKE 224
              + K + P   K+  K     +  ++++   K+     +    + G +    G  R    
Sbjct: 12574 SISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAH 12633

Query: 225   MKKKVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKY 284
             +     +E +RI+ PL+D   K    VVF+C  E+     K  W +  E +   +   KY
Sbjct: 12634 L---TVIEKLRIVVPLKDTRVKEQQEVVFNC--EVNTEGAKAKWFRNEEAI---FDSSKY 12685

Query: 285   DVKQMGTKYMLVISNVNMNDAGIYSLSVGDKR-----MSAELTVLDEPLKFLGEMKPVKV 339
              + Q    Y L I + +++D   Y++S+ + R      +A L V +E L+ +  +K ++ 
Sbjct: 12686 IILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIET 12745

Query: 340   TERQTAVFEIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEF 399
              E+++  F  ++++      W  NG+E+  D++    V  D   H L IKD    D GE+
Sbjct: 12746 MEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRV--DKYKHMLTIKDCGFPDEGEY 12803

Query: 400   SAEAGNLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLM 459
                AG     A+L I   P +FV +L++  V E   A   C+L+ +   ++W ++G+ + 
Sbjct: 12804 IVTAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIK 12863

Query: 460   HGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSG 519
              G KY    +G    LII+D +L D  EY    ++D       S A + VEE    +   
Sbjct: 12864 EGKKYKFEKDGSIHRLIIKDCRLDDECEYAC-GVEDRK-----SRARLFVEEIPVEIIRP 12917

Query: 520   MSDVHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEH 579
               D+  A G+       LN +KVE  WL++   +      Q++ +G +H+L    + P  
Sbjct: 12918 PQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRD 12977

Query: 580   EGKYTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKV 639
             +G+Y F AK  E+ A + +A  P I        A   + V VG    + VP+   P  + 
Sbjct: 12978 QGEYRFIAKDKEARAKLELAAAPKIKT------ADQDLVVDVGKPLTMVVPYDAYPKAEA 13031

Query: 640   TWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLD 699
              W+K+   ++ +   +++   +Q    I    + D G   + L+N HG A   ++L V+D
Sbjct: 13032 EWFKENEPLSTK---TIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVID 13088

Query: 700   RPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVT 759
              P P +  +E  E     V + W+ P  +GG  +  ++VERR + +K+W+   +      
Sbjct: 13089 VPGPVRN-LEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDRAESCE 13147

Query: 760   NFSTNKVEEGKAYQFRILAVNSEGVSDPLETEE-VFAGNPIEPPGFASQPQVTDVTKEAV 818
                T   + G  Y FR+ A N  G  +P+ET+  V A +  + PG      +TDV +  V
Sbjct: 13148 FTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGV 13207

Query: 819   TITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIA 878
             ++TW  P  DGGA +  Y++E R K S  W        +    TV  ++E  EY FRV A
Sbjct: 13208 SLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRA 13267

Query: 879   VNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYI 936
              N+ G G+PS  +  V   DP++ P    +L  SD + SS+ L W  P +  G P  GYI
Sbjct: 13268 QNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYI 13327

Query: 937   LEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAM 996
             +E   E    W +C    +    Y V GL +  KY +R+ A N+AGV +P E+   + A 
Sbjct: 13328 IERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTAD 13387

Query: 997   PPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIW--QKDGVPTKGRETITKS 1054
                  P  DLSA  K  + V     + I    +G P P   W      + T  R  +   
Sbjct: 13388 DAFVEPTMDLSA-FKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTL 13446

Query: 1055  KNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTL 1114
               +++ +I+ ++RSD G+Y + L+N       +I V V   P  P  L+  +   ++V L
Sbjct: 13447 SAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHL 13506

Query: 1115  TWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNE 1174
             TW    D        Y++ KR+ S  TW    + V   ++TV  L+ G++Y F+V ARN+
Sbjct: 13507 TWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNK 13566

Query: 1175  IGDSEP 1180
              G  EP
Sbjct: 13567 CGPGEP 13572



 Score =  380 bits (977), Expect = e-105
 Identities = 300/1056 (28%), Positives = 483/1056 (45%), Gaps = 93/1056 (8%)

Query: 288   QMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVF 347
             +MG KY   ++ VN+     YS S+ +      + + D  L+   ++K   VT R  A  
Sbjct: 29408 KMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPD--LELADDLKKT-VTIRAGASL 29464

Query: 348   EIRLS---KKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKD-ARLSDSGEFSAEA 403
              + +S   +  P   W   G +L      + T S     ++L I D     D+G+++ EA
Sbjct: 29465 RLMVSVSGRPPPVITWSKQGIDLASRAIIDTTES-----YSLLIVDKVNRYDAGKYTIEA 29519

Query: 404   GNLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWK---KDGQLLMH 460
              N   K   T+            +V+VKE SR           VT+ W+    DG   ++
Sbjct: 29520 ENQSGKKSATVLVKVYDTPGPCPSVKVKEVSR---------DSVTITWEIPTIDGGAPVN 29570

Query: 461   GTKYSMNHEGKRA---------ELIIEDAQLSDGGEYTVVAMQD-----GDPTEYYSTAI 506
                        RA         + +   + L +G  Y    + +     G+P E  S A+
Sbjct: 29571 NYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCE-TSDAV 29629

Query: 507   VTVEERLATVKSGMSDVHAATGSPA-ELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQG 565
             +  E  L   K  + DV  +T + A E  +     ++ G  L+  K  T+     +  + 
Sbjct: 29630 LVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKP 29689

Query: 566   AVHKLIFPSMGPEHEGKYTFRAKG-------TESEASVFIAD---PPTIDPSVLEALAAH 615
              V +    S+    +  +  RA+         E+  +V + D    PTID S +     H
Sbjct: 29690 TVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLRVLPTIDLSTMPQKTIH 29749

Query: 616   AITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDS 675
                V  G    + +P  G+P P  +W+  G ++ E ERV++E     A LTI      D+
Sbjct: 29750 ---VPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDT 29806

Query: 676   GLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQ 735
             G   L+LKN  G+ + T+ + +LD+P PP G ++  E+  + + + W+ P+ +GG P++ 
Sbjct: 29807 GEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPELDGGAPLSG 29866

Query: 736   FIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFA 795
             ++VE+R   +  W+ + E   + T F   ++ EG  Y FR+ A N  G+   L++E +  
Sbjct: 29867 YVVEQRDAHRPGWLPVSESVTRST-FKFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIEC 29925

Query: 796   GNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDP 855
              + I  PG     Q+ DV+++ +T+TW  P  DGG+ V GYIVER++  ++ WV VNK P
Sbjct: 29926 RSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVP 29985

Query: 856   IQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSS 915
             +  T+    GL E  EYE RV A+N  G G+PS PS  +VA DP+ PPG  Q+  V+D++
Sbjct: 29986 VTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTT 30045

Query: 916   NSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFF 973
              +S+SLAW  P +  G   +GY++EM+  D  EW+KC   P     YT+  L +  +Y F
Sbjct: 30046 RTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREYTLTHLPQGAEYRF 30105

Query: 974   RIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPP 1033
             R+ A N  G GEP E+   V+       P ++L  R +  + VR G  + +     G P 
Sbjct: 30106 RVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPF 30165

Query: 1034  PDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVA 1093
             P   W K+G     R  I  S+ H++ +I    R DSG Y ++L+N+ G+    I VRV 
Sbjct: 30166 PICKWTKEGQDISKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVI 30225

Query: 1094  DFPRPPTNLRLFEEVP-NTVTLTWNHSPDVQEDGEAH---YIIMKRDASTATWYTAAERV 1149
               P  P     ++++   +V ++W    D   DG A    YI+ +R+   A WYT   RV
Sbjct: 30226 GSPNSPEGPLEYDDIQVRSVRVSWRPPAD---DGGADILGYILERREVPKAAWYTIDSRV 30282

Query: 1150  FSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDW 1209
                   V GL    +Y+FRV A N+ G S+PL S +                 P   K  
Sbjct: 30283 RGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEE-----------------PVTPKTP 30325

Query: 1210  RHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRP------TVTLYKGDVNITANSKFWYNS 1263
              + P    P  P  VL   D T +   L   RP       VT Y  +   T+  K+  ++
Sbjct: 30326 LNPPE--PPSNPPEVL---DVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHN 30380

Query: 1264  TSGVCTLVIPTCTLKDSGDYS--VLVENELGKDRSS 1297
              + + T +     L    +Y   ++ +N++G   +S
Sbjct: 30381 KTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETS 30416



 Score =  377 bits (967), Expect = e-104
 Identities = 245/766 (31%), Positives = 380/766 (49%), Gaps = 52/766 (6%)

Query: 448   TLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIV 507
             +L W K    L+  T+Y      +  E       L+  G     +     PTEY      
Sbjct: 19135 SLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAG-----SSPPSKPTEY------ 19183

Query: 508   TVEERLATVKSGMSDVHAATGSPAELCVVL----NDEKVEGVWLKDGKEITDLPGMQIVK 563
              V  R+     G  +V   T S   L           K+ G ++    E   LPG + V+
Sbjct: 19184 -VTARMPVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFV----EACKLPGDKWVR 19238

Query: 564   -QGAVHKLI---FPSMGPEHEGKYTFRA----------KGTESEASVFIAD--PPTIDPS 607
                A H++    + + G E + +Y FRA              S+    +A+  PP ID S
Sbjct: 19239 CNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLS 19298

Query: 608   VLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTI 667
             V        +TVK G    +     GKP+P V+W KDG  +   E + M    +   L +
Sbjct: 19299 VA---MKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLEL 19355

Query: 668   SNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKD 727
              +  R+DSG   +  +N  GS +AT+ L VLD+P PP   V+  ++      + W+ P +
Sbjct: 19356 FSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPAS-VKINKMYSDRAMLSWEPPLE 19414

Query: 728   NGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDP 787
             +GG  +T +IV++R   + +W ++      +T+ S  K+ EG  YQFRI A N  GV DP
Sbjct: 19415 DGGSEITNYIVDKRETSRPNWAQVSATV-PITSCSVEKLIEGHEYQFRICAENKYGVGDP 19473

Query: 788   LETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNL 847
             + TE   A NP +PPG    P ++++TK+ +T++W  P  DGG+P+ GY++E+R+  +  
Sbjct: 19474 VFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVN 19533

Query: 848   WVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQ 907
             W  VN+ PI        GL E TEYEFRV A+NKAGPG+PS  S +  A+DP  PPG   
Sbjct: 19534 WTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGPPA 19593

Query: 908   DLHVSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIP--ISGTCYTVG 963
                V D++ SS+SL+W +PA   G P  GY++E++  D+  W +C  +P  +  T + V 
Sbjct: 19594 FPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRC-NLPQNLQKTRFEVT 19652

Query: 964   GLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALC 1023
             GL+E  +Y FR+ AVN+ G  +P ++            P+ +L A L+  +++RAG  + 
Sbjct: 19653 GLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTMR 19712

Query: 1024  IHAAFSGSPPPDVIWQKDGVPTKGRETI-TKSKNHSQFL-INSTKRSDSGVYRILLQNEF 1081
             ++    G PPP + W K  V  + R  +  KS +   FL   +  + D+G Y + L+N  
Sbjct: 19713 LYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSC 19772

Query: 1082  GEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDAST 1139
             G+  Y I V+V D P PP N+ + E   ++  +TW   P + + G    +Y++ KRDA  
Sbjct: 19773 GKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTW--EPPIIDGGSPIINYVVQKRDAER 19830

Query: 1140  ATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRD 1185
              +W T         + V  L  G+ Y+FRV A NE G  +P ++RD
Sbjct: 19831 KSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGETRD 19876



 Score =  372 bits (954), Expect = e-102
 Identities = 280/973 (28%), Positives = 457/973 (46%), Gaps = 72/973 (7%)

Query: 262   PNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSL----SVGDKRM 317
             P   + W+K  EPL+      + +V++  T  +L I   N +D G Y++    S G    
Sbjct: 24339 PRPNISWVKDGEPLK---QTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATE 24395

Query: 318   SAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVW--KFNGKELKRDDKYEI 375
             +  + VL++P   +G   PV+  E  +A F + +S + P +    + +   +++ D    
Sbjct: 24396 NLSVIVLEKPGPPVG---PVRFDE-VSADFVV-ISWEPPAYTGGCQISNYIVEKRDTTTT 24450

Query: 376   T---VSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKA-----QLTIDRIPIK------- 420
             T   VS      T+KI   +     +F   A N   K+     +  I + P K       
Sbjct: 24451 TWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGT 24510

Query: 421   -FVSNLKNVR--------VKERSRACLECELTSKDV-TLRWKKDGQLLMHGTKYSMN--H 468
              FV+++   +        V +     +   L  K+  ++ W K  +  +  TK+      
Sbjct: 24511 PFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLD 24570

Query: 469   EGKRAELIIEDAQLSDGGEYT-----VVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDV 523
             EG   E  +    +   G+ +      VA    DP       ++T        K    D 
Sbjct: 24571 EGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKKPAYD- 24629

Query: 524   HAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVH--KLIFPSMGPEHEG 581
                 GS     +V   +  +G W+K     T++   +    G V   +  F  +     G
Sbjct: 24630 ---GGSKITGYIVEKKDLPDGRWMK--ASFTNVLETEFTVSGLVEDQRYEFRVIARNAAG 24684

Query: 582   KYTFRAKGTESEASVFIADPP--TIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKV 639
              ++  +  + +  +    D P  ++DP   + +  HA     G T  ++   RGKP+P V
Sbjct: 24685 NFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHA-----GETFVLEADIRGKPIPDV 24739

Query: 640   TWYKDGMEVTEEE-RVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVL 698
              W KDG E+ E   R+ ++    +  L + +C+R D G  +LKL N  G+ +  + + VL
Sbjct: 24740 VWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVL 24799

Query: 699   DRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKV 758
             DRP PP+G ++   ++    ++ W  P  +GG  ++ +I+E+R   + SW ++   + + 
Sbjct: 24800 DRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVS-TEVQA 24858

Query: 759   TNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAV 818
              N+   K+  G  Y FR++AVN  G+ +PLE+  V A NP +PPG  S P+V+ +TK+++
Sbjct: 24859 LNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSM 24918

Query: 819   TITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIA 878
              +TW  P  DGG  + GYI+E+R K    W   NK  +   +  V GL E   YEFRV A
Sbjct: 24919 VVTWARPVDDGGTEIEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAA 24978

Query: 879   VNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDPPSGYI 936
              N AG G+PS PS    A D + PPG   +  V+D+S SS+SLAW +P    G P  GY+
Sbjct: 24979 ENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYV 25038

Query: 937   LEMRAEDTKEWSKCT-KIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRA 995
             +E++     EW+ CT    + G  +TV  L E  +Y FRI A+N  GVGEP  L   V A
Sbjct: 25039 VEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVA 25098

Query: 996   MPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQK-DGVPTKGRETITKS 1054
                   P+ +L A L+  +V+RA   L +     G P P+V W+K +G+ T  R  I  +
Sbjct: 25099 QERIEPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT-DRAQIEVT 25157

Query: 1055  KNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTL 1114
              + +  +I++  R DSG Y + L+N  G     ++VRV D P  P NL + E   ++VTL
Sbjct: 25158 SSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTL 25217

Query: 1115  TWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVAR 1172
             +W   P + + G    +YI+ KR+ +   + T         + +  L  G  YYFRV+A 
Sbjct: 25218 SW--EPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKTTFRIENLQEGCSYYFRVLAS 25275

Query: 1173  NEIGDSEPLDSRD 1185
             NE G   P ++ +
Sbjct: 25276 NEYGIGLPAETTE 25288



 Score =  369 bits (946), Expect = e-101
 Identities = 203/577 (35%), Positives = 321/577 (55%), Gaps = 11/577 (1%)

Query: 617   ITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSG 676
             +  + G +  ++    GKP P + WYKD  E+     V +E   D A + I +  R +SG
Sbjct: 26882 VKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSG 26941

Query: 677   LILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQF 736
                LKL+N  GSA+AT+ + +LD+P PP G +EF  ++   + + W+ P D+GG  +T +
Sbjct: 26942 CYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHY 27001

Query: 737   IVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAG 796
             IVE+R   +  W  + E   +    +T K+ +G  Y FR+ AVN  G+ +PLE++ V A 
Sbjct: 27002 IVEKRETSRVVWSMVSEHLEECI-ITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAK 27060

Query: 797   NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
             N    PG    P+VT +TK ++T+ W+ P  DGG+ + GY +E+R K S  W  V K+ I
Sbjct: 27061 NAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETI 27120

Query: 857   QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
             + T+  V GL E+++Y++RV AVN AG G  S PS    A DP+ PPG    + ++DS+ 
Sbjct: 27121 RDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTK 27180

Query: 917   SSISLAWREPA--EGDPPSGYILEMRAEDTKEWSK-CTKIPISGTCYTVGGLIERQKYFF 973
             SSI+L W +P    G   +GY++E+R  + +EW+   TK  +  T Y V  L     Y+F
Sbjct: 27181 SSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYF 27240

Query: 974   RIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPP 1033
             R+ AVN AG GEP+E+++ V+A     AP+ DL   L++ ++ +AG  + +   F G PP
Sbjct: 27241 RVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPP 27300

Query: 1034  PDVIWQKD--GVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYD-IHV 1090
             P V W+KD   + +  R +I  + + S   I    R+D+G Y + ++N  GE +   + V
Sbjct: 27301 PTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSV 27360

Query: 1091  RVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAER 1148
             +V D P     L++      TVTL W+  P + + G    +Y+I KRDA+  TW   + +
Sbjct: 27361 KVLDTPAACQKLQVKHVSRGTVTLLWD--PPLIDGGSPIINYVIEKRDATKRTWSVVSHK 27418

Query: 1149  VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRD 1185
               S  + +  L     ++FRV+A NEIG  EP ++ +
Sbjct: 27419 CSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTE 27455



 Score =  361 bits (927), Expect = 2e-99
 Identities = 200/602 (33%), Positives = 315/602 (52%), Gaps = 12/602 (1%)

Query: 590   TESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVT 649
             +ES   + + D       +++      I VK G    I     G+PLP ++W KDG+E+ 
Sbjct: 25772 SESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIE 25831

Query: 650   EEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVE 709
             E  R  +   ++  LLT+ +C+R D+G  +L LKN  G+ +  ++  VLD+P PP G +E
Sbjct: 25832 ERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLE 25891

Query: 710   FLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEG 769
                L+     + W  P+++GG  +  +IVE+R     +W  I E + ++T+    K+ +G
Sbjct: 25892 INGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWT-ICEGELQMTSCKVTKLLKG 25950

Query: 770   KAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDG 829
               Y FR+  VN  GV +PLE+  + A +P   P   +  ++T VTKE++T+ W+ P  DG
Sbjct: 25951 NEYIFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDG 26010

Query: 830   GAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSV 889
             G+ + GYI+ERR+K S  WV VNK P+   +    GL E  EYE+RV A N AG   PS 
Sbjct: 26011 GSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSE 26070

Query: 890   PSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEW 947
              S  + A+DPV  P       + DS  ++I++AW +P    G P +GY +E +  D  +W
Sbjct: 26071 TSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDW 26130

Query: 948   SKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLS 1007
              K +   + GT YT+ GL    +Y FR+++VN+ G  +P +      A      P FD+ 
Sbjct: 26131 -KTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDID 26189

Query: 1008  ARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKR 1067
             + ++  ++V+AG +  +   F G P P+V+W K     + R  +  + + +   I +  R
Sbjct: 26190 SEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRTSLTIENANR 26249

Query: 1068  SDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQE-DG 1126
             +DSG Y + +QN    A   + V+V D P PPTN+ + +    +  L+W    DV E DG
Sbjct: 26250 NDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSW----DVPENDG 26305

Query: 1127  EA---HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
              A   +Y I KR+AS   W +         Y VT L  G  YYFRV   NE G   P ++
Sbjct: 26306 GAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAET 26365

Query: 1184  RD 1185
             ++
Sbjct: 26366 KE 26367



 Score =  358 bits (918), Expect = 2e-98
 Identities = 222/650 (34%), Positives = 334/650 (51%), Gaps = 19/650 (2%)

Query: 552   EITDLPGMQIVKQGAVH--KLIFPSMGPEHEGKYTFR--AKGT--------ESEASVFIA 599
             E  DLP    +K   V+  +  F        GKY FR  AK T        ES  ++   
Sbjct: 20311 EKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICK 20370

Query: 600   DPPTIDPSVLEALAAHAITVKVGHTAHIK-VPFRGKPLPKVTWYKDGMEVTEEERVSMER 658
             D       VL+      +T+K G T  +  +   GKPLPK +W K G ++   +   +  
Sbjct: 20371 DEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITS 20430

Query: 659   GEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCV 718
                 ++LTI    R+D+G   +   N  G+    + ++VLD P PP G VE   +S    
Sbjct: 20431 TPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPP-GPVEISNVSAEKA 20489

Query: 719   HMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILA 778
              + W  P ++GG P+  +I+E+R   +  W  + E D +       K+ +G  Y FR+ A
Sbjct: 20490 TLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSE-DIQSCRHVATKLIQGNEYIFRVSA 20548

Query: 779   VNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIV 838
             VN  G  +P+++E V   +   PPG   +P+V++VTK   T++W  P  DGG+ + GY V
Sbjct: 20549 VNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHV 20608

Query: 839   ERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKD 898
             ERR+K S  WV   K P+   +C V GL E + YEFRV A N+AG G PS  S SV+ KD
Sbjct: 20609 ERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKD 20668

Query: 899   PVKPPGLVQDLHVSDSSNSSISLAWREP--AEGDPPSGYILEMRAEDTKEWSK-CTKIPI 955
                PPG   + HV+D++  S SLAW +P    G   +GY++E +    + W K  T   +
Sbjct: 20669 AAYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTAL 20728

Query: 956   SGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMV 1015
               T + V  L  ++KY FRI A+N+AGVGEP  +   V  +    AP F+L A L+  +V
Sbjct: 20729 RITQFVVPDLQTKEKYNFRISAINDAGVGEPAVI-PDVEIVEREMAPDFELDAELRRTLV 20787

Query: 1016  VRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRI 1075
             VRAG ++ I     G P P+V W KD +  K R  I  +++ +  +I    R D+G + +
Sbjct: 20788 VRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESFTLLIIPECNRYDTGKFVM 20847

Query: 1076  LLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKR 1135
              ++N  G+    ++VRV D P P  NLR  +   ++VTL W+           +YI+ KR
Sbjct: 20848 TIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKR 20907

Query: 1136  DASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRD 1185
             +A+  ++ TA  +     Y VTGL  G +Y+FRV+A NE G  EP ++ +
Sbjct: 20908 EATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTE 20957



 Score =  355 bits (910), Expect = 2e-97
 Identities = 278/985 (28%), Positives = 444/985 (45%), Gaps = 97/985 (9%)

Query: 262   PNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSV----GDKRM 317
             P   + W K   PL+    +   D   + T   L I   + +D G Y ++V    G K  
Sbjct: 23257 PKPTITWTKDGLPLKQTTRINVTDSLDLTT---LSIKETHKDDGGQYGITVANVVGQKTA 23313

Query: 318   SAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVWKF---NGKELKRDDKYE 374
             S E+  LD+P    G   PVK  +   +   I LS   P +       N    KRD    
Sbjct: 23314 SIEIVTLDKPDPPKG---PVKFDD--VSAESITLSWNPPLYTGGCQITNYIVQKRDTTTT 23368

Query: 375   I--TVSEDGLTHTLKIKDARLSDSGEFSAEAGNLV-QKAQLTIDRIPIKF---------- 421
             +   VS      TLK+   +     +F   A N   Q   L  D I  ++          
Sbjct: 23369 VWDVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGT 23428

Query: 422   -----VSNLKNV-----RVKERSRACLECELTSKDV-TLRWKKDGQLLMHGTKYSMNHEG 470
                  +S    V      V       +   L  K+  ++ W K  + ++H T++   +  
Sbjct: 23429 PFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQN-- 23486

Query: 471   KRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMS-DVHAATGS 529
                        L +G EY             Y+  IV V +     +  ++ D     G+
Sbjct: 23487 -----------LEEGIEYEF---------RVYAENIVGVGKASKNSECYVARDPCDPPGT 23526

Query: 530   PAELCVVLNDEKVEGVWLKD----GKEIT-------DLPGMQIVKQGAVHKLI--FPSMG 576
             P  + V  N+  ++  W K     G  IT       DLP  + +K    + +   F   G
Sbjct: 23527 PEPIMVKRNEITLQ--WTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSG 23584

Query: 577   PEHEGKYTFR----------AKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAH 626
                + +Y FR          +K ++S   +   D   +    ++      I V  G T  
Sbjct: 23585 LTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFR 23644

Query: 627   IKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDH 686
             ++    GKPLP + W +   E+ E  R  ++  + +ALL + + +R D G  +L+  N  
Sbjct: 23645 LEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVA 23704

Query: 687   GSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKK 746
             GS +  +++ VLDRP PP+G V+   ++     + W  P  +GG  ++ ++VE+R   + 
Sbjct: 23705 GSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRL 23764

Query: 747   SWIKIGEVDGKVTN-FSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFA 805
             +W  +      VTN     K+ EG  Y FRI+AVN  GV +PLE+  V   NP   PG  
Sbjct: 23765 AWTVVASE--VVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPP 23822

Query: 806   SQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDG 865
                +VT++ K+++T+ WN P  DGG+ ++GYIVE+R +    W+  NK  I   +  V G
Sbjct: 23823 KSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTG 23882

Query: 866   LLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWRE 925
             L ED EYEFRV A N AG G+PS  +    A DPV  PG   + H+ D++ +SI+LAW +
Sbjct: 23883 LTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGK 23942

Query: 926   PA--EGDPPSGYILEMRAEDTKEWSKCT-KIPISGTCYTVGGLIERQKYFFRIRAVNEAG 982
             P    G    GY++E+   D +EW   T +  +  T + +  L E Q+Y  R+ A+N+ G
Sbjct: 23943 PIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVG 24002

Query: 983   VGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDG 1042
             +GE   +   V+      AP+ DL + L+  +VVRAG +  IH  F G P P++ W ++ 
Sbjct: 24003 LGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREE 24062

Query: 1043  VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNL 1102
                  +  I K  N++Q  I++  R+D+G Y + L+N  G     + V+V D P PP NL
Sbjct: 24063 GEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNL 24122

Query: 1103  RLFEEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLL 1160
              + E   ++  L W   P + + G    +Y+I KR+++   +   + +     + V  L 
Sbjct: 24123 AVKEVRKDSAFLVW--EPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKTSFKVENLT 24180

Query: 1161  PGRKYYFRVVARNEIGDSEPLDSRD 1185
              G  YYFRV+A NE G   P+++ D
Sbjct: 24181 EGAIYYFRVMAENEFGVGVPVETVD 24205



 Score =  352 bits (902), Expect = 2e-96
 Identities = 208/628 (33%), Positives = 317/628 (50%), Gaps = 22/628 (3%)

Query: 580   EGK-YTFRA-------KGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPF 631
             EGK YTFR        +GT SE +V   D        L+ L       K      +K+P 
Sbjct: 19947 EGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPI 20006

Query: 632   RGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATA 691
             +GKP P V+W K    +  + RVS+E       L + +C + D+G   + LKN  G+   
Sbjct: 20007 KGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEG 20066

Query: 692   TLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKI 751
             T+ + V+ +P  P G ++F E++   + +KW  PKD+GG  +T +I+E+R      W+  
Sbjct: 20067 TISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTC 20126

Query: 752   GEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVT 811
                  K T F   ++ EG  Y FR+ A N  GV + L++E + A +P + P     P + 
Sbjct: 20127 ASAVQKTT-FRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIV 20185

Query: 812   DVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTE 871
             DV  ++V++TW  P + GG+P+ GY +E +++ S LW   NK PI+     V GL E  E
Sbjct: 20186 DVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLE 20245

Query: 872   YEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EG 929
             YEFRV+A+N AG G+PS+PS  VVA DP+ PPG  + +++   + +S++L W EP    G
Sbjct: 20246 YEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINI---TRNSVTLIWTEPKYDGG 20302

Query: 930   DPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAG-VGEPVE 988
                +GYI+E R   +K W K   + +    +TV  L+E  KY FRIRA N AG +  P E
Sbjct: 20303 HKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSE 20362

Query: 989   LDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHA-AFSGSPPPDVIWQKDGVPTKG 1047
               + +       AP   L   +K  + ++AG  + ++A +  G P P   W K G   + 
Sbjct: 20363 STETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRP 20422

Query: 1048  RE--TITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLF 1105
              +   IT +   S   I    R D+G Y I   N FG     + V V D P PP  + + 
Sbjct: 20423 SDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPPGPVEIS 20482

Query: 1106  EEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGR 1163
                    TLTW  +P +++ G     YI+ KR+ S   W   +E + S ++  T L+ G 
Sbjct: 20483 NVSAEKATLTW--TPPLEDGGSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKLIQGN 20540

Query: 1164  KYYFRVVARNEIGDSEPLDSRDTWLINK 1191
             +Y FRV A N  G  EP+ S    ++++
Sbjct: 20541 EYIFRVSAVNHYGKGEPVQSEPVKMVDR 20568



 Score =  352 bits (902), Expect = 2e-96
 Identities = 217/667 (32%), Positives = 334/667 (50%), Gaps = 19/667 (2%)

Query: 528   GSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAV--HKLIFPSMGPEHEGKYTF 585
             GS     +V   E  EG W+K     T++        G V  H+  F  +     G ++ 
Sbjct: 22467 GSKITGYIVEKKELPEGRWMK--ASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSE 22524

Query: 586   RAKGTESEASVFIADPPTI--DPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYK 643
              ++ T +  +    DPP I  DP   + +  HA     G +  +     GKP+P + W K
Sbjct: 22525 PSESTGAITARDEVDPPRISMDPKYKDTIVVHA-----GESFKVDADIYGKPIPTIQWIK 22579

Query: 644   DGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKP 703
                E++   R+ ++  +    L++ + VR DSG  +LK KN  G  + T+++ VLDRP P
Sbjct: 22580 GDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGP 22639

Query: 704   PQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFST 763
             P+G V    ++     + WK P  +GG  +  +IVERR   +  W  + + + +  +   
Sbjct: 22640 PEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVV-DANVQTLSCKV 22698

Query: 764   NKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWN 823
              K+ EG  Y FRI+AVN  GV +PLE+E V A NP   P     P+VT VTK+++ + W 
Sbjct: 22699 TKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWE 22758

Query: 824   APTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAG 883
              P  DGG+ +LGY++E+R K    W   +K  I   +  V GL+E+ +YEFRV A N AG
Sbjct: 22759 RPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAG 22818

Query: 884   PGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDPPSGYILEMRA 941
               +PS PS+   A DP+  PG   +  V D + SS+ L+W +P    G    GYI+E   
Sbjct: 22819 LSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCD 22878

Query: 942   EDTKEWSKCT-KIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPA 1000
                 EW+ CT    I+ T   V  L+E+ +Y FRI A+N+AGVGE  ++   +       
Sbjct: 22879 VSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLE 22938

Query: 1001  APKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQF 1060
             AP  DL   L+  + +RAG +L +     G P P+V W K     +    I  + + +  
Sbjct: 22939 APDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTSL 22998

Query: 1061  LINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSP 1120
             ++++  R DSG Y + L+N  G     + VRV D P PP NL++ E   ++V++TW   P
Sbjct: 22999 VLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITW--EP 23056

Query: 1121  DVQEDGE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDS 1178
              + + G    +YI+ KR+A+  ++         N + +  L  G  YYFRV A NE G  
Sbjct: 23057 PLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIG 23116

Query: 1179  EPLDSRD 1185
              P  + D
Sbjct: 23117 LPAQTAD 23123



 Score =  351 bits (901), Expect = 2e-96
 Identities = 205/589 (34%), Positives = 309/589 (52%), Gaps = 19/589 (3%)

Query: 608   VLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKD--GMEVTEEERVSMERGEDQALL 665
             VL+   +  +TVK G T  ++   RGKP P+V W KD    ++T   RV ++   D +  
Sbjct: 18202 VLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKF 18261

Query: 666   TISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAP 725
             +++   R D G  ++   N  GS  A   ++VLD+P P +  ++ +++S     + W  P
Sbjct: 18262 SLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRN-LKIVDVSSDRCTVCWDPP 18320

Query: 726   KDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVS 785
             +D+GG  +  +I+E+    +  W             +  ++ EG  Y FR+ A N  G  
Sbjct: 18321 EDDGGCEIQNYILEKCETKRMVWSTYSATV-LTPGTTVTRLIEGNEYIFRVRAENKIGTG 18379

Query: 786   DPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGS 845
              P E++ V A    + PG    P+VT V+KE +T+ WN P  DGG  + GY +E+++K S
Sbjct: 18380 PPTESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHS 18439

Query: 846   NLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGL 905
               WVPVNK  I   +  V  LL D EY+FRV A N+ G G+PS+PS  VVAKDP++PPG 
Sbjct: 18440 TRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGP 18499

Query: 906   VQDLHVSDSSNSSISLAWREPA--EGDPPSGYILEMR-----AEDTKEWSKC-TKIPISG 957
               +  V D++  SI+L W +P    G P  GY++EMR     A   + W +C     +  
Sbjct: 18500 PTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVR 18559

Query: 958   TCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVR 1017
               +TV  L E Q+Y FR+ A N+ G+G P EL + ++       P+ DL A ++  ++VR
Sbjct: 18560 KEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVIVR 18619

Query: 1018  AGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLI--NSTKRSDSGVYRI 1075
             AG  + + A   G P P V W+K G+    R+      +   FL+  NST R DSG Y +
Sbjct: 18620 AGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNST-RDDSGKYSL 18678

Query: 1076  LLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGE--AHYIIM 1133
              L N  GE    ++VRV D P P ++L++ +    +  ++W  +P   + G    HYI+ 
Sbjct: 18679 TLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSW--APPENDGGSQVTHYIVE 18736

Query: 1134  KRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLD 1182
             KR+A   TW T    V    + VT L+PG +YYFRV A NE G   P D
Sbjct: 18737 KREADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTD 18785



 Score =  348 bits (892), Expect = 3e-95
 Identities = 218/651 (33%), Positives = 325/651 (49%), Gaps = 40/651 (6%)

Query: 581   GKYTFRAKGTES------EASVFIAD------PPTIDPSVLEALAAHAITVKVGHTAHIK 628
             G+Y FR K   +       A+V   D      PP+ID           + V+ G   +I 
Sbjct: 16085 GEYEFRVKAVNAAGVSKPSATVGPCDCQRPDMPPSID-------LKEFMEVEEGTNVNIV 16137

Query: 629   VPFRGKPLPKVTWYK------DGME-VTEEERVSMERGEDQALLTISNCVREDSGLILLK 681
                +G P P +TW+K      D  E V  +  V+    +D   L I    R D+GL  + 
Sbjct: 16138 AKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTIT 16197

Query: 682   LKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERR 741
               N+ G+A+  + L+VL RP PP G ++F  +S   + + W  PKD+GG  +T +++E+R
Sbjct: 16198 AVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEKR 16257

Query: 742   AVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEP 801
                +K+W+ +   + K   ++  K+ EG  Y FRI+A N  G+ +PL++E   A N    
Sbjct: 16258 EANRKTWVHVSS-EPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFSV 16316

Query: 802   PGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQ---- 857
             PG   +P V+ VT+ ++T+ W  P  DGG+PV GY +E +   S  W  VN+DPI+    
Sbjct: 16317 PGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTL 16376

Query: 858   GTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNS 917
             G    V GL+E ++Y+FRV A+N AG G  S+PS    A+DP+ PPG      V+D + S
Sbjct: 16377 GVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPGPPFP-KVTDWTKS 16435

Query: 918   SISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRI 975
             S  L W  P +  G   +GYI+E + E  +EW K     + GT   V GL E   Y FR+
Sbjct: 16436 SADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRV 16495

Query: 976   RAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPD 1035
             RAVN AG+GEP E+   +       +P   L A ++  +VV AG  + I A  SG PPP 
Sbjct: 16496 RAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPT 16555

Query: 1036  VIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADF 1095
             V W  +        TI  +   S  +I + +RS  GVY +L +NE GE +  I V V D 
Sbjct: 16556 VTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDV 16615

Query: 1096  PRPPTNLRLFEEVPN-TVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKY 1154
             P P     L   + N +  LTW    D       +Y+I KR++    W      V     
Sbjct: 16616 PGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNA 16675

Query: 1155  TVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINK-----DQIQDLSAK 1200
             TV GL+ G+ Y+FR+ A N IG    +++ +  +I +     ++ +DL  K
Sbjct: 16676 TVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPERPEDLEVK 16726



 Score =  348 bits (892), Expect = 3e-95
 Identities = 210/595 (35%), Positives = 309/595 (51%), Gaps = 17/595 (2%)

Query: 598   IADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSME 657
             IA   TI PS+   L  +  +++ G    I++P  G+P P ++W KDG  + +  RV++E
Sbjct: 24304 IAKDLTIQPSL--KLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVE 24361

Query: 658   RGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSC 717
                   +L I    ++D G   +   N  G+AT  L + VL++P PP G V F E+S   
Sbjct: 24362 ETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVSADF 24421

Query: 718   VHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRIL 777
             V + W+ P   GG  ++ +IVE+R     +W  +     + T     K++ G  YQFRI 
Sbjct: 24422 VVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTT-IKITKLKTGTEYQFRIF 24480

Query: 778   AVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYI 837
             A N  G S PL+++ V    P + PG    P VT ++K+ + + W+ P  DGG  ++GY 
Sbjct: 24481 AENRYGKSAPLDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYH 24540

Query: 838   VERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAK 897
             +E+++K S LWV +NK PIQ TK    GL E  EYEF+V A N  G G+PS  S   VA+
Sbjct: 24541 LEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVAR 24600

Query: 898   DPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIPI 955
             DP  PPG  + + +   + ++++L W++PA   G   +GYI+E +      W K +   +
Sbjct: 24601 DPCDPPGRPEAIVI---TRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNV 24657

Query: 956   SGTCYTVGGLIERQKYFFRIRAVNEAG-VGEPVELDKGVRAMPPPAAPKFDLSARLKSHM 1014
               T +TV GL+E Q+Y FR+ A N AG   EP +    + A     AP   L  + K  +
Sbjct: 24658 LETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVI 24717

Query: 1015  VVRAGTALCIHAAFSGSPPPDVIWQKDG---VPTKGRETITKSKNHSQFLINSTKRSDSG 1071
             VV AG    + A   G P PDV+W KDG     T  R  I  +   +  ++    R+D G
Sbjct: 24718 VVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGG 24777

Query: 1072  VYRILLQNEFGEARYDIHVRVADFPRPPTN-LRLFEEVPNTVTLTWNHSPDVQEDGE--A 1128
              Y + L N  G     I V+V D P PP   L++         L WN  P +Q+ G   +
Sbjct: 24778 QYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWN--PPLQDGGANIS 24835

Query: 1129  HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
             HYII KR+ S  +W   +  V +  Y VT LLPG +Y FRV+A N+ G  EPL+S
Sbjct: 24836 HYIIEKRETSRLSWTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLES 24890



 Score =  345 bits (885), Expect = 2e-94
 Identities = 290/986 (29%), Positives = 433/986 (43%), Gaps = 117/986 (11%)

Query: 268   WIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEP 327
             WIK T    ++ +       Q   KY   IS +N  DAG     VG+  +  ++ +++  
Sbjct: 20719 WIKDTTGTALRITQFVVPDLQTKEKYNFRISAIN--DAG-----VGEPAVIPDVEIVER- 20770

Query: 328   LKFLGEMKP---VKVTERQTAVFEIRLS---------KKEPNFVWKFNGKELKRDDKYEI 375
                  EM P   +    R+T V    LS         +  P   W  +   LK     E 
Sbjct: 20771 -----EMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIEN 20825

Query: 376   TVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPIKFVSNLKNVRVKERSR 435
             T S       L I +    D+G+F            +TI+  P    S   NVRV +   
Sbjct: 20826 TESFT----LLIIPECNRYDTGKFV-----------MTIEN-PAGKKSGFVNVRVLDTPG 20869

Query: 436   ACLEC---ELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRA--------------ELIIE 478
               L     ++T   VTL W  D  L+  G++ +     KR               +   +
Sbjct: 20870 PVLNLRPTDITKDSVTLHW--DLPLIDGGSRITNYIVEKREATRKSYSTATTKCHKCTYK 20927

Query: 479   DAQLSDGGEYTVVAMQD-----GDPTEYYSTAIVTVEERLATVKS-GMSDVHAAT----- 527
                LS+G EY    M +     G+PTE  +T  V   E  +   S  + D+  +T     
Sbjct: 20928 VTGLSEGCEYFFRVMAENEYGIGEPTE--TTEPVKASEAPSPPDSLNIMDITKSTVSLAW 20985

Query: 528   -------GSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHE 580
                    GS     V+    K    W      IT + G++ V +           G E  
Sbjct: 20986 PKPKHDGGSKITGYVIEAQRKGSDQWT----HITTVKGLECVVRNLTE-------GEE-- 21032

Query: 581   GKYTFRAKGTES-------EASVFIADPPTIDPSV-LEALAAHAITVKVGHTAHIKVPFR 632
               YTF+     S       E+   I    T+ P + L  +    +  K G    +++P  
Sbjct: 21033 --YTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVL 21090

Query: 633   GKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATAT 692
             G+P P VTW K    + + +RV+ E      +L I+ CVR DSG   L  +N  G     
Sbjct: 21091 GRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEVGDV 21150

Query: 693   LHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIG 752
             + + V D P PP G ++F E+S   V   W  P+++GG P++ ++VE R     +W+++ 
Sbjct: 21151 ITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELA 21210

Query: 753   EVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTD 812
                 + T +   ++  G  YQFR+ A N  GV   + +  + A  P + PG    PQVT 
Sbjct: 21211 TTVIRTT-YKATRLTTGLEYQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTPQVTA 21269

Query: 813   VTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEY 872
             VTK+++TI+W+ P  DGG+P+LGY VER+++   LW  V+K  + G      GL +   Y
Sbjct: 21270 VTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAY 21329

Query: 873   EFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREP--AEGD 930
             EFRVIA N AG  +PS PS  ++A DP+ PPG    L++   +  +++L W +P    G 
Sbjct: 21330 EFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNI---TRHTVTLKWAKPEYTGGF 21386

Query: 931   PPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAG-VGEPVEL 989
               + YI+E R      W K     I    +TV GL E   Y FR+ A N AG +  P E 
Sbjct: 21387 KITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEP 21446

Query: 990   DKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRE 1049
                +       APK  +  + K  ++++AG A  + A  SG PPP + W KDG   +G  
Sbjct: 21447 SDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTA 21506

Query: 1050  TI-TKSKNHSQFLIN-STKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTN-LRLFE 1106
              +  K  + S  L+N  + R DSG Y +   N  G A++  +V+V D P PP   L + E
Sbjct: 21507 KLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTE 21566

Query: 1107  EVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRK 1164
                    L+W   P + + G    HYI+ KR+ S   W   A  V   K  VT LL G +
Sbjct: 21567 VTSEKCVLSW--FPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNE 21624

Query: 1165  YYFRVVARNEIGDSEPLDSRDTWLIN 1190
             Y FRV+A N+ G  EPL+S     +N
Sbjct: 21625 YIFRVMAVNKYGVGEPLESEPVLAVN 21650



 Score =  341 bits (874), Expect = 3e-93
 Identities = 190/575 (33%), Positives = 298/575 (51%), Gaps = 8/575 (1%)

Query: 617   ITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSG 676
             + +K G    ++    G+P P + W KDG E+    ++ ++  +    L   +  R DSG
Sbjct: 21471 VILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSG 21530

Query: 677   LILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQF 736
                L   N  G A    ++ VLDRP PP+G +   E++     + W  P D+GG  +  +
Sbjct: 21531 AYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHY 21590

Query: 737   IVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAG 796
             IV++R   + +W  +   + +VT     K+ +G  Y FR++AVN  GV +PLE+E V A 
Sbjct: 21591 IVQKRETSRLAWTNVAS-EVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLESEPVLAV 21649

Query: 797   NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
             NP  PP     P+VT +TK+++ + W  P  DGG+ ++ YIVERR K    W+  NK  +
Sbjct: 21650 NPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTL 21709

Query: 857   QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
                +  V GL E  EYEFR++A N AG   PS  S    A D V  PG   +  V D+S 
Sbjct: 21710 TDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFKPGPPGNPRVLDTSR 21769

Query: 917   SSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCT-KIPISGTCYTVGGLIERQKYFF 973
             SSIS+AW +P    G   +GY++E+   +  EW   T    +  T YT+ GL E Q+Y  
Sbjct: 21770 SSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKI 21829

Query: 974   RIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPP 1033
             RI A+N  G+GEP  +    +A      P+ +L A L+  + +RA   L +     G P 
Sbjct: 21830 RIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPA 21889

Query: 1034  PDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVA 1093
             P+V W +D   +  + +I  + +++  ++ +  R DSG Y + ++N  G     ++VRV 
Sbjct: 21890 PEVKWARDHGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVL 21949

Query: 1094  DFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFS 1151
             D P PP +L++ E    +VTLTW+  P + + G    +YI+ KR+++   + T A     
Sbjct: 21950 DTPGPPQDLKVKEVTKTSVTLTWD--PPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHK 22007

Query: 1152  NKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDT 1186
               + V  L  G  YYFRV+A NE G   P ++ ++
Sbjct: 22008 TSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAES 22042



 Score =  340 bits (872), Expect = 5e-93
 Identities = 197/589 (33%), Positives = 296/589 (50%), Gaps = 11/589 (1%)

Query: 601   PPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGE 660
             PP+++   L+      + VK G T       RG P+P   W  DG E+  +E  ++E   
Sbjct: 17507 PPSVE---LDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDN 17563

Query: 661   DQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHM 720
               ++LTI NC+R D+G   + + N  GS T  +HL+VLD P PP G +  L+++   + +
Sbjct: 17564 FSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTI 17623

Query: 721   KWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVN 780
              W+ PKD+GG PV  +IVE++   K +W  +     K T      +++G  Y FR+ A N
Sbjct: 17624 SWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSK-TKLKIPHLQKGCEYVFRVRAEN 17682

Query: 781   SEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVER 840
               GV  PL++    A +   PP    +P VTD+T+ A T++W  P  DGG+P+ GY +ER
Sbjct: 17683 KIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMER 17742

Query: 841   RKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPV 900
             R+  +  WV VNK PI   K  V GL E   YEFRV A N AG  +PS  S  + A  P+
Sbjct: 17743 REV-TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPI 17801

Query: 901   KPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGT 958
             KPPG   +  + D S  +  L W +P    G P  GY++E +   T +W++  K  +   
Sbjct: 17802 KPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQ 17861

Query: 959   C-YTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVR 1017
             C + V GLIE  +Y FRI+A N  G GEP EL + V A      P+ +L    +  + VR
Sbjct: 17862 CAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVR 17921

Query: 1018  AGTALCIHAAFSGSPPPDVIWQKDG--VPTKGRETITKSKNHSQFLINSTKRSDSGVYRI 1075
              G  + I A   G P PD+ W K+G  +  + R  + +     +  I    R+D G Y I
Sbjct: 17922 VGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYII 17981

Query: 1076  LLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKR 1135
               +N  G A+    V V D P P  NL++        T++W +  D       ++I+  R
Sbjct: 17982 SAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYR 18041

Query: 1136  DASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSR 1184
               +   W   A  V + +     LL   +YYFRV A N++G    ++++
Sbjct: 18042 KPNQKGWSIVASDV-TKRLIKANLLANNEYYFRVCAENKVGVGPTIETK 18089



 Score =  335 bits (859), Expect = 2e-91
 Identities = 196/574 (34%), Positives = 306/574 (53%), Gaps = 14/574 (2%)

Query: 617   ITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGE--DQALLTISNCVRED 674
             + +K G +  IK   +G+P+P+VTW+KDG+E+  E+R++ME  +      L + +  R+ 
Sbjct: 27968 LIIKSGESLRIKALVQGRPVPRVTWFKDGVEI--EKRMNMEITDVLGSTSLFVRDATRDH 28025

Query: 675   SGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVT 734
              G+  ++ KN  GSA A + + V D P    G + F  ++G  + + W AP ++G  P+T
Sbjct: 28026 RGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPIT 28085

Query: 735   QFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVF 794
              +I+E+R   + +W  I E   +  +++  K+  G  YQFR+ AVN  GV  PL+++ V 
Sbjct: 28086 HYIIEKRETSRLAWALI-EDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVV 28144

Query: 795   AGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPV-NK 853
             A      P     P+ +++T  ++T+TW  P  DGG+ +  YI+ERR+K S  WV V +K
Sbjct: 28145 AQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISK 28204

Query: 854   DPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSD 913
              PI  T+  V GL E  EYEF V+A N AG G  S  S  +  ++PV PPG    + V+D
Sbjct: 28205 RPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTD 28264

Query: 914   SSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKY 971
             +S +++SL W +P    G    GYI+EM   D  +W K        T YTV  L   ++Y
Sbjct: 28265 TSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEY 28324

Query: 972   FFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGS 1031
              FR+ A+N AG G+  E+   ++A+    AP+ D+ A  K   VVRAG ++ +  A+ G 
Sbjct: 28325 KFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGR 28384

Query: 1032  PPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVR 1091
             P P  +W K       R  I  + + S   + +  R+D+G Y + ++N  G       V+
Sbjct: 28385 PTPTAVWSKPDSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVK 28444

Query: 1092  VADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA---HYIIMKRDASTATWYTAAER 1148
             V D P PP  +   +    + TL W+ +P +  DG A   HY++ KR+AS  +W   +E+
Sbjct: 28445 VLDTPGPPGPITFKDVTRGSATLMWD-APLL--DGGARIHHYVVEKREASRRSWQVISEK 28501

Query: 1149  VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLD 1182
                  + V  L  G  YYFRV A NE G  EP +
Sbjct: 28502 CTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYE 28535



 Score =  331 bits (849), Expect = 2e-90
 Identities = 210/619 (33%), Positives = 310/619 (50%), Gaps = 26/619 (4%)

Query: 582   KYTFRAKGTESEASVFIADPPTIDPSVLEA---------LAAHAITVKVGHTAHIKVPFR 632
             +Y+FR      +    I+DP  +   V+           L  +  TV  G    + VPF 
Sbjct: 22116 EYSFRVSAQNEKG---ISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFI 22172

Query: 633   GKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATAT 692
             G+P P VTW+KD + + +  RV+ E  E+ +LLTI +  RED G  ++KL N  G A  T
Sbjct: 22173 GRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIET 22232

Query: 693   LHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIG 752
             L++ VLD+P PP G V+  E++   + + W  PK +GG  +  +IVE+R     +W  + 
Sbjct: 22233 LNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVS 22292

Query: 753   EVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTD 812
                 + T     +++ G  YQFRI A N  G S  L +E   A  P + PG    P VT 
Sbjct: 22293 ATVARTT-IKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTL 22351

Query: 813   VTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEY 872
              +++++ + WN P  DGG+ V+GY +ER+++ S LWV +NK PI  TK    GL E  EY
Sbjct: 22352 SSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEY 22411

Query: 873   EFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGD 930
             EFRV A N  G G+PS  S   VA+DP  PPG  + + V   + +S++L W++P    G 
Sbjct: 22412 EFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIV---TRNSVTLQWKKPTYDGGS 22468

Query: 931   PPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGV-GEPVEL 989
               +GYI+E +      W K +   I  T + V GL+E  +Y FR+ A N AGV  EP E 
Sbjct: 22469 KITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSES 22528

Query: 990   DKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQK--DGVPTKG 1047
                + A      P+  +  + K  +VV AG +  + A   G P P + W K    +    
Sbjct: 22529 TGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTA 22588

Query: 1048  RETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEE 1107
             R  I  +   +   +    R DSG Y +  +N  GE    ++V+V D P PP    +   
Sbjct: 22589 RLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISG 22648

Query: 1108  V-PNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRK 1164
             V     TL W   P +Q+ G    +YI+ +R+ S   W      V +    VT LL G +
Sbjct: 22649 VTAEKCTLAW--KPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNE 22706

Query: 1165  YYFRVVARNEIGDSEPLDS 1183
             Y FR++A N+ G  EPL+S
Sbjct: 22707 YTFRIMAVNKYGVGEPLES 22725



 Score =  331 bits (848), Expect = 3e-90
 Identities = 261/933 (27%), Positives = 421/933 (45%), Gaps = 67/933 (7%)

Query: 290   GTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEI 349
             G +Y+  + +VN   A   S S  D +++ E    +EPL  +       +  +  A F +
Sbjct: 26150 GAEYVFRVKSVNKVGASDPSDS-SDPQIAKERE--EEPLFDIDSEMRKTLIVKAGASFTM 26206

Query: 350   RL---SKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNL 406
              +    +  PN +W     +L+     + T S   LT    I++A  +DSG+++    N+
Sbjct: 26207 TVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRTSLT----IENANRNDSGKYTLTIQNV 26262

Query: 407   VQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRW---KKDGQLLMHGTK 463
             +  A LT+    +       N+ V++         +T +   L W   + DG   +    
Sbjct: 26263 LSAASLTLVVKVLDTPGPPTNITVQD---------VTKESAVLSWDVPENDGGAPVKNYH 26313

Query: 464   YSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERL---ATVKSGM 520
                    K+A + + +    +   Y V  +Q+G    YY       E  +   A  K G+
Sbjct: 26314 IEKREASKKAWVSVTNN--CNRLSYKVTNLQEG--AIYYFRVSGENEFGVGIPAETKEGV 26369

Query: 521   SDVHAATGSPAELCVV-LNDEKVEGVWLK---DGK--------EITDLPGMQIVKQGAVH 568
               +      P +L V  ++ + V   WLK   DG         E  +      VK     
Sbjct: 26370 K-ITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKCAVAK 26428

Query: 569   KLIFPSMGPEHEGKYTFRA-----KGTESEASVFIA-------DPPTIDPSVLEALAAHA 616
                    G     +Y FR       G      + +        +PP ID   ++   +H 
Sbjct: 26429 STHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEID---MKNFPSHT 26485

Query: 617   ITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSG 676
             + V+ G    + +P  GKPLPKVT  +DG+ +    R + E   +   + +   V  D+G
Sbjct: 26486 VYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAG 26545

Query: 677   LILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQF 736
                +   N  G+  A +++ VLDRP PP G V   +++   V +KW+ PK +GG  VT +
Sbjct: 26546 RYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNY 26605

Query: 737   IVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAG 796
             I+ +R      W ++     + T     K+  G+ YQFRI A N  G+SD +++  V   
Sbjct: 26606 ILLKRETSTAVWTEVSATVAR-TMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVK 26664

Query: 797   NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
              P   PG  S P VT+VT+E++T+ W+ P  +GG+ V+GY +E + + S LW   NK  I
Sbjct: 26665 LPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVI 26724

Query: 857   QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
             + T   V  +     YEFRV A N AG G+PS PS  V+A D  +PP   +++ ++D S 
Sbjct: 26725 RTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPP---RNVRITDISK 26781

Query: 917   SSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFR 974
             +S+SL+W++PA   G   +GYI+E R      W+K +   ++ T + + GL +  +Y FR
Sbjct: 26782 NSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFR 26841

Query: 975   IRAVNEAG-VGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPP 1033
             + A N  G +  P E+   +  +     P  DL       +  RAGT++ + A  SG P 
Sbjct: 26842 VFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPA 26901

Query: 1034  PDVIWQKDG--VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVR 1091
             P + W KD   + T     +  + + +  LI    R +SG Y + L+N  G A   I V+
Sbjct: 26902 PTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQ 26961

Query: 1092  VADFPRPPTNLRLFEEV-PNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVF 1150
             + D P PP     F+ V    +TL W    D       HYI+ KR+ S   W   +E + 
Sbjct: 26962 ILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLE 27021

Query: 1151  SNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
                 T T ++ G +Y FRV A N+ G  EPL+S
Sbjct: 27022 ECIITTTKIIKGNEYIFRVRAVNKYGIGEPLES 27054



 Score =  330 bits (846), Expect = 6e-90
 Identities = 206/622 (33%), Positives = 309/622 (49%), Gaps = 19/622 (3%)

Query: 562   VKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKV 621
             +K+G  ++    ++    +GK +F  K    +  +    PPT+     + L     T++V
Sbjct: 16781 LKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELA---PPTLHLDFRDKL-----TIRV 16832

Query: 622   GHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLK 681
             G    +   + GKP PKV+W+KD  +V E++R  ++       L      R DSG   + 
Sbjct: 16833 GEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVV 16892

Query: 682   LKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERR 741
             ++N  GS      ++V+DRP PP G V F E++   + + WK P D+GG  +T +I+E++
Sbjct: 16893 VENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKK 16952

Query: 742   AVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEP 801
              VGK  W+ +     K T    +K+ EGK Y FRI A N  G+SDPL ++ + A +    
Sbjct: 16953 EVGKDVWMPVTSASAKTT-CKVSKLLEGKDYIFRIHAENLYGISDPLVSDSMKAKDRFRV 17011

Query: 802   PGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQG-TK 860
             P    QP VT+VTK++  +TWN P  DGG P+  YI+E+R+  S  W  V KDPI   TK
Sbjct: 17012 PDAPDQPIVTEVTKDSALVTWNKP-HDGGKPITNYILEKRETMSKRWARVTKDPIHPYTK 17070

Query: 861   CTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSIS 920
               V  LLE  +YEFRV A N+ G G PS PS  V AKDP+  P    +    D++ +S+ 
Sbjct: 17071 FRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVD 17130

Query: 921   LAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPIS--GTCYTVGGLIERQKYFFRIR 976
             L W+ P    G    GYI+E +    +EW +    P S   T Y V GL + Q Y FR+ 
Sbjct: 17131 LTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVL 17190

Query: 977   AVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDV 1036
             AVN AG  +P  + + V        P+  L A +     ++ G  L + A   G P P V
Sbjct: 17191 AVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKV 17250

Query: 1037  IWQKD--GVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVAD 1094
              W+K+    PTK R  +T     S+  I +    D G+Y + ++N  G     + V V D
Sbjct: 17251 TWKKEDRDAPTKARIDVTPV--GSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLD 17308

Query: 1095  FPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKY 1154
              P PP +L + E   ++  LTW    D       +Y++ +RD ++A W   +       +
Sbjct: 17309 KPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSH 17368

Query: 1155  TVTGLLPGRKYYFRVVARNEIG 1176
                 L  G +Y FRV A N+ G
Sbjct: 17369 FAKHLNEGNQYLFRVAAENQYG 17390



 Score =  326 bits (836), Expect = 8e-89
 Identities = 262/890 (29%), Positives = 401/890 (45%), Gaps = 86/890 (9%)

Query: 356   PNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEA----GNLVQKAQ 411
             P  VW     EL   DK  + +   G    L IKDA   D G +   A    G+    A+
Sbjct: 15134 PTKVWTKEEGEL---DKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAAR 15190

Query: 412   LTIDRIPIKFVSNLKNVRVKERSRACLECELTSKD----VT--LRWKKDGQLLMHGTKYS 465
             + +  +P   V +LK V V  R    L       D    +T  +  +KD +  MH  +  
Sbjct: 15191 VEVFDVPGP-VLDLKPV-VTNRKMCLLNWSDPEDDGGSEITGFIIERKDAK--MHTWRQP 15246

Query: 466   MNHEGKRAELIIEDAQLSDGGEYT--VVAMQD---GDPTEYYSTAIV------TVEERLA 514
             +  E  + ++      L +G EY   V+A      G P E      V      T  ERL 
Sbjct: 15247 IETERSKCDI----TGLLEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLT 15302

Query: 515   TVKSGMSDVHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPS 574
               +   S +      P           ++G  ++  K   D P  + V +       F  
Sbjct: 15303 YTERTKSTITLDWKEPRSN----GGSPIQGYIIE--KRRHDKPDFERVNKRLCPTTSFLV 15356

Query: 575   MGPEHEGKYTFRAKGT----ESEAS----VFIAD---PPTIDPSVLEALAAHAITVKVGH 623
                +    Y FR K      ESE S    V I D   PPTI   +  ++    I VK G 
Sbjct: 15357 ENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRL--SVRGDTIKVKAGE 15414

Query: 624   TAHIKVPFRGKPLPKVTWYK---------DGMEVTEEERVSMERGEDQALLTISNCVRED 674
               HI     G P+PK+ W K         D +++T+EE   + R E +  L+I   VRED
Sbjct: 15415 PVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEE---VSRSEAKTELSIPKAVRED 15471

Query: 675   SGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVT 734
              G   +   N  GS    +H+ V DRP PP+  +   ++     ++ W AP DNGG  +T
Sbjct: 15472 KGTYTVTASNRLGSVFRNVHVEVYDRPSPPRN-LAVTDIKAESCYLTWDAPLDNGGSEIT 15530

Query: 735   QFIVERRAVGKKS--WIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEE 792
              +++++R   +K   W ++     +   +   K+     Y+FR+ AVN  G+SD  ++++
Sbjct: 15531 HYVIDKRDASRKKAEWEEVTNTAVE-KRYGIWKLIPNGQYEFRVRAVNKYGISDECKSDK 15589

Query: 793   VFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLW---- 848
             V   +P   PG   +P+V   TK ++ ++W  P  +GG+P+ GY +E+R++GS  W    
Sbjct: 15590 VVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVS 15649

Query: 849   -VPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQ 907
               P+ K  ++G +  V  LLE  +Y+FR +A+N AG G PS PS   VA DP+ PPG   
Sbjct: 15650 RAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPPGPPS 15709

Query: 908   DLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTK-IPISGTC-YTVG 963
                V D + SSISL W+ PA+  G P  GYI+EM+ E T +W +  +   +  TC   V 
Sbjct: 15710 CPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCECVVP 15769

Query: 964   GLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALC 1023
              L E +KY FR++AVNEAG  EP +    + A      P+  +    +  +V +AG+ + 
Sbjct: 15770 NLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIR 15829

Query: 1024  IHAAFSGSPPPDVIWQKDGVPTKGRE----------TITKSKNHSQFLINSTKRSDSGVY 1073
             I A   G P P   W+ DG   K  +           +  ++N S  +I   KRS +G Y
Sbjct: 15830 IPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHTGKY 15889

Query: 1074  RILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIM 1133
              I  +N+ G+   +  V+V D P PP +L++ +    +  L+W    D   D    Y+I 
Sbjct: 15890 SITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIE 15949

Query: 1134  KRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
             KR      W        S  + V  LL  ++Y+FRV A N  G   P+++
Sbjct: 15950 KRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVET 15999



 Score =  326 bits (836), Expect = 8e-89
 Identities = 217/659 (32%), Positives = 323/659 (49%), Gaps = 43/659 (6%)

Query: 562   VKQGAVHKLIFPSMGPEHEGKYTFRAKGT---------ESEASVFIADPPTIDPSVLEAL 612
             V+ G   +L F       + +Y FR K           E+ +SV I +P     + L  +
Sbjct: 28593 VEAGHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGI 28652

Query: 613   AAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVR 672
                 IT K G    I VP  G+P PKVTW  + M + E +RVS+   +D+  LT+ + +R
Sbjct: 28653 TNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMR 28712

Query: 673   EDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRP 732
              DSG   L L+N  G  T ++ + V+ RP P  G +E   +S     + W  PKD GG  
Sbjct: 28713 GDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGGGTE 28772

Query: 733   VTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEE 792
             +T +IVE+R  G  +W  +     K T      + +   Y FR+ + N  GVS PLE+  
Sbjct: 28773 ITNYIVEKRESGTTAWQLVNS-SVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESAP 28831

Query: 793   VFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVN 852
             + A +P  PP   ++P+V  V+  A++I W  P  DGG+ ++GY VE++++ + LWV  N
Sbjct: 28832 IIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKEN 28891

Query: 853   KDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVS 912
             K P       V GL+E  EY+FR  A+N AG  + S  S  ++A++PV  PG  +   V+
Sbjct: 28892 KVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRPE---VT 28948

Query: 913   DSSNSSISLAWREPA--EGDPPSGYILEMRAED---TKEWSKCTKIPISGTCYTVGGLIE 967
             D + S++SL W  PA   G    GYI+E +         W KC    +S   +TV  L E
Sbjct: 28949 DVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSE 29008

Query: 968   RQKYFFRIRAVNEAGVGEPVELDKGVRAMPPP------AAPKFDLSARLKSHMV-VRAGT 1020
                Y FR+ A N AGV     + KG  +  P       A PK +L ARL   +V +RAG+
Sbjct: 29009 GDTYEFRVLAKNAAGV-----ISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGS 29063

Query: 1021  ALCIHAAFSGSPPPDVIWQKDG--VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQ 1078
              L + AA  G P P +IW K    +    + ++  +   +  +I    RSDSG Y + ++
Sbjct: 29064 DLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVK 29123

Query: 1079  NEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA---HYIIMKR 1135
             N  G     + V+V D P P   L +        TL W+     QEDG A   HYI+ +R
Sbjct: 29124 NASGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLP---QEDGGAEITHYIVERR 29180

Query: 1136  DASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIG-----DSEPLDSRDTWLI 1189
             + S   W        +  Y VT L+   +Y FRV A N+ G     +SEP+ +R+++ I
Sbjct: 29181 ETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTI 29239



 Score =  325 bits (833), Expect = 2e-88
 Identities = 227/759 (29%), Positives = 365/759 (48%), Gaps = 54/759 (7%)

Query: 587   AKGTESEASVFIADPPTIDPSVLEA-LAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDG 645
             +KG+ES   V   D      + L+A L    +T++ G    +     GKP PK+ W K  
Sbjct: 29026 SKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGD 29085

Query: 646   MEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQ 705
              E+   E+VS++    +A   I  C R DSG   L +KN  G+   ++ + VLD P P  
Sbjct: 29086 KELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPC- 29144

Query: 706   GRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNK 765
             G++    ++     + W  P+++GG  +T +IVERR   + +W+ I E +    ++   +
Sbjct: 29145 GKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWV-IVEGECPTLSYVVTR 29203

Query: 766   VEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAP 825
             + +   Y FR+ AVN  G   P+E+E + A N    P     P+     KE + I W  P
Sbjct: 29204 LIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKP 29263

Query: 826   TQDGGAPVLGYIVERRKKGSNLWVPVNKD-PIQGTKCTVDGLLEDTEYEFRVIAVNKAGP 884
               DGG  +  Y+V++R+K S  W  VNKD  +  T+  V  L+E  +Y+FRV AVN AG 
Sbjct: 29264 ESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGN 29323

Query: 885   GQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAE 942
              +PS  S+ +  ++P   PG      V D++  SISLAW +P    G    GY+LEM+ +
Sbjct: 29324 SEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEK 29383

Query: 943   DTKEWSKC-TKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAA 1001
             DT +W +  T   I  T +TV  L   QKY FR+ AVN  G+ E  E    +  +     
Sbjct: 29384 DTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEI 29443

Query: 1002  PKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFL 1061
             P  +L+  LK  + +RAG +L +  + SG PPP + W K G+    R  I  ++++S  +
Sbjct: 29444 PDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSLLI 29503

Query: 1062  INSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPD 1121
             ++   R D+G Y I  +N+ G+    + V+V D P P  ++++ E   ++VT+TW   P 
Sbjct: 29504 VDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITW-EIPT 29562

Query: 1122  VQEDGEA---HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDS 1178
             +  DG A   +YI+ KR+A+   + T   +     Y ++GL+ G  YYFRV+  N  G  
Sbjct: 29563 I--DGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIG 29620

Query: 1179  EPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLG 1238
             EP ++ D  L+++                          PL P   L   D T +   L 
Sbjct: 29621 EPCETSDAVLVSE-------------------------VPLVP-AKLEVVDVTKSTVTLA 29654

Query: 1239  NPRPTVTLYKGDVNIT--------ANSKFWYNSTSGVCTLVIPTCTLKDSGD---YSVLV 1287
               +P   LY G   +T        A ++ W    +   T++  T T  + G+   + +  
Sbjct: 29655 WEKP---LYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRA 29711

Query: 1288  ENELGKDRSSCTLTVYDKDDKSVVASI-TESLQKKSKHL 1325
             +NE G      T+T     D  V+ +I   ++ +K+ H+
Sbjct: 29712 QNEKGVSEPRETVTAVTVQDLRVLPTIDLSTMPQKTIHV 29750



 Score =  325 bits (832), Expect = 2e-88
 Identities = 195/607 (32%), Positives = 305/607 (50%), Gaps = 16/607 (2%)

Query: 592   SEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEE 651
             S A   +A    I+P V  A ++++  V+VG    I+VP  G+P P +TW KDG+ + + 
Sbjct: 23216 SLAVPIVAKDLVIEPDVKPAFSSYS--VQVGQDLKIEVPISGRPKPTITWTKDGLPLKQT 23273

Query: 652   ERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFL 711
              R+++    D   L+I    ++D G   + + N  G  TA++ +  LD+P PP+G V+F 
Sbjct: 23274 TRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFD 23333

Query: 712   ELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKA 771
             ++S   + + W  P   GG  +T +IV++R      W  +     + T     K++ G  
Sbjct: 23334 DVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTT-LKVTKLKTGTE 23392

Query: 772   YQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGA 831
             YQFRI A N  G S  LE++ + A  P + PG    P  T ++K+++ I W+ P  +GG+
Sbjct: 23393 YQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGS 23452

Query: 832   PVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPS 891
             PV+GY +ER+++ S LW  VNK  I  T+     L E  EYEFRV A N  G G+ S  S
Sbjct: 23453 PVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNS 23512

Query: 892   SSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSK 949
                VA+DP  PPG  + + V     + I+L W +P    G   +GYI+E R      W K
Sbjct: 23513 ECYVARDPCDPPGTPEPIMV---KRNEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMK 23569

Query: 950   CTKIPISGTCYTVGGLIERQKYFFRIRAVNEAG-VGEPVELDKGVRAMPPPAAPKFDLSA 1008
              +   +  T +TV GL E Q+Y FR+ A N AG + +P +    + A      P+  +  
Sbjct: 23570 ASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDP 23629

Query: 1009  RLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDG--VPTKGRETITKSKNHSQFLINSTK 1066
             + +  +VV AG    + A   G P P + W +    +    R  I  +   +  ++    
Sbjct: 23630 KFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAI 23689

Query: 1067  RSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTN-LRLFEEVPNTVTLTWNHSPDVQED 1125
             R D G Y +   N  G   + ++V+V D P PP   +++        +LTW  SP +Q+ 
Sbjct: 23690 RIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTW--SPPLQDG 23747

Query: 1126  GE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
             G   +HY++ KR+ S   W   A  V +N   VT LL G +Y FR++A N+ G  EPL+S
Sbjct: 23748 GSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPLES 23807

Query: 1184  RDTWLIN 1190
                 + N
Sbjct: 23808 APVLMKN 23814



 Score =  318 bits (816), Expect = 2e-86
 Identities = 196/641 (30%), Positives = 304/641 (47%), Gaps = 25/641 (3%)

Query: 557   PGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEA--------SVFIADPPTIDPSV 608
             P  +  +   V  L     G +   KY FR     +           V+ A    + P +
Sbjct: 18843 PADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKI 18902

Query: 609   LEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTIS 668
             L       IT+K G    I+    GKP P   W K   EV     +++ + +  ++L I 
Sbjct: 18903 L---MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIK 18959

Query: 669   NCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDN 728
             +  R+DSG   L  +N  G+ T  + + V+D P PPQ   +  ++      + W  P ++
Sbjct: 18960 DVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHIPLED 19019

Query: 729   GGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPL 788
             GG  +T +IVE+  V +  W+       K T+    K+  G+ Y FR+ A N  G+S+PL
Sbjct: 19020 GGSNITNYIVEKCDVSRGDWVTALASVTK-TSCRVGKLIPGQEYIFRVRAENRFGISEPL 19078

Query: 789   ETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLW 848
              + ++ A  P   P      +VT V K+ + + W+ P  DGG+P++GY++ER+++ S LW
Sbjct: 19079 TSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLW 19138

Query: 849   VPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQD 908
             V  N   ++ T+    GL+E  EY FR+ A+NKAG   PS P+  V A+ PV PPG  + 
Sbjct: 19139 VKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKPE- 19197

Query: 909   LHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIP--ISGTCYTVGG 964
               V D + S++SL W  P    G    GY +E       +W +C   P  I    YT  G
Sbjct: 19198 --VIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATG 19255

Query: 965   LIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCI 1024
             L E+ +Y FR  A     +  P E    V  +     P+ DLS  +KS + V+AGT +C+
Sbjct: 19256 LEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCL 19315

Query: 1025  HAAFSGSPPPDVIWQKDGVPTKGRETI--TKSKNHSQFLINSTKRSDSGVYRILLQNEFG 1082
              A   G P P V W+KDG   K  E I     +N     + S  R DSG Y I  +N  G
Sbjct: 19316 DATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSG 19375

Query: 1083  EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTA 1140
                  I ++V D P PP ++++ +   +   L+W   P +++ G    +YI+ KR+ S  
Sbjct: 19376 SKSATIKLKVLDKPGPPASVKINKMYSDRAMLSW--EPPLEDGGSEITNYIVDKRETSRP 19433

Query: 1141  TWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPL 1181
              W   +  V     +V  L+ G +Y FR+ A N+ G  +P+
Sbjct: 19434 NWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPV 19474



 Score =  317 bits (812), Expect = 5e-86
 Identities = 193/605 (31%), Positives = 291/605 (48%), Gaps = 26/605 (4%)

Query: 598   IADPPTIDPSVLEALA-----------AHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGM 646
             ++DP TI P  ++ L               +TV++GH  H+++P++GKP P ++W KDG+
Sbjct: 27543 LSDPVTIGPITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGL 27602

Query: 647   EVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQG 706
              + E E V   + E++  L+I N  +E  G   + L N        + +  L  P  P+G
Sbjct: 27603 PLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKG 27662

Query: 707   RVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKV 766
              + F E+    V + W  P+DNGG  +T + +E+R   + +W  +     + T    N V
Sbjct: 27663 PIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCSSVARTTFKVPNLV 27722

Query: 767   EEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPT 826
             ++ + YQFR+ A N  GVS PL +  + A +    PG   +P + +VT + +++TW+AP 
Sbjct: 27723 KDAE-YQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPV 27781

Query: 827   QDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQ 886
              DGG+ V G+ VE++++ S LW  VN  PI G +    GL+E  +Y+FRV A N AG   
Sbjct: 27782 YDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGLSS 27841

Query: 887   PSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDT 944
             PS PS   +A  PV PPG    +   D +  +I+L W  P    G    GY +E R +  
Sbjct: 27842 PSDPSKFTLAVSPVDPPGTPDYI---DVTRETITLKWNPPLRDGGSKIVGYSIEKR-QGN 27897

Query: 945   KEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKG-VRAMPPPAAPK 1003
             + W +C    +S   YTV GL    +Y FRI A N  G   P     G +        P 
Sbjct: 27898 ERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPI 27957

Query: 1004  FDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRET--ITKSKNHSQFL 1061
              +        +++++G +L I A   G P P V W KDGV  + R    IT     +   
Sbjct: 27958 VEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLF 28017

Query: 1062  INSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPD 1121
             +    R   GVY +  +N  G A+ +I V+V D P        F  +       W  +P 
Sbjct: 28018 VRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAP- 28076

Query: 1122  VQEDGEA---HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDS 1178
                DG A   HYII KR+ S   W    ++  +  YT   L+ G +Y FRV A N+ G  
Sbjct: 28077 -LNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVG 28135

Query: 1179  EPLDS 1183
              PLDS
Sbjct: 28136 RPLDS 28140



 Score =  313 bits (801), Expect = 9e-85
 Identities = 262/892 (29%), Positives = 399/892 (44%), Gaps = 90/892 (10%)

Query: 356   PNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTID 415
             P   W  +GKE+K  D+  +T+  D ++  L++  +  +D+G ++    N +  A  +I+
Sbjct: 14416 PTVSWHKDGKEVKASDR--LTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASIN 14473

Query: 416   RIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRAEL 475
                I      K+++  + +++   C+LT +        DG   +          G+R  +
Sbjct: 14474 VKVIGLPGPCKDIKASDITKS--SCKLTWEPPEF----DGGTPILHYVLERREAGRRTYI 14527

Query: 476   IIEDAQ---------LSDGGEY--TVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVH 524
              +   +         L   GEY   V A+      EY       + +          DV 
Sbjct: 14528 PVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVE 14587

Query: 525   AATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVK---------QGAVHKLIFPSM 575
                 +   + +       +G     G +I      +I K         +  V  L + + 
Sbjct: 14588 VHNPTAEAMTITWKPPLYDG-----GSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAK 14642

Query: 576   GPEHEGKYTFRAKGTESEASVFI---ADPPT--IDP-SVLEALAAHAITVKVGHTAHIKV 629
             G E   +Y FR +  E+ A +     A PPT  +DP    + +   ++ VK G    +  
Sbjct: 14643 GLEEGKEYQFRVRA-ENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDA 14701

Query: 630   PFRGKPLPKVTWYKDGM--------------------EVTEEE--------RVSME---R 658
                G P P +TW KD                      EV EEE        R+S++   +
Sbjct: 14702 SISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKK 14761

Query: 659   GEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCV 718
             GE Q  L + + +R D GL ++K++NDHG A A   +SVLD P PP   V F ++  + V
Sbjct: 14762 GESQ--LRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFV-FEDIRKTSV 14818

Query: 719   HMKWKAPKDNGGRPVTQFIVERRAVGK--KSWIKIGEVDGKVTNFSTNKVEEGKAYQFRI 776
               KW+ P D+GG  +  + +E++   K    WI +     +   +S  K+ EGK Y FR+
Sbjct: 14819 LCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTL-RHCKYSVTKLIEGKEYLFRV 14877

Query: 777   LAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGY 836
              A N  G   P  ++ + A +P  PP    +P V DVT  ++ + WN P +D G+P+LGY
Sbjct: 14878 RAENRFGPGPPCVSKPLVAKDPFGPPDAPDKPIVEDVTSNSMLVKWNEP-KDNGSPILGY 14936

Query: 837   IVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVA 896
              +E+R+  S  W  VNK  +   K  VDGLLE   Y FRV A N AGPG+ S PS    A
Sbjct: 14937 WLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTA 14996

Query: 897   KDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIP 954
              DP+ PPG      V+D+S+++I L W  PA   G    GY ++ +   T EWS+CT+  
Sbjct: 14997 HDPISPPG-PPIPRVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKM 15055

Query: 955   ISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHM 1014
             I    YTV  + E   Y  R+ AVN AG G P E  + V    P   P  +L   +K  +
Sbjct: 15056 IKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGE-TQPVTVAEPQEPPAVELDVSVKGGI 15114

Query: 1015  VVRAGTALCIHAAFSGSPPPDVIWQK-DGVPTKGRETITKSKNHSQFLINSTKRSDSGVY 1073
              + AG  L I A  +G P P  +W K +G   K R  I      S+ +I    R D G Y
Sbjct: 15115 QIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSELIIKDALRKDHGRY 15174

Query: 1074  RILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH---Y 1130
              I   N  G       V V D P P  +L+          L W+   D ++DG +    +
Sbjct: 15175 VITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWS---DPEDDGGSEITGF 15231

Query: 1131  IIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLD 1182
             II ++DA   TW    E   S K  +TGLL G++Y FRV+A+N+ G   P++
Sbjct: 15232 IIERKDAKMHTWRQPIETERS-KCDITGLLEGQEYKFRVIAKNKFGCGPPVE 15282



 Score =  308 bits (790), Expect = 2e-83
 Identities = 202/595 (33%), Positives = 288/595 (48%), Gaps = 19/595 (3%)

Query: 598   IADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSME 657
             IA    I PSV   L  H   VK      I VPF+G+P   V W KDG  + E  RV++ 
Sbjct: 25387 IARDIEIKPSV--ELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVS 25444

Query: 658   RGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSC 717
               +    L+I    +ED G   L + N  GS T  + + VLDRP PP G +   E+S   
Sbjct: 25445 SSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPP-GPIRIDEVSCDS 25503

Query: 718   VHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRIL 777
             + + W  P+ +GG  ++ +IVE++     +W  + +   + T+    ++  G  YQFR+ 
Sbjct: 25504 ITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVAR-TSIKIVRLTTGSEYQFRVC 25562

Query: 778   AVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYI 837
             A N  G S   E+  V A  P  PPG    P+V   TK  + +TW  P  DGG+ V+GY 
Sbjct: 25563 AENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYH 25622

Query: 838   VERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAK 897
             +E +++ S LW   NK  I  T+  V GL E   YE+RV A N AG G+ S     V A+
Sbjct: 25623 LEYKERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPAR 25682

Query: 898   DPVKPPGLVQDLHVSDSSNSSISLAWREP--AEGDPPSGYILEMRAEDTKEWSKCTKIPI 955
             DP  PPG  +   V++ +  S+SL W +P    G   +GYI+E R      W KC    I
Sbjct: 25683 DPCDPPGQPE---VTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNI 25739

Query: 956   SGTCYTVGGLIERQKYFFRIRAVNEA-GVGEPVELDKGVRAMPPPAAPKFDLSARLKSHM 1014
               T + V  L E Q+Y FR+ A N A  V EP E    +        P+  +  + +  +
Sbjct: 25740 QETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVI 25799

Query: 1015  VVRAGTALCIHAAFSGSPPPDVIWQKDG--VPTKGRETITKSKNHSQFLINSTKRSDSGV 1072
             VV+AG  L I+A  +G P P + W KDG  +  + R  I  + NH+   +    R D+G 
Sbjct: 25800 VVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQ 25859

Query: 1073  YRILLQNEFGEARYDIHVRVADFPRPPTN-LRLFEEVPNTVTLTWNHSPDVQEDGEA--- 1128
             Y + L+N  G     ++ +V D P PP   L +        +L+W      QEDG A   
Sbjct: 25860 YVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRP---QEDGGADID 25916

Query: 1129  HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
             +YI+ KR+ S   W      +      VT LL G +Y FRV   N+ G  EPL+S
Sbjct: 25917 YYIVEKRETSHLAWTICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLES 25971



 Score =  293 bits (751), Expect = 6e-79
 Identities = 187/608 (30%), Positives = 301/608 (49%), Gaps = 25/608 (4%)

Query: 587   AKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGM 646
             ++ TE   +V   + P I    L+      +TVK G    +     GKP PK+TW K  M
Sbjct: 13673 SRPTEEIQAVDTQEAPEI---FLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADM 13729

Query: 647   EVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQG 706
              + +++R+++E    ++ +TI +  R D+G  +++  N  G ATA + ++VLD+P PP  
Sbjct: 13730 ILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAA 13789

Query: 707   RVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKV 766
               +  +++     + W  P+D+GG  +T ++VERRA   + W K+     K TNF   K+
Sbjct: 13790 -FDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTV-KDTNFKATKL 13847

Query: 767   EEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPT 826
                K Y FR+ A N  GV +P++   + A    +PPG  ++ + +D+TK+AVT+TW  P 
Sbjct: 13848 IPNKEYIFRVAAENMYGVGEPVQASPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPD 13907

Query: 827   QDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQ 886
              DGG+P+ GY VER    ++ WV  NK P++ T   V GL    +Y FRV+A N AGPG+
Sbjct: 13908 DDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGK 13967

Query: 887   PSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDT 944
             PS  +  ++ KDP+ PP       V D   +S+ L W +P    G     Y++EM    T
Sbjct: 13968 PSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGT 14027

Query: 945   KEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGV---RAMPPPAA 1001
              EW +  +  +  T + + GL+E Q+Y FR+RAVN+AG  EP E    V     + PP+ 
Sbjct: 14028 DEWVRVAE-GVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSP 14086

Query: 1002  PKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFL 1061
             P++     +  +    A     +     GSP  + I +K  V  KG +T+  +   ++  
Sbjct: 14087 PRWLEVINITKN---TADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCT 14143

Query: 1062  INSTKRSDSGVYRILLQNEFGEARY---DIHVRVAD---FPRPPTNLRLFEEVPNTVTLT 1115
             +         V+R+  +N  G++ Y   +  V   D    P PP  L + +     V L 
Sbjct: 14144 VTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLK 14203

Query: 1116  WNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFSN-KYTVTGLLPGRKYYFRVVAR 1172
             W   P   + G     Y+I K++     W  A +    +  + VT ++ G +  F+V A 
Sbjct: 14204 W--EPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAE 14261

Query: 1173  NEIGDSEP 1180
             NE G   P
Sbjct: 14262 NEAGVGHP 14269



 Score =  285 bits (729), Expect = 2e-76
 Identities = 315/1307 (24%), Positives = 527/1307 (40%), Gaps = 123/1307 (9%)

Query: 68    EFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKL 127
             EF+ KPQ +   EG+KA F   +   + P + WKR+    ++   K    +  K+ VL +
Sbjct: 12553 EFISKPQNLEILEGEKAEFVCSISKESFP-VQWKRDDKT-LESGDKYDVIADGKKRVLVV 12610

Query: 128   EPLTSDDSDNYKCIASNDHADAIYTV-----------SLLVTEGQEKM-------DFKKM 169
             +  T  D   Y  +     A A  TV              V E QE +       +  K 
Sbjct: 12611 KDATLQDMGTYVVMVGAARAAAHLTVIEKLRIVVPLKDTRVKEQQEVVFNCEVNTEGAKA 12670

Query: 170   LKKRAPPAPKKKQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKV 229
                R   A     K +  +K+++  L        ++       T+ RG   K       V
Sbjct: 12671 KWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVK-SAANLIV 12729

Query: 230   EVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPL----RIQYSLGKYD 285
             E E +RI++PL+D ET    +V F C  ++   NV + W K  E +    R+ Y + KY 
Sbjct: 12730 EEEDLRIVEPLKDIETMEKKSVTFWC--KVNRLNVTLKWTKNGEEVPFDNRVSYRVDKY- 12786

Query: 286   VKQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTA 345
                   K+ML I +    D G Y ++ G  +  AEL +++ P +F+  ++   VTE   A
Sbjct: 12787 ------KHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDA 12840

Query: 346   VFEIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGN 405
             VF  +LS+++ N  W  NG+E+K   KY+    +DG  H L IKD RL D  E++    +
Sbjct: 12841 VFSCQLSREKANVKWYRNGREIKEGKKYKF--EKDGSIHRLIIKDCRLDDECEYACGVED 12898

Query: 406   LVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYS 465
                +A+L ++ IP++ +   +++     +      EL    V ++W ++  +++ G K+ 
Sbjct: 12899 RKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQ 12958

Query: 466   MNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHA 525
             M  EGK   L I D +  D GEY  +A +D +       A          +K+   D+  
Sbjct: 12959 MMSEGKIHRLQICDIKPRDQGEYRFIA-KDKEARAKLELAAAP------KIKTADQDLVV 13011

Query: 526   ATGSPAELCVVLND-EKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYT 584
               G P  + V  +   K E  W K+ + ++    +    +    +++    G +   K  
Sbjct: 13012 DVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKT-IDTTAEQTSFRILEAKKGDKGRYKIV 13070

Query: 585   FRAKGTESEA----SVFIADPPTIDPSVLEAL-----AAHAITVKVGHTAHIKVPFRGKP 635
              + K  ++E      V     P  +  V E        A    +  G +  I      + 
Sbjct: 13071 LQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRD 13130

Query: 636   LPKVTWY--KDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATL 693
             + + TW    D  E  E     +++G  + L  +S   R  +G     ++ D+     + 
Sbjct: 13131 IKRKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGE---PVETDNPVEARSK 13187

Query: 694   HLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGE 753
             +    D P PP   V   +++   V + W+ P+ +GG  +T +++E R      W     
Sbjct: 13188 Y----DVPGPPLN-VTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMT 13242

Query: 754   VDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDP-LETEEVFAGNPIEPPGFASQPQVTD 812
             V  +  + +   V EG+ Y FR+ A N  GV  P   T  V   +PIE P        +D
Sbjct: 13243 VRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSD 13302

Query: 813   VTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEY 872
              T+ +V + W  P +DGG+P+LGYI+ER ++G + W+  N   +      V GL +  +Y
Sbjct: 13303 QTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKY 13362

Query: 873   EFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPP 932
              +RV A NKAG   PS     + A D    P +  DL    +    + +    P     P
Sbjct: 13363 LYRVSAENKAGVSDPSEILGPLTADDAFVEPTM--DL---SAFKDGLEVIVPNPITILVP 13417

Query: 933   S-GYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDK 991
             S GY        T  W    K+  +G         +R K    + A  E  +      DK
Sbjct: 13418 STGY-----PRPTATWCFGDKVLETG---------DRVK-MKTLSAYAELVISPSERSDK 13462

Query: 992   GVRAMPPPAAPKFDLSARLKSHMVVRAG----------TALCIHAAFS------GSPPPD 1035
             G+  +      K  +S  +  +++ R            T   +H  +       GSP   
Sbjct: 13463 GIYTLKLENRVK-TISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTG 13521

Query: 1036  VIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGE---ARYDIHVRV 1092
              + +K  V  K    +       +F +    +    ++++  +N+ G    A  D  V +
Sbjct: 13522 YVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNM 13581

Query: 1093  ---ADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERV 1149
                A  P PP N++  +   N++ LTW+   +        YI+ +    +  W    E V
Sbjct: 13582 STPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGEPV 13641

Query: 1150  FSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDW 1209
                K  VTGL  G+ Y +RV A N  G S+P  SR T     ++IQ +  +  P    D 
Sbjct: 13642 AETKMEVTGLEEGKWYAYRVKALNRQGASKP--SRPT-----EEIQAVDTQEAPEIFLD- 13693

Query: 1210  RHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCT 1269
                   V  L   TV  G    +     G P P +T  K D+ +  + +    +     T
Sbjct: 13694 ------VKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKST 13747

Query: 1270  LVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASITE 1316
             + I      D+G Y +   N  G+  +   + V DK        IT+
Sbjct: 13748 VTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITD 13794



 Score =  273 bits (699), Expect = 6e-73
 Identities = 160/493 (32%), Positives = 252/493 (51%), Gaps = 15/493 (3%)

Query: 701   PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTN 760
             P PP+  +E + ++ +   +KW  P+ +GG P+T +IVE+R V +K W  + +   K T 
Sbjct: 14084 PSPPRW-LEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTV-DTTVKDTK 14141

Query: 761   FSTNKVEEGKAYQFRILAVNSEGVSDPLETEE-VFAGNPIEPPGFASQPQVTDVTKEAVT 819
              +   + EG  Y FR+ A N+ G SD  E E+ V A +    PG      V DVTK  V 
Sbjct: 14142 CTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVD 14201

Query: 820   ITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAV 879
             + W  P  DGG P+  Y++E++++    WV   K         V  ++E TE +F+V A 
Sbjct: 14202 LKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAE 14261

Query: 880   NKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYIL 937
             N+AG G PS P+  +  +DP  PP    DLHV+D+    I++AW+ P +  G P  GY +
Sbjct: 14262 NEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHV 14321

Query: 938   EMRAEDTKEWSKCTKIPISGTCYTV-GGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAM 996
             EM    T++W +    PI    + V  G++  ++Y  R+RAVN  GV EP E+ + V A 
Sbjct: 14322 EMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAK 14381

Query: 997   PPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKN 1056
              P   P  DL       ++V  G  L I   F   P P V W KDG   K  + +T   +
Sbjct: 14382 DPDCKPTIDLETH---DIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKND 14438

Query: 1057  H--SQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTL 1114
             H  +   +  + R+D+G+Y I L+N+ G A   I+V+V   P P  +++  +   ++  L
Sbjct: 14439 HISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKL 14498

Query: 1115  TWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVAR 1172
             TW   P   + G    HY++ +R+A   T+           +TV  L+P  +Y+FRV A 
Sbjct: 14499 TW--EPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAV 14556

Query: 1173  NEIGDSEPLDSRD 1185
             N++G  E ++ ++
Sbjct: 14557 NKVGGGEYIELKN 14569



 Score =  255 bits (652), Expect = 2e-67
 Identities = 168/569 (29%), Positives = 270/569 (47%), Gaps = 36/569 (6%)

Query: 617   ITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSG 676
             I V+ G    + +P +GKP P   W K+G ++++  R  +   E    L I    R DSG
Sbjct: 30146 IFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISK--RAMIATSETHTELVIKEADRGDSG 30203

Query: 677   LILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQF 736
                L L+N  G     + + V+  P  P+G +E+ ++    V + W+ P D+GG  +  +
Sbjct: 30204 TYDLVLENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGY 30263

Query: 737   IVERRAVGKKSWIKIGEVDGKV--TNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVF 794
             I+ERR V K +W  I   D +V  T+     ++E   Y FR+ A N  G+S PL++EE  
Sbjct: 30264 ILERREVPKAAWYTI---DSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPV 30320

Query: 795   AG----NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVP 850
                   NP EPP  ++ P+V DVTK +V+++W+ P  DGG+ V GY +ER++  ++ WV 
Sbjct: 30321 TPKTPLNPPEPP--SNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVR 30378

Query: 851   VNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLH 910
              NK  I  T  TV GL+ D EY+FR+IA N  G  + S  S  VV KDP   P    +L 
Sbjct: 30379 HNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELE 30438

Query: 911   VSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIER 968
             +   S  S++L W +P    G    GY +E R      W K  K  I    +T+GGL+E 
Sbjct: 30439 ILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEA 30498

Query: 969   QKYFFRIRAVNEAGVGEPVELDKGVRA-MPPPAAPKFDLSARLKSHMVVRAGTALCIHAA 1027
              +Y FR+ A NE G+  P      ++  +    AP   +   +K  +  + G A  +   
Sbjct: 30499 TEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAP--GIRKEMKD-VTTKLGEAAQLSCQ 30555

Query: 1028  FSGSPPPDVIWQKDG---VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEA 1084
               G P PD+ W + G   + ++  +  +  + H+   + + ++ D GVY  +  NE GE 
Sbjct: 30556 IVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHT-LTVMTEEQEDEGVYTCIATNEVGEV 30614

Query: 1085  RYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYT 1144
                  + +   P+      L E+    V  T             H + + R     TW+ 
Sbjct: 30615 ETSSKLLLQATPQFHPGYPLKEKYYGAVGSTL----------RLHVMYIGRPVPAMTWF- 30663

Query: 1145  AAERVFSNKYTVTGLLPGRKYYFRVVARN 1173
               +++  N   +T  +   ++Y  +V +N
Sbjct: 30664 HGQKLLQNSENIT--IENTEHYTHLVMKN 30690



 Score =  252 bits (643), Expect = 2e-66
 Identities = 205/799 (25%), Positives = 359/799 (44%), Gaps = 50/799 (6%)

Query: 438   LECELTSKD-VTLRWKK---DG--QLLMHGTKYSMNHEG---KRAELIIEDAQLSDGG-- 486
             LE    SKD VTL+W+K   DG  ++L +  +Y  + +    K  +  I+D Q + GG  
Sbjct: 30437 LEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLL 30496

Query: 487   -----EYTVVAMQDGDPTEYYSTAIVTVEERLAT-----VKSGMSDVHAATGSPAEL-CV 535
                  E+ V A  +   +    TA+ +++ +L +     ++  M DV    G  A+L C 
Sbjct: 30497 EATEYEFRVFAENETGLSRPRRTAM-SIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQ 30555

Query: 536   VLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKG----TE 591
             ++     +  W + GKE+      ++   G  H L   +   E EG YT  A       E
Sbjct: 30556 IVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVE 30615

Query: 592   SEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEE 651
             + + + +   P   P        +     VG T  + V + G+P+P +TW+     +   
Sbjct: 30616 TSSKLLLQATPQFHPGYPLKEKYYGA---VGSTLRLHVMYIGRPVPAMTWFHGQKLLQNS 30672

Query: 652   ERVSMERGEDQALLTISNCVRED-SGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEF 710
             E +++E  E    L + N  R+  +G   ++L N  G+  A L + + D+P  P G +  
Sbjct: 30673 ENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVI 30732

Query: 711   LELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGK 770
               L  +   + WK P D+GG  +T ++VE+    + +  ++      VT      + E  
Sbjct: 30733 EALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENA 30792

Query: 771   AYQFRILAVNSEGVSDPLETEEV-FAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDG 829
              Y FR+ A N+ G+SDPLE   V    +P E PG   +P +T VTK++  + W  P  DG
Sbjct: 30793 GYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDG 30852

Query: 830   GAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSV 889
             GA +  Y +E+R+K  N W+ V  + I+ T  +V  L+E  EYEFRV   N  G  + S 
Sbjct: 30853 GAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSE 30912

Query: 890   PSSSVVAKD--PVKPPGLVQDL-HVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKE 946
              S  +  K   P++ P   ++L +++    S+ +L  +      P   +  + + E   +
Sbjct: 30913 ISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGK-EIIAD 30971

Query: 947   WSKCTKIPISGTCY--TVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKF 1004
               K       G  +   +  + +     +++RA N+ G         G  ++      K 
Sbjct: 30972 GLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGG------SVSGTASLEVEVPAKI 31025

Query: 1005  DLSARLKSHMVVRA--GTALCIHAAFSGSPPPDVIWQK--DGVPTKGRETITKSKNHSQF 1060
              L   L+    V A  G  + I   FSG P P + WQK  D +   G   +  +++ +  
Sbjct: 31026 HLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSL 31085

Query: 1061  LI-NSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHS 1119
             +  N  +R D+G Y +  +N FG  +  + + VAD P PP  +++ +   ++V LTW   
Sbjct: 31086 VFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEP 31145

Query: 1120  PDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSE 1179
                      +YI+ ++ A+TA  +    +    +YTV  L     Y FRV+A N+ G S+
Sbjct: 31146 ASDGGSKITNYIV-EKCATTAERWLRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSK 31204

Query: 1180  PLDSRDTWLINKDQIQDLS 1198
             P +  +  +  +D+ + ++
Sbjct: 31205 PSEPSEPTITKEDKTRAMN 31223



 Score =  243 bits (621), Expect = 7e-64
 Identities = 306/1277 (23%), Positives = 500/1277 (39%), Gaps = 142/1277 (11%)

Query: 68    EFVEKPQPVTAPEGDKAVFRARV-QGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLK 126
             EF +  +  T  EG  AV    V + NAK  + W + +G  I +S K    +  +   L 
Sbjct: 12286 EFTKPLEDQTVEEGATAVLECEVSRENAK--VKWFK-NGTEILKSKKYEIVADGRVRKLV 12342

Query: 127   LEPLTSDDSDNYKCIASN-----------DHADAIYTVSLLVTEGQEKMDFK-------- 167
             +   T +D   Y C A +            H + +  ++ L    +E   F+        
Sbjct: 12343 IHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFECELSRENA 12402

Query: 168   --KMLKKRAPPAPKKKQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEM 225
               K  K  A     KK   ++     + +++K    D  +   E       G+L  L+E 
Sbjct: 12403 KVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEE- 12461

Query: 226   KKKVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYD 285
                   EA+   K L + E     T+   C  E+  P  ++IW KG E +      G+Y+
Sbjct: 12462 ------EAV-FTKNLANIEVSETDTIKLVC--EVSKPGAEVIWYKGDEEI---IETGRYE 12509

Query: 286   VKQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTA 345
             +   G K +LVI N ++ DAG Y+  +   R   ++ V +   +F+ + + +++ E + A
Sbjct: 12510 ILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKA 12569

Query: 346   VFEIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGN 405
              F   +SK+     WK + K L+  DKY++    DG    L +KDA L D G +    G 
Sbjct: 12570 EFVCSISKESFPVQWKRDDKTLESGDKYDVIA--DGKKRVLVVKDATLQDMGTYVVMVGA 12627

Query: 406   LVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYS 465
                 A LT+    ++ V  LK+ RVKE+      CE+ ++    +W ++ + +   +KY 
Sbjct: 12628 ARAAAHLTVIE-KLRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYI 12686

Query: 466   MNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHA 525
             +  +     L I DA L D   Y V ++ +       S A + VEE    +   + D+  
Sbjct: 12687 ILQKDLVYTLRIRDAHLDDQANYNV-SLTNHRGENVKSAANLIVEEEDLRIVEPLKDIET 12745

Query: 526   ATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTF 585
                        +N   V   W K+G+E+     +        H L     G   EG+Y  
Sbjct: 12746 MEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIV 12805

Query: 586   RAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDG 645
              A   +S A + I + PT     +E L    +T         ++    +    V WY++G
Sbjct: 12806 TAGQDKSVAELLIIEAPT---EFVEHLEDQTVTEFDDAVFSCQL---SREKANVKWYRNG 12859

Query: 646   MEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQ 705
              E+ E ++   E+      L I +C  +D       +++    A   +    ++  +PPQ
Sbjct: 12860 REIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQ 12919

Query: 706   GRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAV--GKKSWIKIGEVDGKVTNFST 763
                + LE  G+ V    +  KD   +   Q++     V  G K  +     +GK+     
Sbjct: 12920 ---DILEAPGADVVFLAELNKD---KVEVQWLRNNMVVVQGDKHQMMS---EGKIHRLQI 12970

Query: 764   NKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWN 823
               ++     ++R +A + E  +      E+ A   I+    A Q  V DV K    +   
Sbjct: 12971 CDIKPRDQGEYRFIAKDKEARAKL----ELAAAPKIKT---ADQDLVVDVGKPLTMVV-- 13021

Query: 824   APTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAG 883
                     P   Y      K    W   N +P+  TK T+D   E T   FR++   K  
Sbjct: 13022 --------PYDAY-----PKAEAEWFKEN-EPLS-TK-TIDTTAEQTS--FRILEAKKGD 13063

Query: 884   PGQPSV-------PSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSG 934
              G+  +        +   +    +  PG V++L V+++ +  +SLAW EP    G    G
Sbjct: 13064 KGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIG 13123

Query: 935   YILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQ-KYFFRIRAVNEAGVGEPVELDKGV 993
             Y++E R    K W   T    S   +TV GL +   +Y FR+ A N  G GEPVE D  V
Sbjct: 13124 YVVERRDIKRKTWVLATDRAESCE-FTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPV 13182

Query: 994   RAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPD----------VIWQKDGV 1043
              A      P   L+  +    V R G +L          PP+          VI  +D  
Sbjct: 13183 EARSKYDVPGPPLNVTITD--VNRFGVSLTWE-------PPEYDGGAEITNYVIELRDKT 13233

Query: 1044  PTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDI---HVRVAD---FPR 1097
               +    +T         +          +R+  QN  G  +       V+VAD    P 
Sbjct: 13234 SIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPS 13293

Query: 1098  PPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTAAERVFSN-KY 1154
             PP NL   ++  ++V L W   P +++ G     YII + +     W     ++     Y
Sbjct: 13294 PPVNLTSSDQTQSSVQLKWE--PPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTY 13351

Query: 1155  TVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPR 1214
              VTGL  G KY +RV A N+ G S+P +     L   D   + +  L  ++       P 
Sbjct: 13352 KVTGLEKGNKYLYRVSAENKAGVSDPSEILGP-LTADDAFVEPTMDLSAFKDGLEVIVPN 13410

Query: 1215  FVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPT 1274
              +T L P T              G PRPT T   GD  +    +    + S    LVI  
Sbjct: 13411 PITILVPST--------------GYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISP 13456

Query: 1275  CTLKDSGDYSVLVENEL 1291
                 D G Y++ +EN +
Sbjct: 13457 SERSDKGIYTLKLENRV 13473



 Score =  208 bits (529), Expect = 3e-53
 Identities = 167/633 (26%), Positives = 273/633 (43%), Gaps = 66/633 (10%)

Query: 699   DRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKV 758
             D P PP  R+E  +++   V + W  P D+GG P+T + VER       W++  ++  K 
Sbjct: 13881 DPPGPPT-RLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKD 13939

Query: 759   TNFSTNKVEEGKAYQFRILAVNSEGVSDPLE-TEEVFAGNPIEPPGFASQPQVTDVTKEA 817
             T +    +   K Y+FR+LA N  G   P + TE +   +PI+PP    +P V DV K +
Sbjct: 13940 TTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTS 13999

Query: 818   VTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVI 877
             V + W  P  DGGA +  Y++E  K G++ WV V  + +  T+  + GL+E  EY FRV 
Sbjct: 14000 VRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRV-AEGVPTTQHLLPGLMEGQEYSFRVR 14058

Query: 878   AVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGY 935
             AVNKAG  +PS PS  V+ ++ + PP   + L V + + ++  L W  P +  G P + Y
Sbjct: 14059 AVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNY 14118

Query: 936   ILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRA 995
             I+E R    K W +     +  T  TV  L E   Y FR+ A N  G  +  E++  V A
Sbjct: 14119 IVEKRDVRRKGW-QTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLA 14177

Query: 996   M-------PPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPD---------VIWQ 1039
                     PP A    D++ R               H      PP +         VI +
Sbjct: 14178 KDTFTTPGPPYALAVVDVTKR---------------HVDLKWEPPKNDGGRPIQRYVIEK 14222

Query: 1040  KDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADF---- 1095
             K+ + T+  +    +     F +          +++  +NE G         +       
Sbjct: 14223 KERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPT 14282

Query: 1096  --PRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTAAERVFS 1151
               P PP +L + +     + + W   P  +  G     Y +      T  W     R   
Sbjct: 14283 SPPSPPLDLHVTDAGRKHIAIAWK--PPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIK 14340

Query: 1152  N-KYTVT-GLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDW 1209
             + K+ V  G++P ++Y  RV A N IG SEP +  +  ++ KD     +  L+ ++    
Sbjct: 14341 DLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISEN-VVAKDPDCKPTIDLETHDI--- 14396

Query: 1210  RHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCT 1269
                           V+ G+  ++   F   P PTV+ +K    + A+ +    +      
Sbjct: 14397 -------------IVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAH 14443

Query: 1270  LVIPTCTLKDSGDYSVLVENELGKDRSSCTLTV 1302
             L +P     D+G Y++ +EN+LG   +S  + V
Sbjct: 14444 LEVPKSVRADAGIYTITLENKLGSATASINVKV 14476



 Score =  208 bits (529), Expect = 3e-53
 Identities = 143/432 (33%), Positives = 213/432 (49%), Gaps = 26/432 (6%)

Query: 762   STNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTIT 821
             + N+ + GK   + +   NS G         V     ++ PG     +V +VTK +VT+T
Sbjct: 21920 NVNRFDSGK---YILTVENSSGSKSAFVNVRV-----LDTPGPPQDLKVKEVTKTSVTLT 21971

Query: 822   WNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNK 881
             W+ P  DGG+ +  YIVE+R+     +  V  +    T   VD L E   Y FRV+A N+
Sbjct: 21972 WDPPLLDGGSKIKNYIVEKRESTRKAYSTVATN-CHKTSWKVDQLQEGCSYYFRVLAENE 22030

Query: 882   AGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEM 939
              G G P+  + SV A +   PPG +    + D + +S+SL+W +P    G    GYI+EM
Sbjct: 22031 YGIGLPAETAESVKASERPLPPGKIT---LMDVTRNSVSLSWEKPEHDGGSRILGYIVEM 22087

Query: 940   RAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPP 999
             + + + +W+ C  + ++    T+ GLI+ ++Y FR+ A NE G+ +P +L   V A    
Sbjct: 22088 QTKGSDKWATCATVKVTEA--TITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLV 22145

Query: 1000  AAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKG--RETITKSKNH 1057
               P F L   L +   V AG  L +   F G P P V W KD VP K   R     ++N+
Sbjct: 22146 IPPAFKL---LFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENN 22202

Query: 1058  SQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTN-LRLFEEVPNTVTLTW 1116
             S   I    R D G Y + L N  GEA   ++V V D P PPT  +++ E   +++TL+W
Sbjct: 22203 SLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTADSITLSW 22262

Query: 1117  NHSPDVQEDGEA--HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNE 1174
                P   + G +  +YI+ KRD ST TW   +  V         L  G +Y FR+ A N 
Sbjct: 22263 G--PPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFRIAAENR 22320

Query: 1175  IGDSEPLDSRDT 1186
              G S  L+S  T
Sbjct: 22321 YGKSTYLNSEPT 22332



 Score =  204 bits (518), Expect = 6e-52
 Identities = 122/391 (31%), Positives = 190/391 (48%), Gaps = 6/391 (1%)

Query: 797   NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
             N I  P    + +  D+TK++V +TW  P  DGG+P+ GY+VE+R+     W  V  D +
Sbjct: 13483 NVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV-MDFV 13541

Query: 857   QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
                + TV  L++  EY F+V A NK GPG+P+     V    P   P   +++   D + 
Sbjct: 13542 TDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWRDRTA 13601

Query: 917   SSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFR 974
             +SI L W  P    G    GYI+E     + +W  C + P++ T   V GL E + Y +R
Sbjct: 13602 NSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGE-PVAETKMEVTGLEEGKWYAYR 13660

Query: 975   IRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPP 1034
             ++A+N  G  +P    + ++A+    AP+  L  +L + + V+AGT + + A  +G P P
Sbjct: 13661 VKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEP 13720

Query: 1035  DVIWQKDGVPTKG--RETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRV 1092
              + W K  +  K   R TI      S   I  +KRSD+G Y I   N  G A   + V V
Sbjct: 13721 KITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 13780

Query: 1093  ADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSN 1152
              D P PP    + +    +  LTWN   D       +Y++ +R   +  W+  +  V   
Sbjct: 13781 LDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKDT 13840

Query: 1153  KYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
              +  T L+P ++Y FRV A N  G  EP+ +
Sbjct: 13841 NFKATKLIPNKEYIFRVAAENMYGVGEPVQA 13871



 Score =  201 bits (512), Expect = 3e-51
 Identities = 144/532 (27%), Positives = 249/532 (46%), Gaps = 31/532 (5%)

Query: 168  KMLKKRAPPAPKKKQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKK 227
            K   K     P  K + V+  K    +L  +   D  +      +T   G L    E K 
Sbjct: 2826 KWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGE------YTAVVGQL----ECKA 2875

Query: 228  KVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVK 287
            K+ VE + I K +++ E     T  F+C  E+   NV  +W+K    + +     K+ + 
Sbjct: 2876 KLFVETLHITKTMKNIEVPETKTASFEC--EVSHFNVPSMWLKNGVEIEMSE---KFKIV 2930

Query: 288  QMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVF 347
              G  + L+I N +  D+  Y+   G+ ++SA LTV   P+     +K +   E+ T  F
Sbjct: 2931 VQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVT--PIMITSMLKDINAEEKDTITF 2988

Query: 348  EIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLV 407
            E+ ++ +  ++ W  NG E+K  DK ++   +  LTH+L I++    D+ +++  AG   
Sbjct: 2989 EVTVNYEGISYKWLKNGVEIKSTDKCQMRTKK--LTHSLNIRNVHFGDAADYTFVAGKAT 3046

Query: 408  QKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMN 467
              A L ++   I+F  ++K+++V E+ RA  ECE++  D+T++W KD Q L    +  + 
Sbjct: 3047 STATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQ 3106

Query: 468  HEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAAT 527
             E     L+I   ++SD G+YTVVA  +       STA + VE R   ++S   +V    
Sbjct: 3107 KEKYVHRLLIPSTRMSDAGKYTVVAGGN------VSTAKLFVEGRDVRIRSIKKEVQVIE 3160

Query: 528  GSPAELCVVLNDEKVEGVWLKDGKEIT--DLPGMQIVKQGAVHKLIFPSMGPEHEGKYTF 585
               A +   +N++ V+  W KDG EI        + V +  +H++          G+YTF
Sbjct: 3161 KQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTF 3220

Query: 586  RAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDG 645
             A    S  ++++  P    P VL+ L    +TV+ G  A       G+P PK++WYK+ 
Sbjct: 3221 VAGRNRSSVTLYVNAPE--PPQVLQEL--QPVTVQSGKPARFCAVISGRPQPKISWYKEE 3276

Query: 646  MEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSV 697
              ++   +        +  L +     ED+ +   + KND+G AT +  LSV
Sbjct: 3277 QLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSV 3328



 Score =  201 bits (512), Expect = 3e-51
 Identities = 137/438 (31%), Positives = 208/438 (47%), Gaps = 44/438 (10%)

Query: 802   PGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKC 861
             PG     + +D+TK +  +TW  P  DGG P+L Y++ERR+ G   ++PV     +    
Sbjct: 14480 PGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENK-LSW 14538

Query: 862   TVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISL 921
             TV  L+ + EY FRV AVNK G G+     + V+A+DP +PP    D+ V + +  ++++
Sbjct: 14539 TVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTI 14598

Query: 922   AWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVN 979
              W+ P    G    GYI+E  A+  + W +C +  +    YT  GL E ++Y FR+RA N
Sbjct: 14599 TWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAEN 14658

Query: 980   EAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQ 1039
              AG+ EP       +A+ P  APK      L++ + V+ G  + + A+ SGSP P + W 
Sbjct: 14659 AAGISEPSRATPPTKAVDPIDAPK----VILRTSLEVKRGDEIALDASISGSPYPTITWI 14714

Query: 1040  KDG------------------------------VPTKGRETITKS-KNHSQFLINSTKRS 1068
             KD                               +P   R +I  S K  SQ  +  + R 
Sbjct: 14715 KDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRP 14774

Query: 1069  DSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNT-VTLTWNHSPDVQEDGE 1127
             D G+Y I ++N+ G A+    V V D P PP N  +FE++  T V   W    D      
Sbjct: 14775 DHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINF-VFEDIRKTSVLCKWEPPLDDGGSEI 14833

Query: 1128  AHYIIMKRDAS--TATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRD 1185
              +Y + K+D +   + W      +   KY+VT L+ G++Y FRV A N  G   P  S+ 
Sbjct: 14834 INYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKP 14893

Query: 1186  TWLINKDQIQDLSAKLKP 1203
               L+ KD      A  KP
Sbjct: 14894 --LVAKDPFGPPDAPDKP 14909



 Score =  201 bits (510), Expect = 5e-51
 Identities = 167/595 (28%), Positives = 274/595 (46%), Gaps = 38/595 (6%)

Query: 600   DPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERG 659
             + P +D   L++     I V+ G +A I +PF+G+P P++TW ++  E T+  +V +E+G
Sbjct: 24020 EAPELD---LDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTD--KVQIEKG 24074

Query: 660   EDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVH 719
              +   L+I NC R D+G  +LKL+N  GS +A + + VLD P PPQ  +   E+      
Sbjct: 24075 VNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQN-LAVKEVRKDSAF 24133

Query: 720   MKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAV 779
             + W+ P  +GG  V  +++++R   +K++  +     K T+F    + EG  Y FR++A 
Sbjct: 24134 LVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSK-TSFKVENLTEGAIYYFRVMAE 24192

Query: 780   NSEGVSDPLET-EEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIV 838
             N  GV  P+ET + V A  P  PPG  +   +TDV++ + ++ W  P  DGG+ VLGY+V
Sbjct: 24193 NEFGVGVPVETVDAVKAAEPPSPPGKVT---LTDVSQTSASLMWEKPEHDGGSRVLGYVV 24249

Query: 839   ERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKD 898
             E + KG+  W  V +  +      V GL    EY+FRV A N+ G   P V    V+AKD
Sbjct: 24250 EMQPKGTEKWSIVAESKV--CNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKD 24307

Query: 899   PVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGT 958
                 P L    + + S  +   L    P  G P          E  K+    T++ +  T
Sbjct: 24308 LTIQPSLKLPFN-TYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQ---TTRVNVEET 24363

Query: 959   C-YTVGGLIERQKYFF---RIRAVNEAGVG-EPVELDKGVRAMPPPAAPKFDLSARLKSH 1013
                TV  + E  K  F    + A N AG   E + +    +  PP    +FD    + + 
Sbjct: 24364 ATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFD---EVSAD 24420

Query: 1014  MVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVY 1073
              VV +       A   G    + I +K    T     ++ +   +   I   K      +
Sbjct: 24421 FVVISWEP---PAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQF 24477

Query: 1074  RILLQNEFGE-ARYDIHVRVADF----PRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGE- 1127
             RI  +N +G+ A  D    +  +    P PP    +     + + + W H P V + G  
Sbjct: 24478 RIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQW-HEP-VNDGGTK 24535

Query: 1128  -AHYIIMKRDASTATWYTAAER-VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEP 1180
                Y + +++ ++  W    +  +   K+  TGL  G +Y F+V A N +G  +P
Sbjct: 24536 IIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKP 24590



 Score =  200 bits (509), Expect = 7e-51
 Identities = 157/596 (26%), Positives = 262/596 (43%), Gaps = 26/596 (4%)

Query: 600   DPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERG 659
             +PP +   +L+A  A    +KVG T  +    +G P PKVTW K+  +   + R+ +   
Sbjct: 17214 EPPEL---ILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPV 17270

Query: 660   EDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVH 719
               +  L I N   ED G+  L ++N  GS T ++ + VLD+P PP+  +E  E+     +
Sbjct: 17271 GSK--LEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRD-LEVSEIRKDSCY 17327

Query: 720   MKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAV 779
             + WK P D+GG  +T ++VERR V    W  +     K ++F+ + + EG  Y FR+ A 
Sbjct: 17328 LTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHFAKH-LNEGNQYLFRVAAE 17386

Query: 780   NSEGVSDPLETEE-VFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIV 838
             N  G    +ET + + A +P+ PPG        DV K  V++ WN P +DGG+P+ GY+V
Sbjct: 17387 NQYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLV 17446

Query: 839   ERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKD 898
             E +++G+  W+      +   +C V GL +   Y FRV A N  G G P   +  +  ++
Sbjct: 17447 EYQEEGTQDWIKFK--TVTNLECVVTGLQQGKTYRFRVKAENIVGLGLPDT-TIPIECQE 17503

Query: 899   PVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDP-PSGYILEMRAEDTKEWSKCTKIPI 955
              + PP +  D+ + +          R PA   G P P+       +E   +     +   
Sbjct: 17504 KLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDN 17563

Query: 956   SGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMV 1015
               +  T+   + R    ++I   N AG  + V +   V  +P P     ++      HM 
Sbjct: 17564 FSSVLTIKNCLRRDTGEYQITVSNAAG-SKTVAVHLTVLDVPGPPTGPINILDVTPEHMT 17622

Query: 1016  VRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRI 1075
             +             GSP  + I +K          ++   + ++  I   ++    V+R+
Sbjct: 17623 ISWQPP----KDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRV 17678

Query: 1076  LLQNEFG-----EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHY 1130
               +N+ G     ++   +       P PP    + +   N  T++W   P          
Sbjct: 17679 RAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWT-LPKSDGGSPITG 17737

Query: 1131  IIMKRDASTATWYTAAERVFSN-KYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRD 1185
               M+R   T  W    +   ++ K+ VTGL  G  Y FRV A N  G S+P  S D
Sbjct: 17738 YYMERREVTGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSD 17793



 Score =  196 bits (497), Expect = 2e-49
 Identities = 174/653 (26%), Positives = 280/653 (42%), Gaps = 42/653 (6%)

Query: 567   VHKLIFPSMGPEHEGKYTFRAKGTESEASV---------FIADPPTIDPSVLEALAAHAI 617
             V +L +   G E   KY +R    E++A V           AD   ++P++  +     +
Sbjct: 13346 VPELTYKVTGLEKGNKYLYRVSA-ENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGL 13404

Query: 618   TVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGL 677
              V V +   I VP  G P P  TW      +   +RV M+     A L IS   R D G+
Sbjct: 13405 EVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGI 13464

Query: 678   ILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFI 737
               LKL+N   + +  + ++V+ RP  P+  ++F +++   VH+ W+ P D+GG P+T ++
Sbjct: 13465 YTLKLENRVKTISGEIDVNVIARPSAPK-ELKFGDITKDSVHLTWEPPDDDGGSPLTGYV 13523

Query: 738   VERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEE-VFAG 796
             VE+R V +K+W K+ +    +  F+   + +GK Y F++ A N  G  +P   +E V   
Sbjct: 13524 VEKREVSRKTWTKVMDFVTDL-EFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMS 13582

Query: 797   NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
              P   P      +  D T  ++ +TW+ P  DGG+ + GYIVER  +GS+ WV    +P+
Sbjct: 13583 TPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACG-EPV 13641

Query: 857   QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
               TK  V GL E   Y +RV A+N+ G  +PS P+  + A D  + P +  D+ +     
Sbjct: 13642 AETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLT 13701

Query: 917   SSISLAWREPAE-GDPPSGYILEMRAEDTKEWSK---CTKIPISGTCYTVGGLIERQKYF 972
                      PA     P   I   +A+   +  K      +P   T  T+          
Sbjct: 13702 VKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKST-VTIVDSKRSDTGT 13760

Query: 973   FRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSP 1032
             + I AVN  G    V     +    PPAA  FD++       ++             GS 
Sbjct: 13761 YIIEAVNVCGRATAVVEVNVLDKPGPPAA--FDITDVTNESCLLTWNPP----RDDGGSK 13814

Query: 1033  PPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFG---------- 1082
               + + ++    ++    ++ +   + F       +   ++R+  +N +G          
Sbjct: 13815 ITNYVVERRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQASPI 13874

Query: 1083  EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATW 1142
              A+Y       D P PPT L   +   + VTLTW    D        Y + + D  T  W
Sbjct: 13875 TAKYQF-----DPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKW 13929

Query: 1143  YTAAER-VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQI 1194
                 +  V    Y V GL   +KY FRV+A N  G  +P  S +  LI KD I
Sbjct: 13930 VRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILI-KDPI 13981



 Score =  196 bits (497), Expect = 2e-49
 Identities = 143/520 (27%), Positives = 238/520 (45%), Gaps = 28/520 (5%)

Query: 698   LDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGK 757
             L+ P+PP    E L+++ S V + W  PKD+GG  VT + +ER+      W++  +    
Sbjct: 30326 LNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQIT 30385

Query: 758   VTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEE-VFAGNPIEPPGFASQPQVTDVTKE 816
              T ++   +     YQFRI+A N  G+S+     E V   +P + P    + ++  ++K+
Sbjct: 30386 TTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKD 30445

Query: 817   AVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRV 876
             +VT+ W  P  DGG  +LGY VE R+ G + W   NK+ I+  + T+ GLLE TEYEFRV
Sbjct: 30446 SVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRV 30505

Query: 877   IAVNKAGPGQPSVPSSSVVAK-DPVKPPGLVQDLH-----VSDSSNSSISLAWREPAEGD 930
              A N+ G  +P   + S+  K    + PG+ +++      + +++  S  +  R      
Sbjct: 30506 FAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGR------ 30559

Query: 931   PPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKY--FFRIRAVNEAGVGEPVE 988
              P   I   R       S+  K+   G  +T+  + E Q+    +   A NE G     E
Sbjct: 30560 -PLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVG-----E 30613

Query: 989   LDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGR 1048
             ++   + +   A P+F     LK       G+ L +H  + G P P + W       +  
Sbjct: 30614 VETSSKLLLQ-ATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNS 30672

Query: 1049  ETIT-KSKNHSQFLI--NSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLF 1105
             E IT ++  H   L+  N  +++ +G Y++ L N FG     + V + D P  PT   + 
Sbjct: 30673 ENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVI 30732

Query: 1106  EEV-PNTVTLTWNHSPDVQEDGEAHYIIMKRDAST-ATWYTAAERVFSNKYTVTGLLPGR 1163
             E +  N+  ++W    D       +Y++ K +A   A W   +  +      +  L    
Sbjct: 30733 EALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENA 30792

Query: 1164  KYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKP 1203
              YYFRV A+N  G S+PL+     +I K   +   A  KP
Sbjct: 30793 GYYFRVSAQNTFGISDPLEVSSVVII-KSPFEKPGAPGKP 30831



 Score =  195 bits (496), Expect = 2e-49
 Identities = 163/617 (26%), Positives = 271/617 (43%), Gaps = 43/617 (6%)

Query: 701   PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTN 760
             P PP+   E   ++   + + W  P  +GG  +  +IVERR    + WIK  +       
Sbjct: 21655 PDPPKNP-EVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLR 21713

Query: 761   FSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVF-AGNPIEPPGFASQPQVTDVTKEAVT 819
             +  + + EG  Y+FRI+A N+ G+S P  T   + A + +  PG    P+V D ++ +++
Sbjct: 21714 YKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFKPGPPGNPRVLDTSRSSIS 21773

Query: 820   ITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDP-IQGTKCTVDGLLEDTEYEFRVIA 878
             I WN P  DGG+ + GY+VE      + W  V     ++ T  T+ GL E+ EY+ R+ A
Sbjct: 21774 IAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYA 21833

Query: 879   VNKAGPGQPSVPSSSVVAKDPVKPPG--LVQDLHVSDSSNSSISLAWREPAEGDPPSGYI 936
             +N  G G+P++   +  A+D + PP   L  DL    +  +  +L    P +G P     
Sbjct: 21834 MNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPE-- 21891

Query: 937   LEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAM 996
             ++   +  +   K +    S     + G + R      I  V  +   +   ++  VR +
Sbjct: 21892 VKWARDHGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVN--VRVL 21949

Query: 997   PPPAAPKFDLSARLKSHMVVRAGTALCIHAAF--SGSPPPDVIWQKDGVPTKGRETITKS 1054
               P  P+      LK   V +    L         GS   + I +K     K   T+  +
Sbjct: 21950 DTPGPPQ-----DLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATN 22004

Query: 1055  KNHSQFLINSTKRSDSGVYRILLQNEFG---EARYDIHVRVADFPRPPTNLRLFEEVPNT 1111
              + + + ++  +   S  +R+L +NE+G    A     V+ ++ P PP  + L +   N+
Sbjct: 22005 CHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITLMDVTRNS 22064

Query: 1112  VTLTWNHSPDVQEDGEAH---YIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFR 1168
             V+L+W      + DG +    YI+  +   +  W T A  V   + T+TGL+ G +Y FR
Sbjct: 22065 VSLSWEKP---EHDGGSRILGYIVEMQTKGSDKWATCAT-VKVTEATITGLIQGEEYSFR 22120

Query: 1169  VVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQ 1228
             V A+NE G S+P              + LS    P   KD    P F       TVL G+
Sbjct: 22121 VSAQNEKGISDP--------------RQLSV---PVIAKDLVIPPAFKLLFNTFTVLAGE 22163

Query: 1229  DCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVE 1288
             D  +   F+G P P VT +K +V +   ++    ST     L I     +D G Y V + 
Sbjct: 22164 DLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLT 22223

Query: 1289  NELGKDRSSCTLTVYDK 1305
             N  G+   +  + V DK
Sbjct: 22224 NSAGEAIETLNVIVLDK 22240



 Score =  193 bits (491), Expect = 8e-49
 Identities = 124/393 (31%), Positives = 189/393 (48%), Gaps = 9/393 (2%)

Query: 799   IEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQG 858
             ++ PG     +V+++ K++  +TW  P  DGG+ +  Y+VERR   S  W P++    + 
Sbjct: 17307 LDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKK 17366

Query: 859   TKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSS 918
             +      L E  +Y FRV A N+ G G        + A DP+ PPG  +DLH  D   + 
Sbjct: 17367 SHFAKH-LNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTE 17425

Query: 919   ISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIR 976
             +SL W +P    G P +GY++E + E T++W K   +  +     V GL + + Y FR++
Sbjct: 17426 VSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKTV--TNLECVVTGLQQGKTYRFRVK 17483

Query: 977   AVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDV 1036
             A N  G+G P +    +        P  +L  +L   +VV+AGT +   A   G P P  
Sbjct: 17484 AENIVGLGLP-DTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTA 17542

Query: 1037  IWQKDGVPTKGRETIT-KSKNHSQFL-INSTKRSDSGVYRILLQNEFGEARYDIHVRVAD 1094
              W  DG   K  E  T ++ N S  L I +  R D+G Y+I + N  G     +H+ V D
Sbjct: 17543 KWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLD 17602

Query: 1095  FPRPPTN-LRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNK 1153
              P PPT  + + +  P  +T++W    D       +YI+ K+D    TW   +      K
Sbjct: 17603 VPGPPTGPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTK 17662

Query: 1154  YTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDT 1186
               +  L  G +Y FRV A N+IG   PLDS  T
Sbjct: 17663 LKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPT 17695



 Score =  193 bits (491), Expect = 8e-49
 Identities = 194/806 (24%), Positives = 335/806 (41%), Gaps = 105/806 (13%)

Query: 546   WLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTID 605
             W KDG  +    G+++  Q  +  L   S+  +  G YT  A+ +    S       TI 
Sbjct: 19329 WKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSA------TIK 19382

Query: 606   PSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKD----GMEVT-----EEERVSM 656
               VL+         K G  A +K+         ++W       G E+T     + E    
Sbjct: 19383 LKVLD---------KPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRP 19433

Query: 657   ERGEDQALLTISNC-----VREDSGLILLKLKNDHGSATATL-HLSVLDRPKPPQGRVE- 709
                +  A + I++C     +        +  +N +G         ++   P  P GR + 
Sbjct: 19434 NWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDP 19493

Query: 710   --FLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVE 767
                  ++   + + WK P D+GG P+T +++E+R     +W K+              ++
Sbjct: 19494 PVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQ 19553

Query: 768   EGKAYQFRILAVNSEGVSDPLETEEV-FAGNPIEPPGFASQPQVTDVTKEAVTITWNAPT 826
             EG  Y+FR+ A+N  G   P +  +  +A +P  PPG  + P+V D T+ +V+++W  P 
Sbjct: 19554 EGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGPPAFPKVYDTTRSSVSLSWGKPA 19613

Query: 827   QDGGAPVLGYIVERRKKGSNLWVPVN-KDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPG 885
              DGG+P++GY+VE ++  S+ WV  N    +Q T+  V GL+EDT+Y+FRV AVNK G  
Sbjct: 19614 YDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLMEDTQYQFRVYAVNKIGYS 19673

Query: 886   QPSVPSSSVVAKDPVKPPG--LVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRAED 943
              PS        KD + PP   L  DL  +    + +++    P +G PP           
Sbjct: 19674 DPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTMRLYVPVKGRPPPKIT------- 19726

Query: 944   TKEWSKCTKIPISGTCYTVGGLIERQKY--FFRIRAVNEAGVGEPV----------ELDK 991
                WSK    P       +G  I+   +  F R   VN+   G+ +          E   
Sbjct: 19727 ---WSK----PNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTI 19779

Query: 992   GVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETI 1051
              V+ +  P  P   ++  +K      A           GSP  + + QK     K   T+
Sbjct: 19780 VVKVLDTPGPP---VNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTV 19836

Query: 1052  TKSKNHSQFLINSTKRSDSGVYRILLQNEFG-----EARYDIHVRVADFPRPPTNLRLFE 1106
             T   + + F + + +   S  +R+  +NE+G     E R    V+ +  P P  +L++  
Sbjct: 19837 TTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGETRDA--VKASQTPGPVVDLKVRS 19894

Query: 1107  EVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTAT--WYTAAERVFSNKYTVTGLLPGRK 1164
                ++ ++ W        DG +  I    D  T    W    + + S +Y+   L  G++
Sbjct: 19895 VSKSSCSIGWKKP---HSDGGSRIIGYVVDFLTEENKWQRVMKSL-SLQYSAKDLTEGKE 19950

Query: 1165  YYFRVVARNEIGDSEPLDSRDTWLINKDQI--QDLSAKLKP---YEKKDWRHAPRFVTPL 1219
             Y FRV A NE G+  P    +  ++ +D +   DL  K  P   Y  K+  +  R   P+
Sbjct: 19951 YTFRVSAENENGEGTP---SEITVVARDDVVAPDLDLKGLPDLCYLAKENSNF-RLKIPI 20006

Query: 1220  KPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKD 1279
             K                 G P P+V+  KG+  +  +++    S++   TL++  C   D
Sbjct: 20007 K-----------------GKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSD 20049

Query: 1280  SGDYSVLVENELGKDRSSCTLTVYDK 1305
             +G Y++ ++N  G    + ++ V  K
Sbjct: 20050 AGKYTITLKNVAGTKEGTISIKVVGK 20075



 Score =  193 bits (490), Expect = 1e-48
 Identities = 138/458 (30%), Positives = 214/458 (46%), Gaps = 43/458 (9%)

Query: 749   IKIGEVDGKV------------TNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAG 796
             +K G+VDG++            T+   + V    + ++ +   NS G      T  V   
Sbjct: 22974 VKWGKVDGEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRV--- 23030

Query: 797   NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
               ++ P      +VT++TK++V+ITW  P  DGG+ +  YIVE+R+     +  V  +  
Sbjct: 23031 --LDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTN-C 23087

Query: 857   QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
                   +D L E   Y FRV A N+ G G P+  +  +   +  +PPG +    V D + 
Sbjct: 23088 HKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKIT---VDDVTR 23144

Query: 917   SSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFR 974
             +S+SL+W +P    G     YI+EM+A+ +++WS+C ++       T   L + ++Y FR
Sbjct: 23145 NSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVIT--NLTQGEEYLFR 23202

Query: 975   IRAVNEAGVGEPVELDKGVRA----MPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSG 1030
             + AVNE G  +P  L   + A    + P   P F       S   V+ G  L I    SG
Sbjct: 23203 VVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAF-------SSYSVQVGQDLKIEVPISG 23255

Query: 1031  SPPPDVIWQKDGVPTK--GRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDI 1088
              P P + W KDG+P K   R  +T S + +   I  T + D G Y I + N  G+    I
Sbjct: 23256 RPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASI 23315

Query: 1089  HVRVADFPRPPTNLRLFEEV-PNTVTLTWNHSPDVQEDG--EAHYIIMKRDASTATWYTA 1145
              +   D P PP     F++V   ++TL+WN  P +   G    +YI+ KRD +T  W   
Sbjct: 23316 EIVTLDKPDPPKGPVKFDDVSAESITLSWN--PPLYTGGCQITNYIVQKRDTTTTVWDVV 23373

Query: 1146  AERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
             +  V      VT L  G +Y FR+ A N  G S  L+S
Sbjct: 23374 SATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALES 23411



 Score =  191 bits (486), Expect = 3e-48
 Identities = 152/474 (32%), Positives = 218/474 (45%), Gaps = 34/474 (7%)

Query: 730   GRPVTQF-IVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVS--- 785
             G P+  F IV  R   K +W K+G +D  V     + V+      F ++  ++   S   
Sbjct: 18621 GCPIRLFAIVRGRPAPKVTWRKVG-IDNVVRKGQVDLVD---TMAFLVIPNSTRDDSGKY 18676

Query: 786   -----DPLETEEVFAG-NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVE 839
                  +P   + VF     ++ PG  S  +V+DVTK +  ++W  P  DGG+ V  YIVE
Sbjct: 18677 SLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVE 18736

Query: 840   RRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDP 899
             +R+     W  V  + ++ T   V  L+   EY FRV AVN+ GPG P+     V+A DP
Sbjct: 18737 KREADRKTWSTVTPE-VKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDP 18795

Query: 900   VKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAED--TKEWSKCTKIPI 955
             +  P   + L V++ + +S +LAW  P    G    GYI   R E+     W++ +   +
Sbjct: 18796 LSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYS--VV 18853

Query: 956   SGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMV 1015
                   V GL E +KY FR+ A N  GV  P E +    A      PK      +   + 
Sbjct: 18854 KDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKI----LMPEQIT 18909

Query: 1016  VRAGTALCIHAAFSGSPPPDVIWQK--DGVPTKGRETITKSKNHSQFLINSTKRSDSGVY 1073
             ++AG  L I A   G P P   W+K  D V T     + K+ + S  +I    R DSG Y
Sbjct: 18910 IKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYY 18969

Query: 1074  RILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEV-PNTVTLTWNHSPDVQEDGEA---H 1129
              +  +N  G     I V V D P PP       ++  +  +L+W H P   EDG +   +
Sbjct: 18970 SLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSW-HIP--LEDGGSNITN 19026

Query: 1130  YIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
             YI+ K D S   W TA   V      V  L+PG++Y FRV A N  G SEPL S
Sbjct: 19027 YIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPLTS 19080



 Score =  191 bits (485), Expect = 4e-48
 Identities = 165/599 (27%), Positives = 252/599 (42%), Gaps = 54/599 (9%)

Query: 609   LEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTIS 668
             L+A     I V  G    I     GKP P VTW  +  E T  +  ++E     + + I 
Sbjct: 16526 LDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMN--ERTLPQEATIETTAISSSMVIK 16583

Query: 669   NCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDN 728
             NC R   G+  L  KN+ G    T+ + VLD P P         L+     + W +P+D+
Sbjct: 16584 NCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDD 16643

Query: 729   GGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPL 788
             GG P+T +++E+R   +++W  +     +  N +   + +GKAY FRI A NS G+   +
Sbjct: 16644 GGSPITNYVIEKRESDRRAWTPVTYTVTR-QNATVQGLIQGKAYFFRIAAENSIGMGPFV 16702

Query: 789   ETEEVFA-GNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNL 847
             ET E      PI  P      +V +VTK  VT+TWN P  DGG+ ++ Y++E R  G+  
Sbjct: 16703 ETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEK 16762

Query: 848   WVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQ 907
             +  V  D +   K TV GL E   YE+RV AVN  G G+PS  +  +  KD + PP L  
Sbjct: 16763 FHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHL 16822

Query: 908   DLH--VSDSSNSSISLAWREPAEGDPPSGYILEMR--AEDTKEWSKCTKIPI-------- 955
             D    ++     + +L  R   +  P   +  +     ED +   K T   +        
Sbjct: 16823 DFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAK 16882

Query: 956   ---SGT-CYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLK 1011
                SG  C  V      +K F ++  V+  G              PP     FD     K
Sbjct: 16883 RSDSGKYCVVVENSTGSRKGFCQVNVVDRPG--------------PPVGPVSFD--EVTK 16926

Query: 1012  SHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSG 1071
              +MV+     L       GS   + I +K  V       +T +   +   ++        
Sbjct: 16927 DYMVISWKPPL----DDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDY 16982

Query: 1072  VYRILLQNEFG--------EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQ 1123
             ++RI  +N +G          +     RV D P  P    + E   ++  +TWN   D  
Sbjct: 16983 IFRIHAENLYGISDPLVSDSMKAKDRFRVPDAPDQPI---VTEVTKDSALVTWNKPHDGG 17039

Query: 1124  EDGEAHYIIMKRDASTATWYTAAERVFS--NKYTVTGLLPGRKYYFRVVARNEIGDSEP 1180
             +    +YI+ KR+  +  W    +       K+ V  LL G +Y FRV A NEIG  +P
Sbjct: 17040 KP-ITNYILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDP 17097



 Score =  191 bits (484), Expect = 5e-48
 Identities = 126/394 (31%), Positives = 187/394 (47%), Gaps = 11/394 (2%)

Query: 797   NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
             N ++ PG     +VT+VTKE  TI+W  P  +GG+ +  +IVE RK     W  V  D  
Sbjct: 17997 NVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVT 18056

Query: 857   QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
             +  +     LL + EY FRV A NK G G      + ++A +P+  PG  ++LH++D   
Sbjct: 18057 K--RLIKANLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGK 18114

Query: 917   SSISLAWREP--AEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFR 974
             + + L WR P    G P   Y +E R + + +W +  K  I  T Y V   +E Q Y FR
Sbjct: 18115 TFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFR 18174

Query: 975   IRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPP 1034
             ++  NE G  + V+ ++ V        P  DL  +L   + V+AG  + + A   G P P
Sbjct: 18175 VQTKNEGGESDWVKTEE-VVVKEDLQKPVLDL--KLSGVLTVKAGDTIRLEAGVRGKPFP 18231

Query: 1035  DVIWQKDGVPT----KGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHV 1090
             +V W KD   T      R  I    + S+F +   KRSD G Y +   N  G       V
Sbjct: 18232 EVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATV 18291

Query: 1091  RVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVF 1150
              V D P P  NL++ +   +  T+ W+   D       +YI+ K +     W T +  V 
Sbjct: 18292 NVLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVL 18351

Query: 1151  SNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSR 1184
             +   TVT L+ G +Y FRV A N+IG   P +S+
Sbjct: 18352 TPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESK 18385



 Score =  190 bits (482), Expect = 9e-48
 Identities = 129/462 (27%), Positives = 213/462 (46%), Gaps = 48/462 (10%)

Query: 69   FVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKLE 128
            FV +PQ +   E   A F A+V G+  P++ W +     + +  ++F      E  L++ 
Sbjct: 8456 FVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIR 8515

Query: 129  PLTSDDSDNYKCIASNDHADAIYTVSLLVTEG--QEKM--DFKKMLKKRAPPAPKKKQKK 184
              T  DS  Y+C+A N+H +    V+L V E   QEK+  D + MLKK   P  KK   +
Sbjct: 8516 DTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIEGDLRAMLKKT--PILKKGAGE 8573

Query: 185  VANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVE-------------- 230
               E +++E+L  V  K++EK    YG TDFRGLL+  + +K+  E              
Sbjct: 8574 -EEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRLEIEEIERS 8632

Query: 231  --------------------VEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIK 270
                                 E + ++K +E++    D   VF+  +++  P +K+ W K
Sbjct: 8633 ERDEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDAVFEIDIKINYPEIKLSWYK 8692

Query: 271  GTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKF 330
            GTE L       K+++   G ++ L + N  + D G Y L  G    SA+LTV++   + 
Sbjct: 8693 GTEKLEPS---DKFEISIDGDRHTLRVKNCQLKDQGNYRLVCGPHIASAKLTVIEPAWE- 8748

Query: 331  LGEMKPVKVTERQTAVFEIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKD 390
               ++ V + E QT     + S       W  NG+ LK   +++  V      H L I D
Sbjct: 8749 -RHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRHKTEVEHK--VHKLTIAD 8805

Query: 391  ARLSDSGEFSAEAGNLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLR 450
             R  D G+++ +  +L   A+L I+  PI+F   ++N+ V E   A  ECE++  D  + 
Sbjct: 8806 VRAEDQGQYTCKYEDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIVT 8865

Query: 451  WKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVA 492
            W K    L    KY+  ++G+   + I +    D G Y+V+A
Sbjct: 8866 WYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIA 8907



 Score =  189 bits (481), Expect = 1e-47
 Identities = 158/580 (27%), Positives = 258/580 (44%), Gaps = 42/580 (7%)

Query: 619   VKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLI 678
             V+ G +  + + ++G+P P   W K    ++   R  +   +  + LT+ NC R D+G  
Sbjct: 28369 VRAGASIRLFIAYQGRPTPTAVWSKPDSNLSL--RADIHTTDSFSTLTVENCNRNDAGKY 28426

Query: 679   LLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIV 738
              L ++N+ GS + T  + VLD P PP G + F +++     + W AP  +GG  +  ++V
Sbjct: 28427 TLTVENNSGSKSITFTVKVLDTPGPP-GPITFKDVTRGSATLMWDAPLLDGGARIHHYVV 28485

Query: 739   ERRAVGKKSWIKIGEVDGKVTN--FSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAG 796
             E+R   ++SW  I E   K T   F  N + EG  Y FR+ AVN  GV +P E  E    
Sbjct: 28486 EKREASRRSWQVISE---KCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVA 28542

Query: 797   NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
                E P    +  V D +K +  + W  P  DGG+ + GY++E R+KGS+ WV       
Sbjct: 28543 T--EQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGH--T 28598

Query: 857   QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPP-----GLVQDLHV 911
             +    TV+ L+E TEYEFRV A N AG  +P    SSV+ K+P   P     G+   L +
Sbjct: 28599 KQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQL-I 28657

Query: 912   SDSSNSSISLAWREPAEGDPP---SGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIER 968
             +  + S  ++    P  G P    +  + EMR ++T   S  T      T  TV   +  
Sbjct: 28658 TCKAGSPFTI--DVPISGRPAPKVTWKLEEMRLKETDRVSITT--TKDRTTLTVKDSMRG 28713

Query: 969   QKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAF 1028
                 + +   N AGV +   +   V   P P     ++S+      V+  G         
Sbjct: 28714 DSGRYFLTLENTAGV-KTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEP----KDG 28768

Query: 1029  SGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEAR-YD 1087
              G+   + I +K    T   + +  S   +Q  +    +     +R+  +N FG ++  +
Sbjct: 28769 GGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE 28828

Query: 1088  IHVRVADF----PRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH---YIIMKRDASTA 1140
                 +A+     P  PT   ++    N +++ W    +   DG +    Y + K++ +T 
Sbjct: 28829 SAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWE---EPYHDGGSKIIGYWVEKKERNTI 28885

Query: 1141  TWYTAAE-RVFSNKYTVTGLLPGRKYYFRVVARNEIGDSE 1179
              W    +       Y VTGL+ G +Y FR  A N  G S+
Sbjct: 28886 LWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSK 28925



 Score =  189 bits (480), Expect = 2e-47
 Identities = 192/770 (24%), Positives = 305/770 (39%), Gaps = 73/770 (9%)

Query: 570   LIFPSMGPEHEGKYTFRAKGTESEAS------VFIADPPTIDPSVLEALAAHAITVKVGH 623
             L+ P       G YT  A      AS      V     P + P   E+++A  +T+    
Sbjct: 16181 LVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSW-- 16238

Query: 624   TAHIKVPFRGKPLPKVTWYK-DGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKL 682
                   P +     K+T Y  +  E   +  V +     +   TI   +     +  +  
Sbjct: 16239 -----FPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMA 16293

Query: 683   KNDHGSA--------TATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVT 734
             +N +G          TA    SV   P  P        ++ + + + W+ P+ +GG PVT
Sbjct: 16294 QNKYGIGEPLDSEPETARNLFSVPGAPDKPT----VSSVTRNSMTVNWEEPEYDGGSPVT 16349

Query: 735   QFIVERRAVGKKSWIKIGEVDGKV----TNFSTNKVEEGKAYQFRILAVNSEGVSDP-LE 789
              + +E +    K W ++     K      ++    + EG  YQFR+ A+N+ GV    L 
Sbjct: 16350 GYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLP 16409

Query: 790   TEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWV 849
             ++   A +PI PPG    P+VTD TK +  + W+ P +DGG+ V GYIVE +++G   W 
Sbjct: 16410 SDPATARDPIAPPG-PPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWE 16468

Query: 850   PVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDL 909
                   ++GTK  V GL E   Y+FRV AVN AG G+P   +  +  KD +  P L  D 
Sbjct: 16469 KGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDA 16528

Query: 910   HVSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIE 967
              V D          R  A   G PP      M      + +      IS +   +     
Sbjct: 16529 SVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSSM-VIKNCQR 16587

Query: 968   RQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAA 1027
               +  + + A NEAG  +   +   V  +P P    F       +H +      L   + 
Sbjct: 16588 SHQGVYSLLAKNEAGERKKTII-VDVLDVPGPVGTPF------LAHNLTNESCKLTWFSP 16640

Query: 1028  FS--GSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFG--- 1082
                 GSP  + + +K     +    +T +       +    +  +  +RI  +N  G   
Sbjct: 16641 EDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGP 16700

Query: 1083  --EARYDIHVRVA-DFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDA 1137
               E    + +R     P  P +L + E   NTVTLTWN  P   + G    +Y++  R  
Sbjct: 16701 FVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWN--PPKYDGGSEIINYVLESRLI 16758

Query: 1138  STATWYTAA-ERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQD 1196
              T  ++    + + S KYTV GL  G  Y +RV A N +G  +P                
Sbjct: 16759 GTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKP---------------- 16802

Query: 1197  LSAKLKPYEKKDWRHAPRFVTPLKPHTVLR-GQDCTMTCAFLGNPRPTVTLYKGDVNITA 1255
              S   KP   KD    P      +    +R G+   +T  + G P+P V+ +K + ++  
Sbjct: 16803 -SFCTKPITCKDELAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLE 16861

Query: 1256  NSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDK 1305
             + +    +T     L        DSG Y V+VEN  G  +  C + V D+
Sbjct: 16862 DDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDR 16911



 Score =  188 bits (477), Expect = 3e-47
 Identities = 110/321 (34%), Positives = 176/321 (54%), Gaps = 12/321 (3%)

Query: 590   TESEASVFIADP---PTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGM 646
             +E   +V   DP   PTID      L  H I V  G    I VPFR  P+P V+W+KDG 
Sbjct: 14372 SEISENVVAKDPDCKPTID------LETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGK 14425

Query: 647   EVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQG 706
             EV   +R++M+     A L +   VR D+G+  + L+N  GSATA++++ V+  P P + 
Sbjct: 14426 EVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKD 14485

Query: 707   RVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKV 766
              ++  +++ S   + W+ P+ +GG P+  +++ERR  G++++I +   + K++    + +
Sbjct: 14486 -IKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLI 14544

Query: 767   EEGKAYQFRILAVNSEGVSDPLETEE-VFAGNPIEPPGFASQPQVTDVTKEAVTITWNAP 825
               G+ Y FR+ AVN  G  + +E +  V A +P +PP      +V + T EA+TITW  P
Sbjct: 14545 PNGE-YFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPP 14603

Query: 826   TQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPG 885
               DGG+ ++GYI+E+  KG   W   N+  +     T  GL E  EY+FRV A N AG  
Sbjct: 14604 LYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGIS 14663

Query: 886   QPSVPSSSVVAKDPVKPPGLV 906
             +PS  +    A DP+  P ++
Sbjct: 14664 EPSRATPPTKAVDPIDAPKVI 14684



 Score =  187 bits (475), Expect = 6e-47
 Identities = 164/601 (27%), Positives = 274/601 (45%), Gaps = 52/601 (8%)

Query: 601   PPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGE 660
             PP I+   L+A     +T++   T  + VP +G+P P+V W +D  E    ++ S+E   
Sbjct: 21857 PPEIE---LDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGE--SLDKASIESTS 21911

Query: 661   DQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHM 720
                LL + N  R DSG  +L ++N  GS +A +++ VLD P PPQ  ++  E++ + V +
Sbjct: 21912 SYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQD-LKVKEVTKTSVTL 21970

Query: 721   KWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVN 780
              W  P  +GG  +  +IVE+R   +K++  +     K T++  ++++EG +Y FR+LA N
Sbjct: 21971 TWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHK-TSWKVDQLQEGCSYYFRVLAEN 22029

Query: 781   SEGVSDPLET-EEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVE 839
               G+  P ET E V A     PPG   +  + DVT+ +V+++W  P  DGG+ +LGYIVE
Sbjct: 22030 EYGIGLPAETAESVKASERPLPPG---KITLMDVTRNSVSLSWEKPEHDGGSRILGYIVE 22086

Query: 840   RRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDP 899
              + KGS+ W       ++ T+ T+ GL++  EY FRV A N+ G   P   S  V+AKD 
Sbjct: 22087 MQTKGSDKWATC--ATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDL 22144

Query: 900   VKPPGLV-----------QDLHVSDS--SNSSISLAWREPAEGDPPSGYILEMRAEDTKE 946
             V PP              +DL V        + ++ W    + + P      + AE T+ 
Sbjct: 22145 VIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWH---KDNVPLKQTTRVNAESTEN 22201

Query: 947   WSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVE-LDKGVRAMPPPAAPKFD 1005
              S  T   I   C    G        + ++  N A  GE +E L+  V   P P      
Sbjct: 22202 NSLLT---IKDACREDVG-------HYVVKLTNSA--GEAIETLNVIVLDKPGPPTGPVK 22249

Query: 1006  LSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINST 1065
             +       + +  G          GS   + I +K    T   + ++ +   +       
Sbjct: 22250 MDEVTADSITLSWGPP----KYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRL 22305

Query: 1066  KRSDSGVYRILLQNEFGEARY-DIHVRVADF----PRPPTNLRLFEEVPNTVTLTWNHSP 1120
             K      +RI  +N +G++ Y +    VA +    P PP    +     +++ + WN   
Sbjct: 22306 KTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPI 22365

Query: 1121  DVQEDGEAHYIIMKRDASTATWYTAAER-VFSNKYTVTGLLPGRKYYFRVVARNEIGDSE 1179
                      Y + +++ ++  W    +  +   K+  TGL  G +Y FRV A N +G  +
Sbjct: 22366 SDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGK 22425

Query: 1180  P 1180
             P
Sbjct: 22426 P 22426



 Score =  187 bits (474), Expect = 8e-47
 Identities = 184/687 (26%), Positives = 294/687 (42%), Gaps = 94/687 (13%)

Query: 560   QIVKQGAVHKLIFPSMGPEHEGKYTFRAKGT------------ESEASVFIADPPTIDPS 607
             +I K   + +  F   G     +Y FR K              ES  +  I  PP ++  
Sbjct: 17852 RINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVE-- 17909

Query: 608   VLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTI 667
              L+      ITV+VG T  I    +G+P P +TW K+G  +  E+RV + +   +  L I
Sbjct: 17910 -LDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQI 17968

Query: 668   SNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKD 727
                VR D G  ++  KN  G A  +  ++VLDRP P Q          +C  + W+ P D
Sbjct: 17969 KEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCT-ISWENPLD 18027

Query: 728   NGGRPVTQFIVERRAVGKKSW-IKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSD 786
             NGG  +T FIVE R   +K W I   +V  ++   +     E   Y FR+ A N  GV  
Sbjct: 18028 NGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIKANLLANNE---YYFRVCAENKVGVGP 18084

Query: 787   PLETEE-VFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGS 845
              +ET+  + A NPI+ PG      + D  K  V + W  P  DGG+P L Y VERR KGS
Sbjct: 18085 TIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGS 18144

Query: 846   NLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGL 905
             + W  V+K  I+ T   VD  +E+  YEFRV   N+ G     V +  VV K+ ++ P  
Sbjct: 18145 DDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESD-WVKTEEVVVKEDLQKP-- 18201

Query: 906   VQDLHVSD----SSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYT 961
             V DL +S      +  +I L   E      P   +   + +D  + ++  ++ I     +
Sbjct: 18202 VLDLKLSGVLTVKAGDTIRL---EAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADS 18258

Query: 962   VGGLIERQKYF----FRIRAVNEAG----------VGEP----------VELDKGVRAMP 997
                 + + K      + + A N AG          + +P          V  D+      
Sbjct: 18259 SKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDRCTVCWD 18318

Query: 998   PPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNH 1057
             P   P+ D    ++++++ +  T   + + +S +           V T G  T+T+    
Sbjct: 18319 P---PEDDGGCEIQNYILEKCETKRMVWSTYSAT-----------VLTPG-TTVTRLIEG 18363

Query: 1058  SQFLINSTKRSDSGVYRILLQNEFG-----EARYDIHVRVADFPRPPTNLRLFEEVPNTV 1112
             +++           ++R+  +N+ G     E++  I     D P  P    + +     +
Sbjct: 18364 NEY-----------IFRVRAENKIGTGPPTESKPVIAKTKYDKPGRPDPPEVTKVSKEEM 18412

Query: 1113  TLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTAAERVF-SNKYTVTGLLPGRKYYFRV 1169
             T+ WN  P   + G++   Y + K++  +  W    +      +  V  LLP  +Y FRV
Sbjct: 18413 TVVWN--PPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRV 18470

Query: 1170  VARNEIGDSEP-LDSRDTWLINKDQIQ 1195
              A NEIG  EP L SR   ++ KD I+
Sbjct: 18471 KAENEIGIGEPSLPSRP--VVAKDPIE 18495



 Score =  185 bits (470), Expect = 2e-46
 Identities = 136/460 (29%), Positives = 206/460 (44%), Gaps = 20/460 (4%)

Query: 730   GRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLE 789
             GRP  +    R        ++I E     T  S +  +   A ++ +   NS G      
Sbjct: 24050 GRPTPEITWSREEGEFTDKVQI-EKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFV 24108

Query: 790   TEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWV 849
             T +V     ++ PG      V +V K++  + W  P  DGGA V  Y++++R+     + 
Sbjct: 24109 TVKV-----LDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYA 24163

Query: 850   PVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDL 909
              V+      T   V+ L E   Y FRV+A N+ G G P     +V A +P  PPG V   
Sbjct: 24164 NVSSK-CSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVT-- 24220

Query: 910   HVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIE 967
              ++D S +S SL W +P    G    GY++EM+ + T++WS   +  +     T  GL  
Sbjct: 24221 -LTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVT--GLSS 24277

Query: 968   RQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAA 1027
              Q+Y FR++A NE G  +P  L   V A      P   L     S   ++AG  L I   
Sbjct: 24278 GQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYS---IQAGEDLKIEIP 24334

Query: 1028  FSGSPPPDVIWQKDGVPTKG--RETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEAR 1085
               G P P++ W KDG P K   R  + ++   +   I    + D G Y +   N  G A 
Sbjct: 24335 VIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTAT 24394

Query: 1086  YDIHVRVADFPRPPTNLRLFEEVP-NTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYT 1144
              ++ V V + P PP     F+EV  + V ++W           ++YI+ KRD +T TW+ 
Sbjct: 24395 ENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHM 24454

Query: 1145  AAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSR 1184
              +  V      +T L  G +Y FR+ A N  G S PLDS+
Sbjct: 24455 VSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSK 24494



 Score =  184 bits (467), Expect = 5e-46
 Identities = 129/458 (28%), Positives = 206/458 (44%), Gaps = 17/458 (3%)

Query: 732   PVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETE 791
             P   + +  R + +++ I+   +   +   +  +  +G    + +LA N  G     E +
Sbjct: 16554 PTVTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGV---YSLLAKNEAG-----ERK 16605

Query: 792   EVFAGNPIEPPGFASQPQVT-DVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVP 850
             +    + ++ PG    P +  ++T E+  +TW +P  DGG+P+  Y++E+R+     W P
Sbjct: 16606 KTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTP 16665

Query: 851   VNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLH 910
             V    +     TV GL++   Y FR+ A N  G G     S ++V ++P+  P   +DL 
Sbjct: 16666 VTYT-VTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPERPEDLE 16724

Query: 911   VSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIER 968
             V + + ++++L W  P    G     Y+LE R   T+++ K T   +    YTV GL E 
Sbjct: 16725 VKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEG 16784

Query: 969   QKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAF 1028
               Y +R+ AVN  G G+P    K +      A P   L  R K  + +R G A  +   +
Sbjct: 16785 DTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDK--LTIRVGEAFALTGRY 16842

Query: 1029  SGSPPPDVIWQKD--GVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARY 1086
             SG P P V W KD   V    R  I  +           KRSDSG Y ++++N  G  + 
Sbjct: 16843 SGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKG 16902

Query: 1087  DIHVRVADFPRPPTNLRLFEEVPNT-VTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTA 1145
                V V D P PP     F+EV    + ++W    D       +YII K++     W   
Sbjct: 16903 FCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPV 16962

Query: 1146  AERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
                       V+ LL G+ Y FR+ A N  G S+PL S
Sbjct: 16963 TSASAKTTCKVSKLLEGKDYIFRIHAENLYGISDPLVS 17000



 Score =  183 bits (465), Expect = 8e-46
 Identities = 173/660 (26%), Positives = 266/660 (40%), Gaps = 74/660 (11%)

Query: 582   KYTFRAKGT----ESEASVFIADPPTID----PSVLEALAAH-AITVKVGHTAHIKVPFR 632
             KY FR K      ESE S    + P  D    P V   + A   +  K G    I    +
Sbjct: 15776 KYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIK 15835

Query: 633   GKPLPKVTW---------YKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLK 683
             G+P PK +W          KDG+    E+   +E  E+ +++ I  C R  +G   +  K
Sbjct: 15836 GRPTPKSSWEFDGKAKKAMKDGVHDIPED-AQLETAENSSVIIIPECKRSHTGKYSITAK 15894

Query: 684   NDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAV 743
             N  G  TA   + V+D P PP+         GSC  + WK P D+GG  +  +++E+R +
Sbjct: 15895 NKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSC-RLSWKMPDDDGGDRIKGYVIEKRTI 15953

Query: 744   GKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLET-EEVFAGNPIEPP 802
               K+W K+    G  T    + + E + Y FR+ A N  G+  P+ET +   A +PI PP
Sbjct: 15954 DGKAWTKVNPDCGSTTFVVPDLLSE-QQYFFRVRAENRFGIGPPVETIQRTTARDPIYPP 16012

Query: 803   GFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVE-------RRKKGSNLWVPVNKDP 855
                 + ++  +TK  V ++W  P  DGG+PV  YIVE         KK +  W   NK  
Sbjct: 16013 DPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEA--WRQCNKRD 16070

Query: 856   IQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPG--LVQDLHVSD 913
             ++  + TV+ L+E  EYEFRV AVN AG  +PS        + P  PP   L + + V +
Sbjct: 16071 VEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQRPDMPPSIDLKEFMEVEE 16130

Query: 914   SSNSSI----------SLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVG 963
              +N +I          +L W +     P +        E     +   K+ +  TC  V 
Sbjct: 16131 GTNVNIVAKIKGVPFPTLTWFKAPPKKPDN-------KEPVLYDTHVNKLVVDDTCTLVI 16183

Query: 964   GLIERQKY-FFRIRAVNEAGVGEPVELDKGVRAMP-PPAAPKFDLSARLKSHMVVRAGTA 1021
                 R     + I AVN  G     E+   V   P PP  P      + +S    +   +
Sbjct: 16184 PQSRRSDTGLYTITAVNNLGTASK-EMRLNVLGRPGPPVGP-----IKFESVSADQMTLS 16237

Query: 1022  LCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEF 1081
                     GS   + + +K     K    ++       + I         V+RI+ QN++
Sbjct: 16238 WFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKY 16297

Query: 1082  G-----EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRD 1136
             G     ++  +    +   P  P    +     N++T+ W             Y +  +D
Sbjct: 16298 GIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKD 16357

Query: 1137  ASTATWYTA-----AERVFSNKYTVTGLLPGRKYYFRVVARNEIG------DSEPLDSRD 1185
              ++  W                Y VTGL+ G  Y FRV A N  G       S+P  +RD
Sbjct: 16358 TTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARD 16417



 Score =  182 bits (463), Expect = 1e-45
 Identities = 168/649 (25%), Positives = 276/649 (42%), Gaps = 83/649 (12%)

Query: 582   KYTFRAKGTESEASVFIADPPTIDPSV------------LEALAAHAITVKVGHTAHIKV 629
             +Y FR     SE    + +P T+  SV            L+A     + ++   T  + V
Sbjct: 25073 EYNFRICAINSEG---VGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFV 25129

Query: 630   PFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSA 689
               +G+P P+V W K    +T+  R  +E      +L I N  R DSG   L L+N+ GS 
Sbjct: 25130 TIKGRPEPEVKWEKAEGILTD--RAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSK 25187

Query: 690   TATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWI 749
             TA +++ VLD P  P   +   E+    V + W+ P  +GG  +T +IVE+R   +K++ 
Sbjct: 25188 TAFVNVRVLDSPSAPVN-LTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYA 25246

Query: 750   KIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEE-VFAGNPIEPPGFASQP 808
              I     K T F    ++EG +Y FR+LA N  G+  P ET E V    P  PPG  +  
Sbjct: 25247 TITNNCTKTT-FRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVT-- 25303

Query: 809   QVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLE 868
              + DVT+   TI W  P  DGG+ + GY+VE + KGS  W    +  ++  + T+ GL  
Sbjct: 25304 -LVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQ--VKTLEATISGLTA 25360

Query: 869   DTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE 928
               EY FRV AVN+ G   P      V+A+D    P +    H       + ++  RE  +
Sbjct: 25361 GEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFH-------TFNVKAREQLK 25413

Query: 929   GDPPSGYILEMRAEDTKEWSK-------CTKIPISG----TCYTVGGLIERQKYFFRIRA 977
              D P     + R + T  W K        T++ +S     T  ++    +     + +  
Sbjct: 25414 IDVP----FKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCV 25469

Query: 978   VNEAG-VGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPP--- 1033
              N AG +  P+ +   V   P P  P             +R     C     S +PP   
Sbjct: 25470 SNSAGSITVPITII--VLDRPGPPGP-------------IRIDEVSCDSITISWNPPEYD 25514

Query: 1034  -----PDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARY-D 1087
                   + I +K    +     ++++   +   I          +R+  +N +G++ Y +
Sbjct: 25515 GGCQISNYIVEKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSE 25574

Query: 1088  IHVRVADF----PRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWY 1143
                 VA++    P PP   ++     +T+ +TW    +        Y +  ++ S+  W 
Sbjct: 25575 SSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWS 25634

Query: 1144  TAAERVFSN-KYTVTGLLPGRKYYFRVVARNEIG------DSEPLDSRD 1185
              A + + ++ +  V+GL  G  Y +RV A N  G        EP+ +RD
Sbjct: 25635 KANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARD 25683



 Score =  180 bits (457), Expect = 7e-45
 Identities = 254/1094 (23%), Positives = 428/1094 (39%), Gaps = 120/1094 (10%)

Query: 269  IKGTEPLRIQY--------SLGKYDVKQMGTKYMLVISNVNMNDAGIY----SLSVGDKR 316
            + GT P+ I++        S     V +  T   L +      D+G Y    S  VG   
Sbjct: 4791 VGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTAT 4850

Query: 317  MSAELTVLDEPLKFLGEMKPVKVTER-QTAVFEIRLSKKEPNFV-WKFNGKELKRDDKYE 374
              A L V  EP +F+ +  PV V    Q+  FE +++      V W  +G E+    K+ 
Sbjct: 4851 SKATLFV-KEPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHG 4909

Query: 375  ITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTID---RIPIKFVSNLKNVRVK 431
            I+   DGL  T +I  AR+ +SG +  EA N    A  +I+   + P  F+  LK V V 
Sbjct: 4910 ISFI-DGLA-TFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVV 4967

Query: 432  ERSRACLECELT-SKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTV 490
            + S   LECE+T +    + W K+ + +    KY++        L I     SD GEY  
Sbjct: 4968 KYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQC 5027

Query: 491  VAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDEKVEGVWLKDG 550
            +   +G       +  V ++E  + +K   +       S      V     +   WLKD 
Sbjct: 5028 IVSNEGGSCS--CSTRVALKEPPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDD 5085

Query: 551  KEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAK---GTESEASVFIADPPTIDPS 607
            + + +   + I    +V  L   S+   H G+YT +AK   G E   +  +   P     
Sbjct: 5086 QILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPA---Q 5142

Query: 608  VLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTI 667
            ++E   +  +T K   T    V   G P  KV W KDG ++      SM    + A   I
Sbjct: 5143 IVEKAKSVDVTEKDPMTLECVVA--GTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRI 5200

Query: 668  SNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELS---GSCVHMKWKA 724
             + +++DSG    K++ND GS++   +L VLD+  PP    +  ++    GS +HM+ K 
Sbjct: 5201 QSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKV 5260

Query: 725  PKDNGGRPVT-QFIVERRAVGKKSWIKIGEVDGKVTNFSTN-KVEEGKAYQFRILAVNSE 782
               +G  P++ Q+  + + +   +  ++   +  V+    N ++E+   Y  ++  V  +
Sbjct: 5261 ---SGSLPISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGD 5317

Query: 783  GVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRK 842
                 + T +       EPP F  +P       ++ T+ + A            I++   
Sbjct: 5318 DACSGILTVK-------EPPSFLVKPGRQQAIPDS-TVEFKA------------ILKGTP 5357

Query: 843  KGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDP--- 899
                 W   + + + G KC +   LE +     + +V+ +  GQ +   ++ V  D    
Sbjct: 5358 PFKIKWFKDDVELVSGPKCFIG--LEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTT 5415

Query: 900  ----VKPPGLVQDLHVSDSSNSSISLAWREPAEGDPPSGYIL-----EMRAEDTKEWSKC 950
                 +PP  V+ L  S    +  S        G P    +      E+ A D    +  
Sbjct: 5416 MLLVTEPPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFI 5475

Query: 951  TKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKF-DLSAR 1009
              + +      +  L       F   A N AG          V    PP    F  +   
Sbjct: 5476 DSVAV----IQMNNLSTEDSGDFICEAQNPAG---STSCSTKVIVKEPPVFSSFPPIVET 5528

Query: 1010 LKSHMVVRAGTALCIHAAFSGSPPPDVIWQKD--GVPTKGRETITKSKNHSQFLINSTKR 1067
            LK+         + +    SG+PP +V+W KD   + +  +  I     H+   I +   
Sbjct: 5529 LKN-------AEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDT 5581

Query: 1068 SDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGE 1127
            SD G Y    QNE G       V++ + PR       F    N++T+      ++Q   E
Sbjct: 5582 SDIGEYHCKAQNEVGSDTCVCTVKLKEPPR-------FVSKLNSLTVVAGEPAELQASIE 5634

Query: 1128 AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRD-- 1185
                I         W    E V      +      R  +   VA  +   +EP ++    
Sbjct: 5635 GAQPIF------VQWLKEKEEVIRESENI------RITFVENVATLQFAKAEPANAGKYI 5682

Query: 1186 TWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVT 1245
              + N   +++  A L   E          V    P TV  G+ CT+ C   G P  +V 
Sbjct: 5683 CQIKNDGGMRENMATLMVLE------PAVIVEKAGPMTVTVGETCTLECKVAGTPELSVE 5736

Query: 1246 LYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDK 1305
             YK    +T++ K  ++  + + +L I +   +D+G Y+  V+N +GK  SSCT  V D 
Sbjct: 5737 WYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGK--SSCT-AVVDV 5793

Query: 1306 DDKSVVASITESLQ 1319
             D++V  S T  L+
Sbjct: 5794 SDRAVPPSFTRRLK 5807



 Score =  176 bits (447), Expect = 1e-43
 Identities = 152/630 (24%), Positives = 264/630 (41%), Gaps = 70/630 (11%)

Query: 701   PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTN 760
             P PP+ + E   ++ +   + WK P D+GG  +T + VERR      W++  +       
Sbjct: 20572 PGPPE-KPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDLR 20630

Query: 761   FSTNKVEEGKAYQFRILAVNSEGVSDPLE-TEEVFAGNPIEPPGFASQPQVTDVTKEAVT 819
                  ++EG  Y+FR+ A N  G+  P E ++ V   +   PPG  S P VTD TK++ +
Sbjct: 20631 CKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSAS 20690

Query: 820   ITWNAPTQDGGAPVLGYIVERRKKGSNLWVP-VNKDPIQGTKCTVDGLLEDTEYEFRVIA 878
             + W  P  DGG  + GY+VE +K G   W+       ++ T+  V  L    +Y FR+ A
Sbjct: 20691 LAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQFVVPDLQTKEKYNFRISA 20750

Query: 879   VNKAGPGQPSV-PSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPP----- 932
             +N AG G+P+V P   +V ++      L  +L  +    + +S+    P +G P      
Sbjct: 20751 INDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTW 20810

Query: 933   --SGYILEMRA--EDTKEWS-----KCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGV 983
                   L+ RA  E+T+ ++     +C +        T+     ++  F  +R ++  G 
Sbjct: 20811 TKDNINLKNRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGP 20870

Query: 984   G---EPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQK 1040
                  P ++ K    +     P  D  +R+ +++V                       +K
Sbjct: 20871 VLNLRPTDITKDSVTLHWDL-PLIDGGSRITNYIV-----------------------EK 20906

Query: 1041  DGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFG---EARYDIHVRVADFPR 1097
                  K   T T   +   + +          +R++ +NE+G          V+ ++ P 
Sbjct: 20907 REATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASEAPS 20966

Query: 1098  PPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH---YIIMKRDASTATWYTAAERVFSNKY 1154
             PP +L + +   +TV+L W   P  + DG +    Y+I  +   +  W T    V   + 
Sbjct: 20967 PPDSLNIMDITKSTVSLAW---PKPKHDGGSKITGYVIEAQRKGSDQW-THITTVKGLEC 21022

Query: 1155  TVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPR 1214
              V  L  G +Y F+V+A N  G S P +SR   +  +  + +L  +   Y+K     A  
Sbjct: 21023 VVRNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLR-GIYQKLVIAKA-- 21079

Query: 1215  FVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPT 1274
                         G +  +    LG P+PTVT  KGD  +    +  + +T+    L I  
Sbjct: 21080 ------------GDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINE 21127

Query: 1275  CTLKDSGDYSVLVENELGKDRSSCTLTVYD 1304
             C   DSG Y +   N +G+     T+ V+D
Sbjct: 21128 CVRSDSGPYPLTARNIVGEVGDVITIQVHD 21157



 Score =  174 bits (442), Expect = 4e-43
 Identities = 163/600 (27%), Positives = 259/600 (43%), Gaps = 61/600 (10%)

Query: 609   LEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTIS 668
             L+A     + ++ G T  + VP +G+P PK+TW K  + + +   + ++  +    L   
Sbjct: 19695 LDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCE 19754

Query: 669   NCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDN 728
             N  + D+G  +L L+N  G    T+ + VLD P PP   V   E+S    ++ W+ P  +
Sbjct: 19755 NVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVN-VTVKEISKDSAYVTWEPPIID 19813

Query: 729   GGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPL 788
             GG P+  ++V++R   +KSW  +     K T+F    +EEGK+Y FR+ A N  G+ DP 
Sbjct: 19814 GGSPIINYVVQKRDAERKSWSTVTTECSK-TSFRVANLEEGKSYFFRVFAENEYGIGDPG 19872

Query: 789   ETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLW 848
             ET +    +  + PG     +V  V+K + +I W  P  DGG+ ++GY+V+   +  N W
Sbjct: 19873 ETRDAVKAS--QTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTE-ENKW 19929

Query: 849   VPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGL--- 905
               V K      + +   L E  EY FRV A N+ G G PS    +VVA+D V  P L   
Sbjct: 19930 QRVMKS--LSLQYSAKDLTEGKEYTFRVSAENENGEGTPS--EITVVARDDVVAPDLDLK 19985

Query: 906   -VQDLHVSDSSNSSISLAWREPAEGDP-PSGYILEMRAEDTKEWSKCTKIPIS--GTCYT 961
              + DL      NS+  L  + P +G P PS  +   + ED         +  S   T   
Sbjct: 19986 GLPDLCYLAKENSNFRL--KIPIKGKPAPS--VSWKKGEDPLATDTRVSVESSAVNTTLI 20041

Query: 962   VGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAP-KFDLSARLKSHMVVRAGT 1020
             V    +     + I   N AG  E     K V     P  P KFD        +   A T
Sbjct: 20042 VYDCQKSDAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFD-------EVTAEAMT 20094

Query: 1021  ALCIHAAFSGSPPPD---------VIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSG 1071
                       +PP D         ++ ++D V  K   T   +   + F +         
Sbjct: 20095 -------LKWAPPKDDGGSEITNYILEKRDSVNNKW-VTCASAVQKTTFRVTRLHEGMEY 20146

Query: 1072  VYRILLQNEFG----------EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPD 1121
              +R+  +N++G           AR+     V D P PP    + +   ++V+LTW     
Sbjct: 20147 TFRVSAENKYGVGEGLKSEPIVARHPFD--VPDAPPPP---NIVDVRHDSVSLTWTDPKK 20201

Query: 1122  VQEDGEAHYIIMKRDASTATWYTAAER-VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEP 1180
                     Y +  ++ ++  W  A +  +    + VTGL  G +Y FRV+A N  G  +P
Sbjct: 20202 TGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKP 20261



 Score =  174 bits (440), Expect = 7e-43
 Identities = 143/479 (29%), Positives = 208/479 (43%), Gaps = 77/479 (16%)

Query: 743   VGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPP 802
             V KKS + I  VD K ++  T  +E          AVN  G         V   N ++ P
Sbjct: 13742 VPKKSTVTI--VDSKRSDTGTYIIE----------AVNVCG-----RATAVVEVNVLDKP 13784

Query: 803   GFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCT 862
             G  +   +TDVT E+  +TWN P  DGG+ +  Y+VERR   S +W  ++   ++ T   
Sbjct: 13785 GPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSST-VKDTNFK 13843

Query: 863   VDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLA 922
                L+ + EY FRV A N  G G+P V +S + AK    PPG    L  SD +  +++L 
Sbjct: 13844 ATKLIPNKEYIFRVAAENMYGVGEP-VQASPITAKYQFDPPGPPTRLEPSDITKDAVTLT 13902

Query: 923   WREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNE 980
             W EP +  G P +GY +E    DT +W +C K+P+  T Y V GL  ++KY FR+ A N 
Sbjct: 13903 WCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENL 13962

Query: 981   AGVG------EPVELDKGVRAMPPPAAP-----------------KFDLSARLKSHMV-- 1015
             AG G      EP+ +   +    PP  P                 + D  A+++S+++  
Sbjct: 13963 AGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEM 14022

Query: 1016  VRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRI 1075
             ++ GT   +  A             +GVPT            +Q L+          +R+
Sbjct: 14023 LKTGTDEWVRVA-------------EGVPT------------TQHLLPGLMEGQEYSFRV 14057

Query: 1076  LLQNEFGEARYD-----IHVRVADFP-RPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH 1129
                N+ GE+        +  R   +P  PP  L +     NT  L W            +
Sbjct: 14058 RAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITN 14117

Query: 1130  YIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWL 1188
             YI+ KRD     W T    V   K TVT L  G  Y FRV A N IG S+  +  D+ L
Sbjct: 14118 YIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVL 14176



 Score =  174 bits (440), Expect = 7e-43
 Identities = 141/466 (30%), Positives = 208/466 (44%), Gaps = 32/466 (6%)

Query: 730   GRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFST-------NKVEEGKAYQFRILAVNSE 782
             GRP  +    +  V  +   +IG +D K T+F T       NK + GK   + +   NS 
Sbjct: 19719 GRPPPKITWSKPNVNLRD--RIG-LDIKSTDFDTFLRCENVNKYDAGK---YILTLENSC 19772

Query: 783   GVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRK 842
             G     + E       ++ PG      V +++K++  +TW  P  DGG+P++ Y+V++R 
Sbjct: 19773 G-----KKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRD 19827

Query: 843   KGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKP 902
                  W  V  +    T   V  L E   Y FRV A N+ G G P     +V A    + 
Sbjct: 19828 AERKSWSTVTTE-CSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGETRDAVKAS---QT 19883

Query: 903   PGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCY 960
             PG V DL V   S SS S+ W++P    G    GY+++   E+ K W +  K       Y
Sbjct: 19884 PGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTEENK-WQRVMKS--LSLQY 19940

Query: 961   TVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGT 1020
             +   L E ++Y FR+ A NE G G P E+   V A     AP  DL        + +  +
Sbjct: 19941 SAKDLTEGKEYTFRVSAENENGEGTPSEIT--VVARDDVVAPDLDLKGLPDLCYLAKENS 19998

Query: 1021  ALCIHAAFSGSPPPDVIWQK--DGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQ 1078
                +     G P P V W+K  D + T  R ++  S  ++  ++   ++SD+G Y I L+
Sbjct: 19999 NFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLK 20058

Query: 1079  NEFGEARYDIHVRVADFPRPPTNLRLFEEV-PNTVTLTWNHSPDVQEDGEAHYIIMKRDA 1137
             N  G     I ++V   P  PT    F+EV    +TL W    D       +YI+ KRD+
Sbjct: 20059 NVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDS 20118

Query: 1138  STATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
                 W T A  V    + VT L  G +Y FRV A N+ G  E L S
Sbjct: 20119 VNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKS 20164



 Score =  172 bits (437), Expect = 1e-42
 Identities = 175/656 (26%), Positives = 265/656 (40%), Gaps = 95/656 (14%)

Query: 701   PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIG-----EVD 755
             P PP G+ + L  +   + + W  P DNGG P+T + +E+R  G   W ++      +V 
Sbjct: 15599 PGPP-GKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVG 15657

Query: 756   GKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLE-TEEVFAGNPIEPPGFASQPQVTDVT 814
              K   F+  ++ EG  YQFR +A+N+ G+  P E ++   AG+PI PPG  S P+V D T
Sbjct: 15658 LKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPPGPPSCPEVKDKT 15717

Query: 815   KEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDP--IQGTKCTVDGLLEDTEY 872
             K ++++ W  P +DGG+P+ GYIVE +++G+  W  VN+    I   +C V  L E  +Y
Sbjct: 15718 KSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCECVVPNLKELRKY 15777

Query: 873   EFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA----E 928
              FRV AVN+AG  +PS  +  + A D  + P +  D+   D          R PA     
Sbjct: 15778 RFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGR 15837

Query: 929   GDPPSGYILEMRAE----------------DTKEWSKCTKIPISGTCYTVGGLIERQKYF 972
               P S +  + +A+                +T E S    IP     +T        KY 
Sbjct: 15838 PTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHT-------GKY- 15889

Query: 973   FRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALC--IHAAFSG 1030
               I A N+AG       +  V+ M  P  PK      LK   + R    L   +     G
Sbjct: 15890 -SITAKNKAG---QKTANCRVKVMDVPGPPK-----DLKVSDITRGSCRLSWKMPDDDGG 15940

Query: 1031  SPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFG-------- 1082
                   + +K  +  K    +      + F++          +R+  +N FG        
Sbjct: 15941 DRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETI 16000

Query: 1083  ---EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIM-----K 1134
                 AR  I+      P PP  L++     NTV L+W    +       HYI+       
Sbjct: 16001 QRTTARDPIYP-----PDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDP 16055

Query: 1135  RDASTATWYTAAER-VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQ 1193
                    W    +R V   ++TV  L+ G +Y FRV A N  G S+P             
Sbjct: 16056 TGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKP------------- 16102

Query: 1194  IQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNI 1253
                 SA + P + +     P  +   +   V  G +  +     G P PT+T +K     
Sbjct: 16103 ----SATVGPCDCQR-PDMPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKK 16157

Query: 1254  TANSKFWYNST-------SGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTV 1302
               N +     T          CTLVIP     D+G Y++   N LG       L V
Sbjct: 16158 PDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNV 16213



 Score =  172 bits (437), Expect = 1e-42
 Identities = 178/792 (22%), Positives = 321/792 (40%), Gaps = 74/792 (9%)

Query: 546   WLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFI------A 599
             W+K  +E+++   ++I        L          G Y  +AK    E SV +       
Sbjct: 22577 WIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDR 22636

Query: 600   DPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERG 659
               P   P V+  + A   T+        K P +      + +  +  E +      ++  
Sbjct: 22637 PGPPEGPVVISGVTAEKCTLAW------KPPLQDGGSDIINYIVERRETSRLVWTVVDAN 22690

Query: 660   EDQALLTISNCVREDSGLILLKLKNDHG--------SATATLHLSVLDRPKPPQGRVEFL 711
                    ++  +  +     +   N +G           A     V D PK P    E  
Sbjct: 22691 VQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAP----EVT 22746

Query: 712   ELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIK-----IGEVDGKVTNFSTNKV 766
              ++   + + W+ P  +GG  +  +++E+R      W +     IGE+  +VT    N  
Sbjct: 22747 TVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENH- 22805

Query: 767   EEGKAYQFRILAVNSEGVSDPLETEEVF-AGNPIEPPGFASQPQVTDVTKEAVTITWNAP 825
                  Y+FR+ A N+ G+S+P        A +PI  PG  + P+V D+T+ +V ++W+ P
Sbjct: 22806 ----DYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKP 22861

Query: 826   TQDGGAPVLGYIVERRKKGSNLWVPVNKDP-IQGTKCTVDGLLEDTEYEFRVIAVNKAGP 884
               DGG  + GYIVE+       W        I  T   V+ LLE  EY FR+ A+NKAG 
Sbjct: 22862 IYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGV 22921

Query: 885   GQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN--SSISLAWREPAEGDPPSGYILEMRAE 942
             G+ +     ++ ++ ++ P +  DL +    N  +  SL    P +G P +  +   + +
Sbjct: 22922 GEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRP-TPEVKWGKVD 22980

Query: 943   DTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAP 1002
                  +    +  S T   +  +       + +   N +G          VR +  P+ P
Sbjct: 22981 GEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVT---VRVLDTPSPP 23037

Query: 1003  KFDLSARLKSHMVVRAGTALCIHAAF--SGSPPPDVIWQKDGVPTKGRETITKSKNHSQF 1060
                    LK   + +   ++         GS   + I +K     K    +  + + + +
Sbjct: 23038 -----VNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSW 23092

Query: 1061  LINSTKRSDSGVYRILLQNEFG---EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWN 1117
              I+  +   S  +R+  +NE+G    A+    ++VA+ P+PP  + + +   N+V+L+W 
Sbjct: 23093 KIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKITVDDVTRNSVSLSWT 23152

Query: 1118  HSPDVQEDGEAHYI--IMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEI 1175
                  + DG +  I  I++  A  +  ++   RV S +  +T L  G +Y FRVVA NE 
Sbjct: 23153 KP---EHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVITNLTQGEEYLFRVVAVNEK 23209

Query: 1176  GDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCA 1235
             G S+P  S    ++ KD + +   K            P F +    ++V  GQD  +   
Sbjct: 23210 GRSDPR-SLAVPIVAKDLVIEPDVK------------PAFSS----YSVQVGQDLKIEVP 23252

Query: 1236  FLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDR 1295
               G P+PT+T  K  + +   ++     +  + TL I      D G Y + V N +G+  
Sbjct: 23253 ISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKT 23312

Query: 1296  SSCTLTVYDKDD 1307
             +S  +   DK D
Sbjct: 23313 ASIEIVTLDKPD 23324



 Score =  171 bits (432), Expect = 6e-42
 Identities = 170/661 (25%), Positives = 275/661 (41%), Gaps = 101/661 (15%)

Query: 701   PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTN 760
             P PP   +  ++++   V +KW+ PK++GGRP+ ++++E++      W+K G+  G   N
Sbjct: 14184 PGPPYA-LAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCN 14242

Query: 761   FSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFA-GNPIEPPGFASQPQVTDVTKEAVT 819
             F    V EG   QF++ A N  GV  P E  E+ +  +P  PP       VTD  ++ + 
Sbjct: 14243 FRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIA 14302

Query: 820   ITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVD-GLLEDTEYEFRVIA 878
             I W  P ++GG+P++GY VE    G+  W+ VN  PI+  K  V+ G++ D EY  RV A
Sbjct: 14303 IAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRA 14362

Query: 879   VNKAGPGQPSVPSSSVVAKDPVKPPGL---VQDLHVSDSSNSSISLAWREPAEGDPPSGY 935
             VN  G  +PS  S +VVAKDP   P +     D+ V +    SI + +R  A   P   +
Sbjct: 14363 VNAIGVSEPSEISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFR--AVPVPTVSW 14420

Query: 936   ILEMRAEDTKEWSKCTKIPISGTCYT----VGGLIERQKYFFRIRAVNEAGVGEPVELDK 991
                   +D KE     ++ +     +    V   +      + I   N+ G      ++ 
Sbjct: 14421 -----HKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLG-SATASINV 14474

Query: 992   GVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAA-FSGSPP--PDVIWQKDGVPTKGR 1048
              V  +P P          +K+  + ++   L      F G  P    V+ +++     GR
Sbjct: 14475 KVIGLPGPCKD-------IKASDITKSSCKLTWEPPEFDGGTPILHYVLERREA----GR 14523

Query: 1049  ET---ITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVR---VADFPR----P 1098
              T   +   +N   + +     +    +R+   N+ G   Y I ++   +A  P+    P
Sbjct: 14524 RTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEY-IELKNPVIAQDPKQPPDP 14582

Query: 1099  PTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTAAERVFSN-KYT 1155
             P ++ +       +T+TW   P + + G     YII K       W    E +     YT
Sbjct: 14583 PVDVEVHNPTAEAMTITWK--PPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYT 14640

Query: 1156  VTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRF 1215
               GL  G++Y FRV A N  G SEP                 S    P +  D   AP+ 
Sbjct: 14641 AKGLEEGKEYQFRVRAENAAGISEP-----------------SRATPPTKAVDPIDAPKV 14683

Query: 1216  V--TPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWY------------ 1261
             +  T L+   V RG +  +  +  G+P PT+T  K D N+    +               
Sbjct: 14684 ILRTSLE---VKRGDEIALDASISGSPYPTITWIK-DENVIVPEEIKKRAAPLVRRRKGE 14739

Query: 1262  ------------------NSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVY 1303
                               NS  G   L +      D G Y + VEN+ G  ++ CT++V 
Sbjct: 14740 VQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVL 14799

Query: 1304  D 1304
             D
Sbjct: 14800 D 14800



 Score =  169 bits (427), Expect = 2e-41
 Identities = 217/939 (23%), Positives = 367/939 (39%), Gaps = 112/939 (11%)

Query: 430   VKERSRACLECELTSK-DVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEY 488
             VK R +  ++     +   T+ W+KDGQ L   T+ +++       L I++A   D G Y
Sbjct: 25406 VKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTY 25465

Query: 489   TVVAMQDGDPTEYYSTAIVTVEERLA---TVKSGMSDVHAATGSPAEL---CVVLNDEKV 542
              +             T IV           +     D    + +P E    C + N    
Sbjct: 25466 ELCVSNSAGSITVPITIIVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQISN---- 25521

Query: 543   EGVWLKDGKEITDLPGMQIVKQGAVH---KLIFPSMGPEHEGKYTFR---AKGTESEASV 596
                ++ + KE T      IV Q       K++  + G E++ +        K + SE+S 
Sbjct: 25522 ---YIVEKKETTSTT-WHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSA 25577

Query: 597   FIADPPTIDPS------VLEA-----LAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDG 645
              +A+ P   P       V+ A     L    + V  G +  I      K    + W K  
Sbjct: 25578 VVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKAN 25637

Query: 646   MEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQ 705
               +  + ++ +  G D+ L+       E+   I        G  + +        P  P 
Sbjct: 25638 KILIADTQMKVS-GLDEGLMYEYRVYAENIAGI--------GKCSKSCEPVPARDPCDPP 25688

Query: 706   GRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNK 765
             G+ E   ++   V +KW  P  +GG  +T +IVERR +    W+K    + + T F   +
Sbjct: 25689 GQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQETYFEVTE 25748

Query: 766   VEEGKAYQFRILAVNS-EGVSDPLE-TEEVFAGNPIEPPGFASQPQVTDV--TKEAVTIT 821
             + E + Y+FR+ A N+ + VS+P E T  +   + +EPP      +  DV   K    + 
Sbjct: 25749 LTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLK 25808

Query: 822   WNAPTQDGGAPVLGYI---VERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIA 878
              NA       PV+ +    +E  ++     +  +   +   K   D +  DT    + + 
Sbjct: 25809 INADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVK---DCIRRDTG---QYVL 25862

Query: 879   VNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYI 936
               K   G  SV  +  V   P  P G    L ++  +    SL+W  P E  G     YI
Sbjct: 25863 TLKNVAGTRSVAVNCKVLDKPGPPAG---PLEINGLTAEKCSLSWGRPQEDGGADIDYYI 25919

Query: 937   LEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAM 996
             +E R      W+ C    +  T   V  L++  +Y FR+  VN+ GVGEP+E    ++A+
Sbjct: 25920 VEKRETSHLAWTICEG-ELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLE-SVAIKAL 25977

Query: 997   PPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETIT---- 1052
              P   P    S  + S  V +    LC        P  D   +  G   + RE  +    
Sbjct: 25978 DPFTVPSPPTSLEITS--VTKESMTLCW-----SRPESDGGSEISGYIIERREKNSLRWV 26030

Query: 1053  --KSKNHSQFLINST--KRSDSGVYRILLQNEFG---EARYDIHVRVAD---FPRPPTNL 1102
                 K      + ST  +      YR+  +N  G    +     +R  D    P PP+  
Sbjct: 26031 RVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKP 26090

Query: 1103  RLFEEVPNTVTLTWNHSPDVQEDGEAH---YIIMKRDASTATWYTAAERVFSNKYTVTGL 1159
             ++ +    T+T+ W        DG A    Y +  + +    W T+ + +   +YT++GL
Sbjct: 26091 KIVDSGKTTITIAWVKP---LFDGGAPITGYTVEYKKSDDTDWKTSIQSLRGTEYTISGL 26147

Query: 1160  LPGRKYYFRVVARNEIGDSEPLDSRDTWLI---NKDQIQDLSAKLKPYEKKDWRHAPRFV 1216
               G +Y FRV + N++G S+P DS D  +     ++ + D+ ++++              
Sbjct: 26148 TTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMR-------------- 26193

Query: 1217  TPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCT 1276
                K   V  G   TMT  F G P P V   K D ++   ++ + ++T    +L I    
Sbjct: 26194 ---KTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDL--RTRAYVDTTDSRTSLTIENAN 26248

Query: 1277  LKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASIT 1315
               DSG Y++ ++N L    +S TL V   D      +IT
Sbjct: 26249 RNDSGKYTLTIQNVL--SAASLTLVVKVLDTPGPPTNIT 26285



 Score =  167 bits (424), Expect = 5e-41
 Identities = 248/1114 (22%), Positives = 419/1114 (37%), Gaps = 162/1114 (14%)

Query: 262   PNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSL----SVGDKRM 317
             P  K+ W K    LR +  L   D+K       L   NVN  DAG Y L    S G K  
Sbjct: 19721 PPPKITWSKPNVNLRDRIGL---DIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEY 19777

Query: 318   SAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEP---------NFVWKFNGKELK 368
             +  + VLD P        PV VT ++ +     ++ + P         N+V +    E K
Sbjct: 19778 TIVVKVLDTP------GPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERK 19831

Query: 369   R---------DDKYEITVSEDGLTHTLKI---KDARLSDSGEFSAEAGNLVQKAQLTIDR 416
                          + +   E+G ++  ++    +  + D GE + +A    Q     +D 
Sbjct: 19832 SWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGE-TRDAVKASQTPGPVVD- 19889

Query: 417   IPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKK---DGQLLMHGTKYSMNHEGKRA 473
                          +K RS +   C       ++ WKK   DG   + G       E  + 
Sbjct: 19890 -------------LKVRSVSKSSC-------SIGWKKPHSDGGSRIIGYVVDFLTEENKW 19929

Query: 474   ELIIEDAQL-------SDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKS----GMSD 522
             + +++   L       ++G EYT     + +  E   + I  V             G+ D
Sbjct: 19930 QRVMKSLSLQYSAKDLTEGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPD 19989

Query: 523   VH--AATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHK-LIFPSMGPEH 579
             +   A   S   L + +  +    V  K G++         V+  AV+  LI        
Sbjct: 19990 LCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSD 20049

Query: 580   EGKYTFRAKGT----ESEASVFIADPPTID--PSVLEALAAHAITVKVGHTAHIKVPFRG 633
              GKYT   K      E   S+ +   P I   P   + + A A+T+K         P + 
Sbjct: 20050 AGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWA-------PPKD 20102

Query: 634   KPLPKVTWY-KDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSA--- 689
                 ++T Y  +  +    + V+      +    ++           +  +N +G     
Sbjct: 20103 DGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGL 20162

Query: 690   -----TATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVG 744
                   A     V D P PP      +++    V + W  PK  GG P+T + +E +   
Sbjct: 20163 KSEPIVARHPFDVPDAPPPPN----IVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERN 20218

Query: 745   KKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDP-LETEEVFAGNPIEPPG 803
                W +  +   ++ +F    + EG  Y+FR++A+N  GV  P L +E V A +PI+PPG
Sbjct: 20219 SLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPG 20278

Query: 804   FASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTV 863
                +P+V ++T+ +VT+ W  P  DGG  + GYIVE+R   S  W+  N   +     TV
Sbjct: 20279 ---KPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTV 20335

Query: 864   DGLLEDTEYEFRVIAVNKAGP-GQPSVPSSSVVAKDPVKPPGLVQDLHVSD-----SSNS 917
               L+E  +YEFR+ A N AG    PS  + +++ KD  + P +V D  + D     + ++
Sbjct: 20336 TDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDT 20395

Query: 918   SISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRA 977
              +  A     +  P S +    +     + ++ T  P S +  T+     +    + I A
Sbjct: 20396 IVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTS-SMLTIKYATRKDAGEYTITA 20454

Query: 978   VNEAGVG-EPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDV 1036
              N  G   E V++   V  +P P  P       + +    +A           GSP    
Sbjct: 20455 TNPFGTKVEHVKVT--VLDVPGPPGP-----VEISNVSAEKATLTWTPPLEDGGSPIKSY 20507

Query: 1037  IWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEAR--YDIHVRVAD 1094
             I +K          +++     + +     + +  ++R+   N +G+        V++ D
Sbjct: 20508 ILEKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQSEPVKMVD 20567

Query: 1095  F---PRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFS 1151
                 P PP    +     NT T++W    D        Y + +R+  +  W  A +   S
Sbjct: 20568 RFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVS 20627

Query: 1152  N-KYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWR 1210
             + +  VTGL  G  Y FRV A N  G   P ++ D+ L+                 KD  
Sbjct: 20628 DLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLM-----------------KDAA 20670

Query: 1211  HAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNIT--------ANSKFWYN 1262
             + P    P  PH      D T   A L   +P    Y G + IT           + W  
Sbjct: 20671 YPPG--PPSNPHVT----DTTKKSASLAWGKPH---YDGGLEITGYVVEHQKVGDEAWIK 20721

Query: 1263  STSG----VCTLVIPTCTLKDSGDYSVLVENELG 1292
              T+G    +   V+P    K+  ++ +   N+ G
Sbjct: 20722 DTTGTALRITQFVVPDLQTKEKYNFRISAINDAG 20755



 Score =  167 bits (423), Expect = 6e-41
 Identities = 166/658 (25%), Positives = 277/658 (42%), Gaps = 63/658 (9%)

Query: 562   VKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKV 621
             +++GA +KL   ++    EG        T +E      +PP ++   L+      I +  
Sbjct: 15066 IREGADYKLRVSAVNAAGEGPPGETQPVTVAEPQ----EPPAVE---LDVSVKGGIQIMA 15118

Query: 622   GHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLK 681
             G T  I     G+P+P   W K+  E+ +++RV ++    ++ L I + +R+D G  ++ 
Sbjct: 15119 GKTLRIPAVVTGRPVPTKVWTKEEGEL-DKDRVVIDNVGTKSELIIKDALRKDHGRYVIT 15177

Query: 682   LKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERR 741
               N  GS  A   + V D P P       +     C+ + W  P+D+GG  +T FI+ER+
Sbjct: 15178 ATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCL-LNWSDPEDDGGSEITGFIIERK 15236

Query: 742   AVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEP 801
                  +W +   ++ + +      + EG+ Y+FR++A N  G   P+E   + A +P+ P
Sbjct: 15237 DAKMHTWRQ--PIETERSKCDITGLLEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLGP 15294

Query: 802   PGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKC 861
             P    +   T+ TK  +T+ W  P  +GG+P+ GYI+E+R+     +  VNK     T  
Sbjct: 15295 PTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSF 15354

Query: 862   TVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISL 921
              V+ L E   YEFRV AVN+ G  +PS+P + V+  D V PP +   L V      +I +
Sbjct: 15355 LVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEV-PPTIKLRLSV---RGDTIKV 15410

Query: 922   AWREPAEGDPPSGYILEMRAEDTKEWSK-------------CTKIPIS----GTCYTVGG 964
                EP    P     L M      EWSK              TK  +S     T  ++  
Sbjct: 15411 KAGEPVH-IPADVTGLPM---PKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPK 15466

Query: 965   LIERQKYFFRIRAVNEAG-VGEPVELDKGVRAMPPPAAPKFDLSAR---LKSHMVVRAGT 1020
              +   K  + + A N  G V   V ++   R  PP      D+ A    L     +  G 
Sbjct: 15467 AVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGG 15526

Query: 1021  ALCIHAAFSGSPPPDVIWQKDGVPTKGR-ETITKSKNHSQFLINSTKRSDSGVYRILLQN 1079
             +   H          VI ++D    K   E +T +    ++ I     +    +R+   N
Sbjct: 15527 SEITHY---------VIDKRDASRKKAEWEEVTNTAVEKRYGIWKLIPNGQYEFRVRAVN 15577

Query: 1080  EFG---EARYDIHVRVAD---FPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIM 1133
             ++G   E + D  V + D    P PP   ++      ++ ++W    D        Y + 
Sbjct: 15578 KYGISDECKSD-KVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLE 15636

Query: 1134  KRDASTATWYTAAERVFSN------KYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRD 1185
             KR+  +  W   +    +       ++ V  LL G KY FR +A N  G   P +  D
Sbjct: 15637 KREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSD 15694



 Score =  165 bits (417), Expect = 3e-40
 Identities = 163/635 (25%), Positives = 271/635 (42%), Gaps = 78/635 (12%)

Query: 698   LDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGK 757
             +D  +PP+  V   ++S + V + W+ P  +GG  +T +IVERR +    W K    +  
Sbjct: 26765 IDACEPPRN-VRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVT 26823

Query: 758   VTNFSTNKVEEGKAYQFRILAVNSEG-------VSDPLETEEVFAGNPIEPPGFASQPQV 810
              T F  + + +   Y+FR+ A N+ G       V  P+   + + G  I+ P      + 
Sbjct: 26824 ETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGPVIDLP-----LEY 26878

Query: 811   TDVTK--EAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLE 868
             T+V K     ++   A      AP + +  + ++  +N  V V     + T      L++
Sbjct: 26879 TEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCV-----ENTTDLASILIK 26933

Query: 869   DTE------YEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLA 922
             D +      YE ++   N  G    ++    V   D   PPG    +     +   I+L 
Sbjct: 26934 DADRLNSGCYELKLR--NAMGSASATI---RVQILDKPGPPG--GPIEFKTVTAEKITLL 26986

Query: 923   WREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNE 980
             WR PA+  G   + YI+E R      WS  ++  +     T   +I+  +Y FR+RAVN+
Sbjct: 26987 WRPPADDGGAKITHYIVEKRETSRVVWSMVSE-HLEECIITTTKIIKGNEYIFRVRAVNK 27045

Query: 981   AGVGEPVELDKGV--RAMPPPAAPKF-DLSARLKSHMVVRAGTALCIHAAFSGSPPPDVI 1037
              G+GEP+E D  V   A   P  P   +++   K+ M V     +    A  GS      
Sbjct: 27046 YGIGEPLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPI----ADGGSDISGYF 27101

Query: 1038  WQKDGVPTKGRETITKS--KNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRV--- 1092
              +K    + G   + K   ++  Q +   T+ SD   YR+   N  G+  +         
Sbjct: 27102 LEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQ-YRVCAVNAAGQGPFSEPSEFYKA 27160

Query: 1093  ---ADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTAAE 1147
                 D P PP  +R+ +   +++TL W  S  V + G A   Y++  R      W T + 
Sbjct: 27161 ADPIDPPGPPAKIRIADSTKSSITLGW--SKPVYDGGSAVTGYVVEIRQGEEEEWTTVST 27218

Query: 1148  R--VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYE 1205
             +  V + +Y V+ L PG  YYFRV A N  G  EP++  +                 P +
Sbjct: 27219 KGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNE-----------------PVQ 27261

Query: 1206  KKDWRHAPRFVTPLKPHTVL---RGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYN 1262
              KD   AP     +   T +    G+D  +   F G P PTVT  K + N+ +++++   
Sbjct: 27262 AKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIE 27321

Query: 1263  STSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSS 1297
             +T     L IP  T  D+G Y + +EN +G+ +SS
Sbjct: 27322 NTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSS 27356



 Score =  165 bits (417), Expect = 3e-40
 Identities = 205/927 (22%), Positives = 345/927 (37%), Gaps = 119/927 (12%)

Query: 441   ELTSKDVTLRWK---KDGQLLMHGTKYSMN-HEGKRAELIIEDAQLSDGGEYTVVAMQDG 496
             ++T + +TL+W    +DG   + G  YS+   +G    +      +S+  +YTV  +  G
Sbjct: 27865 DVTRETITLKWNPPLRDGGSKIVG--YSIEKRQGNERWVRCNFTDVSEC-QYTVTGLSPG 27921

Query: 497   D----------------PTEYYSTAIVTVEERLATV----KSGMSDVHAATGSPAELCVV 536
             D                P    S  I+T +E +  +          +   +G    +  +
Sbjct: 27922 DRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKAL 27981

Query: 537   LNDEKVEGV-WLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGT----E 591
             +    V  V W KDG EI     M+I        L       +H G YT  AK      +
Sbjct: 27982 VQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAK 28041

Query: 592   SEASVFIADPP--TIDPSVLEALAAHAITV------KVGHTAHIKVPFRGKPLPKVTW-- 641
             +E  V + D P   + P     +    +T+        G           +   ++ W  
Sbjct: 28042 AEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWAL 28101

Query: 642   YKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRP 701
              +D  E      + +  G +     +S   +   G  L     D     A +  +V D P
Sbjct: 28102 IEDKCEAQSYTAIKLINGNEYQF-RVSAVNKFGVGRPL-----DSDPVVAQIQYTVPDAP 28155

Query: 702   KPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIK-IGEVDGKVTN 760
               P+       ++G+ + + W  P+ +GG  + Q+I+ERR      W+K I +     T 
Sbjct: 28156 GIPEPS----NITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETR 28211

Query: 761   FSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVF-AGNPIEPPGFASQPQVTDVTKEAVT 819
             F    + EG  Y+F ++A N+ GV        +     P+ PPG  +  +VTD +K  V+
Sbjct: 28212 FKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVS 28271

Query: 820   ITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAV 879
             + W+ P  DGG  ++GYI+E  K     W  VN +    T+ TV  L    EY+FRV A+
Sbjct: 28272 LEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAI 28331

Query: 880   NKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDS----SNSSISL------------AW 923
             N AG G     + ++ A D +  P L  D +   +    + +SI L             W
Sbjct: 28332 NGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVW 28391

Query: 924   REPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGV 983
              +P         I    +  T     C +        TV      +   F ++ ++  G 
Sbjct: 28392 SKPDSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGP 28451

Query: 984   GEPVELDKGVRAMPPPA--APKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKD 1041
               P+      R        AP  D  AR+  ++V                       +K 
Sbjct: 28452 PGPITFKDVTRGSATLMWDAPLLDGGARIHHYVV-----------------------EKR 28488

Query: 1042  GVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEAR-YDIH--VRVADFPRP 1098
                 +  + I++      F +N         +R+   NE+G    Y++   +   + P P
Sbjct: 28489 EASRRSWQVISEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPAP 28548

Query: 1099  PTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH---YIIMKRDASTATWYTAAERVFSNKYT 1155
             P  L + +   ++  L W   PD   DG +    Y++  R   +  W  A        +T
Sbjct: 28549 PRRLDVVDTSKSSAVLAWL-KPD--HDGGSRITGYLLEMRQKGSDFWVEAGHTK-QLTFT 28604

Query: 1156  VTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRF 1215
             V  L+   +Y FRV A+N+ G SEP ++  + +I + QI+  +A L              
Sbjct: 28605 VERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEP-TADLTGITN--------- 28654

Query: 1216  VTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTC 1275
                 +  T   G   T+     G P P VT    ++ +    +    +T    TL +   
Sbjct: 28655 ----QLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDS 28710

Query: 1276  TLKDSGDYSVLVENELGKDRSSCTLTV 1302
                DSG Y + +EN  G    S T+ V
Sbjct: 28711 MRGDSGRYFLTLENTAGVKTFSVTVVV 28737



 Score =  164 bits (416), Expect = 4e-40
 Identities = 230/1109 (20%), Positives = 416/1109 (37%), Gaps = 125/1109 (11%)

Query: 268   WIKGTEPLRIQYSLGKYDVKQMGT------KYMLVISNVNMNDAGIYSL----SVGDKRM 317
             ++ G  P  + +++ +  + Q  T         +VI N   +  G+YSL      G+++ 
Sbjct: 16547 YVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERKK 16606

Query: 318   SAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVWKFNGKELKRDDK----- 372
             +  + VLD P           +T     +          + +  +  ++ + D +     
Sbjct: 16607 TIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPV 16666

Query: 373   -YEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPIKFVSNLKNVRVK 431
              Y +T     +   ++ K      + E S   G  V+ ++  + R PI      +++ VK
Sbjct: 16667 TYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPERPEDLEVK 16726

Query: 432   ERSRACLECELTSKDVTLRWKKD----GQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGE 487
             E         +T   VTL W       G  +++    S     ++   +  D  LS   +
Sbjct: 16727 E---------VTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSR--K 16775

Query: 488   YTVVAMQDGDPTEYYSTAI--------------VTVEERLA------------TVKSGMS 521
             YTV  +++GD  EY  +A+              +T ++ LA            T++ G  
Sbjct: 16776 YTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIRVG-- 16833

Query: 522   DVHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEG 581
             +  A TG  +         K +  W KD  ++ +     I    A   L          G
Sbjct: 16834 EAFALTGRYS------GKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSG 16887

Query: 582   KYTFRAKGTES------EASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKP 635
             KY    + +        + +V     P + P   + +    + +        K P     
Sbjct: 16888 KYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISW------KPPLDDGG 16941

Query: 636   LPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLH- 694
                  +  +  EV ++  + +     +    +S  +     +  +  +N +G +   +  
Sbjct: 16942 SKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDYIFRIHAENLYGISDPLVSD 17001

Query: 695   -LSVLDRPKPPQGRVEFL--ELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKI 751
              +   DR + P    + +  E++     + W  P D GG+P+T +I+E+R    K W ++
Sbjct: 17002 SMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKPHD-GGKPITNYILEKRETMSKRWARV 17060

Query: 752   GEVD-GKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLE-TEEVFAGNPIEPPGFASQPQ 809
              +      T F    + EG  Y+FR+ A N  G+ DP   ++ VFA +PI  P     P+
Sbjct: 17061 TKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPE 17120

Query: 810   VTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDP--IQGTKCTVDGLL 867
               D T  +V +TW  P  DGG+ +LGYIVE +K G   W   N  P     TK  V GL 
Sbjct: 17121 AIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLR 17180

Query: 868   EDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA 927
             +   Y+FRV+AVN AG   P+     V+ KD ++PP L+ D +++   +  +    R  A
Sbjct: 17181 DGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSA 17240

Query: 928   --EGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGE 985
               +G P      +    D    ++    P+ G+   +          + +   N AG   
Sbjct: 17241 IIKGVPFPKVTWKKEDRDAPTKARIDVTPV-GSKLEIRNAAHEDGGIYSLTVENPAG--- 17296

Query: 986   PVELDKGVRAMPPPAAPK-FDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVP 1044
                +   V  +  P  P+  ++S   K    +     L       GS   + + ++  V 
Sbjct: 17297 SKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPL----DDGGSVITNYVVERRDVA 17352

Query: 1045  TKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARY---DIHVRVADF---PRP 1098
             +     ++ +              +  ++R+  +N++G   +      ++  D    P P
Sbjct: 17353 SAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGP 17412

Query: 1099  PTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH---YIIMKRDASTATWYTAAERVFSNKYT 1155
             P +L   +     V+L WN  PD   DG +    Y++  ++  T  W    + V + +  
Sbjct: 17413 PKDLHHVDVDKTEVSLVWN-KPD--RDGGSPITGYLVEYQEEGTQDWIKF-KTVTNLECV 17468

Query: 1156  VTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRF 1215
             VTGL  G+ Y FRV A N +G   P               D +  ++  EK         
Sbjct: 17469 VTGLQQGKTYRFRVKAENIVGLGLP---------------DTTIPIECQEKLVPPSVELD 17513

Query: 1216  VTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTC 1275
             V  ++   V  G          G P PT         I  +  +   + +    L I  C
Sbjct: 17514 VKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNC 17573

Query: 1276  TLKDSGDYSVLVENELGKDRSSCTLTVYD 1304
               +D+G+Y + V N  G    +  LTV D
Sbjct: 17574 LRRDTGEYQITVSNAAGSKTVAVHLTVLD 17602



 Score =  163 bits (412), Expect = 1e-39
 Identities = 149/604 (24%), Positives = 259/604 (42%), Gaps = 43/604 (7%)

Query: 598   IADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSME 657
             I + P ID   L+     ++  K G    + +PF+G+P P VTW KD   +  + R S+E
Sbjct: 27265 ILEAPEID---LDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIE 27321

Query: 658   RGEDQALLTISNCVREDSGLILLKLKNDHGS-ATATLHLSVLDRPKPPQGRVEFLELSGS 716
               +  +LLTI    R D+G  +L ++N  G   ++T+ + VLD P   Q +++   +S  
Sbjct: 27322 NTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQ-KLQVKHVSRG 27380

Query: 717   CVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRI 776
              V + W  P  +GG P+  +++E+R   K++W  +       T+F    + E   + FR+
Sbjct: 27381 TVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSS-TSFKLIDLSEKTPFFFRV 27439

Query: 777   LAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGY 836
             LA N  G+ +P ET E       E P       + D TK +V ++W  P  DGG+ +  Y
Sbjct: 27440 LAENEIGIGEPCETTEPV--KAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEY 27497

Query: 837   IVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVA 896
             +VER+ KG   W        +  +  V  L E +  EFRV A N+ G   P V    +  
Sbjct: 27498 VVERKGKGEQTWSHAGIS--KTCEIEVSQLKEQSVLEFRVFAKNEKGLSDP-VTIGPITV 27554

Query: 897   KDPVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPIS 956
             K+ +  P    ++ +SD   + +++        + P     + + + +  W K   +P+ 
Sbjct: 27555 KELIITP----EVDLSDIPGAQVTVRIGHNVHLELP----YKGKPKPSISWLK-DGLPLK 27605

Query: 957   GTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGV--RAMP-------PPAAPKFDLS 1007
              + +      E +       A  E G    V LD  V   A+P       PP+ PK  + 
Sbjct: 27606 ESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKGPIR 27665

Query: 1008  -ARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTK 1066
                +K+  V+ +     +     G        +K        + +  S   + F + +  
Sbjct: 27666 FDEIKADSVILSWD---VPEDNGGGEITCYSIEKRETSQTNWKMVCSSVARTTFKVPNLV 27722

Query: 1067  RSDSGVYRILLQNEFGEAR---YDIHVRVADF--PRPPTNLRLFEEVPNTVTLTWNHSPD 1121
             +     +R+  +N +G ++     I V    F  P PP    ++    + ++LTW+    
Sbjct: 27723 KDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWD--AP 27780

Query: 1122  VQEDGE--AHYIIMKRDASTATWYTA-AERVFSNKYTVTGLLPGRKYYFRVVARNEIGDS 1178
             V + G     + + K++ ++  W       +   +Y  TGL+ G  Y FRV A N  G S
Sbjct: 27781 VYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGLS 27840

Query: 1179  EPLD 1182
              P D
Sbjct: 27841 SPSD 27844



 Score =  162 bits (409), Expect = 3e-39
 Identities = 153/668 (22%), Positives = 271/668 (40%), Gaps = 55/668 (8%)

Query: 68    EFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKL 127
             +F+   + VTA E + AVF   +  +    + W +     +  +  +      K H +  
Sbjct: 11930 KFLTPLKDVTAKEKESAVFTVELSHD-NIRVKWFKNDQ-RLHTTRSVSMQDEGKTHSITF 11987

Query: 128   EPLTSDDSDNYKCIASNDHADAIYTV---------SLLVTEGQEKMDF------------ 166
             + L+ DD+   +  A    ++A  TV          L    G EK +             
Sbjct: 11988 KDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAP 12047

Query: 167   KKMLKKRAPPAPKKKQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMK 226
              K  K      P K     A+ K+ + IL K  K D  +   + G     G        K
Sbjct: 12048 VKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSG--------K 12099

Query: 227   KKVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIW-IKGTEPLRIQYSLGKYD 285
               +E   I++++PL   E     T  F+   E+ + ++   W +KG   L+        +
Sbjct: 12100 LDIEDREIKLVRPLHSVEVMETETARFET--EISEDDIHANWKLKGEALLQTP----DCE 12153

Query: 286   VKQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTA 345
             +K+ G  + LV+ N  ++  G       + + SA L V    +  L  +K V VT  +TA
Sbjct: 12154 IKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETA 12213

Query: 346   VFEIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGN 405
              F+  LS ++    W   GK+L+  DK  +    +G  HTL ++D +L D+GE    A +
Sbjct: 12214 TFDCELSYEDIPVEWYLKGKKLEPSDK--VVPRSEGKVHTLTLRDVKLEDAGEVQLTAKD 12271

Query: 406   LVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYS 465
                 A L +   P++F   L++  V+E + A LECE++ ++  ++W K+G  ++   KY 
Sbjct: 12272 FKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYE 12331

Query: 466   MNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHA 525
             +  +G+  +L+I D    D   YT       D  ++ ++  + V          ++D+  
Sbjct: 12332 IVADGRVRKLVIHDCTPEDIKTYTC------DAKDFKTSCNLNVVPPHVEFLRPLTDLQV 12385

Query: 526   ATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTF 585
                  A     L+ E  +  W KDG EI       I+ +GAV  L+      + E +Y+ 
Sbjct: 12386 REKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSC 12445

Query: 586   RAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFR-GKPLPKVTWYKD 644
               +   +   + + +   +          +   ++V  T  IK+     KP  +V WYK 
Sbjct: 12446 EVRTARTSGMLTVLEEEAV-------FTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKG 12498

Query: 645   GMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPP 704
               E+ E  R  +     + +L I N   ED+G    +L +        +H    +    P
Sbjct: 12499 DEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKP 12558

Query: 705   QGRVEFLE 712
             Q  +E LE
Sbjct: 12559 Q-NLEILE 12565



 Score =  160 bits (406), Expect = 6e-39
 Identities = 256/1157 (22%), Positives = 432/1157 (37%), Gaps = 180/1157 (15%)

Query: 242   DKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVN 301
             ++  KV  T+    I++   P  K+ W K     R   +  + DV  +G+K  L I N  
Sbjct: 17227 EQHIKVGDTLRLSAIIK-GVPFPKVTWKKED---RDAPTKARIDVTPVGSK--LEIRNAA 17280

Query: 302   MNDAGIYSLSV----GDKRMSAELTVLDEPLKFLGEMKPVKVTE-RQTAVFEIRLSKKEP 356
               D GIYSL+V    G K +S ++ VLD+P    G  + ++V+E R+ + +   L+ KEP
Sbjct: 17281 HEDGGIYSLTVENPAGSKTVSVKVLVLDKP----GPPRDLEVSEIRKDSCY---LTWKEP 17333

Query: 357   ---------NFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGE---FSAEAG 404
                      N+V       ++R D      S    T   K   A+  + G    F   A 
Sbjct: 17334 LDDGGSVITNYV-------VERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAE 17386

Query: 405   NLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKK---DGQLLMHG 461
             N   +        PIK +  L         +     ++   +V+L W K   DG   + G
Sbjct: 17387 NQYGRGPFVETPKPIKALDPL---HPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITG 17443

Query: 462   TKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYY-------------STAIVT 508
                    EG +  +  +        E  V  +Q G    +              +T  + 
Sbjct: 17444 YLVEYQEEGTQDWIKFKTV---TNLECVVTGLQQGKTYRFRVKAENIVGLGLPDTTIPIE 17500

Query: 509   VEERLATVKSGM-----SDVHAATGSPAELCVVLNDEKV-EGVWLKDGKEITDLPGMQIV 562
              +E+L      +       +    G+      ++    V    W  DG EI       + 
Sbjct: 17501 CQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVE 17560

Query: 563   KQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVF-------IADPPTIDPSVLEALAAH 615
                    L   +      G+Y           +V        +  PPT   ++L+    H
Sbjct: 17561 TDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEH 17620

Query: 616   AITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDS 675
                     T   + P      P + +  +  +  ++    +  G  +  L I +  +   
Sbjct: 17621 M-------TISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCE 17673

Query: 676   GLILLKLKNDHG-----SATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGG 730
              +  ++ +N  G      +T T+       P PP G+    +++ +   + W  PK +GG
Sbjct: 17674 YVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPP-GKPVVTDITENAATVSWTLPKSDGG 17732

Query: 731   RPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPL-E 789
              P+T + +ERR V  K W+++ +       F    + EG  Y+FR+ A N  G+S P   
Sbjct: 17733 SPITGYYMERREVTGK-WVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPS 17791

Query: 790   TEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWV 849
             ++ + A  PI+PPG    P++ D ++E   + W  P  DGG+P+LGY+VE +K G+  W 
Sbjct: 17792 SDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWN 17851

Query: 850   PVNKDP-IQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQD 908
              +NKD  I+     V GL+E  EY FR+ A N  G G+P   + SV+AKD + PP +  D
Sbjct: 17852 RINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELD 17911

Query: 909   LHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIER 968
             +   D     +    R  A         ++ R E    W+K             G ++ R
Sbjct: 17912 VTCRDVITVRVGQTIRILAR--------VKGRPEPDITWTK------------EGKVLVR 17951

Query: 969   QKYFFRIRAVN--EAGVGEPVELDKGVRAMPPPAAPKFDLSARLKS---------HMVVR 1017
             +K    I+ +   E  + E V  D G          K+ +SA+  S         +++ R
Sbjct: 17952 EKRVDLIQDLPRVELQIKEAVRADHG----------KYIISAKNSSGHAQGSAIVNVLDR 18001

Query: 1018  AGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETIT---------KSKNHSQFLINSTKR- 1067
              G    +           + W+       G   IT           K  S    + TKR 
Sbjct: 18002 PGPCQNLKVTNVTKENCTISWENP--LDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRL 18059

Query: 1068  -------SDSGVYRILLQNEFG-----EARYDI-HVRVADFPRPPTNLRLFEEVPNTVTL 1114
                    ++   +R+  +N+ G     E +  I  +   D P  P NL + ++    V L
Sbjct: 18060 IKANLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYL 18119

Query: 1115  TWNHSPDVQEDGEAHYIIMKRDASTATWYTAAE-RVFSNKYTVTGLLPGRKYYFRVVARN 1173
              W             Y + +R   +  W    +  +    Y V   +  + Y FRV  +N
Sbjct: 18120 KWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKN 18179

Query: 1174  EIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPH---TVLRGQDC 1230
             E G+S+ + + +  ++ K+ +Q      KP            V  LK     TV  G   
Sbjct: 18180 EGGESDWVKTEE--VVVKEDLQ------KP------------VLDLKLSGVLTVKAGDTI 18219

Query: 1231  TMTCAFLGNPRPTV--TLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVE 1288
              +     G P P V  T  K   ++T + +   ++ +      +      D G Y V   
Sbjct: 18220 RLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTAT 18279

Query: 1289  NELGKDRSSCTLTVYDK 1305
             N  G   +  T+ V DK
Sbjct: 18280 NTAGSFVAYATVNVLDK 18296



 Score =  160 bits (406), Expect = 6e-39
 Identities = 157/655 (23%), Positives = 275/655 (41%), Gaps = 61/655 (9%)

Query: 661   DQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDR-----PKPPQGRVEFLELSG 715
             ++ ++T +  ++ +  +  ++  N +G        SV+ +     P PP G  E  +++ 
Sbjct: 27021 EECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPP-GIPEVTKITK 27079

Query: 716   SCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFR 775
             + + + W  P  +GG  ++ + +E+R      W K+ +   + T      + E   YQ+R
Sbjct: 27080 NSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYR 27139

Query: 776   ILAVNSEGVSDPLETEEVF-AGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVL 834
             + AVN+ G     E  E + A +PI+PPG  ++ ++ D TK ++T+ W+ P  DGG+ V 
Sbjct: 27140 VCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVT 27199

Query: 835   GYIVERRKKGSNLWVPVN-KDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSS 893
             GY+VE R+     W  V+ K  ++ T+  V  L     Y FRV AVN AG G+P   +  
Sbjct: 27200 GYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEP 27259

Query: 894   VVAKDPVKPPGLVQD--LHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCT 951
             V AKD ++ P +  D  L  S  + +   +    P +G PP         +D K      
Sbjct: 27260 VQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWR---KDEKNLGSDA 27316

Query: 952   KIPISGT----CYTVGGLIERQ--KYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFD 1005
             +  I  T      T+  +      KY   I    E GVGEP      V+ +  PAA +  
Sbjct: 27317 RYSIENTDSSSLLTIPQVTRNDTGKYILTI----ENGVGEPKSSTVSVKVLDTPAACQ-- 27370

Query: 1006  LSARLKSHMVVRAGTALCIHAAF--SGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLIN 1063
                +L+   V R    L         GSP  + + +K     +    ++   + + F + 
Sbjct: 27371 ---KLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSSTSFKLI 27427

Query: 1064  STKRSDSGVYRILLQNEFG---EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSP 1120
                      +R+L +NE G          V+ A+ P P  +L + +    +V L+W   P
Sbjct: 27428 DLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWT-KP 27486

Query: 1121  DVQEDGEA---HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGD 1177
             D   DG +    Y++ ++     TW  A     + +  V+ L       FRV A+NE G 
Sbjct: 27487 DF--DGGSVITEYVVERKGKGEQTWSHAGISK-TCEIEVSQLKEQSVLEFRVFAKNEKGL 27543

Query: 1178  SEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVT---PLKPHTVLRGQDCTMTC 1234
             S+P+                   + P   K+    P       P    TV  G +  +  
Sbjct: 27544 SDPVT------------------IGPITVKELIITPEVDLSDIPGAQVTVRIGHNVHLEL 27585

Query: 1235  AFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVEN 1289
              + G P+P+++  K  + +  +    ++ T    TL I     +  G Y+V+++N
Sbjct: 27586 PYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDN 27640



 Score =  159 bits (402), Expect = 2e-38
 Identities = 291/1327 (21%), Positives = 496/1327 (37%), Gaps = 203/1327 (15%)

Query: 76   VTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKLEPLTSDDS 135
            +  PE   A F   V     P +  K    I + E  KI      K H L +   +++DS
Sbjct: 2891 IEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQG--KLHQLIIMNTSTEDS 2948

Query: 136  DNYKCIASNDHADAIYTVS-LLVT--------EGQEKMDFKKMLKKRAPPAPKKKQKKVA 186
              Y  +  ND   A  TV+ +++T        E ++ + F+  +          K     
Sbjct: 2949 AEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEI 3008

Query: 187  NEKEMLEILSKVPKKDFEKVCMEYG-FTDFRGLLRKLKEMKKK-VEVEAIRILKPLEDKE 244
               +  ++ +K          + +G   D+  +  K        VE   I   K ++D +
Sbjct: 3009 KSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIK 3068

Query: 245  TKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMND 304
                   +F+C  E+ +P++ + W+K  + L+I     +  +++    + L+I +  M+D
Sbjct: 3069 VLEKKRAMFEC--EVSEPDITVQWMKDDQELQIT---DRIKIQKEKYVHRLLIPSTRMSD 3123

Query: 305  AGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVWKFNG 364
            AG Y++  G    +A+L V    ++     K V+V E+Q AV E  +++ + +  W  +G
Sbjct: 3124 AGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDG 3183

Query: 365  KELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRI-PIKFVS 423
             E+    +       +   H + I + R SD+GE++  AG       L ++   P + + 
Sbjct: 3184 IEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQ 3243

Query: 424  NLKNVRVKERSRACLECELTSK-DVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQL 482
             L+ V V+    A     ++ +    + W K+ QLL  G K    H+G+   L++ +A  
Sbjct: 3244 ELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFP 3303

Query: 483  SDGGEYTVVAMQDGDPTEYYSTAIVTVEERLA----------TVKSGMSDVHAATGSPAE 532
             D   YT  A  D       ++  V V E ++           + + + D   + G PA 
Sbjct: 3304 EDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPAR 3363

Query: 533  LCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGT-- 590
                ++   ++  W    K+I      ++ +    ++L      PE EG YTF A     
Sbjct: 3364 FQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVG 3423

Query: 591  --ESEASVFIADPPTI------DPSVLEALAAHAITVKV-------GHTAHIKVPFRGKP 635
               S A++ +  P +I          +E  AA  I  K+       GH A      +  P
Sbjct: 3424 QVSSTANLSLEAPESILHERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAP 3483

Query: 636  LPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHL 695
              +  W+K G E+ E ++ S+   +  + L I      D G    K  N++GS + T  L
Sbjct: 3484 NVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATL 3543

Query: 696  SVLDRPKPPQGRVEFLELSGSCVHMKWKAPK---DNGGRPVTQFIVERRAVG---KKSWI 749
            +V +   P      FL    S      KA K      G PV + I ++         +W 
Sbjct: 3544 TVTEAYPP-----TFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNW- 3597

Query: 750  KIGEVDGK-VTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNP-----IEPPG 803
            +I + + K +   S   +++   Y  +  A N  G +D  + E +    P     +EP  
Sbjct: 3598 RISDAENKHILELSNLTIQDRGVYSCK--ASNKFG-ADICQAELIIIDKPHFIKELEPVQ 3654

Query: 804  FASQPQV---TDVTKE-AVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGT 859
             A   +V     V ++  VT+TW+   Q    P   Y +    K + L +P+ K    GT
Sbjct: 3655 SAINKKVHLECQVDEDRKVTVTWSKDGQK-LPPGKDYKICFEDKIATLEIPLAKLKDSGT 3713

Query: 860  -KCTVDGLLEDTEYEFRVIAVNKAGPGQPSV------PSSSVVAKDP--VKPPGLVQDLH 910
              CT               A N+AG    S       P S V   DP  +  PG    LH
Sbjct: 3714 YVCT---------------ASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGESARLH 3758

Query: 911  VSDSSNSSISLAW----REPAEGDPPSGYILEMRA-EDTKEWSKCTKIPISGTCYTVGGL 965
                 +  I + W    +E +E +    Y +   A  D  +     K+  SG+       
Sbjct: 3759 CKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITD----VKVEDSGS------- 3807

Query: 966  IERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIH 1025
                   +   AVN+ G          +    PP+  K      L+   +VR GT   + 
Sbjct: 3808 -------YSCEAVNDVGSD---SCSTEIVIKEPPSFIK-----TLEPADIVR-GTNALLQ 3851

Query: 1026 AAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFL--------INSTKRSDSGVYRILL 1077
               SG+ P ++ W KD      ++ I  SK +  F         I S   +D G Y  ++
Sbjct: 3852 CEVSGTGPFEISWFKD------KKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVV 3905

Query: 1078 QNEFGEARYDIHVRVADFPRPPTNLRLFEEV----PNTVTL------------TWNHSPD 1121
             NE G+      +       PPT ++  +++      TVTL            TW    +
Sbjct: 3906 ANEVGKCGC---MATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQE 3962

Query: 1122 V-QEDGEAHYIIMKRDASTATWYTAAERV-FSNKYTVTGLLPGRKYYFRVVARNEIGDSE 1179
            V +EDG+   I M      A       ++ F  KYT              +A NE G   
Sbjct: 3963 VIREDGK---IKMSFSNGVAVLIIPDVQISFGGKYT-------------CLAENEAG--- 4003

Query: 1180 PLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGN 1239
                      ++  + +L  K             + +   +   V  G   T+     G 
Sbjct: 4004 ----------SQTSVGELIVK----------EPAKIIERAELIQVTAGDPATLEYTVAGT 4043

Query: 1240 PRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCT 1299
            P      YK    + A+ K+  +  + V  L   +  L DSG Y+  + NE+G      T
Sbjct: 4044 PELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETT 4103

Query: 1300 LTVYDKD 1306
             TV D+D
Sbjct: 4104 FTVLDRD 4110



 Score =  159 bits (401), Expect = 2e-38
 Identities = 300/1354 (22%), Positives = 492/1354 (36%), Gaps = 216/1354 (15%)

Query: 67   PEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLK 126
            P F+E  + V A  G+ A  + +V G  +  ISW +E     K  +   Y    K +V  
Sbjct: 7020 PYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEH---TKLRSAPAYKMQFKNNVAS 7076

Query: 127  LEPLTSDDSD--NYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPKKKQKK 184
            L     D SD   Y C A N    A+ + ++LV +            ++ PP   +K K 
Sbjct: 7077 LVINKVDHSDVGEYSCKADNS-VGAVASSAVLVIKA-----------RKLPPFFARKLKD 7124

Query: 185  V-------------ANEKEMLEIL---SKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKK 228
            V              N  E L++      V  KD     ++  F      L+ L+  +  
Sbjct: 7125 VHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDAN--LQTSFVHNVATLQILQTDQSH 7182

Query: 229  VEVEAIRILKPLEDKETKV-------DTTVVFDCI-----MELKDPNVKMIWIKGTEPLR 276
            +         PL    +         +    FD       + L +       + GT P++
Sbjct: 7183 IGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGTAPIK 7242

Query: 277  IQYSLGKYDVKQMGTKYMLVISN--------VNMNDAGIY----SLSVGDKRMSAELTVL 324
            I ++    +++  G   M ++ N        V   DAG Y    S   G    SA+L V 
Sbjct: 7243 ITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGV- 7301

Query: 325  DEPLKFLGEMKPVKVTERQTAV-FEIRLS-KKEPNFVWKFNGKELKRDDKYEITVSEDGL 382
             EP +F+ +++P ++ ++     +E ++    E   +W  +  E++   K+ ++  +   
Sbjct: 7302 QEPPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDS-- 7359

Query: 383  THTLKIKDARLSDSGEFSAEAGNLVQKAQ----LTIDRIPIKFVSNLKNVRVKERSRACL 438
               L++ +  + DSG+++ EA N    A     L +   PI F      +   + +   L
Sbjct: 7360 VAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPI-FRKKPHPIETLKGADVHL 7418

Query: 439  ECELT-SKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGD 497
            ECEL  +    + W KD + L  G KY +  E     + I +   +D GEY   A  D  
Sbjct: 7419 ECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVG 7478

Query: 498  PTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLND-EKVEGVWLKD-GKEITD 555
                  +  +    R       +SD+    G   +L   +   E +  VW KD G+ + +
Sbjct: 7479 SDTCVGSIALKAPPRFV---KKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRE 7535

Query: 556  LPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGT----ESEASVFIADPPTIDPSVLEA 611
               + I     +  L F  + P + GKYT + K      E  A++ + +P TI       
Sbjct: 7536 SDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEK---- 7591

Query: 612  LAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCV 671
                +I V  G T  ++    G P     W+KDG E+T + +  +      + L I N  
Sbjct: 7592 --PESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVA 7649

Query: 672  REDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLE---LSGSCVHMKWKAPKDN 728
              DSG+   +++N  G  + T  L V DR  PP    +  E   LSGS V M+ K     
Sbjct: 7650 PSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKV---Y 7706

Query: 729  GGRPVT-QFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVN---SEGV 784
            G  P++  +  E   +      +    D      + N +EE  +  +  +A N   S+  
Sbjct: 7707 GSPPISVSWFHEGNEISSGRKYQTTLTDNTCA-LTVNMLEESDSGDYTCIATNMAGSDEC 7765

Query: 785  SDPLETEEVFAGNPIEPPGFASQPQVTDV-TKEAVTITWNAPTQDGGAPVLGYIVERRKK 843
            S PL           EPP F  +P   DV T   VT T               IV+    
Sbjct: 7766 SAPLTVR--------EPPSFVQKPDPMDVLTGTNVTFT--------------SIVKGTPP 7803

Query: 844  GSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSS---------- 893
             S  W   + + + G +C V   LED+  E  +  V+ +  G+ +   S+          
Sbjct: 7804 FSVSWFKGSSELVPGDRCNVS--LEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTH 7861

Query: 894  VVAKDPVKPPGLVQDLHVSD----------SSNSSISLAWREPAEGDPPSGYILEMRAED 943
            +  K P K    + D  +            +    IS+ W++      PS    +     
Sbjct: 7862 LYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPS----QRCNIT 7917

Query: 944  TKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPK 1003
            T E S   +IP S T    G         +     N +G          +  + PP    
Sbjct: 7918 TTEKSAILEIP-SSTVEDAGQ--------YNCYIENASGKD---SCSAQILILEPP---- 7961

Query: 1004 FDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKS----KNHSQ 1059
                 +    + V  G +  +    +G+P   V W K    TK R T T       N + 
Sbjct: 7962 --YFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKG--DTKLRPTTTYKMHFRNNVAT 8017

Query: 1060 FLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTL----- 1114
             + N    +DSG Y    +N  GE      + V +   PP+  R   +V  TV L     
Sbjct: 8018 LVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFD 8077

Query: 1115 -----TWNHSPDVQEDGEAHYIIMKRDASTATWY---TAAERVFSNKYTVTGLLPGRKYY 1166
                 +   S    +DG+     +K   +  T +   TA   +F    ++ G        
Sbjct: 8078 CAISGSEPISVSWYKDGKP----LKDSPNVQTSFLDNTATLNIFKTDRSLAG-------Q 8126

Query: 1167 FRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLR 1226
            +   A N IG +                   SA+L   E K   + P F   L P   + 
Sbjct: 8127 YSCTATNPIGSASS-----------------SARLILTEGK---NPPFFDIRLAPVDAVV 8166

Query: 1227 GQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVL 1286
            G+     C   G     V+  K    I +  K+  +       L +      DSG Y+  
Sbjct: 8167 GESADFECHVTGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCY 8226

Query: 1287 VENELGKDRSSCTLTVYDKDDKSVVASITESLQK 1320
              NE+GKD  SCT  +  K ++ +  S T+ L +
Sbjct: 8227 AVNEVGKD--SCTAQLNIK-ERLIPPSFTKRLSE 8257



 Score =  154 bits (389), Expect = 5e-37
 Identities = 157/664 (23%), Positives = 267/664 (40%), Gaps = 60/664 (9%)

Query: 68   EFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKL 127
            + ++KP+ VTA E     F   V  +  P + W  +S + IK S K    S  K H L L
Sbjct: 2796 KIIKKPKDVTALENATVAFEVSVSHDTVP-VKWFHKS-VEIKPSDKHRLVSERKVHKLML 2853

Query: 128  EPLTSDDSDNYKCIASNDHADA-IYTVSLLVTEGQEKMDFKKMLKKRAPPAPKKKQKKVA 186
            + ++  D+  Y  +       A ++  +L +T+  + ++            P+ K     
Sbjct: 2854 QNISPSDAGEYTAVVGQLECKAKLFVETLHITKTMKNIE-----------VPETKTASFE 2902

Query: 187  NEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVE---------------- 230
             E     + S   K   E    E      +G L +L  M    E                
Sbjct: 2903 CEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSA 2962

Query: 231  ---VEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVK 287
               V  I I   L+D   +   T+ F+  +  +  + K  W+K    ++   S  K  ++
Sbjct: 2963 TLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYK--WLKNGVEIK---STDKCQMR 3017

Query: 288  QMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVF 347
                 + L I NV+  DA  Y+   G    +A L V    ++F   +K +KV E++ A+F
Sbjct: 3018 TKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMF 3077

Query: 348  EIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLV 407
            E  +S+ +    W  + +EL+  D+  I + ++   H L I   R+SD+G+++  AG  V
Sbjct: 3078 ECEVSEPDITVQWMKDDQELQITDR--IKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNV 3135

Query: 408  QKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMN 467
              A+L ++   ++  S  K V+V E+ RA +E E+   DV   W KDG  +    +    
Sbjct: 3136 STAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHK 3195

Query: 468  H--EGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHA 525
            +  E +   + I + + SD GEYT VA ++      Y  A          V   +  V  
Sbjct: 3196 YVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNA-----PEPPQVLQELQPVTV 3250

Query: 526  ATGSPAELCVVLNDEKVEGV-WLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYT 584
             +G PA  C V++      + W K+ + ++     + +  G  + L+     PE    YT
Sbjct: 3251 QSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYT 3310

Query: 585  FRAKG----TESEASVFIADPPTIDPSVLEALAAHAITVKV-------GHTAHIKVPFRG 633
              AK       + AS+ +  P  + P     +   AI   +       G  A  +    G
Sbjct: 3311 CEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSG 3370

Query: 634  KPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATL 693
              L KV+WY    ++       M + ED   L I+    ED G       N  G  ++T 
Sbjct: 3371 TDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTA 3429

Query: 694  HLSV 697
            +LS+
Sbjct: 3430 NLSL 3433



 Score =  152 bits (385), Expect = 2e-36
 Identities = 151/601 (25%), Positives = 256/601 (42%), Gaps = 58/601 (9%)

Query: 600   DPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERG 659
             + P ID   L+      I ++ G +  + VP +G+P P+V W K   E+ +   + +   
Sbjct: 22938 EAPDID---LDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSS 22994

Query: 660   EDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVH 719
                  L + N  R DSG   L L+N  G+ +A + + VLD P PP   ++  E++   V 
Sbjct: 22995 FTS--LVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVN-LKVTEITKDSVS 23051

Query: 720   MKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTN-----KVEEGKAYQF 774
             + W+ P  +GG  +  +IVE+R   +KS+  +      VTN   N     +++EG +Y F
Sbjct: 23052 ITWEPPLLDGGSKIKNYIVEKREATRKSYAAV------VTNCHKNSWKIDQLQEGCSYYF 23105

Query: 775   RILAVNSEGVSDPLETEE-VFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPV 833
             R+ A N  G+  P +T + +      +PPG  +   V DVT+ +V+++W  P  DGG+ +
Sbjct: 23106 RVTAENEYGIGLPAQTADPIKVAEVPQPPGKIT---VDDVTRNSVSLSWTKPEHDGGSKI 23162

Query: 834   LGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSS 893
             + YIVE + K S  W    +  ++  +  +  L +  EY FRV+AVN+ G   P   +  
Sbjct: 23163 IQYIVEMQAKHSEKWSECAR--VKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVP 23220

Query: 894   VVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKI 953
             +VAKD V  P  V+    S S      L    P  G P          +D     + T+I
Sbjct: 23221 IVAKDLVIEPD-VKPAFSSYSVQVGQDLKIEVPISGRPKPTITW---TKDGLPLKQTTRI 23276

Query: 954   PISGTC-YTVGGLIERQK---YFFRIRAVNEAGVG----EPVELDKGVRAMPPPAAPKFD 1005
              ++ +   T   + E  K     + I   N  G      E V LDK     PP    KFD
Sbjct: 23277 NVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDK---PDPPKGPVKFD 23333

Query: 1006  ----LSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFL 1061
                  S  L  +  +  G          G    + I QK    T   + ++ +   +   
Sbjct: 23334 DVSAESITLSWNPPLYTG----------GCQITNYIVQKRDTTTTVWDVVSATVARTTLK 23383

Query: 1062  INSTKRSDSGVYRILLQNEFGEA-RYDIHVRVADF----PRPPTNLRLFEEVPNTVTLTW 1116
             +   K      +RI  +N +G++   +    VA +    P PP          +++ + W
Sbjct: 23384 VTKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQW 23443

Query: 1117  NHSPDVQEDGEAHYIIMKRDASTATWYTAAERVF-SNKYTVTGLLPGRKYYFRVVARNEI 1175
             +   +        Y + +++ ++  W    + +    ++    L  G +Y FRV A N +
Sbjct: 23444 HEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIV 23503

Query: 1176  G 1176
             G
Sbjct: 23504 G 23504



 Score =  151 bits (381), Expect = 5e-36
 Identities = 228/1018 (22%), Positives = 388/1018 (38%), Gaps = 103/1018 (10%)

Query: 224   EMKKKVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQY---- 279
             EM + V+ + I     LE  E  +D  +    I +  +    +I  KG  P  + +    
Sbjct: 27255 EMNEPVQAKDI-----LEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDE 27309

Query: 280   ----SLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSVGD-----KRMSAELTVLDEPLKF 330
                 S  +Y ++   +  +L I  V  ND G Y L++ +     K  +  + VLD P   
Sbjct: 27310 KNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAAC 27369

Query: 331   LGEMKPVKVTERQTAVFE-----IRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHT 385
               +   VK   R T         I       N+V       +++ D  + T S   ++H 
Sbjct: 27370 --QKLQVKHVSRGTVTLLWDPPLIDGGSPIINYV-------IEKRDATKRTWSV--VSHK 27418

Query: 386   LKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSK 445
                   +L D  E +     ++ + ++ I   P +    +K   V    R     + T  
Sbjct: 27419 CSSTSFKLIDLSEKTPFFFRVLAENEIGIGE-PCETTEPVKAAEVPAPIRDLSMKDSTKT 27477

Query: 446   DVTLRWKK---DGQLLMHGTKYSMNHEGKRAELI----------IEDAQLSDGG--EYTV 490
              V L W K   DG  ++  T+Y +  +GK  +            IE +QL +    E+ V
Sbjct: 27478 SVILSWTKPDFDGGSVI--TEYVVERKGKGEQTWSHAGISKTCEIEVSQLKEQSVLEFRV 27535

Query: 491   VAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAAT-----GSPAELCVVLNDEKVEGV 545
              A  +   ++  +   +TV+E + T +  +SD+  A      G    L +    +    +
Sbjct: 27536 FAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSI 27595

Query: 546   -WLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIA----D 600
              WLKDG  + +   ++  K      L   +   EH GKYT          +V I      
Sbjct: 27596 SWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLG 27655

Query: 601   PPT--IDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSME- 657
             PP+    P   + + A ++ +         VP       ++T Y      T +    M  
Sbjct: 27656 PPSKPKGPIRFDEIKADSVILS------WDVP-EDNGGGEITCYSIEKRETSQTNWKMVC 27708

Query: 658   RGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDR-----PKPPQGRVEFLE 712
                 +    + N V++      ++ +N +G +   +   ++ +     P PP G+     
Sbjct: 27709 SSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPP-GKPVIYN 27767

Query: 713   LSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAY 772
             ++   + + W AP  +GG  VT F VE++      W K+         +    + EG  Y
Sbjct: 27768 VTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDY 27827

Query: 773   QFRILAVNSEGVSDPLETEE-VFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGA 831
             QFR+ A NS G+S P +  +   A +P++PPG    P   DVT+E +T+ WN P +DGG+
Sbjct: 27828 QFRVYAENSAGLSSPSDPSKFTLAVSPVDPPG---TPDYIDVTRETITLKWNPPLRDGGS 27884

Query: 832   PVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGP-GQPSVP 890
              ++GY +E+R +G+  WV  N   +   + TV GL     YEFR+IA N  G    PS  
Sbjct: 27885 KIVGYSIEKR-QGNERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQS 27943

Query: 891   SSSVVAKDPVKPPGLVQDLHVSDS--SNSSISLAWREPAEGDP-PSGYILEMRAEDTKEW 947
             S  ++ +D   PP +       D     S  SL  +   +G P P     +   E  K  
Sbjct: 27944 SGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRM 28003

Query: 948   SKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLS 1007
             +      +  T   V       +  + + A N +G  +  E+   V+  P         +
Sbjct: 28004 NMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAK-AEIKVKVQDTPGKVVGPIRFT 28062

Query: 1008  ARLKSHMV------VRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRE-TITKSKNHSQF 1060
                   M       +  G A   H          + W       + +  T  K  N +++
Sbjct: 28063 NITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIKLINGNEY 28122

Query: 1061  LINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSP 1120
                 +  +  GV R L   +       I   V D P  P    +     N++TLTW    
Sbjct: 28123 QFRVSAVNKFGVGRPL---DSDPVVAQIQYTVPDAPGIPEPSNI---TGNSITLTWARPE 28176

Query: 1121  DVQEDGEAHYIIMKRDASTATWYTAAER--VFSNKYTVTGLLPGRKYYFRVVARNEIG 1176
                      YI+ +R+  +  W     +  +   ++ VTGL  G +Y F V+A N  G
Sbjct: 28177 SDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAG 28234



 Score =  148 bits (374), Expect = 3e-35
 Identities = 305/1410 (21%), Positives = 507/1410 (35%), Gaps = 188/1410 (13%)

Query: 1    MTTIHSRQMLQE--HVSMEFSSSTTHVQTFSQTTKIVGEEVVRRKSSSIVE---FFSLVT 55
            +T +   Q+L E  +V + F  S   +Q  S      G    + K+ S VE    F LV 
Sbjct: 5079 ITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQ 5138

Query: 56   RSSNIPAGDSVPEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIF 115
              + I         VEK + V   E D       V G  +  + W ++ G  I  S    
Sbjct: 5139 EPAQI---------VEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKD-GKQIVPSRYFS 5188

Query: 116  YDSINKEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMD-FKKMLKKRA 174
                N     +++ +   DS  Y     ND              G    D + ++L +  
Sbjct: 5189 MSFENNVASFRIQSVMKQDSGQYTFKVENDF-------------GSSSCDAYLRVLDQNI 5235

Query: 175  PPAPKKKQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLK------EMKKK 228
            PP+  KK  K+  +K +   +    K           F D + +    K      E    
Sbjct: 5236 PPSFTKKLTKM--DKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHERSVS 5293

Query: 229  VEVEAIRILKPLEDKETKVDTTVVFDC---IMELKDPNVKMIW----------------- 268
            +EV  +  L+   +   KV      D    I+ +K+P   ++                  
Sbjct: 5294 LEVNNLE-LEDTANYTCKVSNVAGDDACSGILTVKEPPSFLVKPGRQQAIPDSTVEFKAI 5352

Query: 269  IKGTEPLRIQYSLGKYDVKQM----------GTKYMLVISNVNMNDAGIYSLSVGDKRMS 318
            +KGT P +I++   K DV+ +          G+   L + +V+ +  G Y+  V +   S
Sbjct: 5353 LKGTPPFKIKWF--KDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGS 5410

Query: 319  AELTVL---DEPLKFLGEMKPVKVTER-QTAVFEIRLS-KKEPNFVWKFNGKELKRDDKY 373
               T +    EP KF+ +++  K+ +   ++  E +++   E   VW  N  EL   DKY
Sbjct: 5411 DSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKY 5470

Query: 374  EITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLT---IDRIPIKFVSNLKNVRV 430
             +T  +      +++ +    DSG+F  EA N       +   I + P  F S    V  
Sbjct: 5471 RMTFIDS--VAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVET 5528

Query: 431  KERSRACLECELT-SKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYT 489
             + +   LECEL+ +    + W KD + L    KY +  +     + I +   SD GEY 
Sbjct: 5529 LKNAEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYH 5588

Query: 490  VVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDEKVEGV-WLK 548
              A  +        T  +    R     S ++ +    G PAEL   +   +   V WLK
Sbjct: 5589 CKAQNEVGSDTCVCTVKLKEPPRFV---SKLNSLTVVAGEPAELQASIEGAQPIFVQWLK 5645

Query: 549  DGKE-ITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGT----ESEASVFIADPPT 603
            + +E I +   ++I     V  L F    P + GKY  + K      E+ A++ + +P  
Sbjct: 5646 EKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAV 5705

Query: 604  IDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQA 663
            I         A  +TV VG T  ++    G P   V WYKDG  +T  ++         +
Sbjct: 5706 IVEK------AGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKIS 5759

Query: 664  LLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSG----SCVH 719
             L I +  R+D+G    +++N+ G ++ T  + V DR  PP          G    SC+ 
Sbjct: 5760 SLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCI- 5818

Query: 720  MKWKAPKDNGGRPVT-QFIVERRAV--GKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRI 776
                  K  G  P++  +  E+  +  G K      +    V     N ++      +  
Sbjct: 5819 ---LECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSD---NVCTLQLNSLDSSDMGNYTC 5872

Query: 777  LAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTK-EAVTITWNAPTQDGGAPVLG 835
            +A N  G SD  E   V      EPP F  +P+  +V   + VT T              
Sbjct: 5873 VAANVAG-SD--ECRAVLTVQ--EPPSFVKEPEPLEVLPGKNVTFT-------------- 5913

Query: 836  YIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQ------PSV 889
             ++         W    ++ ++G +C +    EDT  E  +  ++ +  G+       + 
Sbjct: 5914 SVIRGTPPFKVNWFRGARELVKGDRCNI--YFEDTVAELELFNIDISQSGEYTCVVSNNA 5971

Query: 890  PSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSK 949
              +S   +  VK P          S     S+       G  P     +    +     K
Sbjct: 5972 GQASCTTRLFVKEPAAFLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEK 6031

Query: 950  CTKIPISGTC-YTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSA 1008
            C  +    TC   +    +R    +     NEAG      L   V  + PP         
Sbjct: 6032 CNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGAL---VSTLEPP------YFV 6082

Query: 1009 RLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGV---PTKGRETITKSKNHSQFLINST 1065
                 +    G ++ +    +G+P   V W K      PT    T   + N +  + N  
Sbjct: 6083 TELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYF-TNNVATLVFNKV 6141

Query: 1066 KRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEV------PNTVTLTWNHS 1119
              +DSG Y    +N  G A      R+ +   PP+  R  +++      P T+T   N S
Sbjct: 6142 NINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGS 6201

Query: 1120 PDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSE 1179
              +Q       ++++ D +  T +   + V + K   T L    +Y            S 
Sbjct: 6202 APIQVCWYRDGVLLRDDENLQTSF--VDNVATLKILQTDLSHSGQY--------SCSASN 6251

Query: 1180 PLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGN 1239
            PL +  +           SA+L   E K    +P F        V+ G+     C   G 
Sbjct: 6252 PLGTASS-----------SARLTAREPK---KSPFFDIKPVSIDVIAGESADFECHVTGA 6297

Query: 1240 PRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCT 1299
                +T  K +  I     +          L I      DSG Y+    N++GKD  S  
Sbjct: 6298 QPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQ 6357

Query: 1300 LTVYD------KDDKSVVASITESLQKKSK 1323
            L+V +      K + S VA   ES+Q + K
Sbjct: 6358 LSVKEPPKFVKKLEASKVAKQGESIQLECK 6387



 Score =  147 bits (371), Expect = 7e-35
 Identities = 156/631 (24%), Positives = 257/631 (40%), Gaps = 77/631 (12%)

Query: 702   KPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNF 761
             KP   RV   + + + V + W  P+D GG  VT +++E + V +  W K      K+  +
Sbjct: 30035 KPQNPRVT--DTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREY 30092

Query: 762   STNKVEEGKAYQFRILAVNSEGVSDPLETE-EVFAGNPIEPPGFASQPQVTD--VTKEAV 818
             +   + +G  Y+FR+LA N+ G  +P E    V     +E P +    +  +    ++  
Sbjct: 30093 TLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQGG 30152

Query: 819   TITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVN--------KDPIQGTKCTVDGLLEDT 870
              I    P +    P+  +  E +       +  +        K+  +G   T D +LE  
Sbjct: 30153 VIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTELVIKEADRGDSGTYDLVLE-- 30210

Query: 871   EYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE-- 928
                      NK G  + +V     V   P  P G    L   D    S+ ++WR PA+  
Sbjct: 30211 ---------NKCG--KKAVYIKVRVIGSPNSPEG---PLEYDDIQVRSVRVSWRPPADDG 30256

Query: 929   GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVE 988
             G    GYILE R      W       + GT   V GL E  +Y FR+ A N+ G+ +P++
Sbjct: 30257 GADILGYILERREVPKAAWYTIDS-RVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLK 30315

Query: 989   LDKGVRAMPP--PAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQK-DGVPT 1045
              ++ V    P  P  P  +    L    V ++  +L      S S P D    +  G   
Sbjct: 30316 SEEPVTPKTPLNPPEPPSNPPEVLD---VTKSSVSL------SWSRPKDDGGSRVTGYYI 30366

Query: 1046  KGRETIT-KSKNHSQFLINSTKRSDSGV-------YRILLQNEFGEARYD------IHVR 1091
             + +ET T K   H++  I +T  + +G+       +RI+ QN+ G +         +   
Sbjct: 30367 ERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKD 30426

Query: 1092  VADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA-HYIIMKRDASTATWYTA-AERV 1149
               D P  P  L +     ++VTL W   P+     E   Y +  R +  + W  +  ER+
Sbjct: 30427 PFDKPSQPGELEILSISKDSVTLQWE-KPECDGGKEILGYWVEYRQSGDSAWKKSNKERI 30485

Query: 1150  FSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDW 1209
                ++T+ GLL   +Y FRV A NE G S P          +     +  KL   E    
Sbjct: 30486 KDKQFTIGGLLEATEYEFRVFAENETGLSRP----------RRTAMSIKTKLTSGE---- 30531

Query: 1210  RHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCT 1269
               AP     +K  T   G+   ++C  +G P P +  Y+    +  + K+  +S     T
Sbjct: 30532 --APGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHT 30589

Query: 1270  LVIPTCTLKDSGDYSVLVENELGKDRSSCTL 1300
             L + T   +D G Y+ +  NE+G+  +S  L
Sbjct: 30590 LTVMTEEQEDEGVYTCIATNEVGEVETSSKL 30620



 Score =  147 bits (370), Expect = 9e-35
 Identities = 238/1124 (21%), Positives = 420/1124 (37%), Gaps = 171/1124 (15%)

Query: 270  KGTEPLRIQYSLGKYDVKQMGTKYM--------LVISNVNMNDAGIYSLSV----GDKRM 317
            +G+ PL I++  G  ++   G+ Y+        L +  V  +D+G Y+  V    G    
Sbjct: 4230 QGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVEC 4289

Query: 318  SAELTVLDEPLKFLGEMKPVKVTERQTAV-FEIRLSKKEP-NFVWKFNGKELKRDDKYEI 375
            SA L V  EP  F+ +++P ++ ++  A     +++   P    W  N +E+K   K+ +
Sbjct: 4290 SANLFV-KEPATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRM 4348

Query: 376  TVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQK---AQLTIDRIPIKFVSNLKNVRVKE 432
            +  E   T  L++ D  + DSGE+  EA N       + + I +    F    K + V +
Sbjct: 4349 SFVES--TAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKPIEVLK 4406

Query: 433  RSRACLECELT-SKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVV 491
                 L  E+  +    + W KD  +L  G KY    +     L I     +D GEY   
Sbjct: 4407 EYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCR 4466

Query: 492  AMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDEKVEGVWLKDGK 551
               +   +    +A VT+ E  + +K   S      G+ A    +     +   WLKD  
Sbjct: 4467 VTNEVGSS--ICSARVTLREPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSD 4524

Query: 552  EITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTES----EASVFIADPPTIDPS 607
            EIT+   +++  +  V  L    +  +H+GKY  +AK         A + + +P TI   
Sbjct: 4525 EITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEE 4584

Query: 608  VLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTI 667
             +      +I V  G  A ++V F G       W+KDG E+T   +  +   +  ++L I
Sbjct: 4585 AV------SIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKI 4638

Query: 668  SNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLE---LSGSCVHMKWKA 724
             +  ++DSG    +++ND G ++    ++VLD   PP    +  +   + GS + ++   
Sbjct: 4639 ISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIV 4698

Query: 725  PKDNGGRPVT-QFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEG 783
                G  P++ Q+  + + +      K    D        +++E   +  +   A N  G
Sbjct: 4699 A---GSHPISIQWFKDDQEISASEKYKFSFHD-NTAFLEISQLEGTDSGTYTCSATNKAG 4754

Query: 784  ---VSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVER 840
                S  L  +        EPP F  +PQ  DV     T         G AP+       
Sbjct: 4755 HNQCSGHLTVK--------EPPYFVEKPQSQDVNPN--TRVQLKALVGGTAPM------- 4797

Query: 841  RKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQ----------PSVP 890
                +  W   NK+   G   +V    +DT     + A      G            +  
Sbjct: 4798 ----TIKWFKDNKELHSGAARSV--WKDDTSTSLELFAAKATDSGTYICQLSNDVGTATS 4851

Query: 891  SSSVVAKDP---VKPPGLVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEW 947
             +++  K+P   +K P  V  L    S+     +       G P      ++R     + 
Sbjct: 4852 KATLFVKEPPQFIKKPSPVLVLRNGQSTTFECQIT------GTP------KIRVSWYLDG 4899

Query: 948  SKCTKIPISG-------TCYTVGGLIERQKYFFRIRAVNEAGVGE-PVELDKGVRAMPPP 999
            ++ T I   G         + + G        +   A N+AG     +EL    +   PP
Sbjct: 4900 NEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIEL----KVKEPP 4955

Query: 1000 AAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQ 1059
                      LK   VV+  + + +    +G+PP +V W K+    +  +  T +   S 
Sbjct: 4956 T-----FIRELKPVEVVKY-SDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSV 5009

Query: 1060 FLINSTK--RSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNT------ 1111
            F ++ TK   SD+G Y+ ++ NE G       V + +   PP+ ++  E           
Sbjct: 5010 FNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKE---PPSFIKKIENTTTVLKSSAT 5066

Query: 1112 ----------VTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTGLLP 1161
                      +++TW     + ++ +  YI    D+       + +   S +YT      
Sbjct: 5067 FQSTVAGSPPISITWLKDDQILDEDDNVYISFV-DSVATLQIRSVDNGHSGRYTCQ---- 5121

Query: 1162 GRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKP 1221
                     A+NE G    ++    +L+ ++  Q                    V   K 
Sbjct: 5122 ---------AKNESG----VERCYAFLLVQEPAQ-------------------IVEKAKS 5149

Query: 1222 HTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSG 1281
              V      T+ C   G P   V   K    I  +  F  +  + V +  I +   +DSG
Sbjct: 5150 VDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSG 5209

Query: 1282 DYSVLVENELGKDRSSCTLTVYDKDDKSVVASITESLQKKSKHL 1325
             Y+  VEN+ G       L V    D+++  S T+ L K  K L
Sbjct: 5210 QYTFKVENDFGSSSCDAYLRVL---DQNIPPSFTKKLTKMDKVL 5250



 Score =  146 bits (368), Expect = 1e-34
 Identities = 152/685 (22%), Positives = 274/685 (40%), Gaps = 60/685 (8%)

Query: 68    EFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKL 127
             +F    + VT PE  +A F   +   A  ++ W +   I IK S K    +  K+H+L +
Sbjct: 11487 DFAVPLKDVTVPERRQARFECVLTREA--NVIWSKGPDI-IKSSDKFDIIADGKKHILVI 11543

Query: 128   EPLTSDDSDNYKCIASNDHADAIYTVSLL------------VTEGQEKMDFKKMLKKRAP 175
                  DD   Y          A   V+ +            V EG+      ++  ++  
Sbjct: 11544 NDSQFDDEGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVKEGETATFVCELSHEKMH 11603

Query: 176   PAPKKKQKKVANEKEML-EILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVEVEAI 234
                 K   K+   + +L     K  K + ++V ++    D   +  ++KE+    +++ +
Sbjct: 11604 VVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLD----DISQIKAQVKELSSTAQLKVL 11659

Query: 235   R----ILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMG 290
                      L DK       +   C +  KD  VK  W K  E +       KY +K  G
Sbjct: 11660 EADPYFTVKLHDKTAVEKDEITLKCEVS-KDVPVK--WFKDGEEI---VPSPKYSIKADG 11713

Query: 291   TKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIR 350
              + +L I   ++ D G Y    G  +  A +TV    +K    +  V+V   +TA FEI 
Sbjct: 11714 LRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIE 11773

Query: 351   LSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKA 410
             LS+ + +  WK  G+ L      EI   EDG  H L + + +L  +GE S +A N    A
Sbjct: 11774 LSEPDVHGQWKLKGQPLTASPDCEII--EDGKKHILILHNCQLGMTGEVSFQAANAKSAA 11831

Query: 411   QLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEG 470
              L +  +P+ F++ L +V+V E+  A  ECE++ +  T RW K  Q +    ++ +  +G
Sbjct: 11832 NLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDG 11891

Query: 471   KRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSP 530
              +  ++I+ A   D  +Y   A       + +++  + +E       + + DV A     
Sbjct: 11892 TKHSMVIKSAAFEDEAKYMFEA------EDKHTSGKLIIEGIRLKFLTPLKDVTAKEKES 11945

Query: 531   AELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGT 590
             A   V L+ + +   W K+ + +     + +  +G  H + F  +  +   +    A G 
Sbjct: 11946 AVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGM 12005

Query: 591   ESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTE 650
              SEA + + +    DP     L  +    K       ++     P   V W+KDG E+  
Sbjct: 12006 SSEAKLTVLEG---DPYFTGKLQDYTGVEKDEVILQCEISKADAP---VKWFKDGKEIKP 12059

Query: 651   EERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRP---KPPQGR 707
              +   ++    + +L +   ++ D G    +   D G+   +  L + DR      P   
Sbjct: 12060 SKNAVIKADGKKRMLILKKALKSDIG----QYTCDCGTDKTSGKLDIEDREIKLVRPLHS 12115

Query: 708   VEFL---------ELSGSCVHMKWK 723
             VE +         E+S   +H  WK
Sbjct: 12116 VEVMETETARFETEISEDDIHANWK 12140



 Score =  143 bits (361), Expect = 1e-33
 Identities = 192/826 (23%), Positives = 330/826 (39%), Gaps = 134/826 (16%)

Query: 67   PEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESA-KIFYDSINKEHVL 125
            P+ V  P+PV   EG+ A FR RV G  +P ++W     +  K    ++ YD I   H L
Sbjct: 1841 PDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGI---HYL 1897

Query: 126  KLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPK------ 179
             +    S D+   K  A N      + V L   E Q++ DF+ +L++   P P+      
Sbjct: 1898 DIVDCKSYDTGEVKVTAENPEGVIEHKVKL---EIQQREDFRSVLRRAPEPRPEFHVHEP 1954

Query: 180  -------------------------KKQKKVANEK---EMLEILSKVPKKDFEKVCMEYG 211
                                     K+ +++ +EK   E  E+ SK  ++  E       
Sbjct: 1955 GKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAIT 2014

Query: 212  FTDFRGLLR--KLKEMKKKVEVEAIRILKPLEDKETK----------------------- 246
              + +   +    +E+ +K + E +   K L ++E K                       
Sbjct: 2015 AVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPS 2074

Query: 247  VDTTVVFDCIME---------------LKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGT 291
            ++   +F+ I                 +  P+ +  W K    ++I+ S   Y       
Sbjct: 2075 MEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNG--VKIERSDRIYWYWPEDN 2132

Query: 292  KYMLVISNVNMNDAGIYSLSV----GDKRMSAELTVLDEPL-KFLGEMKPVKVTERQT-A 345
               LVI +V   D+    +      G+    A L V  + L  F  E++ V   E+ T A
Sbjct: 2133 VCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMA 2192

Query: 346  VFEIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSA---E 402
             FE   S+      W  +G E+   DKY +    D   H L I     SD+ ++S    E
Sbjct: 2193 TFECETSEPFVKVKWYKDGMEVHEGDKYRM--HSDRKVHFLSILTIDTSDAEDYSCVLVE 2250

Query: 403  AGNLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGT 462
              N+   A+L ++   ++FV  L+++ V E     LEC ++ +++  +W  +   L    
Sbjct: 2251 DENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNG 2310

Query: 463  KYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSD 522
            KY++     R  L ++D    D GEY+ V   DG  T    T  + ++ R   +  G+SD
Sbjct: 2311 KYTITSRRGRQNLTVKDVTKEDQGEYSFVI--DGKKT----TCKLKMKPRPIAILQGLSD 2364

Query: 523  VHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGK 582
                 G   +L V ++ E VEGVW+KDG+E+     + IV     H L+   M  E  G 
Sbjct: 2365 QKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGN 2424

Query: 583  YTFR----AKGTESEASVFIAD--PPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPL 636
            Y+F        T    SV+  D   P  D +V+E         K      + VP     +
Sbjct: 2425 YSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEG-------TKAVLECKVSVP----DV 2473

Query: 637  PKVTWYKDGMEVTEEERV-SMERGEDQALLTISNCVREDSG---LILLKLKNDHGSATAT 692
              V WY +  ++  ++RV ++ +G  Q L+ I+     D G   LI+ +++ +   +   
Sbjct: 2474 TSVKWYLNDEQIKPDDRVQAIVKGTKQRLV-INRTHASDEGPYKLIVGRVETNCNLSVEK 2532

Query: 693  LHL--SVLDRPKPPQGRVEF-LELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWI 749
            + +   + D        V F +ELS S + + W   KD   +P +++ +E      K  +
Sbjct: 2533 IKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNF-KDKEIKPSSKYKIEAHGKIYKLTV 2591

Query: 750  --KIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEV 793
               + + +GK T ++   +  GK      L V    +S PL  + V
Sbjct: 2592 LNMMKDDEGKYTFYAGENMTSGK------LTVAGGAISKPLTDQTV 2631



 Score =  143 bits (360), Expect = 1e-33
 Identities = 157/639 (24%), Positives = 271/639 (42%), Gaps = 54/639 (8%)

Query: 701   PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTN 760
             P  P GR E + ++ + V +KWK P  +GG  +T +IVE++ +    W+K    +   T 
Sbjct: 24602 PCDPPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETE 24661

Query: 761   FSTNKVEEGKAYQFRILAVNSEG-VSDPLETE-EVFAGNPIEPPGFASQPQVTDVTKEAV 818
             F+ + + E + Y+FR++A N+ G  S+P ++   + A + I+ P  +  P+  DV     
Sbjct: 24662 FTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHA 24721

Query: 819   TITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLED---TEYEFR 875
               T+       G P+   +    K G  L     +  I+ T      +++D   T+    
Sbjct: 24722 GETFVLEADIRGKPIPDVVWS--KDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQY 24779

Query: 876   VIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPS 933
             ++ ++  G G  S+P +  V   P  P G    L V+  +     LAW  P +  G   S
Sbjct: 24780 ILKLSNVG-GTKSIPITVKVLDRPGPPEG---PLKVTGVTAEKCYLAWNPPLQDGGANIS 24835

Query: 934   GYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGV 993
              YI+E R      W++ +   +    Y V  L+   +Y FR+ AVN+ G+GEP+E     
Sbjct: 24836 HYIIEKRETSRLSWTQVST-EVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESGPVT 24894

Query: 994   RAMP-----PPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQK-DGVPTKG 1047
                P     PP+ P  ++SA  K  MVV     +       G+     I +K D    + 
Sbjct: 24895 ACNPYKPPGPPSTP--EVSAITKDSMVVTWARPV----DDGGTEIEGYILEKRDKEGVRW 24948

Query: 1048  RETITKSKNHSQFLINSTKRSDSGVYRILLQNEFG---EARYDIHVRVADF---PRPPTN 1101
              +   K+    +  +       S  +R+  +N  G    +   +  R  D    P PP+N
Sbjct: 24949 TKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSN 25008

Query: 1102  LRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTAAER--VFSNKYTVT 1157
              ++ +   ++V+L W  S  + + G     Y++  ++A+   W T      +   ++TVT
Sbjct: 25009 PKVTDTSRSSVSLAW--SKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTVT 25066

Query: 1158  GLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVT 1217
              L    +Y FR+ A N  G  EP     + ++ +++I+    +L    +K        V 
Sbjct: 25067 KLKENTEYNFRICAINSEGVGEPATLPGS-VVAQERIEPPEIELDADLRK--------VV 25117

Query: 1218  PLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTL 1277
              L+    LR     +     G P P V   K +  +T  ++     TS    LVI   T 
Sbjct: 25118 VLRASATLR-----LFVTIKGRPEPEVKWEKAEGILTDRAQI--EVTSSFTMLVIDNVTR 25170

Query: 1278  KDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASITE 1316
              DSG Y++ +EN  G   +   + V D     V  +I E
Sbjct: 25171 FDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIRE 25209



 Score =  141 bits (356), Expect = 4e-33
 Identities = 163/756 (21%), Positives = 295/756 (39%), Gaps = 74/756 (9%)

Query: 581   GKYTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVT 640
             GKYT   +   S AS+ +       P     +    +T K        VP      P   
Sbjct: 26253 GKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVT-KESAVLSWDVPENDGGAPVKN 26311

Query: 641   WYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHG---SATATLHLSV 697
             ++ +  E +++  VS+    ++    ++N          +  +N+ G    A     + +
Sbjct: 26312 YHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVKI 26371

Query: 698   LDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGK 757
              ++P PP+ ++    +S   V + W  P+ +GG  +  ++VE    G+K+W+K      K
Sbjct: 26372 TEKPSPPE-KLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKCAVA--K 26428

Query: 758   VTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETE-EVFAGNPIEPPGFASQ--PQVTDVT 814
              T+   + + E   Y FR+ A N  G+SDP E    V     +EPP    +  P  T   
Sbjct: 26429 STHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYV 26488

Query: 815   KEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYE- 873
             +    +  + P    G P+    + R        VP+       T+ T + L  + +   
Sbjct: 26489 RAGSNLKVDIPIS--GKPLPKVTLSRDG------VPLKATMRFNTEITAENLTINLKESV 26540

Query: 874   ------FRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA 927
                   + + A N +G  +  +  + VV   P  P G V    +SD +  S++L W  P 
Sbjct: 26541 TADAGRYEITAANSSGTTKAFI--NIVVLDRPGPPTGPVV---ISDITEESVTLKWEPPK 26595

Query: 928   E--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGE 985
                G   + YIL  R   T  W++ +   ++ T   V  L   ++Y FRI+A N  G+ +
Sbjct: 26596 YDGGSQVTNYILLKRETSTAVWTEVSAT-VARTMMKVMKLTTGEEYQFRIKAENRFGISD 26654

Query: 986   PVELDKGVRAMP-----PPAAPKFDLSAR----LKSHMVVRAGTALCIHAAFSGSPPPDV 1036
              ++       +P     PP+ P      R    +  H  V  G +  +           +
Sbjct: 26655 HIDSACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSI 26714

Query: 1037  IWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIH---VRVA 1093
             +WQK        + + ++   + F + +        +R+  +N  G  +       V   
Sbjct: 26715 LWQK------ANKLVIRT---THFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAI 26765

Query: 1094  DFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAA-ERVFSN 1152
             D   PP N+R+ +   N+V+L+W             YI+ +RD     W  A+   V   
Sbjct: 26766 DACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTET 26825

Query: 1153  KYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHA 1212
             ++ ++GL    +Y FRV ARN +G                 I + S  + P    D    
Sbjct: 26826 QFIISGLTQNSQYEFRVFARNAVGS----------------ISNPSEVVGPITCIDSYGG 26869

Query: 1213  PRFVTPLKPHTVLR---GQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCT 1269
             P    PL+   V++   G    +     G P PT+  YK D  +  N+     +T+ + +
Sbjct: 26870 PVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLAS 26929

Query: 1270  LVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDK 1305
             ++I      +SG Y + + N +G   ++  + + DK
Sbjct: 26930 ILIKDADRLNSGCYELKLRNAMGSASATIRVQILDK 26965



 Score =  141 bits (355), Expect = 5e-33
 Identities = 259/1145 (22%), Positives = 436/1145 (38%), Gaps = 157/1145 (13%)

Query: 231  VEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGK-YDVKQM 289
            ++    +K LE  ++ ++  V  +C ++ +D  V + W K  + L      GK Y +   
Sbjct: 3641 IDKPHFIKELEPVQSAINKKVHLECQVD-EDRKVTVTWSKDGQKL----PPGKDYKICFE 3695

Query: 290  GTKYMLVISNVNMNDAGIY----SLSVGDKRMSAELTVLDEPLKFLGEMKP-VKVTERQT 344
                 L I    + D+G Y    S   G    SA +TV  EP  F+ ++ P   +   ++
Sbjct: 3696 DKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVR-EPPSFVKKVDPSYLMLPGES 3754

Query: 345  AVFEIRLSKKEP--NFVWKFNGKELKRDDKYEIT-VSEDGLTHTLKIKDARLSDSGEFSA 401
            A    +L K  P     W  N KEL   +   +  V+ + +   L I D ++ DSG +S 
Sbjct: 3755 ARLHCKL-KGSPVIQVTWFKNNKELSESNTVRMYFVNSEAI---LDITDVKVEDSGSYSC 3810

Query: 402  EAGNLVQKAQLTIDRI---PIKFVSNLKNVRVKERSRACLECELTSKD-VTLRWKKDGQL 457
            EA N V     + + +   P  F+  L+   +   + A L+CE++      + W KD + 
Sbjct: 3811 EAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQ 3870

Query: 458  LMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVK 517
            +    KY +  +     L I     +D GEY  V   +       +T ++   +   T  
Sbjct: 3871 IRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLL---KEPPTFV 3927

Query: 518  SGMSDVHAATGSPAEL-CVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMG 576
              + D+ A  G    L   V   E +   W+K  + I +   +++     V  LI P + 
Sbjct: 3928 KKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQ 3987

Query: 577  PEHEGKYTFRAK---GTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRG 633
                GKYT  A+   G+++     I   P     ++E   A  I V  G  A ++    G
Sbjct: 3988 ISFGGKYTCLAENEAGSQTSVGELIVKEPA---KIIER--AELIQVTAGDPATLEYTVAG 4042

Query: 634  KPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATL 693
             P  K  WYKDG  +   ++  +    + A L   +    DSG    ++ N+ GS++   
Sbjct: 4043 TPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCET 4102

Query: 694  HLSVLDRP-----KPPQGRVEFLELSGSCVHMKWKAPKDNGGRPV-TQFIVERRAVGKKS 747
              +VLDR        P   V+ + ++G+C  +  K     G  P+   +  + + +    
Sbjct: 4103 TFTVLDRDIAPFFTKPLRNVDSV-VNGTC-RLDCKIA---GSLPMRVSWFKDGKEIAASD 4157

Query: 748  WIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQ 807
              +I  V+G   +    +V+   A  F   A NS G  D      V      EPP F ++
Sbjct: 4158 RYRIAFVEG-TASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIV-----QEPPSFVTK 4211

Query: 808  PQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLL 867
            P   DV   +        T  G  P+           +  W   NK+ + G  C +    
Sbjct: 4212 PGSKDVLPGSAVCL--KSTFQGSTPL-----------TIRWFKGNKELVSGGSCYITKEA 4258

Query: 868  EDTEYEFRVIAVNKAGPGQPSVP--------SSSVVAKDPVKPPGLVQDLHVSDSSNSSI 919
             ++  E  ++  + +G     V         S+++  K+P      V+ L  S       
Sbjct: 4259 LESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPAT---FVEKLEPSQLLKKGD 4315

Query: 920  SLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTC---YTVGGLIERQKYFFRIR 976
            +        G PP          + KE SK     +  T     T  G+ +  +Y     
Sbjct: 4316 ATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYM--CE 4373

Query: 977  AVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDV 1036
            A NEAG      +   +    P    +F     LK + V+       + A  +G+PP ++
Sbjct: 4374 AQNEAGSDHCSSI--VIVKESPYFTKEFKPIEVLKEYDVM-------LLAEVAGTPPFEI 4424

Query: 1037 IWQKDG-VPTKGRETITKSKNHSQFL-INSTKRSDSGVYRILLQNEFGEARYDIHVRVAD 1094
             W KD  +   GR+  T  ++H   L I     +D+G Y+  + NE G +     V + +
Sbjct: 4425 TWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLRE 4484

Query: 1095 FPRPPTNLRLFEEVPN----------------TVTLTW-NHSPDVQEDGEAHYIIMKRDA 1137
               PP+ ++  E   +                 +T+TW   S ++ ED     I M  + 
Sbjct: 4485 ---PPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDN---IRMTFEN 4538

Query: 1138 STATWYTAAERV-FSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQD 1196
            + A+ Y +   V    KY                A+N+ G                 IQ 
Sbjct: 4539 NVASLYLSGIEVKHDGKYVCQ-------------AKNDAG-----------------IQR 4568

Query: 1197 LSAKLKPYEKKDWRHAPRFVT-PLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITA 1255
             SA L   E       P  +T       V +G   T+   F G    T   +K    +T 
Sbjct: 4569 CSALLSVKE-------PATITEEAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTL 4621

Query: 1256 NSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASIT 1315
             SK+  + T  V  L I +   KDSG+Y+  V+N++G  RSSC   + +  D  +  S T
Sbjct: 4622 GSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVG--RSSCKARI-NVLDLIIPPSFT 4678

Query: 1316 ESLQK 1320
            + L+K
Sbjct: 4679 KKLKK 4683



 Score =  140 bits (353), Expect = 8e-33
 Identities = 280/1344 (20%), Positives = 494/1344 (36%), Gaps = 191/1344 (14%)

Query: 67   PEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLK 126
            P FVEKPQ        +   +A V G A   I W +++      +A+  +   +    L+
Sbjct: 4768 PYFVEKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKD-DTSTSLE 4826

Query: 127  LEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPP---------- 176
            L    + DS  Y C  SND   A    +L V E  +       +KK +P           
Sbjct: 4827 LFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQ------FIKKPSPVLVLRNGQSTT 4880

Query: 177  -------APKKK-------QKKVANEKEMLEILSKVPKKDFEKVCMEYGFT------DFR 216
                    PK +        +  A +K  +  +  +         +E   T      +  
Sbjct: 4881 FECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDA 4940

Query: 217  GLLRKLKEMKKKVEVEAIRILKPLE-----DKETKVDTTVVFDCIMELKDPNVKMIWIKG 271
            G      E+K K     IR LKP+E     D E + + T           P  ++ W+K 
Sbjct: 4941 GTASCSIELKVKEPPTFIRELKPVEVVKYSDVELECEVTGT---------PPFEVTWLKN 4991

Query: 272  TEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTV---LDEPL 328
               +R   S  KY +    + + L I+  + +D G Y   V ++  S   +    L EP 
Sbjct: 4992 NREIR---SSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPP 5048

Query: 329  KFLGEMKPVKVTERQTAVFEIRLSKKEP-NFVWKFNGKELKRDDKYEITVSEDGLTHTLK 387
             F+ +++      + +A F+  ++   P +  W  + + L  DD   I+  +     TL+
Sbjct: 5049 SFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDS--VATLQ 5106

Query: 388  IKDARLSDSGEFSAEAGN---LVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELT- 443
            I+      SG ++ +A N   + +     + + P + V   K+V V E+    LEC +  
Sbjct: 5107 IRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIVEKAKSVDVTEKDPMTLECVVAG 5166

Query: 444  SKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYS 503
            + ++ ++W KDG+ ++    +SM+ E   A   I+     D G+YT     D   +   +
Sbjct: 5167 TPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDA 5226

Query: 504  TAIVTVEERLATVKSGMSDVHAATGSPAEL-CVVLNDEKVEGVWLKDGKEITDLPGMQIV 562
               V  +    +    ++ +    GS   + C V     +   W KDGKEI+     ++V
Sbjct: 5227 YLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLV 5286

Query: 563  KQGAVHKLIFPSMGPEHEGKYTFRAKGTESEAS----VFIADPPT--IDPSVLEALAAHA 616
                   L   ++  E    YT +      + +    + + +PP+  + P   +A+    
Sbjct: 5287 CHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLVKPGRQQAIP--- 5343

Query: 617  ITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSG 676
                   T   K   +G P  K+ W+KD +E+    +  +      + L + +     +G
Sbjct: 5344 -----DSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTG 5398

Query: 677  LILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELS-----GSCVHMKWKAPKDNGGR 731
                 + ND GS + T  L V + PK     V+ LE S     G    ++ K      G 
Sbjct: 5399 QYTCHVTNDVGSDSCTTMLLVTEPPK----FVKKLEASKIVKAGDSSRLECKI----AGS 5450

Query: 732  PVTQFIVERRA--VGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLE 789
            P  + +  R    +      ++  +D  V     N +    +  F   A N  G S    
Sbjct: 5451 PEIRVVWFRNEHELPASDKYRMTFIDS-VAVIQMNNLSTEDSGDFICEAQNPAG-STSCS 5508

Query: 790  TEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAP---VLGYIVERRKKGSN 846
            T+ +      EPP F+S P + +  K A     +   +  G P   V+ Y  +R+ + S 
Sbjct: 5509 TKVIVK----EPPVFSSFPPIVETLKNAEV---SLECELSGTPPFEVVWYKDKRQLRSSK 5561

Query: 847  LWVPVNKDPIQGTKCTVDGLLEDTEY--EFRVIAVNKAGPGQPSVPSSSVVAKDPVK-PP 903
             +   +K+       ++  L  DT    E+   A N+ G       S + V    +K PP
Sbjct: 5562 KYKIASKN----FHTSIHILNVDTSDIGEYHCKAQNEVG-------SDTCVCTVKLKEPP 5610

Query: 904  GLVQDLHVSDSSNSSISLAWREPAE------GDPPSGYILEMRAEDTKEWSKCTKIPISG 957
              V  L+       S+++   EPAE      G  P         E+    S+  +I    
Sbjct: 5611 RFVSKLN-------SLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVE 5663

Query: 958  TCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRA-MPPPAAPKFDLSARLKSHMVV 1016
               T+         F +    N       ++ D G+R  M      +  +       M V
Sbjct: 5664 NVATL--------QFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTV 5715

Query: 1017 RAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNH--------SQFLINSTKRS 1068
              G    +    +G+P   V W KDG      + +T S+ H        S   I S +R 
Sbjct: 5716 TVGETCTLECKVAGTPELSVEWYKDG------KLLTSSQKHKFSFYNKISSLRILSVERQ 5769

Query: 1069 DSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA 1128
            D+G Y   +QN  G++     V V+D   PP+  R  +     +             G +
Sbjct: 5770 DAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVL-------------GAS 5816

Query: 1129 HYIIMKRDAST---ATWYTAAERVFSN-KYTVTGLLPGRKYYFRVVARNEIG--DSEPLD 1182
              +  K   S+     W+    ++ S  KY  T        +   V   ++   DS  + 
Sbjct: 5817 CILECKVAGSSPISVAWFHEKTKIVSGAKYQTT--------FSDNVCTLQLNSLDSSDMG 5868

Query: 1183 SRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRP 1242
            +      N     +  A L   E       P FV   +P  VL G++ T T    G P  
Sbjct: 5869 NYTCVAANVAGSDECRAVLTVQEP------PSFVKEPEPLEVLPGKNVTFTSVIRGTPPF 5922

Query: 1243 TVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTV 1302
             V  ++G   +    +        V  L +    +  SG+Y+ +V N  G  ++SCT  +
Sbjct: 5923 KVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAG--QASCTTRL 5980

Query: 1303 YDKDDKSVVASITESLQKKSKHLM 1326
            + K+  + +  +++   +  K ++
Sbjct: 5981 FVKEPAAFLKRLSDHSVEPGKSII 6004



 Score =  139 bits (349), Expect = 2e-32
 Identities = 190/815 (23%), Positives = 305/815 (37%), Gaps = 84/815 (10%)

Query: 528   GSPAELCVVLNDEKVEGV-WLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFR 586
             G P  L  ++       V W K G +     G Q+     +  L+ P+   +  GKY+  
Sbjct: 18621 GCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKG-QVDLVDTMAFLVIPNSTRDDSGKYSLT 18679

Query: 587   AKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGM 646
                   E +VF+       P  +  L    +T    H +    P       +VT Y   +
Sbjct: 18680 LVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSW--APPENDGGSQVTHYI--V 18735

Query: 647   EVTEEERVSMERGEDQALLT---ISNCVREDSGLILLKLKNDHGSATAT------LHLSV 697
             E  E +R +      +   T   ++N V  +     +   N++G    T      L    
Sbjct: 18736 EKREADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDP 18795

Query: 698   LDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKS--WIKIGEVD 755
             L  P PP+ ++E  E++ +   + W  P  +GG  +  +I   R   + +  W +   V 
Sbjct: 18796 LSEPDPPR-KLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYSVV- 18853

Query: 756   GKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVF-AGNPIEPPGFASQPQVTDVT 814
              K  +     ++EGK Y+FR+ A N+ GVS P E E V+ A   + PP      Q+T   
Sbjct: 18854 -KDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQIT--I 18910

Query: 815   KEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEF 874
             K    +   A       P   +     +  ++  + V+K          D   +D+ Y +
Sbjct: 18911 KAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGY-Y 18969

Query: 875   RVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPP 932
              + A N +G     +    + A  P +PP       +SD    + SL+W  P E  G   
Sbjct: 18970 SLTAENSSGTDTQKIKVVVMDAPGPPQPP-----FDISDIDADACSLSWHIPLEDGGSNI 19024

Query: 933   SGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKG 992
             + YI+E       +W          +C  VG LI  Q+Y FR+RA N  G+ EP+   K 
Sbjct: 19025 TNYIVEKCDVSRGDWVTALASVTKTSC-RVGKLIPGQEYIFRVRAENRFGISEPLTSPKM 19083

Query: 993   VRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETIT 1052
             V   P      F + +  K+  V +     CI  A+     PD      G P  G     
Sbjct: 19084 VAQFP------FGVPSEPKNARVTKVNKD-CIFVAWDR---PD---SDGGSPIIGYLIER 19130

Query: 1053  KSKNH------SQFLINSTKRSDSGV-------YRILLQNEFGEA---RYDIHVRVADFP 1096
             K +N       +  L+ ST+   +G+       +RI   N+ G +   +   +V      
Sbjct: 19131 KERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPV 19190

Query: 1097  RPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWY---TAAERVFSNK 1153
              PP    + +   +TV+L W             Y +         W    TA  ++   +
Sbjct: 19191 DPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEE 19250

Query: 1154  YTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQ---DLSAKLKPYEKKDWR 1210
             YT TGL    +Y FR +AR  +  S P +  D   I  + +    DLS  +K        
Sbjct: 19251 YTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLL----- 19305

Query: 1211  HAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTL 1270
                         TV  G +  +     G P PTV+  K    +             +CTL
Sbjct: 19306 ------------TVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTL 19353

Query: 1271  VIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDK 1305
              + +   KDSGDY++  EN  G   ++  L V DK
Sbjct: 19354 ELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDK 19388



 Score =  137 bits (346), Expect = 5e-32
 Identities = 219/998 (21%), Positives = 382/998 (38%), Gaps = 131/998 (13%)

Query: 262   PNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSV----GDKRM 317
             P  K+ W K    + I   + K  V  + T   LVI N   +D+G YSL++    G+K +
Sbjct: 18634 PAPKVTWRK----VGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAV 18689

Query: 318   SAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVWKFNGKELKRDDKYEITV 377
                + VLD P   + ++K   VT+    V          + V  +  ++ + D K   TV
Sbjct: 18690 FVNVRVLDTPGP-VSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTV 18748

Query: 378   SEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPIKFVSNLKNVRVKERSRAC 437
             + +    +  + +    +   F   A N       T    P+     L      +  R  
Sbjct: 18749 TPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPLSE---PDPPRKL 18805

Query: 438   LECELTSKDVTLRW---KKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQ 494
                E+T    TL W    +DG   + G   S   E + A+   E + + D     V  ++
Sbjct: 18806 EVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYSVVKD-LSLVVTGLK 18864

Query: 495   DGDPTEYYSTA--------------IVTVEERL----------ATVKSGMS---DVHAAT 527
             +G   ++   A              +   +E+L           T+K+G     + H   
Sbjct: 18865 EGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAH-VY 18923

Query: 528   GSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRA 587
             G P   C           W K   E+     + + K  +   LI   +  +  G Y+  A
Sbjct: 18924 GKPHPTC----------KWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTA 18973

Query: 588   K---GTESE---ASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTW 641
             +   GT+++     V  A  P   P  +  + A A ++    + HI +   G  +    +
Sbjct: 18974 ENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSL----SWHIPLEDGGSNI--TNY 19027

Query: 642   YKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHG-SATATLHLSVLDR 700
               +  +V+  + V+      +    +   +     +  ++ +N  G S   T    V   
Sbjct: 19028 IVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMVAQF 19087

Query: 701   P-----KPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVD 755
             P     +P   RV   +++  C+ + W  P  +GG P+  +++ER+      W+K  +  
Sbjct: 19088 PFGVPSEPKNARV--TKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVKANDTL 19145

Query: 756   GKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLE-TEEVFAGNPIEPPGFASQPQVTDVT 814
              + T +    + EG  Y FRI A+N  G S P + TE V A  P++PPG   +P+V DVT
Sbjct: 19146 VRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPG---KPEVIDVT 19202

Query: 815   KEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDP--IQGTKCTVDGLLEDTEY 872
             K  V++ W  P  DGG+ ++GY VE  K   + WV  N  P  I   + T  GL E  +Y
Sbjct: 19203 KSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQY 19262

Query: 873   EFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSI------------- 919
             +FR IA        PS PS  V       PP +  DL V+  S  ++             
Sbjct: 19263 QFRAIARTAVNISPPSEPSDPVTILAENVPPRI--DLSVAMKSLLTVKAGTNVCLDATVF 19320

Query: 920   -----SLAWR------EPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIER 968
                  +++W+      +PAEG      +   R   T E     +        T       
Sbjct: 19321 GKPMPTVSWKKDGTLLKPAEGIK----MAMQRNLCTLELFSVNRKDSGDYTITAENSSGS 19376

Query: 969   QKYFFRIRAVNEAGVGEPVELDK--GVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHA 1026
             +    +++ +++ G    V+++K    RAM     P  D  + + +++V +  T+    A
Sbjct: 19377 KSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWA 19436

Query: 1027  AFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARY 1086
               S + P         + +   E + +   + QF I +  +   G   +  +    +  Y
Sbjct: 19437 QVSATVP---------ITSCSVEKLIEGHEY-QFRICAENKYGVG-DPVFTEPAIAKNPY 19485

Query: 1087  DIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAA 1146
             D   R      PP    + ++    +T++W    D        Y++ KR+     W    
Sbjct: 19486 DPPGRC----DPPVISNITKD---HMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVN 19538

Query: 1147  ER-VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
              + +       TGL  G +Y FRV A N+ G  +P D+
Sbjct: 19539 RKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDA 19576



 Score =  137 bits (344), Expect = 9e-32
 Identities = 160/649 (24%), Positives = 257/649 (39%), Gaps = 75/649 (11%)

Query: 690   TATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWI 749
             T  L ++ +DRP  P+  +   +   + V++KW+ P  +GG P   + VERR  G   W 
Sbjct: 18090 TPILAINPIDRPGEPEN-LHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWE 18148

Query: 750   KIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQ 809
             ++ +   K T++  ++  E + Y+FR+   N  G SD ++TEEV     ++ P    +  
Sbjct: 18149 RVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLS 18208

Query: 810   VTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDP-IQGTKCTVDGLLE 868
                  K   TI   A  +    P + +  ++          V  D     +K ++     
Sbjct: 18209 GVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKR 18268

Query: 869   DTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE 928
                 ++ V A N AG     V  ++V   D    PG V++L + D S+   ++ W  P +
Sbjct: 18269 SDGGKYVVTATNTAGS---FVAYATVNVLDK---PGPVRNLKIVDVSSDRCTVCWDPPED 18322

Query: 929   --GDPPSGYILEMRAEDTKEWSKCTKIPIS-GTCYTVGGLIERQKYFFRIRAVNEAGVGE 985
               G     YILE        WS  +   ++ GT  TV  LIE  +Y FR+RA N+ G G 
Sbjct: 18323 DGGCEIQNYILEKCETKRMVWSTYSATVLTPGT--TVTRLIEGNEYIFRVRAENKIGTGP 18380

Query: 986   PVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPT 1045
             P E      + P  A  K+D   R     V +             +PP     + DG  +
Sbjct: 18381 PTE------SKPVIAKTKYDKPGRPDPPEVTKVSKE---EMTVVWNPP-----EYDGGKS 18426

Query: 1046  KGRETITKSKNHSQFLINSTKRS--------------DSGVYRILLQNEFGEARYDIHVR 1091
                  + K + HS   +   K +                  +R+  +NE G     +  R
Sbjct: 18427 ITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSR 18486

Query: 1092  VA------DFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH---YIIMKR----DAS 1138
                     + P PPTN R+ +   +++TL W        DG A    Y++  R    DAS
Sbjct: 18487 PVVAKDPIEPPGPPTNFRVVDTTKHSITLGWGKPV---YDGGAPIIGYVVEMRPKIADAS 18543

Query: 1139  TATWY---TAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQ 1195
                 +    AA ++   ++TVT L   ++Y FRV A+N++G   P               
Sbjct: 18544 PDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRP--------------A 18589

Query: 1196  DLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITA 1255
             +L   +KP E  +        +  K   V  G    +     G P P VT  K  ++   
Sbjct: 18590 ELKEAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVV 18649

Query: 1256  NSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYD 1304
               K   +    +  LVIP  T  DSG YS+ + N  G+      + V D
Sbjct: 18650 R-KGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLD 18697



 Score =  135 bits (341), Expect = 2e-31
 Identities = 152/639 (23%), Positives = 252/639 (39%), Gaps = 77/639 (12%)

Query: 712   ELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKA 771
             +++ + + +KW  PKDNG  P+  + +E+R V    W ++ +        + + + EG  
Sbjct: 14913 DVTSNSMLVKWNEPKDNGS-PILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLT 14971

Query: 772   YQFRILAVNSEG---VSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQD 828
             Y FR+ A N+ G    S P + +   A +PI PPG    P+VTD +   + + W  P  +
Sbjct: 14972 YVFRVCAENAAGPGKFSPPSDPKT--AHDPISPPG-PPIPRVTDTSSTTIELEWEPPAFN 15028

Query: 829   GGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPS 888
             GG  ++GY V+++  G+N W    +  I+  + TV  + E  +Y+ RV AVN AG G P 
Sbjct: 15029 GGGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPG 15088

Query: 889   VPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWS 948
                   VA +P +PP +  D+ V            R PA        ++  R   TK W+
Sbjct: 15089 ETQPVTVA-EPQEPPAVELDVSVKGGIQIMAGKTLRIPA--------VVTGRPVPTKVWT 15139

Query: 949   KCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPP-------AA 1001
             K             G L + +     +   +E  + + +  D G   +          AA
Sbjct: 15140 K-----------EEGELDKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAA 15188

Query: 1002  PK---FDLSARLKSHMVVRAGTALCIHAAFSGSPPPD---------VIWQKDGVPTKGRE 1049
              +   FD+   +     V     +C+    + S P D         +I +KD      R+
Sbjct: 15189 ARVEVFDVPGPVLDLKPVVTNRKMCL---LNWSDPEDDGGSEITGFIIERKDAKMHTWRQ 15245

Query: 1050  TITKSKNHSQFLINSTKRSDSGVYRILLQNEFG-----EARYDIHVRVADFPRPPTNLRL 1104
              I   ++     I          +R++ +N+FG     E    + V     P  P  L  
Sbjct: 15246 PIETERSKCD--ITGLLEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLTY 15303

Query: 1105  FEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVF-SNKYTVTGLLPGR 1163
              E   +T+TL W             YII KR      +    +R+  +  + V  L   +
Sbjct: 15304 TERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQ 15363

Query: 1164  KYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHT 1223
              Y FRV A NEIG+SEP  S    ++ +D     + KL+   + D               
Sbjct: 15364 MYEFRVKAVNEIGESEP--SLPLNVVIQDDEVPPTIKLRLSVRGD------------TIK 15409

Query: 1224  VLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANS------KFWYNSTSGVCTLVIPTCTL 1277
             V  G+   +     G P P +   K +  I   +      K   + +     L IP    
Sbjct: 15410 VKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVR 15469

Query: 1278  KDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASITE 1316
             +D G Y+V   N LG    +  + VYD+       ++T+
Sbjct: 15470 EDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTD 15508



 Score =  135 bits (339), Expect = 3e-31
 Identities = 264/1312 (20%), Positives = 494/1312 (37%), Gaps = 133/1312 (10%)

Query: 67   PEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLK 126
            P FV+K   ++   G +   +  ++G     + W ++ G  ++ES  I+         L+
Sbjct: 7492 PRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIATLQ 7551

Query: 127  LEPLTSDDSDNYKCIASNDHA--DAIYTVSLL----VTEGQEKMDFKK----MLKKRAPP 176
               +   ++  Y C   ND    +   T+S+L    + E  E +         L+     
Sbjct: 7552 FSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPESIKVTTGDTCTLECTVAG 7611

Query: 177  APKKKQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVEVEAIRI 236
             P+   K   + KE+    +K     F KV            L+ +        V +  +
Sbjct: 7612 TPELSTKWFKDGKELTSD-NKYKISFFNKVSG----------LKIINVAPSDSGVYSFEV 7660

Query: 237  LKPLEDKETKV-----DTTVVFDCIMELKDPN-------VKMIWIKGTEPLRIQY----- 279
              P+            D TV      +LK+ N       V    + G+ P+ + +     
Sbjct: 7661 QNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGN 7720

Query: 280  ---SLGKYDVKQMGTKYMLVISNVNMNDAGIYSL----SVGDKRMSAELTVLDEPLKFLG 332
               S  KY          L ++ +  +D+G Y+       G    SA LTV  EP  F+ 
Sbjct: 7721 EISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVR-EPPSFVQ 7779

Query: 333  EMKPVKVTERQTAVFEIRLSKKEPNFVWKFNGK-ELKRDDKYEITVSEDGLTHTLKIKDA 391
            +  P+ V       F   +    P  V  F G  EL   D+  +++ ED +   L++ D 
Sbjct: 7780 KPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSL-EDSVAE-LELFDV 7837

Query: 392  RLSDSGEFSAEAGNLVQKAQLTID---RIPIKFVSNLKNVRVKERSRACLECELT-SKDV 447
              S SGE++    N   KA  T     + P KFV  L +  +++     LE   T +  +
Sbjct: 7838 DTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPI 7897

Query: 448  TLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIV 507
            ++ WKK+G  +    + ++    K A L I  + + D G+Y    +++    +  S  I+
Sbjct: 7898 SVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCY-IENASGKDSCSAQIL 7956

Query: 508  TVEERLATVKSGMSDVHAATGSPAEL-CVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGA 566
             +E      +  +  V  + G  A L C +    ++   W K   ++      ++  +  
Sbjct: 7957 ILEPPYFVKQ--LEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNN 8014

Query: 567  VHKLIFPSMGPEHEGKYTFRAKGTESE--ASVFIA-DPPTIDPSVLEALAAHAITVKVGH 623
            V  L+F  +     G+Y  +A+ +  E  AS F+      + PS    L    +   VG 
Sbjct: 8015 VATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQL--RDVQETVGL 8072

Query: 624  TAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLK 683
                     G     V+WYKDG  + +   V     ++ A L I    R  +G       
Sbjct: 8073 PVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTAT 8132

Query: 684  NDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPV-TQFIVERRA 742
            N  GSA+++  L + +   PP   +    +               G +P+   +  + R 
Sbjct: 8133 NPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSRE 8192

Query: 743  VGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPP 802
            +      +I  ++    + +  KV++G + Q+   AVN  G      T ++     + PP
Sbjct: 8193 IRSGGKYQISYLENSA-HLTVLKVDKGDSGQYTCYAVNEVGKDSC--TAQLNIKERLIPP 8249

Query: 803  GFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSN----LWVPVNKDPIQG 858
             F  +  +++  +E           +G +    + +E R  GS      W   N +    
Sbjct: 8250 SFTKR--LSETVEET----------EGNS----FKLEGRVAGSQPITVAWYKNNIEIQPT 8293

Query: 859  TKCTVDGLLEDTEYEFRVIAVNKAG--------PGQPSVPSSSVVAKDPVKPPGLVQDLH 910
            + C +         + R   +N AG            ++ +SS+V K+P KPP   Q L 
Sbjct: 8294 SNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKKPPVFDQHLT 8353

Query: 911  -VSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYT-VGGLIER 968
             V+ S    + L+     +G  P          + K   +C+    SGT    +  + + 
Sbjct: 8354 PVTVSEGEYVQLSCH--VQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKA 8411

Query: 969  QKYFFRIRAVNEAGVGEPVELDKGVRAMPP--PAAPKFDLSARL------KSHMVVRAGT 1020
                +  +A N AG  +  +    ++  P   PA  K  +  RL      +S  VV   T
Sbjct: 8412 DSGDYVCKASNVAG-SDTTKSKVTIKDKPAVAPATKKAAVDGRLFFVSEPQSIRVVEKTT 8470

Query: 1021 ALCIHAAFSGSPPPDVIWQKDG---VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILL 1077
            A  I A   G P P+V W K     +   GR  I +  + ++  I  T ++DSG+YR + 
Sbjct: 8471 ATFI-AKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVA 8529

Query: 1078 QNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQ----EDGEAHYIIM 1133
             NE GE   +++++V +  +        E++   +      +P ++    E+ E   + +
Sbjct: 8530 FNEHGEIESNVNLQVDERKKQ-------EKIEGDLRAMLKKTPILKKGAGEEEEIDIMEL 8582

Query: 1134 KRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQ 1193
             ++     +       ++  Y +T    G    F ++ +++  ++  L+  +     +D+
Sbjct: 8583 LKNVDPKEY-----EKYARMYGITD-FRGLLQAFELLKQSQEEETHRLEIEEIERSERDE 8636

Query: 1194 IQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAF-LGNPRPTVTLYKGDVN 1252
             +         ++         +  ++  TVL+  D        +  P   ++ YKG   
Sbjct: 8637 KEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDAVFEIDIKINYPEIKLSWYKGTEK 8696

Query: 1253 ITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYD 1304
            +  + KF  +      TL +  C LKD G+Y ++     G   +S  LTV +
Sbjct: 8697 LEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLV----CGPHIASAKLTVIE 8744



 Score =  130 bits (328), Expect = 6e-30
 Identities = 172/696 (24%), Positives = 279/696 (40%), Gaps = 100/696 (14%)

Query: 67   PEFVEKPQPV-TAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVL 125
            P+FV+K +    A +G+      ++ G+ +  +SW R     + ES K     IN   +L
Sbjct: 6364 PKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDS-ELHESWKYNMSFINSVALL 6422

Query: 126  KLEPLTSDDSDNYKCIASNDHADAIYTVSLLV------TEGQEKMDFKK----MLKKRAP 175
             +   +++DS +Y C A N   DA  + +L V      T+    +   K    +L+    
Sbjct: 6423 TINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEIS 6482

Query: 176  PAPK------KKQKKVANEKEMLEILSKVPKKDFE------------------KVCMEYG 211
              P       K +K+V N K+      K+  K F+                  K   E G
Sbjct: 6483 GTPPFEVVWVKDRKQVRNSKKF-----KITSKHFDTSLHILNLEASDVGEYHCKATNEVG 6537

Query: 212  FTDFRGLLRKLKEMKKKVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKG 271
             +D      K KE          R +K L D  T +   V    I+E   P + ++W+K 
Sbjct: 6538 -SDTCSCSVKFKEPP--------RFVKKLSDTSTLIGDAVELRAIVEGFQP-ISVVWLKD 6587

Query: 272  -------TEPLRIQY-------SLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSVGDKRM 317
                   +E  RI +        LG  +    G KY+  I N    DAG+       +  
Sbjct: 6588 RGEVIRESENTRISFIDNIATLQLGSPEASNSG-KYICQIKN----DAGM-------REC 6635

Query: 318  SAELTVLDEPLKFLGEMKPVKVTERQTAVFE-IRLSKKEPNFVWKFNGKELKRDDKYEIT 376
            SA LTVL EP + + + +P+ VT       E +     E +  W  +G+EL  D K+ IT
Sbjct: 6636 SAVLTVL-EPARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHIT 6694

Query: 377  VSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTI-----DRI-PIKFVSNLKNVRV 430
                    +LKI  A +SD G +S E  N V K+  T+     DRI P  F+  LK+V  
Sbjct: 6695 FINK--VASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNA 6752

Query: 431  KERSRACLECELT-SKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYT 489
               +   LEC ++ S  +++ W +DG  ++ G K   +       L +   + SD G YT
Sbjct: 6753 ILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYT 6812

Query: 490  VVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDEKVEGVWLKD 549
             VA       E   +A++TV+E  +  ++  S       S     V+      +  W K 
Sbjct: 6813 CVAANVAGSDE--CSAVLTVQEPPSFEQTPDSVEVLPGMSLTFTSVIRGTPPFKVKWFKG 6870

Query: 550  GKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEAS----VFIADPPTID 605
             +E+       I  +  V +L    + P   G Y+         AS    +F+ +P T  
Sbjct: 6871 SRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFV 6930

Query: 606  PSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALL 665
              + +       +V+ G    ++  + G P   V+W KD   +++ ER S+   E   +L
Sbjct: 6931 KRLAD------FSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTIL 6984

Query: 666  TISNCVREDSGLILLKLKNDHGSATATLHLSVLDRP 701
             I     ED       ++N+ G       +SVL+ P
Sbjct: 6985 EILESTIEDYAQYSCLIENEAGQDICEALVSVLEPP 7020



 Score =  130 bits (328), Expect = 6e-30
 Identities = 143/631 (22%), Positives = 251/631 (39%), Gaps = 64/631 (10%)

Query: 701   PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTN 760
             P  P G  ++++++   + +KW  P  +GG  +  + +E+R  G + W++    D     
Sbjct: 27854 PVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVGYSIEKRQ-GNERWVRCNFTDVSECQ 27912

Query: 761   FSTNKVEEGKAYQFRILAVNSEGVSDPLETEE--VFAGNPIEPPGFASQPQVTD--VTKE 816
             ++   +  G  Y+FRI+A N+ G   P       +   +   PP     P+  D  + K 
Sbjct: 27913 YTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKS 27972

Query: 817   AVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRV 876
               ++   A  Q    P + +  +  +    + + +  D +  T   V     D    + V
Sbjct: 27973 GESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEIT-DVLGSTSLFVRDATRDHRGVYTV 28031

Query: 877   IAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAEGD--PPSG 934
              A N +G  +  +    V  +D   P  +V  +  ++ +   ++L W  P      P + 
Sbjct: 28032 EAKNASGSAKAEI---KVKVQDT--PGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITH 28086

Query: 935   YILEMRAEDTKEWS----KCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELD 990
             YI+E R      W+    KC         YT   LI   +Y FR+ AVN+ GVG P++ D
Sbjct: 28087 YIIEKRETSRLAWALIEDKC-----EAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSD 28141

Query: 991   KGVRAMP--PPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQK-DGVPTKG 1047
               V  +    P AP     + +  + +           +  GS     I ++ +   T+ 
Sbjct: 28142 PVVAQIQYTVPDAPGIPEPSNITGNSITLTWAR---PESDGGSEIQQYILERREKKSTRW 28198

Query: 1048  RETITKSK-NHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRV------ADFPRPPT 1100
              + I+K   + ++F +      +   + ++ +N  G        R+       + P PPT
Sbjct: 28199 VKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPT 28258

Query: 1101  NLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTA-AERVFSNKYTVT 1157
              +++ +    TV+L W  S  V + G     YII    A    W+   AE     +YTVT
Sbjct: 28259 VVKVTDTSKTTVSLEW--SKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVT 28316

Query: 1158  GLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQ----DLSAKLKPYEKKDWRHAP 1213
              L  G +Y FRV A N  G  +  +   T +   D++     D+ A  K           
Sbjct: 28317 DLQAGEEYKFRVSAINGAGKGDSCEVTGT-IKAVDRLTAPELDIDANFK----------- 28364

Query: 1214  RFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIP 1273
                   + H V  G    +  A+ G P PT    K D N++  +    ++T    TL + 
Sbjct: 28365 ------QTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADI--HTTDSFSTLTVE 28416

Query: 1274  TCTLKDSGDYSVLVENELGKDRSSCTLTVYD 1304
              C   D+G Y++ VEN  G    + T+ V D
Sbjct: 28417 NCNRNDAGKYTLTVENNSGSKSITFTVKVLD 28447



 Score =  130 bits (327), Expect = 8e-30
 Identities = 192/809 (23%), Positives = 309/809 (38%), Gaps = 115/809 (14%)

Query: 546   WLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTID 605
             W K   EI D   + +    +   L+  ++     GKYT   + +    S F+       
Sbjct: 22976 WGKVDGEIRDAAIIDVTS--SFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDT 23033

Query: 606   PSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTW----YKDGMEVTEEERVSMERGED 661
             PS    L    IT               K    +TW       G ++        E    
Sbjct: 23034 PSPPVNLKVTEIT---------------KDSVSITWEPPLLDGGSKIKNYIVEKREATRK 23078

Query: 662   QALLTISNCVRED----------SGLILLKLKNDHG---SATATLHLSVLDRPKPPQGRV 708
                  ++NC +            S    +  +N++G    A     + V + P+PP G++
Sbjct: 23079 SYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPP-GKI 23137

Query: 709   EFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEE 768
                +++ + V + W  P+ +GG  + Q+IVE +A   + W +   V  K        + +
Sbjct: 23138 TVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARV--KSLQAVITNLTQ 23195

Query: 769   GKAYQFRILAVNSEGVSDP--LETEEVFAGNPIEP---PGFASQP-QVTDVTKEAV---- 818
             G+ Y FR++AVN +G SDP  L    V     IEP   P F+S   QV    K  V    
Sbjct: 23196 GEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISG 23255

Query: 819   ----TITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEF 874
                 TITW   T+DG  P+        K+ + + V    D +  T  ++    +D   ++
Sbjct: 23256 RPKPTITW---TKDG-LPL--------KQTTRINVT---DSLDLTTLSIKETHKDDGGQY 23300

Query: 875   RVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREP--AEGDPP 932
              +   N  G    S+   ++   DP K P     +   D S  SI+L+W  P    G   
Sbjct: 23301 GITVANVVGQKTASIEIVTLDKPDPPKGP-----VKFDDVSAESITLSWNPPLYTGGCQI 23355

Query: 933   SGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKG 992
             + YI++ R   T  W       ++ T   V  L    +Y FRI A N  G    +E D  
Sbjct: 23356 TNYIVQKRDTTTTVWD-VVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPI 23414

Query: 993   VRAMP-----PPAAPKFDLSAR----LKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGV 1043
             V   P     PP  P     ++    ++ H  V  G +  I           ++W     
Sbjct: 23415 VAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILW----- 23469

Query: 1044  PTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQN--EFGEARYDIHVRVADFP-RPPT 1100
              TK  +TI    + +QF   + +      +R+  +N    G+A  +    VA  P  PP 
Sbjct: 23470 -TKVNKTII---HDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPG 23525

Query: 1101  NLRLFEEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTATWYTAA-ERVFSNKYTVT 1157
                      N +TL W  +  V + G     YI+ KRD     W  A+   V   ++TV+
Sbjct: 23526 TPEPIMVKRNEITLQW--TKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVS 23583

Query: 1158  GLLPGRKYYFRVVARNEIGD-SEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFV 1216
             GL   ++Y FRV+A+N  G  S+P DS    +  KD+++       P    D    P+F 
Sbjct: 23584 GLTEDQRYEFRVIAKNAAGAISKPSDSTGP-ITAKDEVE------LPRISMD----PKFR 23632

Query: 1217  TPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCT 1276
               +    V  G+   +     G P PT+   +GD  I  +++    +T     L++    
Sbjct: 23633 DTI---VVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAI 23689

Query: 1277  LKDSGDYSVLVENELGKDRSSCTLTVYDK 1305
               D G Y +   N  G       + V D+
Sbjct: 23690 RIDGGQYILRASNVAGSKSFPVNVKVLDR 23718



 Score =  130 bits (326), Expect = 1e-29
 Identities = 117/443 (26%), Positives = 200/443 (45%), Gaps = 28/443 (6%)

Query: 228  KVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVK 287
            K+ V    I KPL D+        VF+C  E+ +P+ K  W++  + L +  ++     +
Sbjct: 2614 KLTVAGGAISKPLTDQTVAESQEAVFEC--EVANPDSKGEWLRDGKHLPLTNNIRS---E 2668

Query: 288  QMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVF 347
              G K  L+I+   ++D G Y+  V   + SA+L V  E +K    +K + VTE Q AVF
Sbjct: 2669 SDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKV--EAVKIKKTLKNLTVTETQDAVF 2726

Query: 348  EIRLSKKEPNFV-WKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNL 406
             + L+      V W  NG  L+ ++KY I+V   G  ++L+IK+  + D   +    G L
Sbjct: 2727 TVELTHPNVKGVQWIKNGVVLESNEKYAISVK--GTIYSLRIKNCAIVDESVYGFRLGRL 2784

Query: 407  VQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSM 466
               A+L ++ +  K +   K+V   E +    E  ++   V ++W      +    K+ +
Sbjct: 2785 GASARLHVETV--KIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRL 2842

Query: 467  NHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAA 526
              E K  +L++++   SD GEYT V  Q     E  +   V   E L   K+ M ++   
Sbjct: 2843 VSERKVHKLMLQNISPSDAGEYTAVVGQ----LECKAKLFV---ETLHITKT-MKNIEVP 2894

Query: 527  TGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFR 586
                A     ++   V  +WLK+G EI      +IV QG +H+LI  +   E   +YTF 
Sbjct: 2895 ETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFV 2954

Query: 587  AKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGM 646
                +  A++ +   P +  S+L+ + A     K   T  + V + G       W K+G+
Sbjct: 2955 CGNDQVSATLTVT--PIMITSMLKDINAEE---KDTITFEVTVNYEG---ISYKWLKNGV 3006

Query: 647  EVTEEERVSMERGEDQALLTISN 669
            E+   ++  M   +    L I N
Sbjct: 3007 EIKSTDKCQMRTKKLTHSLNIRN 3029



 Score =  130 bits (326), Expect = 1e-29
 Identities = 162/646 (25%), Positives = 269/646 (41%), Gaps = 69/646 (10%)

Query: 701   PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTN 760
             P  P GR E + ++ + V ++WK P  +GG  +T +IVE++ + +  W+K    +   T+
Sbjct: 22438 PCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASFTNIIDTH 22497

Query: 761   FSTNKVEEGKAYQFRILAVNSEGV-SDPLE-TEEVFAGNPIEPPGFASQPQVTD--VTKE 816
             F    + E   Y+FR++A N+ GV S+P E T  + A + ++PP  +  P+  D  V   
Sbjct: 22498 FEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVVHA 22557

Query: 817   AVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRV 876
               +   +A       P + +I   ++  +   + +       +    D +  D+      
Sbjct: 22558 GESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSG---NY 22614

Query: 877   IAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSG 934
             I   K   G+ SV  +  V   P  P G V    +S  +    +LAW+ P +  G     
Sbjct: 22615 ILKAKNVAGERSVTVNVKVLDRPGPPEGPVV---ISGVTAEKCTLAWKPPLQDGGSDIIN 22671

Query: 935   YILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVR 994
             YI+E R      W+       + +C  V  L+E  +Y FRI AVN+ GVGEP+E +  V 
Sbjct: 22672 YIVERRETSRLVWTVVDANVQTLSC-KVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVA 22730

Query: 995   AMP--PPAAPKF-DLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETI 1051
               P   P APK  +++   K  M+V         A+  GS     + +K     + +E I
Sbjct: 22731 KNPFVVPDAPKAPEVTTVTKDSMIVVWERP----ASDGGSEILGYVLEK-----RDKEGI 22781

Query: 1052  TKSKNHSQFLINSTKRSDSGV-------YRILLQNEFG------EARYDIHVRVADFPRP 1098
               ++ H + LI   +   +G+       +R+  +N  G       + Y         P P
Sbjct: 22782 RWTRCHKR-LIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGP 22840

Query: 1099  PTNLRLFEEVPNTVTLTWNHSPDVQEDG--EAHYIIMKRDASTATWYTAAERVFSNKYT- 1155
             P N ++ +   ++V L+W  S  + + G     YI+ K D S   W         NK   
Sbjct: 22841 PNNPKVIDITRSSVFLSW--SKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNI 22898

Query: 1156  -VTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQ----DLSAKLKPYEKKDWR 1210
              V  LL   +Y FR+ A N+ G  E  D     +I +++++    DL  +L+        
Sbjct: 22899 EVEKLLEKHEYNFRICAINKAGVGEHADVPGP-IIVEEKLEAPDIDLDLELRKIINIRAG 22957

Query: 1211  HAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTL 1270
              + R   P+K                 G P P V   K D  I   +    + TS   +L
Sbjct: 22958 GSLRLFVPIK-----------------GRPTPEVKWGKVDGEIRDAAII--DVTSSFTSL 22998

Query: 1271  VIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASITE 1316
             V+      DSG Y++ +EN  G   +  T+ V D     V   +TE
Sbjct: 22999 VLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTE 23044



 Score =  129 bits (324), Expect = 2e-29
 Identities = 180/796 (22%), Positives = 290/796 (36%), Gaps = 82/796 (10%)

Query: 543   EGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPP 602
             E  W ++  E TD   +QI K     +L   +      GKY  + + +    S F+    
Sbjct: 24055 EITWSREEGEFTDK--VQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKV 24112

Query: 603   TIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQ 662
                P   + LA   +               G    K  +  D  E T +   ++     +
Sbjct: 24113 LDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVK-NYVIDKRESTRKAYANVSSKCSK 24171

Query: 663   ALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQ--GRVEFLELSGSCVHM 720
                 + N          +  +N+ G       +  +   +PP   G+V   ++S +   +
Sbjct: 24172 TSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASL 24231

Query: 721   KWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVN 780
              W+ P+ +GG  V  ++VE +  G + W  + E   KV N     +  G+ YQFR+ A N
Sbjct: 24232 MWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAE--SKVCNAVVTGLSSGQEYQFRVKAYN 24289

Query: 781   SEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGA------PVL 834
              +G SDP        G P+       QP        ++ + +N  +   G       PV+
Sbjct: 24290 EKGKSDPR-----VLGVPVIAKDLTIQP--------SLKLPFNTYSIQAGEDLKIEIPVI 24336

Query: 835   GYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEY-----------EFRVIAVNKAG 883
             G     R + +  WV   +   Q T+  V+     T             ++ V A N AG
Sbjct: 24337 G-----RPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAG 24391

Query: 884   PGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRA 941
                 ++  S +V + P  P G V+     + S   + ++W  PA   G   S YI+E R 
Sbjct: 24392 TATENL--SVIVLEKPGPPVGPVR---FDEVSADFVVISWEPPAYTGGCQISNYIVEKRD 24446

Query: 942   EDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMP---- 997
               T  W   +   ++ T   +  L    +Y FRI A N  G   P++    +   P    
Sbjct: 24447 TTTTTWHMVSAT-VARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEP 24505

Query: 998   -PPAAPKFDLSAR----LKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETIT 1052
              PP  P     ++    ++ H  V  G    I           ++W K    T  ++T  
Sbjct: 24506 GPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLN-KTPIQDTKF 24564

Query: 1053  KSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTV 1112
             K+    + L    K S   +  I   ++  E          D   PP          N V
Sbjct: 24565 KTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFV-----ARDPCDPPGRPEAIVITRNNV 24619

Query: 1113  TLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAA-ERVFSNKYTVTGLLPGRKYYFRVVA 1171
             TL W             YI+ K+D     W  A+   V   ++TV+GL+  ++Y FRV+A
Sbjct: 24620 TLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIA 24679

Query: 1172  RNEIGD-SEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDC 1230
             RN  G+ SEP DS    +  +D+I   +A L P  K                 V  G+  
Sbjct: 24680 RNAAGNFSEPSDSSGA-ITARDEIDAPNASLDPKYK-------------DVIVVHAGETF 24725

Query: 1231  TMTCAFLGNPRPTVTLYKGDVNITAN-SKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVEN 1289
              +     G P P V   K    +    ++    ST    TLV+  C   D G Y + + N
Sbjct: 24726 VLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSN 24785

Query: 1290  ELGKDRSSCTLTVYDK 1305
               G      T+ V D+
Sbjct: 24786 VGGTKSIPITVKVLDR 24801



 Score =  123 bits (309), Expect = 1e-27
 Identities = 159/650 (24%), Positives = 271/650 (41%), Gaps = 64/650 (9%)

Query: 693   LHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIG 752
             L +  L  P  P+ R+ + E + S + + WK P+ NGG P+  +I+E+R   K  + ++ 
Sbjct: 15287 LAVDPLGPPTSPE-RLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVN 15345

Query: 753   EVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVT- 811
             +     T+F    ++E + Y+FR+ AVN  G S+P     V   +   PP    +  V  
Sbjct: 15346 KRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRG 15405

Query: 812   DVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVP-----VNKDPIQG----TKCT 862
             D  K       + P    G P+    +E  K  + +  P     + K+ +      T+ +
Sbjct: 15406 DTIKVKAGEPVHIPADVTGLPMPK--IEWSKNETVIEKPTDALQITKEEVSRSEAKTELS 15463

Query: 863   VDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLA 922
             +   + + +  + V A N+ G    +V    V   D   PP   ++L V+D    S  L 
Sbjct: 15464 IPKAVREDKGTYTVTASNRLGSVFRNV---HVEVYDRPSPP---RNLAVTDIKAESCYLT 15517

Query: 923   WREPAE--GDPPSGYILEMRAEDTK--EWSKCTKIPISGTCYTVGGLIERQKYFFRIRAV 978
             W  P +  G   + Y+++ R    K  EW + T   +    Y +  LI   +Y FR+RAV
Sbjct: 15518 WDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKR-YGIWKLIPNGQYEFRVRAV 15576

Query: 979   NEAGVGEPVELDKGVRAMP-----PPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPP 1033
             N+ G+ +  + DK V   P     PP  PK  + AR K  M+V     L      +G  P
Sbjct: 15577 NKYGISDECKSDKVVIQDPYRLPGPPGKPK--VLARTKGSMLVSWTPPLD-----NGGSP 15629

Query: 1034  PDVIW---QKDGVP---TKGRETITK-SKNHSQFLINSTKRSDSGVYRILLQNEFG---- 1082
                 W   +++G P      R  ITK      +F +          +R +  N  G    
Sbjct: 15630 ITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPP 15689

Query: 1083  EARYDIHVRVADF--PRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDAS 1138
                 D  V       P PP+   + ++  ++++L W   P  ++ G     YI+  ++  
Sbjct: 15690 SEPSDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWK--PPAKDGGSPIKGYIVEMQEEG 15747

Query: 1139  TATWYTAAER---VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQ 1195
             T  W    E    + + +  V  L   RKY FRV A NE G+SEP D+  T  I    IQ
Sbjct: 15748 TTDWKRVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDT--TGEIPATDIQ 15805

Query: 1196  DLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTC-AFLGNPRPTVTLYKGDVNIT 1254
             +          +D     +  + ++   V++G+    +   F G  +  +     D+   
Sbjct: 15806 EEPEVFIDIGAQDCLVC-KAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPED 15864

Query: 1255  ANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYD 1304
             A  +   NS+     ++IP C    +G YS+  +N+ G+  ++C + V D
Sbjct: 15865 AQLETAENSS----VIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMD 15910



 Score =  123 bits (308), Expect = 1e-27
 Identities = 280/1305 (21%), Positives = 461/1305 (35%), Gaps = 147/1305 (11%)

Query: 67   PEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISW-KRESGIPIKESAKIFYDSINKEHVL 125
            P FV + +P+ A  GD    + +V G  +  +SW K ++ +      + ++   N    L
Sbjct: 6079 PYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFT--NNVATL 6136

Query: 126  KLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAP----PAPKKK 181
                +  +DS  Y C A N    A       + E Q    F + LK        P     
Sbjct: 6137 VFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTC 6196

Query: 182  QKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVEVEAIRILKPLE 241
            +   +   ++      V  +D E   ++  F D    L+ L+         +     PL 
Sbjct: 6197 RLNGSAPIQVCWYRDGVLLRDDEN--LQTSFVDNVATLKILQTDLSHSGQYSCSASNPLG 6254

Query: 242  DKETKVDTTV---VFDCIMELKDPNVKMI---------WIKGTEPLRIQYSL-------- 281
               +    T          ++K  ++ +I          + G +P+RI +S         
Sbjct: 6255 TASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPG 6314

Query: 282  GKYDVKQMGTKYMLVISNVNMNDAGIYSLS----VGDKRMSAELTVLDEPLKFLGEMKPV 337
            G Y +  +G    L I  V   D+G Y+      VG    SA+L+V  EP KF+ +++  
Sbjct: 6315 GNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSV-KEPPKFVKKLEAS 6373

Query: 338  KVTERQTAV-FEIRLS-KKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSD 395
            KV ++  ++  E ++S   E    W  N  EL    KY ++         L I +A   D
Sbjct: 6374 KVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINS--VALLTINEASAED 6431

Query: 396  SGEFSAEAGNLVQKAQ----LTIDRIPIKFVSNLKNVRVKERSRACLECELT-SKDVTLR 450
            SG++  EA N V  A     LT+   P+ F      V   + S   L+CE++ +    + 
Sbjct: 6432 SGDYICEAHNGVGDASCSTALTVKAPPV-FTQKPSPVGALKGSDVILQCEISGTPPFEVV 6490

Query: 451  WKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQD-GDPTEYYSTAIVTV 509
            W KD + + +  K+ +  +     L I + + SD GEY   A  + G  T    +  V  
Sbjct: 6491 WVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDT---CSCSVKF 6547

Query: 510  EERLATVKSGMSDVHAATGSPAEL-CVVLNDEKVEGVWLKD-GKEITDLPGMQIVKQGAV 567
            +E    VK  +SD     G   EL  +V   + +  VWLKD G+ I +    +I     +
Sbjct: 6548 KEPPRFVKK-LSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNI 6606

Query: 568  HKLIFPSMGPEHEGKYTFRAKGT----ESEASVFIADPPTIDPSVLEALAAHAITVKVGH 623
              L   S    + GKY  + K      E  A + + +P  I            +TV  G+
Sbjct: 6607 ATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARIIEK------PEPMTVTTGN 6660

Query: 624  TAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLK 683
               ++    G P     W+KDG E++ + +  +      A L I      D GL   ++K
Sbjct: 6661 PFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVK 6720

Query: 684  NDHGSATATLHLSVLDRPKPPQGRVEFLELS---GSCVHMKWKAPKDNGGRPVTQFIVE- 739
            N  G +  T+ + V DR  PP    +  +++   G+ V ++ +    +G  P++    + 
Sbjct: 6721 NSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECRV---SGSAPISVGWFQD 6777

Query: 740  --RRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGN 797
                  G K      E    V   + + +E      +  +A N  G SD  E   V    
Sbjct: 6778 GNEIVSGPKCQSSFSE---NVCTLNLSLLEPSDTGIYTCVAANVAG-SD--ECSAVLTVQ 6831

Query: 798  PIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQ 857
              EPP F   P   +V    +++T+ +            ++         W   +++ + 
Sbjct: 6832 --EPPSFEQTPDSVEVL-PGMSLTFTS------------VIRGTPPFKVKWFKGSRELVP 6876

Query: 858  GTKCTVDGLLEDTEYEFRVIAVNKAGPGQPS------VPSSSVVAKDPVKPPGLVQDLHV 911
            G  C +   LED   E  +  V     G  S        S+S      VK P        
Sbjct: 6877 GESCNIS--LEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLA 6934

Query: 912  SDSSNSSISLAWREPAEGDPP--SGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQ 969
              S  +   +       G PP    +I +       E    T    S     +   IE  
Sbjct: 6935 DFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDY 6994

Query: 970  KYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFS 1029
              +  +   NEAG      L   V  + PP             H+    G    +     
Sbjct: 6995 AQYSCL-IENEAGQDICEAL---VSVLEPP------YFIEPLEHVEAVIGEPATLQCKVD 7044

Query: 1030 GSPPPDVIWQKDGVPTKGRET--ITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYD 1087
            G+P   + W K+    +      +    N +  +IN    SD G Y     N  G     
Sbjct: 7045 GTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASS 7104

Query: 1088 IHVRVADFPRPPTNLRLFEEVPNTV------TLTWNHSPDVQEDGEAHYIIMKRDASTAT 1141
              + +     PP   R  ++V  T+          N S  +Q       +++K DA+  T
Sbjct: 7105 AVLVIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQT 7164

Query: 1142 WYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKL 1201
             +        N  T+  L   + +    + +     S PL +  +           SAKL
Sbjct: 7165 SFV------HNVATLQILQTDQSH----IGQYNCSASNPLGTASS-----------SAKL 7203

Query: 1202 KPYEKKDWRHAPRFVTPLKPHTV--LRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKF 1259
               E       P F   LKP +V    G+  T  C   G     +T  K +  I     +
Sbjct: 7204 ILSE----HEVPPFF-DLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNY 7258

Query: 1260 WYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYD 1304
                     TL +      D+G Y+    N  GKD  S  L V +
Sbjct: 7259 KMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQE 7303



 Score =  123 bits (308), Expect = 1e-27
 Identities = 164/700 (23%), Positives = 281/700 (40%), Gaps = 79/700 (11%)

Query: 57   SSNIPAGDSV---------PEFVEKPQPVTAPEGDKAV-FRARVQGNAKPHISWKRESGI 106
            +SNI   DS          P F++K +P    + D+   +  ++ G+ +  + W ++   
Sbjct: 7286 ASNIAGKDSCSAQLGVQEPPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDE-T 7344

Query: 107  PIKESAKIFYDSINKEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDF 166
             I+ES+K     ++   VL++  L+ +DS +Y C A N    A  + SL V E       
Sbjct: 7345 EIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKE------- 7397

Query: 167  KKMLKKRAPPAPKKKQKKVANEKEM-----LEILSKVPKKDFE-----KVCMEYGFTDFR 216
              + +K+  P    K   V  E E+       +     K++       K+  E   T   
Sbjct: 7398 PPIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIH 7457

Query: 217  GL-----------LRKLKEMKKKVEVEAI------RILKPLEDKETKVDTTVVFDCIMEL 259
             L            +   ++     V +I      R +K L D  T V   V     +E 
Sbjct: 7458 ILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEG 7517

Query: 260  KDPNVKMIWIKGT-EPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSV----GD 314
             +P + ++W K   E +R   ++     + + T   L  S V   +AG Y+  +    G 
Sbjct: 7518 AEP-ISVVWFKDKGEIVRESDNIWISYSENIAT---LQFSRVEPANAGKYTCQIKNDAGM 7573

Query: 315  KRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLS-KKEPNFVWKFNGKELKRDDKY 373
            +   A L+VL EP   + + + +KVT   T   E  ++   E +  W  +GKEL  D+KY
Sbjct: 7574 QECFATLSVL-EPATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKY 7632

Query: 374  EITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTI-----DR-IPIKFVSNLKN 427
            +I+         LKI +   SDSG +S E  N V K   T      DR +P  F   LK 
Sbjct: 7633 KISFFNK--VSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKE 7690

Query: 428  VRVKERSRACLECEL-TSKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGG 486
                  S   +EC++  S  +++ W  +G  +  G KY          L +   + SD G
Sbjct: 7691 TNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSG 7750

Query: 487  EYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDEKVEGV- 545
            +YT +A       E   +A +TV E  + V+     +   TG+      ++       V 
Sbjct: 7751 DYTCIATNMAGSDE--CSAPLTVREPPSFVQK-PDPMDVLTGTNVTFTSIVKGTPPFSVS 7807

Query: 546  WLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEAS----VFIADP 601
            W K   E+       +  + +V +L    +     G+YT        +AS    ++I  P
Sbjct: 7808 WFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAP 7867

Query: 602  PTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGED 661
                         +  +++ G    ++  F G P   VTW K+G+ VT  +R ++   E 
Sbjct: 7868 AKF------VKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEK 7921

Query: 662  QALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRP 701
             A+L I +   ED+G     ++N  G  + +  + +L+ P
Sbjct: 7922 SAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPP 7961



 Score =  122 bits (307), Expect = 2e-27
 Identities = 148/640 (23%), Positives = 248/640 (38%), Gaps = 83/640 (12%)

Query: 699   DRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKV 758
             +RP PP G++  ++++ + V + W+ P+ +GG  +  +IVE +  G   W     V  KV
Sbjct: 22047 ERPLPP-GKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATCATV--KV 22103

Query: 759   TNFSTNKVEEGKAYQFRILAVNSEGVSDPLETE-EVFAGNPIEPPGF----------ASQ 807
             T  +   + +G+ Y FR+ A N +G+SDP +    V A + + PP F          A +
Sbjct: 22104 TEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGE 22163

Query: 808   PQVTDVT---KEAVTITW---NAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKC 861
                 DV    +    +TW   N P +           E  +  S L +            
Sbjct: 22164 DLKVDVPFIGRPTPAVTWHKDNVPLKQ----TTRVNAESTENNSLLTIK----------- 22208

Query: 862   TVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISL 921
               D   ED  + + V   N AG    ++ + +V+  D   PP     + + + +  SI+L
Sbjct: 22209 --DACREDVGH-YVVKLTNSAGE---AIETLNVIVLDKPGPP--TGPVKMDEVTADSITL 22260

Query: 922   AWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVN 979
             +W  P    G   + YI+E R   T  W +     ++ T      L    +Y FRI A N
Sbjct: 22261 SWGPPKYDGGSSINNYIVEKRDTSTTTW-QIVSATVARTTIKACRLKTGCEYQFRIAAEN 22319

Query: 980   EAGVGEPVELDKGVRAMP-----PPAAPKFDLSAR----LKSHMVVRAGTALCIHAAFSG 1030
               G    +  +  V   P     PP  P   LS+R    ++ +  +  G +  I      
Sbjct: 22320 RYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLER 22379

Query: 1031  SPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYD--I 1088
                  ++W K       +  I ++K    F     +      +R+  +N  G  +     
Sbjct: 22380 KERNSILWVK-----LNKTPIPQTK----FKTTGLEEGVEYEFRVSAENIVGIGKPSKVS 22430

Query: 1089  HVRVADFP-RPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAA- 1146
                VA  P  PP          N+VTL W             YI+ K++     W  A+ 
Sbjct: 22431 ECYVARDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASF 22490

Query: 1147  ERVFSNKYTVTGLLPGRKYYFRVVARNEIGD-SEPLDSRDTWLINKDQIQDLSAKLKPYE 1205
               +    + VTGL+   +Y FRV+ARN  G  SEP +S    +  +D++      + P  
Sbjct: 22491 TNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGA-ITARDEVDPPRISMDPKY 22549

Query: 1206  KKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTS 1265
             K                 V  G+   +     G P PT+   KGD  ++  ++    ST 
Sbjct: 22550 KDTI-------------VVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTD 22596

Query: 1266  GVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDK 1305
                +L +      DSG+Y +  +N  G+   +  + V D+
Sbjct: 22597 FATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDR 22636



 Score =  122 bits (306), Expect = 2e-27
 Identities = 200/934 (21%), Positives = 332/934 (35%), Gaps = 131/934 (14%)

Query: 441   ELTSKDVTLRWKK---DGQLLMHGTKYSMNHEGKRA-------------ELIIEDAQLSD 484
             + T K  +L W K   DG L + G        G  A             + ++ D Q  +
Sbjct: 20683 DTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQFVVPDLQTKE 20742

Query: 485   GGEYTVVAMQD---GDPTEYYSTAIVTVE-----------ERLATVKSGMSD--VHAATG 528
                + + A+ D   G+P       IV  E            R   V++G+S        G
Sbjct: 20743 KYNFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKG 20802

Query: 529   SPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAK 588
              PA           E  W KD   + +   ++  +   +  LI P       GK+    +
Sbjct: 20803 RPAP----------EVTWTKDNINLKNRANIENTESFTL--LIIPECNRYDTGKFVMTIE 20850

Query: 589   GTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEV 648
                 + S F+       P  +  L    IT K   T H  +P              G  +
Sbjct: 20851 NPAGKKSGFVNVRVLDTPGPVLNLRPTDIT-KDSVTLHWDLPL----------IDGGSRI 20899

Query: 649   TE---EERVSMERGEDQALLTISNCVREDSGL-------ILLKLKNDHG---SATATLHL 695
             T    E+R +  +    A      C  + +GL         +  +N++G       T  +
Sbjct: 20900 TNYIVEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPV 20959

Query: 696   SVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVD 755
                + P PP   +  ++++ S V + W  PK +GG  +T +++E +  G   W  I  V 
Sbjct: 20960 KASEAPSPPDS-LNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITTVK 21018

Query: 756   GKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQP--QVTDV 813
             G         + EG+ Y F+++AVNS G S P E+  V        P    +   Q   +
Sbjct: 21019 G--LECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVI 21076

Query: 814   TKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCT----VDGLLED 869
              K    I    P      P + +     KKG  +     +   + T  +    ++  +  
Sbjct: 21077 AKAGDNIKVEIPVLGRPKPTVTW-----KKGDQILKQTQRVNFETTATSTILNINECVRS 21131

Query: 870   TEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE- 928
                 + + A N  G     +   ++   D   PP     +   + S+  ++ +W  P   
Sbjct: 21132 DSGPYPLTARNIVGEVGDVI---TIQVHDIPGPP--TGPIKFDEVSSDFVTFSWDPPEND 21186

Query: 929   -GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPV 987
              G P S Y++EMR  D+  W +     I  T Y    L    +Y FR++A N  GVG  +
Sbjct: 21187 GGVPISNYVVEMRQTDSTTWVELATTVIR-TTYKATRLTTGLEYQFRVKAQNRYGVGPGI 21245

Query: 988   ELDKGVRAMP-----PPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDG 1042
                  V   P     PP  P+  ++A  K  M +        H   S    P + +  + 
Sbjct: 21246 TSACIVANYPFKVPGPPGTPQ--VTAVTKDSMTISW------HEPLSDGGSPILGYHVER 21297

Query: 1043  VPTKGRETITKSKNHSQFLINSTKRSDSGV---YRILLQNEFGEARYD------IHVRVA 1093
                 G    T SK      I  +     G+   +R++ +N  G+++        + +   
Sbjct: 21298 KERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPI 21357

Query: 1094  DFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAA-ERVFSN 1152
             D P  P  L +     +TVTL W             YI+ KRD     W  A    +  N
Sbjct: 21358 DPPGKPVPLNITR---HTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILEN 21414

Query: 1153  KYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHA 1212
             ++TV+GL     Y FRV+A+N  G   P       +  +D ++  + K+K   K      
Sbjct: 21415 EFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVE--APKIKVDVK------ 21466

Query: 1213  PRFVTPLKPHTVLR-GQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLV 1271
                    K   +L+ G+   +     G P PT+   K    +   +K           LV
Sbjct: 21467 ------FKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLV 21520

Query: 1272  IPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDK 1305
                 T +DSG Y++   N  G  +    + V D+
Sbjct: 21521 NKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDR 21554



 Score =  122 bits (305), Expect = 3e-27
 Identities = 271/1302 (20%), Positives = 464/1302 (35%), Gaps = 144/1302 (11%)

Query: 67   PEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRE-----SGIPIKESAKIFYDSINK 121
            P F   P  V   +  +      + G     + W ++     S    K ++K F+ SI  
Sbjct: 5517 PVFSSFPPIVETLKNAEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKIASKNFHTSI-- 5574

Query: 122  EHVLKLEPLTSDDSDNYKCIASNDHAD--AIYTVSL------------LVTEGQEKMDFK 167
             H+L ++   + D   Y C A N+      + TV L            L     E  + +
Sbjct: 5575 -HILNVD---TSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLNSLTVVAGEPAELQ 5630

Query: 168  KMLKKRAPPAPK--KKQKKVANEKEMLEI--LSKVPKKDFEKVCMEYGFTDFRGLLRKLK 223
              ++   P   +  K++++V  E E + I  +  V    F K          + + +   
Sbjct: 5631 ASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKA---EPANAGKYICQIKN 5687

Query: 224  EMKKKVEVEAIRILKP--LEDKETKVDTTVVFDCIMELK---DPNVKMIWIKGTEPLRIQ 278
            +   +  +  + +L+P  + +K   +  TV   C +E K    P + + W K  + L   
Sbjct: 5688 DGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLT-- 5745

Query: 279  YSLGKYDVKQMGTKYMLVISNVNMNDAGIYSL----SVGDKRMSAELTVLDE--PLKFLG 332
             S  K+          L I +V   DAG Y+     +VG    +A + V D   P  F  
Sbjct: 5746 -SSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTR 5804

Query: 333  EMKPVKVTERQTAVFEIRLSKKEP-NFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDA 391
             +K        + + E +++   P +  W     ++    KY+ T S++  T  L   D+
Sbjct: 5805 RLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDS 5864

Query: 392  RLSDSGEFSAEAGNLVQ----KAQLTIDRIPIKFVSNLKNVRVKERSRACLECELT-SKD 446
              SD G ++  A N+      +A LT+   P  FV   + + V           +  +  
Sbjct: 5865 --SDMGNYTCVAANVAGSDECRAVLTVQEPP-SFVKEPEPLEVLPGKNVTFTSVIRGTPP 5921

Query: 447  VTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAI 506
              + W +  + L+ G + ++  E   AEL + +  +S  GEYT V   +        T  
Sbjct: 5922 FKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQAS--CTTR 5979

Query: 507  VTVEERLATVKSGMSDVHAATGSPAEL-CVVLNDEKVEGVWLKDGKEITDLPGMQIVKQG 565
            + V+E  A +K  +SD     G    L         +   W KDG  IT      IV   
Sbjct: 5980 LFVKEPAAFLKR-LSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTE 6038

Query: 566  AVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTA 625
                L   +      G+Y+   +  E+   V  A   T++P          +   VG + 
Sbjct: 6039 KTCILEILNSTKRDAGQYSCEIEN-EAGRDVCGALVSTLEPPYF-VTELEPLEAAVGDSV 6096

Query: 626  HIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKND 685
             ++    G P   V+WYK   ++            + A L  +     DSG    K +N 
Sbjct: 6097 SLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENS 6156

Query: 686  HGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGK 745
             G+A++     + +R  PP    +  ++  +         + NG  P+           +
Sbjct: 6157 IGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPI-----------Q 6205

Query: 746  KSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEG-----VSDPLETEE----VFAG 796
              W + G +     N  T+ V+     +     ++  G      S+PL T      + A 
Sbjct: 6206 VCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAR 6265

Query: 797  NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
             P + P F  +P   DV            + D    V G    R       W   NK+  
Sbjct: 6266 EPKKSPFFDIKPVSIDVIA--------GESADFECHVTGAQPMRIT-----WSKDNKEIR 6312

Query: 857  QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPV-------KPPGLVQDL 909
             G   T+   + +T +  R++ V K   GQ +  +++ V KD         +PP  V+ L
Sbjct: 6313 PGGNYTIT-CVGNTPH-LRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKL 6370

Query: 910  HVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKE-WSKCTKIPISGTCYTVGGLIER 968
              S  +    S+       G P           +  E W        S    T+      
Sbjct: 6371 EASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAE 6430

Query: 969  QKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAF 1028
                +   A N  GVG+           PP    K      LK       G+ + +    
Sbjct: 6431 DSGDYICEAHN--GVGDASCSTALTVKAPPVFTQKPSPVGALK-------GSDVILQCEI 6481

Query: 1029 SGSPPPDVIWQKDGVPTKGRETITKSKNH--SQFLINSTKRSDSGVYRILLQNEFGEARY 1086
            SG+PP +V+W KD    +  +    +  H  +   I + + SD G Y     NE G    
Sbjct: 6482 SGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTC 6541

Query: 1087 DIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAA 1146
               V+   F  PP   R  +++ +T TL       + +  E   I+      +  W    
Sbjct: 6542 SCSVK---FKEPP---RFVKKLSDTSTL-------IGDAVELRAIVEGFQPISVVWLKDR 6588

Query: 1147 ERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRD--TWLINKDQIQDLSAKLKPY 1204
              V             R  +   +A  ++G  E  +S      + N   +++ SA L   
Sbjct: 6589 GEVIRESENT------RISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVL 6642

Query: 1205 EKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNST 1264
            E        R +   +P TV  G    + C   G P  +   +K    ++A+SK      
Sbjct: 6643 EPA------RIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFI 6696

Query: 1265 SGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKD 1306
            + V +L IP   + D G YS  V+N +GK  S+CT++V+  D
Sbjct: 6697 NKVASLKIPCAEMSDKGLYSFEVKNSVGK--SNCTVSVHVSD 6736



 Score =  121 bits (303), Expect = 5e-27
 Identities = 146/660 (22%), Positives = 265/660 (40%), Gaps = 56/660 (8%)

Query: 69   FVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKLE 128
            F ++ Q V A E D               + W ++ G+ + E  K    S  K H L + 
Sbjct: 2176 FTQELQDVVAKEKDTMATFECETSEPFVKVKWYKD-GMEVHEGDKYRMHSDRKVHFLSIL 2234

Query: 129  PLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPKKKQKKVANE 188
             + + D+++Y C+   D  + + T + L+ EG   ++F K L+    P     + +    
Sbjct: 2235 TIDTSDAEDYSCVLVED--ENVKTTAKLIVEG-AVVEFVKELQDIEVPESYSGELECIVS 2291

Query: 189  KEMLEILSKVPKKDFE-KVCMEYGFTDFRG--------------------LLRKLKEMKK 227
             E +E   K    D E K   +Y  T  RG                    +  K    K 
Sbjct: 2292 PENIE--GKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKL 2349

Query: 228  KVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVK 287
            K++   I IL+ L D++      V  +  + L+  +V+ +W+K  + ++    +     K
Sbjct: 2350 KMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLE--SVEGVWMKDGQEVQPSDRVHIVIDK 2407

Query: 288  QMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVF 347
            Q    +ML+I ++   DAG YS ++    +S    V    +  +  +K V V E   AV 
Sbjct: 2408 Q---SHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVL 2464

Query: 348  EIRLSKKEPNFV-WKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNL 406
            E ++S  +   V W  N +++K DD+ +  V   G    L I     SD G +    G +
Sbjct: 2465 ECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVK--GTKQRLVINRTHASDEGPYKLIVGRV 2522

Query: 407  VQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSM 466
                 L++++  IK +  L+++   E      E EL+   + + W    + +   +KY +
Sbjct: 2523 ETNCNLSVEK--IKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKI 2580

Query: 467  NHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAA 526
               GK  +L + +    D G+YT  A       E  ++  +TV      +   ++D   A
Sbjct: 2581 EAHGKIYKLTVLNMMKDDEGKYTFYA------GENMTSGKLTVAG--GAISKPLTDQTVA 2632

Query: 527  TGSPAEL-CVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTF 585
                A   C V N +  +G WL+DGK +     ++    G   +LI  +   +  G+YT+
Sbjct: 2633 ESQEAVFECEVANPDS-KGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTY 2691

Query: 586  RAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDG 645
            +   +++ A + +        +V        +TV     A   V      +  V W K+G
Sbjct: 2692 KVATSKTSAKLKV-------EAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNG 2744

Query: 646  MEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQ 705
            + +   E+ ++        L I NC   D  +   +L      A+A LH+  +   K P+
Sbjct: 2745 VVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRL--GRLGASARLHVETVKIIKKPK 2802



 Score =  121 bits (303), Expect = 5e-27
 Identities = 150/654 (22%), Positives = 261/654 (39%), Gaps = 83/654 (12%)

Query: 701   PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTN 760
             P  P G+ E ++++ S V + W  PK +GG  +  + VE   +    W++      ++  
Sbjct: 19189 PVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQ 19248

Query: 761   --FSTNKVEEGKAYQFRILAVNSEGVSDPLETEE---VFAGNPIEPPGFASQPQVTDVTK 815
               ++   +EE   YQFR +A  +  +S P E  +   + A N       +   +     K
Sbjct: 19249 EEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVK 19308

Query: 816   EAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVN--KDPIQGTKCTVD--GLLEDTE 871
                 +  +A       P + +     KK   L  P    K  +Q   CT++   +     
Sbjct: 19309 AGTNVCLDATVFGKPMPTVSW-----KKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDS 19363

Query: 872   YEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--G 929
              ++ + A N +G        S+ +    +  PG    + ++   +    L+W  P E  G
Sbjct: 19364 GDYTITAENSSGS------KSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGG 19417

Query: 930   DPPSGYILEMRAEDTKEWSKCTK-IPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVE 988
                + YI++ R      W++ +  +PI  T  +V  LIE  +Y FRI A N+ GVG+PV 
Sbjct: 19418 SEITNYIVDKRETSRPNWAQVSATVPI--TSCSVEKLIEGHEYQFRICAENKYGVGDPVF 19475

Query: 989   LDKGVRAMPPPAAPKFD---LSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPT 1045
              +  +   P     + D   +S   K HM V            S  PP D      G P 
Sbjct: 19476 TEPAIAKNPYDPPGRCDPPVISNITKDHMTV------------SWKPPAD----DGGSPI 19519

Query: 1046  KG-----RET--ITKSKNHSQFLINSTKRSDSGV-------YRILLQNEFG-----EARY 1086
              G     RET  +  +K + + +I  T ++ +G+       +R+   N+ G     +A  
Sbjct: 19520 TGYLLEKRETQAVNWTKVNRKPIIERTLKA-TGLQEGTEYEFRVTAINKAGPGKPSDASK 19578

Query: 1087  DIHVRVADFPR-PPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTA 1145
               + R   +P  PP   ++++   ++V+L+W             Y++  + A +  W   
Sbjct: 19579 AAYARDPQYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRC 19638

Query: 1146  --AERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKP 1203
                + +   ++ VTGL+   +Y FRV A N+IG S+P D  D     K   +D+   + P
Sbjct: 19639 NLPQNLQKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPD-----KHYPKDIL--IPP 19691

Query: 1204  YEKKDWRHAPRFVTPLKPHTVLR-GQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYN 1262
               + D          L+   +LR G    +     G P P +T  K +VN+         
Sbjct: 19692 EGELD--------ADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIK 19743

Query: 1263  STSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASITE 1316
             ST     L        D+G Y + +EN  GK   +  + V D     V  ++ E
Sbjct: 19744 STDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKE 19797



 Score =  121 bits (303), Expect = 5e-27
 Identities = 140/627 (22%), Positives = 244/627 (38%), Gaps = 83/627 (13%)

Query: 718   VHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRIL 777
             V + W  P  +GG  +T+++VER+  G+++W   G    K      ++++E    +FR+ 
Sbjct: 27479 VILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGI--SKTCEIEVSQLKEQSVLEFRVF 27536

Query: 778   AVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTIT------WNAPTQDGGA 831
             A N +G+SDP+    +     I  P    +  ++D+    VT+          P +    
Sbjct: 27537 AKNEKGLSDPVTIGPITVKELIITP----EVDLSDIPGAQVTVRIGHNVHLELPYKGKPK 27592

Query: 832   PVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPS 891
             P + ++ +      + +V  +K   + T  ++    ++   ++ VI  N     + +VP 
Sbjct: 27593 PSISWLKDGLPLKESEFVRFSKTENKIT-LSIKNAKKEHGGKYTVILDNAVC--RIAVPI 27649

Query: 892   SSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSK 949
             + +    P KP G ++     +    S+ L+W  P +  G   + Y +E R      W K
Sbjct: 27650 TVITLGPPSKPKGPIR---FDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNW-K 27705

Query: 950   CTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEP-----VELDKGVRAMPPPAAPKF 1004
                  ++ T + V  L++  +Y FR+RA N  GV +P     +      R   PP  P  
Sbjct: 27706 MVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVI 27765

Query: 1005  DLSARLKSHMVVRAGTALCIHA-AFSGSPPP-----------DVIWQKDGV-PTKGRETI 1051
                     + V   G +L   A  + G                ++WQK    P  GRE  
Sbjct: 27766 --------YNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGRE-- 27815

Query: 1052  TKSKNHSQFLINSTKRSDSGVYRILLQNEFG------EARYDIHVRVADFPRPPTNLRLF 1105
                     +            +R+  +N  G       +++ + V   D P  P  + + 
Sbjct: 27816 --------YRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVT 27867

Query: 1106  EEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGR 1163
              E   T+TL WN  P +++ G     Y I KR  +          V   +YTVTGL PG 
Sbjct: 27868 RE---TITLKWN--PPLRDGGSKIVGYSIEKRQGNERWVRCNFTDVSECQYTVTGLSPGD 27922

Query: 1164  KYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHT 1223
             +Y FR++ARN +G   P       ++ +D+       + P  +      P +   L    
Sbjct: 27923 RYEFRIIARNAVGTISPPSQSSGIIMTRDE------NVPPIVE----FGPEYFDGL---I 27969

Query: 1224  VLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDY 1283
             +  G+   +     G P P VT +K  V I            G  +L +   T    G Y
Sbjct: 27970 IKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVY 28029

Query: 1284  SVLVENELGKDRSSCTLTVYDKDDKSV 1310
             +V  +N  G  ++   + V D   K V
Sbjct: 28030 TVEAKNASGSAKAEIKVKVQDTPGKVV 28056



 Score =  120 bits (302), Expect = 7e-27
 Identities = 163/681 (23%), Positives = 272/681 (39%), Gaps = 74/681 (10%)

Query: 361   KFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPIK 420
             + N  EL R   + +    +G  +  +IK A +   GE    A +++ K  L    + + 
Sbjct: 17852 RINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELD 17911

Query: 421   FVS-NLKNVRVKERSRACLECE-LTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIE 478
                 ++  VRV +  R     +     D+T  W K+G++L+   +  +  +  R EL I+
Sbjct: 17912 VTCRDVITVRVGQTIRILARVKGRPEPDIT--WTKEGKVLVREKRVDLIQDLPRVELQIK 17969

Query: 479   DAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLN 538
             +A  +D G+Y + A       +   +AIV V +R      G       T    E C +  
Sbjct: 17970 EAVRADHGKYIISAKNSSGHAQ--GSAIVNVLDR-----PGPCQNLKVTNVTKENCTISW 18022

Query: 539   DEKVEGVWLKDGKEITDL---------PGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKG 589
             +  ++      G EIT+           G  IV      +LI  ++   +E  Y FR   
Sbjct: 18023 ENPLD----NGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIKANLLANNE--YYFRV-C 18075

Query: 590   TESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYK---DGM 646
              E++  V     PTI+      LA + I  + G   ++ +  +GK    + W +   DG 
Sbjct: 18076 AENKVGV----GPTIETKT-PILAINPID-RPGEPENLHIADKGKTFVYLKWRRPDYDGG 18129

Query: 647   EVTEEERVSME-RGED-----------QALLTISNCVREDSGLILLKLKNDHGSATATLH 694
                    V    +G D           +    +  CV        ++ KN+ G +     
Sbjct: 18130 SPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDWVKT 18189

Query: 695   LSVL---DRPKPPQGRVEFLELSGSCV-----HMKWKAPKDNGGRPVTQFIVERRA--VG 744
               V+   D  KP    V  L+LSG         ++ +A       P   +  ++ A  + 
Sbjct: 18190 EEVVVKEDLQKP----VLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLT 18245

Query: 745   KKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGF 804
             +   +KI +     + FS  K +     ++ + A N+ G      T      N ++ PG 
Sbjct: 18246 RSPRVKI-DTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATV-----NVLDKPGP 18299

Query: 805   ASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI-QGTKCTV 863
                 ++ DV+ +  T+ W+ P  DGG  +  YI+E+ +    +W   +   +  GT  TV
Sbjct: 18300 VRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGT--TV 18357

Query: 864   DGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAW 923
               L+E  EY FRV A NK G G P+  S  V+AK     PG      V+  S   +++ W
Sbjct: 18358 TRLIEGNEYIFRVRAENKIGTGPPT-ESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVW 18416

Query: 924   REPA--EGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEA 981
               P    G   +GY LE + + +  W    K  I      V  L+   +Y FR++A NE 
Sbjct: 18417 NPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEI 18476

Query: 982   GVGEPVELDKGVRAMPPPAAP 1002
             G+GEP    + V A  P   P
Sbjct: 18477 GIGEPSLPSRPVVAKDPIEPP 18497



 Score =  120 bits (301), Expect = 9e-27
 Identities = 275/1316 (20%), Positives = 466/1316 (35%), Gaps = 160/1316 (12%)

Query: 67   PEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLK 126
            P F++  +P     G  A+ +  V G     ISW ++    I+ S K    S      L+
Sbjct: 3831 PSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKK-QIRSSKKYRLFSQKSLVCLE 3889

Query: 127  LEPLTSDDSDNYKCIASNDHADA--------------IYTVSLLVTEGQEKMDFKKMLKK 172
            +    S D   Y+C+ +N+                  +  V  L+  G + +  +  ++ 
Sbjct: 3890 IFSFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRG 3949

Query: 173  RAP-PAPKKKQKKVANE--KEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMK--K 227
              P      K ++V  E  K  +   + V       V + +G     G    L E +   
Sbjct: 3950 SEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFG-----GKYTCLAENEAGS 4004

Query: 228  KVEVEAIRILKPLE--DKETKVDTTVVFDCIMELK---DPNVKMIWIKGTEPLRIQYSLG 282
            +  V  + + +P +  ++   +  T      +E      P +K  W K   PL    +  
Sbjct: 4005 QTSVGELIVKEPAKIIERAELIQVTAGDPATLEYTVAGTPELKPKWYKDGRPL---VASK 4061

Query: 283  KYDVKQMGTKYMLVISNVNMNDAGIY----SLSVGDKRMSAELTVLDEPLK--FLGEMKP 336
            KY +        L   +  ++D+G Y    S  VG        TVLD  +   F   ++ 
Sbjct: 4062 KYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRN 4121

Query: 337  VKVTERQTAVFEIRLSKKEPNFV-WKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSD 395
            V      T   + +++   P  V W  +GKE+   D+Y I   E   T +L+I    ++D
Sbjct: 4122 VDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEG--TASLEIIRVDMND 4179

Query: 396  SGEFSAEAGNLV---QKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELT-SKDVTLRW 451
            +G F+  A N V     +   I + P  FV+   +  V   S  CL+     S  +T+RW
Sbjct: 4180 AGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRW 4239

Query: 452  KKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEE 511
             K  + L+ G    +  E   + L +   + SD G YT          E   +A + V+E
Sbjct: 4240 FKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVE--CSANLFVKE 4297

Query: 512  RLATVKSGMSDVHAATGSPAEL-CVVLNDEKVEGVWLKDGKEITDLP--GMQIVKQGAVH 568
                V+          G   +L C V     ++  W  + +EI +     M  V+  AV 
Sbjct: 4298 PATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVL 4357

Query: 569  KLIFPSMGPEHEGKYTFRAK---GTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTA 625
            +L    +G E  G+Y   A+   G++  +S+ I     +  S         I V   +  
Sbjct: 4358 RL--TDVGIEDSGEYMCEAQNEAGSDHCSSIVI-----VKESPYFTKEFKPIEVLKEYDV 4410

Query: 626  HIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKND 685
             +     G P  ++TW+KD   +    +      +    L I   V  D+G    ++ N+
Sbjct: 4411 MLLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNE 4470

Query: 686  HGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGK 745
             GS+  +  +++    + P   ++ +E + S            GG    Q  ++      
Sbjct: 4471 VGSSICSARVTL----REPPSFIKKIESTSSL----------RGGTAAFQATLKGSLPIT 4516

Query: 746  KSWIK----IGEVDGKVTNFSTN-------KVEEGKAYQFRILAVNSEGVSDPLETEEVF 794
             +W+K    I E D     F  N        +E     ++   A N  G+          
Sbjct: 4517 VTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQ--------- 4567

Query: 795  AGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKD 854
                       S  +   +T+EAV+I        G    L       K+ +  W    ++
Sbjct: 4568 -----RCSALLSVKEPATITEEAVSI----DVTQGDPATLQVKFSGTKEITAKWFKDGQE 4618

Query: 855  PIQGTKCTVDGLLEDTEYEFRVIAVNKAGPG------QPSVPSSSVVAK----DPVKPPG 904
               G+K  +   + DT    ++I+  K   G      Q  V  SS  A+    D + PP 
Sbjct: 4619 LTLGSKYKIS--VTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPS 4676

Query: 905  LVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPIS---GTCY- 960
              + L   DS   S        A   P    I     +D +E S   K   S    T + 
Sbjct: 4677 FTKKLKKMDSIKGSFIDLECIVAGSHP----ISIQWFKDDQEISASEKYKFSFHDNTAFL 4732

Query: 961  TVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGT 1020
             +  L       +   A N+AG     +    +    PP                V   T
Sbjct: 4733 EISQLEGTDSGTYTCSATNKAGHN---QCSGHLTVKEPP------YFVEKPQSQDVNPNT 4783

Query: 1021 ALCIHAAFSGSPPPDVIWQKDG--VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQ 1078
             + + A   G+ P  + W KD   + +    ++ K    +   + + K +DSG Y   L 
Sbjct: 4784 RVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLS 4843

Query: 1079 NEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDAS 1138
            N+ G A     + V + P+       F + P+ V +  N      E       I      
Sbjct: 4844 NDVGTATSKATLFVKEPPQ-------FIKKPSPVLVLRNGQSTTFE-----CQITGTPKI 4891

Query: 1139 TATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLS 1198
              +WY     + + +      + G   +    AR E   +   ++R     N       S
Sbjct: 4892 RVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEAR-----NDAGTASCS 4946

Query: 1199 AKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSK 1258
             +LK  E       P F+  LKP  V++  D  + C   G P   VT  K +  I ++ K
Sbjct: 4947 IELKVKE------PPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKK 5000

Query: 1259 FWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASI 1314
            +       V  L I  C   D+G+Y  +V NE G    SC+  V  K+  S +  I
Sbjct: 5001 YTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGS--CSCSTRVALKEPPSFIKKI 5054



 Score =  119 bits (297), Expect = 3e-26
 Identities = 231/1056 (21%), Positives = 389/1056 (36%), Gaps = 124/1056 (11%)

Query: 294  MLVISNVNMNDAGIYSLSVGDKR---MSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIR 350
            +L I N    DAG YS  + ++    +   L    EP  F+ E++P++     +   + +
Sbjct: 6042 ILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSLQCQ 6101

Query: 351  LS-KKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQK 409
            ++   E    W     +L+   +Y    + +    TL      ++DSGE++ +A N +  
Sbjct: 6102 VAGTPEITVSWYKGDTKLRPTPEYRTYFTNN--VATLVFNKVNINDSGEYTCKAENSIGT 6159

Query: 410  AQL-TIDRI-----PIKFVSNLKNVRVKERSRACLECELT-SKDVTLRWKKDGQLLMHGT 462
            A   T+ RI     P  F   LK++         L C L  S  + + W +DG LL    
Sbjct: 6160 ASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDE 6219

Query: 463  KYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLAT----VKS 518
                +     A L I    LS  G+Y+  A          S+A +T  E   +    +K 
Sbjct: 6220 NLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTAS--SSARLTAREPKKSPFFDIKP 6277

Query: 519  GMSDVHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPE 578
               DV A   +  E C V   + +   W KD KEI       I   G    L    +G  
Sbjct: 6278 VSIDVIAGESADFE-CHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKG 6336

Query: 579  HEGKYTFRAKGTESE----ASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGK 634
              G+YT +A     +    A + + +PP      ++ L A  +  K G +  ++    G 
Sbjct: 6337 DSGQYTCQATNDVGKDMCSAQLSVKEPPKF----VKKLEASKVA-KQGESIQLECKISGS 6391

Query: 635  PLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLH 694
            P  KV+W+++  E+ E  + +M      ALLTI+    EDSG  + +  N  G A+ +  
Sbjct: 6392 PEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTA 6451

Query: 695  LSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQ--FIVERRAVGKKSWIKIG 752
            L+V   P   Q       L GS V ++ +      G P  +  ++ +R+ V      KI 
Sbjct: 6452 LTVKAPPVFTQKPSPVGALKGSDVILQCEI----SGTPPFEVVWVKDRKQVRNSKKFKIT 6507

Query: 753  EVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTD 812
                  T+     +E     ++   A N  G SD       F     EPP F  +   T 
Sbjct: 6508 SKHFD-TSLHILNLEASDVGEYHCKATNEVG-SDTCSCSVKFK----EPPRFVKKLSDTS 6561

Query: 813  VTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEY 872
                         T  G A  L  IVE  +  S +W+    + I+ +        E+T  
Sbjct: 6562 -------------TLIGDAVELRAIVEGFQPISVVWLKDRGEVIRES--------ENTRI 6600

Query: 873  EFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPP 932
             F +  +     G P   +S           G+ +   V      +  +   EP      
Sbjct: 6601 SF-IDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARIIEKPEPMTVTTG 6659

Query: 933  SGYILEMRAEDTKE----WSKCTK-------------IPISGTCYTVGGLIERQKYFFRI 975
            + + LE     T E    W K  +               ++        + ++  Y F +
Sbjct: 6660 NPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEV 6719

Query: 976  RAVNEAGVGE-PVELDKGVRAMPPPAAPKF-DLSARLKSHMVVRAGTALCIHAAFSGSPP 1033
            +  N  G     V +    R +PP    K  D++A L        G ++ +    SGS P
Sbjct: 6720 K--NSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAIL--------GASVVLECRVSGSAP 6769

Query: 1034 PDVIWQKDG--VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVR 1091
              V W +DG  + +  +   + S+N     ++  + SD+G+Y  +  N  G    D    
Sbjct: 6770 ISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGS---DECSA 6826

Query: 1092 VADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFS 1151
            V     PP+    FE+ P++V +    S           +I         W+  +     
Sbjct: 6827 VLTVQEPPS----FEQTPDSVEVLPGMSLTFTS------VIRGTPPFKVKWFKGSRE--- 6873

Query: 1152 NKYTVTGLLPGRKYYFRV---VARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKD 1208
                   L+PG      +   V   E+ + +PL+S D   +  +     S     + K+ 
Sbjct: 6874 -------LVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKE- 6925

Query: 1209 WRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVC 1268
                  FV  L   +V  G    +   + G P  +V+  K +  I+ + +     T    
Sbjct: 6926 ---PATFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKST 6982

Query: 1269 TLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYD 1304
             L I   T++D   YS L+ENE G+D     ++V +
Sbjct: 6983 ILEILESTIEDYAQYSCLIENEAGQDICEALVSVLE 7018



 Score =  117 bits (294), Expect = 6e-26
 Identities = 148/628 (23%), Positives = 233/628 (37%), Gaps = 87/628 (13%)

Query: 713   LSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAY 772
             +S S   + WK P  +GG  +  ++V+      K W ++  +      +S   + EGK Y
Sbjct: 19895 VSKSSCSIGWKKPHSDGGSRIIGYVVDFLTEENK-WQRV--MKSLSLQYSAKDLTEGKEY 19951

Query: 773   QFRILAVNSEGVSDPLETEEVFAGNPIEPP-GFASQPQVTDVTKEAVTITWNAPTQDGGA 831
              FR+ A N  G   P E   V   + + P       P +  + KE        P +   A
Sbjct: 19952 TFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPA 20011

Query: 832   PVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPS 891
             P + +        ++  V V    +  T    D    D   ++ +   N AG  + ++ S
Sbjct: 20012 PSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAG-KYTITLKNVAGTKEGTI-S 20069

Query: 892   SSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSK 949
               VV K P  P G ++     + +  +++L W  P +  G   + YILE R     +W  
Sbjct: 20070 IKVVGK-PGIPTGPIK---FDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVT 20125

Query: 950   CTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSAR 1009
             C    +  T + V  L E  +Y FR+ A N+ GVGE      G+++ P  A   FD+   
Sbjct: 20126 CASA-VQKTTFRVTRLHEGMEYTFRVSAENKYGVGE------GLKSEPIVARHPFDVP-- 20176

Query: 1010  LKSHMVVRAGTALCIHAAFSGSPPPDVI----------W----QKDGVPTKGRETITKSK 1055
                                   PPP+++          W    +  G P  G     K +
Sbjct: 20177 -------------------DAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKER 20217

Query: 1056  NH-------------SQFLINSTKRSDSGVYRILLQNEFGEARYDIH---VRVADFPRPP 1099
             N                F +          +R++  N  G  +  +    V   D   PP
Sbjct: 20218 NSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPP 20277

Query: 1100  TNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAE-RVFSNKYTVTG 1158
                 +     N+VTL W             YI+ KRD  + +W  A    V    +TVT 
Sbjct: 20278 GKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTD 20337

Query: 1159  LLPGRKYYFRVVARNEIGD-SEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVT 1217
             L+ G KY FR+ A+N  G  S P +S +T +I KD+ +  +  L P  K           
Sbjct: 20338 LVEGGKYEFRIRAKNTAGAISAPSESTET-IICKDEYEAPTIVLDPTIKDGL-------- 20388

Query: 1218  PLKPHTVLRGQDCTMTC-AFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCT 1276
                  T+  G    +   + LG P P  +  K   +I  +      ST     L I   T
Sbjct: 20389 -----TIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYAT 20443

Query: 1277  LKDSGDYSVLVENELGKDRSSCTLTVYD 1304
              KD+G+Y++   N  G       +TV D
Sbjct: 20444 RKDAGEYTITATNPFGTKVEHVKVTVLD 20471



 Score =  112 bits (281), Expect = 2e-24
 Identities = 156/679 (22%), Positives = 263/679 (38%), Gaps = 103/679 (15%)

Query: 52   SLVTRSSNIPAGDSVPEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISW-KRESGIPIKE 110
            S VT   N P     P+ +++ QPVT   G  A F A + G  +P ISW K E  +    
Sbjct: 3227 SSVTLYVNAP---EPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGF 3283

Query: 111  SAKIFYDSINKEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKML 170
              K  +D   +E+ L L     +D+  Y C A ND+  A  + SL V E  E +   + +
Sbjct: 3284 KCKFLHD--GQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSV-EVPEVVSPDQEM 3340

Query: 171  KKRAPPAPKKKQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVE 230
                P      Q  V +E +      +V   D                  K+    K  +
Sbjct: 3341 PVYPPAIITPLQDTVTSEGQPARFQCRVSGTDL-----------------KVSWYSKDKK 3383

Query: 231  VEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMG 290
            ++  R  +  + ++T                                Q  + +   +  G
Sbjct: 3384 IKPSRFFRMTQFEDT-------------------------------YQLEIAEAYPEDEG 3412

Query: 291  TKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPL--KFLGEMKPVKVTERQTAVFE 348
            T Y  V SN     +   +LS     + A  ++L E +  +   EMK   V +R+    E
Sbjct: 3413 T-YTFVASNAVGQVSSTANLS-----LEAPESILHERIEQEIEMEMKAAPVIKRKIEPLE 3466

Query: 349  IRLS---------KKEPN--FVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSG 397
            + L          +  PN  F W   G+E+   DK  I  S+     +L+I   ++ D G
Sbjct: 3467 VALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSK--YISSLEILRTQVVDCG 3524

Query: 398  EFSAEA----GNLVQKAQLTI-DRIPIKFVSNLKNVRVKERSRACLECELTSKDV-TLRW 451
            E++ +A    G++   A LT+ +  P  F+S  K++       A   C +T   V    W
Sbjct: 3525 EYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIW 3584

Query: 452  KKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEE 511
            +KDG  L     + ++    +  L + +  + D G Y+  A          +  I+  + 
Sbjct: 3585 QKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKP 3644

Query: 512  RLATVKSGMSDVHAATGSPAEL-CVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKL 570
                    +  V +A      L C V  D KV   W KDG+++      +I  +  +  L
Sbjct: 3645 HFI---KELEPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATL 3701

Query: 571  IFPSMGPEHEGKYTFRAK----GTESEASVFIADPPT----IDPSVLEALAAHAITVKVG 622
              P    +  G Y   A      +   A+V + +PP+    +DPS L         +  G
Sbjct: 3702 EIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDPSYL---------MLPG 3752

Query: 623  HTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKL 682
             +A +    +G P+ +VTW+K+  E++E   V M     +A+L I++   EDSG    + 
Sbjct: 3753 ESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEA 3812

Query: 683  KNDHGSATATLHLSVLDRP 701
             ND GS + +  + + + P
Sbjct: 3813 VNDVGSDSCSTEIVIKEPP 3831



 Score =  112 bits (280), Expect = 2e-24
 Identities = 159/745 (21%), Positives = 291/745 (39%), Gaps = 74/745 (9%)

Query: 5    HSRQMLQEHVSMEFSSSTTHVQTFSQTTKIVGEEVVRRKSS--SIVEFFSLVTRSSNIPA 62
            H++        M+F ++   +         VGE   +  +S  ++     LV ++  +P 
Sbjct: 7057 HTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLP- 7115

Query: 63   GDSVPEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKE 122
                P F  K + V    G    F  R+ G+    +SW ++ G+ +K+ A +    ++  
Sbjct: 7116 ----PFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKD-GVLLKDDANLQTSFVHNV 7170

Query: 123  HVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQ-----------------EKMD 165
              L++          Y C ASN    A  +  L+++E +                 E   
Sbjct: 7171 ATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGT 7230

Query: 166  FKKMLKKRAP-------------PAPKKKQKKVANEKEMLEILSKVPKKDFEKVCMEYGF 212
            FK  +   AP             P    K   V N   +  +  KV K D  +      +
Sbjct: 7231 FKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVL--KVGKGDAGQ------Y 7282

Query: 213  TDFRGLLRKLKEMKKKVEV-EAIRILKPLE-DKETKVDTTVVFDCIMELKDPNVKMIWIK 270
            T +   +        ++ V E  R +K LE  +  K D    ++C +    P +K++W K
Sbjct: 7283 TCYASNIAGKDSCSAQLGVQEPPRFIKKLEPSRIVKQDEFTRYECKIG-GSPEIKVLWYK 7341

Query: 271  GTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSL----SVGDKRMSAELTVLDE 326
              +   IQ S  K+ +  + +  +L + N+++ D+G Y+     + G    S  L V + 
Sbjct: 7342 --DETEIQES-SKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEP 7398

Query: 327  PLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFV-WKFNGKELKRDDKYEITVSEDGLTHT 385
            P+ F  +  P++  +      E  L    P  V W  + +EL+   KY+I +SE+ LT +
Sbjct: 7399 PI-FRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKI-MSENFLT-S 7455

Query: 386  LKIKDARLSDSGEFSAEAGNLVQKAQLTID---RIPIKFVSNLKNVRVKERSRACLECEL 442
            + I +   +D GE+  +A N V           + P +FV  L ++         L+  +
Sbjct: 7456 IHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTI 7515

Query: 443  T-SKDVTLRWKKD-GQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTE 500
              ++ +++ W KD G+++       +++    A L     + ++ G+YT     D    E
Sbjct: 7516 EGAEPISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQE 7575

Query: 501  YYSTAIVTVEERLATVKSGMSDVHAATGSPAEL-CVVLNDEKVEGVWLKDGKEITDLPGM 559
             ++T  V      AT+      +   TG    L C V    ++   W KDGKE+T     
Sbjct: 7576 CFATLSVL---EPATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKY 7632

Query: 560  QIVKQGAVHKLIFPSMGPEHEGKYTFRAK---GTESEASVFIADPPTIDPSVLEALAAHA 616
            +I     V  L   ++ P   G Y+F  +   G +S  +       T+ PS    L    
Sbjct: 7633 KISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKL--KE 7690

Query: 617  ITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSG 676
                 G +  ++    G P   V+W+ +G E++   +      ++   LT++     DSG
Sbjct: 7691 TNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSG 7750

Query: 677  LILLKLKNDHGSATATLHLSVLDRP 701
                   N  GS   +  L+V + P
Sbjct: 7751 DYTCIATNMAGSDECSAPLTVREPP 7775



 Score =  109 bits (273), Expect = 2e-23
 Identities = 145/639 (22%), Positives = 241/639 (37%), Gaps = 71/639 (11%)

Query: 695   LSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEV 754
             ++V +RP+     +E  E++ + V + W  PK +GG  +  +++E R +G + + K+   
Sbjct: 16714 ITVPERPED----LEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTND 16769

Query: 755   DGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVT 814
             +     ++   ++EG  Y++R+ AVN  G   P      F   PI      + P +    
Sbjct: 16770 NLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPS-----FCTKPITCKDELAPPTLHLDF 16824

Query: 815   KEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYE- 873
             ++ +TI      + G A  L      + K    W     D ++  +  +         E 
Sbjct: 16825 RDKLTI------RVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEK 16878

Query: 874   ----------FRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAW 923
                       + V+  N  G  +     + V   D   PP  V  +   + +   + ++W
Sbjct: 16879 IKAKRSDSGKYCVVVENSTGSRKGFCQVNVV---DRPGPP--VGPVSFDEVTKDYMVISW 16933

Query: 924   REPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEA 981
             + P +  G   + YI+E +      W   T      TC  V  L+E + Y FRI A N  
Sbjct: 16934 KPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTC-KVSKLLEGKDYIFRIHAENLY 16992

Query: 982   GVGEPVELD--KGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQ 1039
             G+ +P+  D  K       P AP   +   +     +             G P  + I +
Sbjct: 16993 GISDPLVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNK----PHDGGKPITNYILE 17048

Query: 1040  KDGVPTKGRETITKSKNH--SQFLINSTKRSDSGVYRILLQNEFG------EARYDIHVR 1091
             K    +K    +TK   H  ++F +          +R+  +NE G       ++      
Sbjct: 17049 KRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKD 17108

Query: 1092  VADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTA---A 1146
                 P PP N    +   N+V LTW   P   + G     YI+  +      W  A    
Sbjct: 17109 PIAKPSPPVNPEAIDTTCNSVDLTWQ--PPRHDGGSKILGYIVEYQKVGDEEWRRANHTP 17166

Query: 1147  ERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEK 1206
             E     KY VTGL  G+ Y FRV+A N  G+S+P    +  L+ KD+++     L     
Sbjct: 17167 ESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLV-KDRLEPPELILD---- 17221

Query: 1207  KDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSG 1266
                          +   +  G    ++    G P P VT  K D +  A +K   + T  
Sbjct: 17222 ---------ANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRD--APTKARIDVTPV 17270

Query: 1267  VCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDK 1305
                L I     +D G YS+ VEN  G    S  + V DK
Sbjct: 17271 GSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDK 17309



 Score =  107 bits (268), Expect = 6e-23
 Identities = 144/617 (23%), Positives = 249/617 (40%), Gaps = 55/617 (8%)

Query: 217   GLLRKLKEMKKKVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLR 276
             G   K    K  VE   +R +K LE++ T V    ++      K+ +V  +W K  +   
Sbjct: 11195 GNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDV--VWRKDGKI-- 11250

Query: 277   IQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSV---GDKRMSAELTVLDEPLKFLGE 333
             +    G+     +G    L I++ +  DAG Y+++V    +   S+ + V++    +L  
Sbjct: 11251 VVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWL-- 11308

Query: 334   MKPVK---VTERQTAVFEIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKD 390
             +KP++   V  + TA+F   ++K  PN  W     E+  +   +  +  DG    LKIK+
Sbjct: 11309 VKPIRDQHVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKN 11368

Query: 391   ARLSDSGEFSAEAGNLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLR 450
             A   D  E++ E       A+LT+    ++ +  +++V + E+  A  + E++  D+  +
Sbjct: 11369 AMPEDIAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQ 11428

Query: 451   WKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVE 510
             WK  G+LL       +  EG +  L +   +L   GE    A+         +TAI+TV+
Sbjct: 11429 WKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQAL------NAITTAILTVK 11482

Query: 511   ERLATVKSGMSDVHAATGSPAEL-CVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHK 569
             E        + DV       A   CV+  +  V  +W K    I       I+  G  H 
Sbjct: 11483 EIELDFAVPLKDVTVPERRQARFECVLTREANV--IWSKGPDIIKSSDKFDIIADGKKHI 11540

Query: 570   LIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKV 629
             L+      + EG YT   +G ++ A +F+        S LE       TVK G TA    
Sbjct: 11541 LVINDSQFDDEGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQ-----TVKEGETATFVC 11595

Query: 630   PFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSA 689
                 + +  V W+K+  ++     V +        L +     +D   I  ++K      
Sbjct: 11596 ELSHEKM-HVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVK----EL 11650

Query: 690   TATLHLSVLDRPK------PPQGRVEFLELSGSC-----VHMKWKAPKDNGGRPVTQFIV 738
             ++T  L VL+           +  VE  E++  C     V +KW     +G   V     
Sbjct: 11651 SSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKDVPVKW---FKDGEEIVPSPKY 11707

Query: 739   ERRAVGKKSWIKIGEVDGK-----VTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEV 793
               +A G +  +KI + D K     V +  T+K +     + R++ V       PL   EV
Sbjct: 11708 SIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEK-----PLYGVEV 11762

Query: 794   FAGNPIEPPGFASQPQV 810
             F G         S+P V
Sbjct: 11763 FVGETAHFEIELSEPDV 11779



 Score =  107 bits (266), Expect = 1e-22
 Identities = 168/748 (22%), Positives = 293/748 (39%), Gaps = 96/748 (12%)

Query: 232   EAIRILKPLEDKETKVDTTVVFDC-IMELKDPNVKMIWIK-GTEPLRIQYSLGKYDVKQM 289
             EA  I K ++D  TK+       C I+    P++K  W + G E ++ +    KY +   
Sbjct: 30531 EAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIK--WYRFGKELIQSR----KYKMSSD 30584

Query: 290   GTKYMLVISNVNMNDAGIYSL----SVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTA 345
             G  + L +      D G+Y+      VG+   S++L +   P    G   P+K       
Sbjct: 30585 GRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGY--PLKEKYYGAV 30642

Query: 346   VFEIRL-----SKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFS 400
                +RL      +  P   W F+G++L ++ +     + +  TH +     R + +G++ 
Sbjct: 30643 GSTLRLHVMYIGRPVPAMTW-FHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYK 30701

Query: 401   AEAGNLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMH 460
              +  N+       +D         +++   K      +E  L +  V + WK        
Sbjct: 30702 VQLSNVFGTVDAILD-------VEIQDKPDKPTGPIVIEALLKNSAV-ISWKPPAD---D 30750

Query: 461   GTKYSMNH--------EGKRAELIIEDAQLS---------DGGEYTVVAMQD----GDPT 499
             G  +  N+        EG   +L+     ++         + G Y  V+ Q+     DP 
Sbjct: 30751 GGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPL 30810

Query: 500   EYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVL-------NDEKVEGVWLKDGKE 552
             E  S  I+    +    K G       T    + CVV           K+   +L+  +E
Sbjct: 30811 EVSSVVII----KSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEK-RE 30865

Query: 553   ITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAK----GTESEASVFI------ADPP 602
                   + +  +  + + +F         +Y FR K    G ESE S         +D P
Sbjct: 30866 KKQNKWISVTTE-EIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVP 30924

Query: 603   TIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEE---RVSMERG 659
                P   E L    + V+    A +     G P P V WY+ G E+  +    R+   +G
Sbjct: 30925 IQAPHFKEEL--RNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKG 30982

Query: 660   EDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSV-----LDRPKPPQGRVEFLELS 714
                 L+ I++   +D+ +  ++  N  GS + T  L V     +  PK  +G      L 
Sbjct: 30983 GYHQLI-IASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALR 31041

Query: 715   GSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQF 774
             G  V +K   P      PV  +   +  +      ++       +    N VE   A  +
Sbjct: 31042 GEVVSIK--IPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFY 31099

Query: 775   RILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVL 834
              + A N  G+    +T E+   +  +PP      +V+DV++++V +TW  P  DGG+ + 
Sbjct: 31100 VVCAKNRFGIDQ--KTVELDVADVPDPPRGV---KVSDVSRDSVNLTWTEPASDGGSKIT 31154

Query: 835   GYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSV 894
              YIVE+    +  W+ V +   + T+ TV  L   T Y+FRVIA NK G  +PS PS   
Sbjct: 31155 NYIVEKCATTAERWLRVGQ--ARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPT 31212

Query: 895   VAKDPVKPPGLVQDLHVSDSSNSSISLA 922
             + K+  K   +  D  V ++   S++ A
Sbjct: 31213 ITKED-KTRAMNYDEEVDETREVSMTKA 31239



 Score = 99.0 bits (245), Expect = 3e-20
 Identities = 146/681 (21%), Positives = 262/681 (38%), Gaps = 70/681 (10%)

Query: 70   VEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKLEP 129
            +EKP+P+T   G+       V G  +    W ++ G  +   +K     INK   LK+  
Sbjct: 6648 IEKPEPMTVTTGNPFALECVVTGTPELSAKWFKD-GRELSADSKHHITFINKVASLKIPC 6706

Query: 130  LTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPKKKQKKVANEK 189
                D   Y     N    +  TVS+ V++            +  PP+  +K K V N  
Sbjct: 6707 AEMSDKGLYSFEVKNSVGKSNCTVSVHVSD------------RIVPPSFIRKLKDV-NAI 6753

Query: 190  EMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVEVEAIRILKPLEDKETKVDT 249
                ++ +        + + + F D   ++   K      E      L  LE  +T + T
Sbjct: 6754 LGASVVLECRVSGSAPISVGW-FQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYT 6812

Query: 250  TVVFD--------CIMELKDP--------NVKMI---------WIKGTEPLRIQYSLGKY 284
             V  +         ++ +++P        +V+++          I+GT P ++++  G  
Sbjct: 6813 CVAANVAGSDECSAVLTVQEPPSFEQTPDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSR 6872

Query: 285  DVKQMGTKYM--------LVISNVNMNDAGIYSLSVGDKRMSAELTV---LDEPLKFLGE 333
            ++    +  +        L +  V   ++G YS  V +   SA  T    + EP  F+  
Sbjct: 6873 ELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKR 6932

Query: 334  MKPVKVTERQTAVFEIRLSKKEPNFV-WKFNGKELKRDDKYEITVSEDGLTHTLKIKDAR 392
            +    V      V E   +   P  V W  +   + + ++  IT++E      L+I ++ 
Sbjct: 6933 LADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTI--LEILEST 6990

Query: 393  LSDSGEFSA----EAGNLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELT-SKDV 447
            + D  ++S     EAG  + +A +++   P  F+  L++V       A L+C++  + ++
Sbjct: 6991 IEDYAQYSCLIENEAGQDICEALVSVLEPPY-FIEPLEHVEAVIGEPATLQCKVDGTPEI 7049

Query: 448  TLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIV 507
             + W K+   L     Y M  +   A L+I     SD GEY+  A  D       S+A++
Sbjct: 7050 RISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKA--DNSVGAVASSAVL 7107

Query: 508  TVEERLAT--VKSGMSDVHAATGSPAEL-CVVLNDEKVEGVWLKDGKEITDLPGMQIVKQ 564
             ++ R         + DVH   G P    C +   E ++  W KDG  + D   +Q    
Sbjct: 7108 VIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFV 7167

Query: 565  GAVHKLIFPSMGPEHEGKYTFRAK---GTESEASVFIADPPTIDPSVLEALAAHAITVKV 621
              V  L        H G+Y   A    GT S ++  I     + P     L   ++ + +
Sbjct: 7168 HNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFF--DLKPVSVDLAL 7225

Query: 622  GHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLK 681
            G +   K    G    K+TW KD  E+       M   E+ A LT+    + D+G     
Sbjct: 7226 GESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCY 7285

Query: 682  LKNDHGSATATLHLSVLDRPK 702
              N  G  + +  L V + P+
Sbjct: 7286 ASNIAGKDSCSAQLGVQEPPR 7306



 Score = 98.2 bits (243), Expect = 5e-20
 Identities = 145/714 (20%), Positives = 274/714 (38%), Gaps = 108/714 (15%)

Query: 3    TIHSRQMLQEHVSMEFSSSTTHVQTFSQTTKIVGEEVVRRKSSSIVEFFSLVTRSSNIPA 62
            T+ +   L   VS EF   TT V     T K   EE    +S  +V   + +T     P 
Sbjct: 1023 TVSTSCYLAVQVSEEFEKETTAV-----TEKFTTEEKRFVESRDVVMTDTSLTEEQAGPG 1077

Query: 63   GDSVPEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESA--KIFYDSIN 120
              + P F+ KP      EG   VF  +V GN KPH+ WK+ SG+P+      K+ Y+   
Sbjct: 1078 EPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKK-SGVPLTTGYRYKVSYNKQT 1136

Query: 121  KEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPKK 180
             E  L +    +DD+  Y  +  N H +   + SLL     E+ D++ ++K +     + 
Sbjct: 1137 GECKLVISMTFADDAGEYTIVVRNKHGETSASASLL-----EEADYELLMKSQQEMLYQT 1191

Query: 181  KQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVEVEAIRILKPL 240
            +      E ++ E        ++EK   EY         ++   ++KK+  + + +   +
Sbjct: 1192 QVTAFVQEPKVGETAPGFVYSEYEK---EYE--------KEQALIRKKMAKDTVVVRTYV 1240

Query: 241  EDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNV 300
            ED+E  + +          ++  +K           I+Y + K  ++++           
Sbjct: 1241 EDQEFHISS---------FEERLIK----------EIEYRIIKTTLEEL----------- 1270

Query: 301  NMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKE-PNFV 359
             + + G   ++V      A  +  D        +K  ++ E     F  ++S    P   
Sbjct: 1271 -LEEDGEEKMAVDISESEAVESGFDS------RIKNYRILEGMGVTFHCKMSGYPLPKIA 1323

Query: 360  WKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEA----GNLVQKAQLTID 415
            W  +GK +K  ++Y++   +DG   +L+I      D G ++A A    GN +   +L ++
Sbjct: 1324 WYKDGKRIKHGERYQMDFLQDGRA-SLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVE 1382

Query: 416  -RIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRAE 474
               P+   + +  +    R R+     ++   + +   +     M   + S         
Sbjct: 1383 PAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMS--------- 1433

Query: 475  LIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVH--AATGSPAE 532
                 A++S G       +++ D ++          ERL      +  V      G  A 
Sbjct: 1434 ----PARMSPGRR-----LEETDESQL---------ERLYKPVFVLKPVSFKCLEGQTAR 1475

Query: 533  LCV-VLNDEKVEGVWLKDGKEIT-DLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGT 590
              + V+     E  W  DG++I  D     ++K+     LI     P   G++T  A+  
Sbjct: 1476 FDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNR 1535

Query: 591  ESEASVFI-----ADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDG 645
               +S+ +     A    + P  +E L    + +K G    +KV   G P P + W K+ 
Sbjct: 1536 AGRSSISVILTVEAVEHQVKPMFVEKLKN--VNIKEGSRLEMKVRATGNPNPDIVWLKNS 1593

Query: 646  MEVTEEE--RVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSV 697
              +   +  ++ +E  + +A L I + V +DS        N  G  T    ++V
Sbjct: 1594 DIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNV 1647



 Score = 95.9 bits (237), Expect = 2e-19
 Identities = 152/639 (23%), Positives = 238/639 (37%), Gaps = 111/639 (17%)

Query: 430   VKERSRACLECELTSKDV-TLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEY 488
             VK  +  CL+  +  K + T+ WKKDG LL       M  +     L +      D G+Y
Sbjct: 19307 VKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDY 19366

Query: 489   TVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCV-VLNDEKVEGVW- 546
             T+             TA  +   + AT+K  + D     G PA + +  +  ++    W 
Sbjct: 19367 TI-------------TAENSSGSKSATIKLKVLD---KPGPPASVKINKMYSDRAMLSWE 19410

Query: 547   --LKDG----------KEITDLPGMQIVKQG------AVHKLIFPSMGPEHEGKYTFRAK 588
               L+DG          K  T  P    V         +V KLI       HE ++   A+
Sbjct: 19411 PPLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLI-----EGHEYQFRICAE 19465

Query: 589   G---------TESEASVFIADPP-TIDPSVLEALAAHAITVKVGHTAHIK-VPFRGKPLP 637
                       TE   +    DPP   DP V+  +    +TV     A     P  G  L 
Sbjct: 19466 NKYGVGDPVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLE 19525

Query: 638   K-----VTWYKDGMEVTEEERVS----MERGEDQALLTISNCVREDSGLILLKLKNDHGS 688
             K     V W K   +   E  +      E  E +  +T  N             K   G 
Sbjct: 19526 KRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAIN-------------KAGPGK 19572

Query: 689   ATATLHLSVLDRPKPPQGRVEF---LELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGK 745
              +     +    P+ P G   F    + + S V + W  P  +GG P+  ++VE +    
Sbjct: 19573 PSDASKAAYARDPQYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADS 19632

Query: 746   KSWIKIGEVDG-KVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLET-EEVFAGNPIEPPG 803
              +W++       + T F    + E   YQFR+ AVN  G SDP +  ++ +  + + PP 
Sbjct: 19633 DNWVRCNLPQNLQKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPE 19692

Query: 804   --FASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKC 861
                 +  + T + +  VT+    P +    P + +     K   NL   +  D       
Sbjct: 19693 GELDADLRKTLILRAGVTMRLYVPVKGRPPPKITW----SKPNVNLRDRIGLD------- 19741

Query: 862   TVDGLLEDTEYE--FRVIAVNKAGPGQPSVPSSSVVAKDP-------VKPPGLVQDLHVS 912
                  ++ T+++   R   VNK   G+  +   +   K         +  PG   ++ V 
Sbjct: 19742 -----IKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVK 19796

Query: 913   DSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQK 970
             + S  S  + W  P    G P   Y+++ R  + K WS  T    S T + V  L E + 
Sbjct: 19797 EISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTVTT-ECSKTSFRVANLEEGKS 19855

Query: 971   YFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSAR 1009
             YFFR+ A NE G+G+P E    V+A   P  P  DL  R
Sbjct: 19856 YFFRVFAENEYGIGDPGETRDAVKASQTP-GPVVDLKVR 19893



 Score = 93.2 bits (230), Expect = 1e-18
 Identities = 145/690 (21%), Positives = 261/690 (37%), Gaps = 111/690 (16%)

Query: 52   SLVTRSSNIPAGDSVPEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKES 111
            +L T S  I      P F +   PVT  EG+       VQG+    I W + +G  IK S
Sbjct: 8331 ALCTSSIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLK-AGREIKPS 8389

Query: 112  AKIFYDSINKEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLK 171
             +  +   +   VL+L  +   DS +Y C ASN               G +    K  +K
Sbjct: 8390 DRCSFSFASGTAVLELRDVAKADSGDYVCKASN-------------VAGSDTTKSKVTIK 8436

Query: 172  KRAPPAPKKKQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVEV 231
             +   AP  K+  V      +                                     E 
Sbjct: 8437 DKPAVAPATKKAAVDGRLFFVS------------------------------------EP 8460

Query: 232  EAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGT 291
            ++IR+++          TT  F   +   DP   + W KG    R     G+  + Q G 
Sbjct: 8461 QSIRVVEK---------TTATFIAKVG-GDPIPNVKWTKGK--WRQLNQGGRVFIHQKGD 8508

Query: 292  KYMLVISNVNMNDAGIYSLSVGDKRMSAELTV---LDEPLKFLGEMKPVKVTERQTAVFE 348
            +  L I +    D+G+Y     ++    E  V   +DE  K       ++   ++T + +
Sbjct: 8509 EAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIEGDLRAMLKKTPILK 8568

Query: 349  IRLSKKEPNFVWKF-NGKELKRDDKYE-----------------ITVSEDGLTHTLKIKD 390
                ++E   + +     + K  +KY                  +  S++  TH L+I++
Sbjct: 8569 KGAGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRLEIEE 8628

Query: 391  ARLSDSGEFSAEAGNLVQKAQLTIDRI-PIKFVSNLKNVRVKERSRACLECELTSK--DV 447
               S+  E   E   LV   Q  + +  P+  + +++N  V + + A  E ++     ++
Sbjct: 8629 IERSERDEKEFE--ELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDAVFEIDIKINYPEI 8686

Query: 448  TLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIV 507
             L W K  + L    K+ ++ +G R  L +++ QL D G Y +V         + ++A +
Sbjct: 8687 KLSWYKGTEKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLVC------GPHIASAKL 8740

Query: 508  TVEERLATVKSGMSDVHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAV 567
            TV E     +  + DV    G    +    +   V+  W ++G+ +      +   +  V
Sbjct: 8741 TVIE--PAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRHKTEVEHKV 8798

Query: 568  HKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHI 627
            HKL    +  E +G+YT + +  E+ A + I   P      ++ +    ++     T   
Sbjct: 8799 HKLTIADVRAEDQGQYTCKYEDLETSAELRIEAEPIQFTKRIQNIV---VSEHQSATFEC 8855

Query: 628  KVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGL--ILLKLK-N 684
            +V F       VTWYK   E+TE ++ +         +TI N   +D G+  ++ +L+  
Sbjct: 8856 EVSFDDAI---VTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPR 8912

Query: 685  DHGSATATLHLSV------LDRPKPPQGRV 708
                +TA L+L+       L  P  P  RV
Sbjct: 8913 GEARSTAELYLTTKEIKLELKPPDIPDSRV 8942



 Score = 92.8 bits (229), Expect = 2e-18
 Identities = 110/495 (22%), Positives = 193/495 (38%), Gaps = 34/495 (6%)

Query: 232  EAIRILKPLEDKETKV-DTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMG 290
            + I   + L+D   K  DT   F+C  E  +P VK+ W K    +   +   KY +    
Sbjct: 2172 QLITFTQELQDVVAKEKDTMATFEC--ETSEPFVKVKWYKDGMEV---HEGDKYRMHSDR 2226

Query: 291  TKYMLVISNVNMNDAGIYS-LSVGDKRM--SAELTVLDEPLKFLGEMKPVKVTERQTAVF 347
              + L I  ++ +DA  YS + V D+ +  +A+L V    ++F+ E++ ++V E  +   
Sbjct: 2227 KVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGEL 2286

Query: 348  EIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLV 407
            E  +S +     W  N  ELK + KY IT S  G    L +KD    D GE+S       
Sbjct: 2287 ECIVSPENIEGKWYHNDVELKSNGKYTIT-SRRG-RQNLTVKDVTKEDQGEYSFVIDGKK 2344

Query: 408  QKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMN 467
               +L +   PI  +  L + +V E     LE +++ + V   W KDGQ +    +  + 
Sbjct: 2345 TTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIV 2404

Query: 468  HEGKRAELIIEDAQLSDGGEYT----VVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDV 523
             + +   L+IED    D G Y+     + +        YS  ++T           + DV
Sbjct: 2405 IDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVIT----------PLKDV 2454

Query: 524  HAATGSPAEL-CVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGK 582
            +   G+ A L C V   +     W  + ++I     +Q + +G   +L+        EG 
Sbjct: 2455 NVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGP 2514

Query: 583  YTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWY 642
            Y       E+  ++ +         ++  L     T        +++   G     V W 
Sbjct: 2515 YKLIVGRVETNCNLSVE-----KIKIIRGLRDLTCTETQNVVFEVELSHSG---IDVLWN 2566

Query: 643  KDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPK 702
                E+    +  +E       LT+ N +++D G        +  S   T+    + +P 
Sbjct: 2567 FKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKPL 2626

Query: 703  PPQGRVEFLELSGSC 717
              Q   E  E    C
Sbjct: 2627 TDQTVAESQEAVFEC 2641



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 147/715 (20%), Positives = 268/715 (37%), Gaps = 124/715 (17%)

Query: 72    KPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKLEPLT 131
             KP+ +T  EG+ A F     G   P ++W R+  + +  SA+    +   +   ++  + 
Sbjct: 32566 KPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQV-LSTSARHQVTTTKYKSTFEISSVQ 32624

Query: 132   SDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKR--------APPAPKKKQK 183
             + D  NY  +  N             +EG+++ +F   ++K         +PP  K  + 
Sbjct: 32625 ASDEGNYSVVVEN-------------SEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEP 32671

Query: 184   KVANEKEMLEILS-KVPKKDFEKVCMEYGFTDFRGL-LRKLKEMKKKVEVEAIRILKPLE 241
             +V + + +      K P+    K       T+ +     K++ +      +  + LK   
Sbjct: 32672 RVKSPEAVKSPKRVKSPEPSHPKAVSP---TETKPTPTEKVQHLPVSAPPKITQFLKAEA 32728

Query: 242   DKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVN 301
              KE    T VV   ++  K+    + W K  + L+ +    ++     GT Y L I+N+ 
Sbjct: 32729 SKEIAKLTCVVESSVLRAKE----VTWYKDGKKLK-ENGHFQFHYSADGT-YELKINNLT 32782

Query: 302   MNDAGIYSLSVGDKRMSAE--LTVLDEPLKFLGEM------------------------- 334
              +D G Y   +  +  +++  L  + +  K + E                          
Sbjct: 32783 ESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEP 32842

Query: 335   --------KPVKVTERQ--------TAVFEIRLS-KKEPNFVWKFNGKELKRDDKYEITV 377
                     KPV VT  Q         A F ++ + +  P  +W  +GK + +  KY++  
Sbjct: 32843 KAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKL-- 32900

Query: 378   SEDGLTHTLKIKDARLSDSGEFSA----EAGNLVQKAQLTIDRIP---IKFVSNLKNVRV 430
             SED     L+I     SDSG ++      AG++    +LTI  I     + VS  K   +
Sbjct: 32901 SEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEI 32960

Query: 431   KERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTV 490
               + +A ++ E++ K +     K  +      K ++  E  +  LI E+ + S       
Sbjct: 32961 TPQKKAVVQEEISQKALRSEEIKMSEAKSQ-EKLALKEEASKV-LISEEVKKSAATSLEK 33018

Query: 491   VAMQDGDPTEYYSTAIVTVEERL-ATVKSGMSDVHAATGSPAELCVVLNDEKVEGV-WLK 548
               + +    E   T+  + E R  A +K+  + +    G    L +  N      V W+ 
Sbjct: 33019 SIVHE----EITKTSQASEEVRTHAEIKAFSTQMSINEGQ--RLVLKANIAGATDVKWVL 33072

Query: 549   DGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTE---------------SE 593
             +G E+T+    +    G+   L         EG  T  +K  E               S+
Sbjct: 33073 NGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSD 33132

Query: 594   ASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEER 653
             A  FI+ P              +  +  G          G+P P++ W+K+ + ++    
Sbjct: 33133 APAFISQP-------------RSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSN 33179

Query: 654   VSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRV 708
             VS+ R  +   L I N    DSG   +K KN  G  +AT  L VL   + P   V
Sbjct: 33180 VSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREV 33234



 Score = 83.6 bits (205), Expect = 1e-15
 Identities = 80/296 (27%), Positives = 128/296 (43%), Gaps = 15/296 (5%)

Query: 417   IPIKFVSNLKNVRVKER----SRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKR 472
             +P+KFV  +K++ + E     S A  EC ++       W KDG  +    K+    +GK 
Sbjct: 11113 VPLKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKD 11172

Query: 473   AELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAE 532
              +L I D QLSD GEYT V ++ G+  +  +  +V  E  +  VK+   +V    G P  
Sbjct: 11173 RKLHIIDVQLSDAGEYTCV-LRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLY 11231

Query: 533   LCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQ--GAVHKLIFPSMGPEHEGKYTFRAKGT 590
             L   LN E+ + VW KDGK + + PG +IV    G +  L          G YT   +  
Sbjct: 11232 LSCELNKER-DVVWRKDGKIVVEKPG-RIVPGVIGLMRALTINDADDTDAGTYTVTVENA 11289

Query: 591   ES-EASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVT 649
              + E S  +     I   +++ +      VK   TA        K  P + W+K   E+ 
Sbjct: 11290 NNLECSSCVKVVEVIRDWLVKPIRDQ--HVKPKGTAIFACDI-AKDTPNIKWFKGYDEIP 11346

Query: 650   EE--ERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKP 703
              E  ++  + R  +   L I N + ED     ++++     A  TL    ++  KP
Sbjct: 11347 AEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGEREVELLKP 11402



 Score = 83.6 bits (205), Expect = 1e-15
 Identities = 150/648 (23%), Positives = 250/648 (38%), Gaps = 101/648 (15%)

Query: 699   DRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKV 758
             D+P  P G +E L +S   V ++W+ P+ +GG+ +  + VE R  G  +W K  +   K 
Sbjct: 30429 DKPSQP-GELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKD 30487

Query: 759   TNFSTNKVEEGKAYQFRILAVNSEGVSDPLETE-----EVFAGNPIEPPGFASQPQVTDV 813
               F+   + E   Y+FR+ A N  G+S P  T      ++ +G   E PG   + ++ DV
Sbjct: 30488 KQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSG---EAPGI--RKEMKDV 30542

Query: 814   TKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKC---------TVD 864
             T           T+ G A  L   +  R      W    K+ IQ  K          T+ 
Sbjct: 30543 T-----------TKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLT 30591

Query: 865   GLLEDTEYE--FRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLA 922
              + E+ E E  +  IA N+ G  + S  S  ++   P   PG         +  S++ L 
Sbjct: 30592 VMTEEQEDEGVYTCIATNEVGEVETS--SKLLLQATPQFHPGYPLKEKYYGAVGSTLRLH 30649

Query: 923   WREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGT---CYTVGGLIERQKYF--FRIRA 977
                     P   +    +     E      I I  T    + V   ++R+ +   ++++ 
Sbjct: 30650 VMYIGRPVPAMTWFHGQKLLQNSE-----NITIENTEHYTHLVMKNVQRKTHAGKYKVQL 30704

Query: 978   VNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDV- 1036
              N  G  + + LD  ++  P        + A LK+  V+            S  PP D  
Sbjct: 30705 SNVFGTVDAI-LDVEIQDKPDKPTGPIVIEALLKNSAVI------------SWKPPADDG 30751

Query: 1037  -IWQKDGVPTK-----GRETITKSKNHSQF---LINSTKRSDSGVY-RILLQNEFGEAR- 1085
               W  + V  K     G E    S   S     ++N T+  ++G Y R+  QN FG +  
Sbjct: 30752 GSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTE--NAGYYFRVSAQNTFGISDP 30809

Query: 1086  ---YDIHVRVADFPRP--PTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDAS 1138
                  + +  + F +P  P    +     ++  + W   P   + G    +Y + KR+  
Sbjct: 30810 LEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWK--PPASDGGAKIRNYYLEKREKK 30867

Query: 1139  TATWYTAA-ERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDL 1197
                W +   E +    ++V  L+ G +Y FRV   N  G+SE       W        ++
Sbjct: 30868 QNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESE-------W-------SEI 30913

Query: 1198  SAKLKPYEKKDWR-HAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITAN 1256
             S  + P  K D    AP F   L+   V    + T+ C   G+P+P V  Y+    I A+
Sbjct: 30914 SEPITP--KSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIAD 30971

Query: 1257  SKFW--YNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTV 1302
                +       G   L+I + T  D+  Y V   N+ G    + +L V
Sbjct: 30972 GLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEV 31019



 Score = 77.0 bits (188), Expect = 1e-13
 Identities = 74/286 (25%), Positives = 127/286 (44%), Gaps = 17/286 (5%)

Query: 327   PLKFLGEMKPVKVTERQ----TAVFEIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGL 382
             PLKF+ E+K + +TE +    +A+FE  +S       W  +G  ++   K+      DG 
Sbjct: 11114 PLKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIA--DGK 11171

Query: 383   THTLKIKDARLSDSGEFSA--EAGN--LVQKAQLTIDRIPIKFVSNL-KNVRVKERSRAC 437
                L I D +LSD+GE++     GN      A+L ++ +P++FV  L + V V +     
Sbjct: 11172 DRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLY 11231

Query: 438   LECELTSKDVTLRWKKDGQLLMHGT-KYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDG 496
             L CEL +K+  + W+KDG++++    +      G    L I DA  +D G YT V +++ 
Sbjct: 11232 LSCEL-NKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYT-VTVENA 11289

Query: 497   DPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDEKVEGVWLKDGKEITDL 556
             +  E  S+ +  VE     +   + D H      A     +  +     W K   EI   
Sbjct: 11290 NNLE-CSSCVKVVEVIRDWLVKPIRDQHVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAE 11348

Query: 557   PG--MQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIAD 600
             P    +I++ G    L   +  PE   +Y    +G    A + + +
Sbjct: 11349 PNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGE 11394



 Score = 75.5 bits (184), Expect = 3e-13
 Identities = 142/714 (19%), Positives = 258/714 (36%), Gaps = 116/714 (16%)

Query: 14    VSMEFSSSTTHVQTFSQTTKIVGEEVVR---RKSSSIVEFFSLVTRSSNIPAGDSV---P 67
             +S E  +S T++Q   Q  K + E+V +    K S      S VTR +   A + +   P
Sbjct: 32793 ISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKP 32852

Query: 68    EFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKL 127
               V   Q  T      A F  +  G  +P   W ++ G  I +  K              
Sbjct: 32853 VIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKD-GKAITQGGKY------------- 32898

Query: 128   EPLTSDDSDNYKCIASNDHADA-IYTVSLLVTEGQEKMDFKKMLKKRAPPAPKKKQKKVA 186
               L+ D    +  I   D +D+ +YT ++  + G      K  +K         + +KV+
Sbjct: 32899 -KLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKA----IKDTEAQKVS 32953

Query: 187   NEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVEVEAIRILKPLEDKETK 246
              +K                               ++   KK V  E I   K L  +E  
Sbjct: 32954 TQKTS-----------------------------EITPQKKAVVQEEIS-QKALRSEE-- 32981

Query: 247   VDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAG 306
                              +KM   K  E L ++    K  + +   K     +  ++  + 
Sbjct: 32982 -----------------IKMSEAKSQEKLALKEEASKVLISEEVKKS----AATSLEKSI 33020

Query: 307   IYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVWKFNGKE 366
             ++       + S E+    E   F  +M    + E Q  V +  ++    +  W  NG E
Sbjct: 33021 VHEEITKTSQASEEVRTHAEIKAFSTQMS---INEGQRLVLKANIAGAT-DVKWVLNGVE 33076

Query: 367   LKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSA----EAGNLVQKAQLTIDRI---PI 419
             L   ++Y   VS  G   TL IK A   D G  +     + G +  +  LT+ +      
Sbjct: 33077 LTNSEEYRYGVS--GSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAP 33134

Query: 420   KFVSNLKNVRVKERSRACLECELTSK-DVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIE 478
              F+S  ++  + E       CE++ +    + W K+   +   +  S++       L I 
Sbjct: 33135 AFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIR 33194

Query: 479   DAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLN 538
             +A +SD G+YT+ A          ++ +V     L  V+    +V   T     L    +
Sbjct: 33195 NASVSDSGKYTIKAKNFRGQCSATASLMV-----LPLVEEPSREVVLRTSGDTSLQGSFS 33249

Query: 539   DEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFI 598
              + V+   +   K+             ++ ++ F SM  +             S + + I
Sbjct: 33250 SQSVQ---MSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGI 33306

Query: 599   ADPPTIDPSVLEALAAHA-------------ITVKVGHTAHIKVPFRGKPLPKVTWYKDG 645
             ++   ++ S  + L A               I++  G    +   F G+P P+VTW   G
Sbjct: 33307 SNMTQLESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGG 33366

Query: 646   MEVTEEE--RVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSV 697
              ++  +E  R  +E  +D   L I +  ++D GL  L L N+ GS +AT+++ +
Sbjct: 33367 RKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 33420



 Score = 73.9 bits (180), Expect = 9e-13
 Identities = 141/679 (20%), Positives = 253/679 (37%), Gaps = 92/679 (13%)

Query: 54   VTRSSNIPAGDSVP----EFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIK 109
            VT ++ +PA   +P      V   + VT  EG+       + G   P ++W RE    I+
Sbjct: 926  VTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYRED-YQIE 984

Query: 110  ESAKIFYDSINKEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKM 169
             S        +    L +    ++DS  + C A N+ A  + T   L  +  E+ +    
Sbjct: 985  SSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNE-AGTVSTSCYLAVQVSEEFE---- 1039

Query: 170  LKKRAPPAPKKKQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKV 229
                       K+     EK   E    V  +D   V  +   T+        ++     
Sbjct: 1040 -----------KETTAVTEKFTTEEKRFVESRDV--VMTDTSLTE--------EQAGPGE 1078

Query: 230  EVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQM 289
                  I KP+  K  +   +VVF C +   +P   + W K   PL   Y       KQ 
Sbjct: 1079 PAAPYFITKPVVQKLVE-GGSVVFGCQVG-GNPKPHVYWKKSGVPLTTGYRYKVSYNKQT 1136

Query: 290  GTKYMLVISNVNMNDAGIYSLSVGDKR--MSAELTVLDEP---LKFLGEMKPVKVTERQT 344
            G +  LVIS    +DAG Y++ V +K    SA  ++L+E    L    + + +  T+   
Sbjct: 1137 G-ECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEMLYQTQVTA 1195

Query: 345  AVFEIRLSKKEPNFVWKFNGKELKR---------------------DDKYEITVSEDGLT 383
             V E ++ +  P FV+    KE ++                     D ++ I+  E+ L 
Sbjct: 1196 FVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLI 1255

Query: 384  HTLKIKDARLSDSGEFSAEAGNLVQKAQLT-IDRIPIKFVSNLKNVRVKERSRACLECEL 442
              ++ +  + +   E   E G       ++  + +   F S +KN R+ E       C++
Sbjct: 1256 KEIEYRIIKTTLE-ELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKM 1314

Query: 443  TSKDVT-LRWKKDGQLLMHGTKYSMNH-EGKRAELIIEDAQLSDGGEYTVVAMQDGDPTE 500
            +   +  + W KDG+ + HG +Y M+  +  RA L I      D G YT  A      + 
Sbjct: 1315 SGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFA------SN 1368

Query: 501  YYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQ 560
                AI + +  +       +  +  T  P      L+   V          I   P   
Sbjct: 1369 IKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSV------SRSPIRMSPARM 1422

Query: 561  IVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVK 620
               + +  ++    M P    + T  ++       VF+  P  +    LE          
Sbjct: 1423 SPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKP--VSFKCLE---------- 1470

Query: 621  VGHTAHIKVPFRGKPLPKVTWYKDGMEVTEE--ERVSMERGEDQALLTISNCVREDSGLI 678
             G TA   +   G+P+P+  W+ DG ++  +   +V ++    Q+L+ +      DSG  
Sbjct: 1471 -GQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVP-ATPSDSGEW 1528

Query: 679  LLKLKNDHGSATATLHLSV 697
             +  +N  G ++ ++ L+V
Sbjct: 1529 TVVAQNRAGRSSISVILTV 1547



 Score = 68.2 bits (165), Expect = 5e-11
 Identities = 46/164 (28%), Positives = 76/164 (46%), Gaps = 7/164 (4%)

Query: 546 WLKDGKEITD--LPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRA---KGTESEASVFIAD 600
           W +DG+ I+   LPG+QI       KL  P++   + G+Y+ +A    G  +  +  +  
Sbjct: 39  WFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVK 98

Query: 601 PPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGE 660
             T  P+ ++ L   ++TV+ G    ++V   G P P V +Y+DG E+       + +  
Sbjct: 99  AETAPPNFVQRL--QSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEG 156

Query: 661 DQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPP 704
           D   L I+    EDSG   +   N  G AT+T  L V    + P
Sbjct: 157 DLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVP 200



 Score = 67.4 bits (163), Expect = 9e-11
 Identities = 105/466 (22%), Positives = 185/466 (39%), Gaps = 44/466 (9%)

Query: 867   LEDTEYEFRVIAVN---KAGPGQPSVPSSSV-----------VAKDPVKPPGLVQDLHVS 912
             +E+TE+   ++  N   K   G+  V  S+V           +   P KP G +    + 
Sbjct: 30677 IENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIV---IE 30733

Query: 913   DSSNSSISLAWREPAE--GDPPSGYILEM-RAEDTKEWSKCTKIPISGTCYTVGGLIERQ 969
                 +S  ++W+ PA+  G   + Y++E   A++  EW   +      TC  V  L E  
Sbjct: 30734 ALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVN-LTENA 30792

Query: 970   KYFFRIRAVNEAGVGEPVELDKGVRAMPP---PAAP-KFDLSARLKSHMVVRAGTALCIH 1025
              Y+FR+ A N  G+ +P+E+   V    P   P AP K  ++A  K   VV    A    
Sbjct: 30793 GYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVV----AWKPP 30848

Query: 1026  AAFSGSPPPDVIWQK-DGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEA 1084
             A+  G+   +   +K +    K     T+    + F + +        +R+  +N  GE+
Sbjct: 30849 ASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGES 30908

Query: 1085  RYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYT 1144
              +     +++   P +++ +  + P+      N +   Q +      +         WY 
Sbjct: 30909 EWS---EISEPITPKSDVPI--QAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYR 30963

Query: 1145  AAERVFSN--KYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLK 1202
               + + ++  KY +     G  Y+  ++A     D+     R T   N+      +A L+
Sbjct: 30964 QGKEIIADGLKYRIQEFKGG--YHQLIIASVTDDDATVYQVRAT---NQGGSVSGTASLE 31018

Query: 1203  PYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYN 1262
               E     H P+ +  +     LRG+  ++   F G P P +T  KG   I  N  +   
Sbjct: 31019 -VEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVI 31077

Query: 1263  STSGVCTLVIPT-CTLKDSGDYSVLVENELGKDRSSCTLTVYDKDD 1307
              T    +LV P     KD+G Y V  +N  G D+ +  L V D  D
Sbjct: 31078 VTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPD 31123



 Score = 62.8 bits (151), Expect = 2e-09
 Identities = 36/115 (31%), Positives = 56/115 (48%), Gaps = 1/115 (0%)

Query: 1213 PRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVI 1272
            P  V+ LK  TV+ G+  T+ C   G P PTVT Y+ D  I ++  F     SG+  L+I
Sbjct: 943  PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMI 1002

Query: 1273 PTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDD-KSVVASITESLQKKSKHLM 1326
                 +DSG ++    NE G   +SC L V   ++ +    ++TE    + K  +
Sbjct: 1003 REAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFV 1057



 Score = 62.8 bits (151), Expect = 2e-09
 Identities = 127/605 (20%), Positives = 241/605 (39%), Gaps = 84/605 (13%)

Query: 67    PEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLK 126
             P   ++ + VT   G+ A    ++ G   P I W R  G  + +S K    S  + H L 
Sbjct: 30533 PGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYR-FGKELIQSRKYKMSSDGRTHTLT 30591

Query: 127   LEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPKKKQKKVA 186
             +     +D   Y CIA+N+  + + T S L+ +   +      LK++   A     +   
Sbjct: 30592 VMTEEQEDEGVYTCIATNEVGE-VETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLR--- 30647

Query: 187   NEKEMLEILSKVPK----------KDFEKVCME----YGFTDFRGLLRKLKEMKKKVE-- 230
                 ++ I   VP           ++ E + +E    Y     + + RK    K KV+  
Sbjct: 30648 --LHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLS 30705

Query: 231   -----VEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTE---PLRIQYSLG 282
                  V+AI  ++ ++DK  K    +V + +++    +  + W    +        Y + 
Sbjct: 30706 NVFGTVDAILDVE-IQDKPDKPTGPIVIEALLK---NSAVISWKPPADDGGSWITNYVVE 30761

Query: 283   KYDVKQMGTKYMLVISNVNMNDAGIYSLSVGDK---RMSAELTV-LDEPLKFLGEMKPVK 338
             K + K+ G ++ LV S +++    I +L+       R+SA+ T  + +PL+    +    
Sbjct: 30762 KCEAKE-GAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKS 30820

Query: 339   VTERQTAVFE---IRLSKKEPNFVWK--------------FNGKELKRDDKYEITVSE-- 379
               E+  A  +     ++K      WK                 +E K++    +T  E  
Sbjct: 30821 PFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIR 30880

Query: 380   ----------DGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPIKFVSNLKNVR 429
                       +GL +  ++K   L    E+S  +  +  K+ + I      F   L+N+ 
Sbjct: 30881 ETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQ--APHFKEELRNLN 30938

Query: 430   VKERSRACLECELTSKDVTL-RWKKDG-QLLMHGTKYSMNH-EGKRAELIIEDAQLSDGG 486
             V+ +S A L C++T     + +W + G +++  G KY +   +G   +LII      D  
Sbjct: 30939 VRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDAT 30998

Query: 487   EYTVVAMQDGDPTEYYSTAIVTVEERLATVKS--GMSDVHAATGSPAELCVVLNDEKVEG 544
              Y V A   G      ++  V V  ++   K+  GM  VHA  G    + +  + +    
Sbjct: 30999 VYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPV 31058

Query: 545   VWLKDGKEITDLPG-MQIVKQGAVHKLIFPSMGPEHE--GKYTFRAKG----TESEASVF 597
             +  + G+++ D  G  Q++   +   L+FP+ G E +  G Y   AK      +    + 
Sbjct: 31059 ITWQKGQDLIDNNGHYQVIVTRSFTSLVFPN-GVERKDAGFYVVCAKNRFGIDQKTVELD 31117

Query: 598   IADPP 602
             +AD P
Sbjct: 31118 VADVP 31122



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 70/309 (22%), Positives = 126/309 (40%), Gaps = 28/309 (9%)

Query: 1001  APKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTK--GRETITKSKNHS 1058
             AP F    R ++   +  G  +      SG P P++ W K+ +P       +I++S+N  
Sbjct: 33133 APAFISQPRSQN---INEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVY 33189

Query: 1059  QFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNH 1118
                I +   SDSG Y I  +N  G+      + V         L L EE    V L  + 
Sbjct: 33190 SLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV---------LPLVEEPSREVVLRTSG 33240

Query: 1119  SPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDS 1178
                +Q    +  + M      A++ +     FS+  + + +   +       + + + +S
Sbjct: 33241 DTSLQGSFSSQSVQMSASKQEASFSS-----FSSS-SASSMTEMKFASMSAQSMSSMQES 33294

Query: 1179  --EPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPH-TVLRGQDCTMTCA 1235
               E   S    + N  Q++  ++K+    K   R  P  +  L    ++  G+  T+ CA
Sbjct: 33295 FVEMSSSSFMGISNMTQLESSTSKML---KAGIRGIPPKIEALPSDISIDEGKVLTVACA 33351

Query: 1236  FLGNPRPTVTLYKGDVNITANS--KFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGK 1293
             F G P P VT   G   I +    +F   +T  + TL+I     +D G Y++ + NE G 
Sbjct: 33352 FTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGS 33411

Query: 1294  DRSSCTLTV 1302
             D ++  + +
Sbjct: 33412 DSATVNIHI 33420



 Score = 57.4 bits (137), Expect = 9e-08
 Identities = 77/307 (25%), Positives = 121/307 (39%), Gaps = 34/307 (11%)

Query: 1001  APKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETI--TKSKNHS 1058
             AP+  L  R++SH V   G            P  +V W  +GV  +    I  T +    
Sbjct: 32373 APRITL--RMRSHRVP-CGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVL 32429

Query: 1059  QFLINSTKRSDSGVYRILLQNEFGEAR--YDIHVRVADFPRPPTNLRLFEEVPNTVTLTW 1116
                I      DSG YR +  N  GEA     + V   D+    +  R  EEVP +V    
Sbjct: 32430 TLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRR-DEEVPRSVF--- 32485

Query: 1117  NHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIG 1176
                P++    EA+ +   +  S     ++   V S        L   ++      ++   
Sbjct: 32486 ---PELTRT-EAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAAL 32541

Query: 1177  DSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAF 1236
             + + L+ + T           + K+K         A R +T  +  TV  G+    +C  
Sbjct: 32542 EEKSLEEKST-----------TRKIKT------TLAARILTKPRSMTVYEGESARFSCDT 32584

Query: 1237  LGNPRPTVT-LYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDR 1295
              G P PTVT L KG V ++ +++    +T    T  I +    D G+YSV+VEN  GK  
Sbjct: 32585 DGEPVPTVTWLRKGQV-LSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQE 32643

Query: 1296  SSCTLTV 1302
             +  TLT+
Sbjct: 32644 AEFTLTI 32650



 Score = 55.8 bits (133), Expect = 3e-07
 Identities = 99/494 (20%), Positives = 176/494 (35%), Gaps = 85/494 (17%)

Query: 316  RMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSK-KEPNFVWKFNGKELKRDDKYE 374
            R+ A + +   P   +  +K V V E ++   E  +S    P   W     +++    ++
Sbjct: 931  RVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQ 990

Query: 375  ITVSEDGLTHTLKIKDARLSDSGEFSA----EAGNLVQKAQLTID----------RIPIK 420
            IT  + G+   L I++A   DSG F+     EAG +     L +            +  K
Sbjct: 991  ITF-QSGIAR-LMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEK 1048

Query: 421  FVSNLKNVRVKERSRACLECELTSKDVT-------------------------------- 448
            F +  K   V+ R     +  LT +                                   
Sbjct: 1049 FTTEEKRF-VESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGG 1107

Query: 449  -----LRWKKDGQLLMHGTKYSMNHEGKRAE--LIIEDAQLSDGGEYTVVAMQDGDPTEY 501
                 + WKK G  L  G +Y +++  +  E  L+I      D GEYT+V       T  
Sbjct: 1108 NPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETS- 1166

Query: 502  YSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQI 561
             ++A +  E     +     ++   T   A +      E   G    + ++  +     I
Sbjct: 1167 -ASASLLEEADYELLMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALI 1225

Query: 562  VKQGAVHKLIFPSMGPEHE-----------GKYTFRAKGT----------ESEASVFIAD 600
             K+ A   ++  +   + E            +  +R   T          E + +V I++
Sbjct: 1226 RKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISE 1285

Query: 601  PPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGE 660
               ++      +  + I   +G T H K+   G PLPK+ WYKDG  +   ER  M+  +
Sbjct: 1286 SEAVESGFDSRIKNYRILEGMGVTFHCKMS--GYPLPKIAWYKDGKRIKHGERYQMDFLQ 1343

Query: 661  D-QALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVH 719
            D +A L I   + ED G+      N  G+A  +  L V   P  P G   ++        
Sbjct: 1344 DGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYV--EPAAPLGAPTYIPTLEPVSR 1401

Query: 720  MKWKAPKDNGGRPV 733
            ++  +P+     P+
Sbjct: 1402 IRSLSPRSVSRSPI 1415



 Score = 54.3 bits (129), Expect = 8e-07
 Identities = 33/96 (34%), Positives = 41/96 (42%)

Query: 1211  HAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTL 1270
             HAPR    ++ H V  GQ+          P   V  Y   V +  +SK  Y +TSGV TL
Sbjct: 32372 HAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTL 32431

Query: 1271  VIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKD 1306
              I  C   DSG Y  +  N  G+     TL V   D
Sbjct: 32432 EILDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGD 32467



 Score = 52.8 bits (125), Expect = 2e-06
 Identities = 66/296 (22%), Positives = 108/296 (36%), Gaps = 50/296 (16%)

Query: 251   VVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSL 310
             V + C +E  D + ++ W  G   L    +  KY++       +L + ++   D G Y  
Sbjct: 31585 VKYVCKIENYDQSTQVTWYFGVRQLE---NSEKYEITYEDGVAILYVKDITKLDDGTYRC 31641

Query: 311   SVGD-------------------------------KRMSAELTVLDEPLKFLGEMKPVKV 339
              V +                               KR +  + +L+ P +F   +     
Sbjct: 31642 KVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTA 31701

Query: 340   TERQTAVFEIRLS-KKEPNFVWKFNGKELKR-DDKYEITVSEDGLTHTLKIKDARLSDSG 397
                +   F + ++   EP+  W  +G+++K  D+  + T   D   + L I      D  
Sbjct: 31702 YVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDA 31761

Query: 398   EFSAEAGNLVQ----KAQLTIDRIPIKFVSNLK--------NVRVKERSRACLECELTS- 444
             E++  A N       KA+LT+   P    S L+        N   +E    C E  ++  
Sbjct: 31762 EYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGI 31821

Query: 445   KDVTLRWKKDGQLLMHGTKYSMNHEG-KRAELIIEDAQLSDGGEYTVVAMQDGDPT 499
                TL+W+KDGQ L  G    + HEG     L I D    D G Y V A      T
Sbjct: 31822 PPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGST 31877



 Score = 52.4 bits (124), Expect = 3e-06
 Identities = 70/313 (22%), Positives = 120/313 (38%), Gaps = 39/313 (12%)

Query: 999  PAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVP-TKG---RETITKS 1054
            PAAP F ++  +   +V   G ++       G+P P V W+K GVP T G   + +  K 
Sbjct: 1079 PAAPYF-ITKPVVQKLV--EGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQ 1135

Query: 1055 KNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTL 1114
                + +I+ T   D+G Y I+++N+ GE                 +  L EE    + +
Sbjct: 1136 TGECKLVISMTFADDAGEYTIVVRNKHGET--------------SASASLLEEADYELLM 1181

Query: 1115 TWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKY-YFRVVARN 1173
                    Q    A ++   +   TA  +  +E  +  +Y     L  +K     VV R 
Sbjct: 1182 KSQQEMLYQTQVTA-FVQEPKVGETAPGFVYSE--YEKEYEKEQALIRKKMAKDTVVVRT 1238

Query: 1174 EIGDSE-PLDSRDTWLINKDQIQDLSAKLKPYEKKDWRH------------APRFVTPLK 1220
             + D E  + S +  LI + + + +   L+   ++D                  F + +K
Sbjct: 1239 YVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIK 1298

Query: 1221 PHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYN-STSGVCTLVIPTCTLKD 1279
             + +L G   T  C   G P P +  YK    I    ++  +    G  +L IP    +D
Sbjct: 1299 NYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPED 1358

Query: 1280 SGDYSVLVENELG 1292
             G Y+    N  G
Sbjct: 1359 EGIYTAFASNIKG 1371



 Score = 52.4 bits (124), Expect = 3e-06
 Identities = 29/91 (31%), Positives = 46/91 (50%), Gaps = 2/91 (2%)

Query: 1212 APRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFW--YNSTSGVCT 1269
            AP F+T      ++ G      C   GNP+P V   K  V +T   ++   YN  +G C 
Sbjct: 1081 APYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECK 1140

Query: 1270 LVIPTCTLKDSGDYSVLVENELGKDRSSCTL 1300
            LVI      D+G+Y+++V N+ G+  +S +L
Sbjct: 1141 LVISMTFADDAGEYTIVVRNKHGETSASASL 1171



 Score = 51.2 bits (121), Expect = 6e-06
 Identities = 33/109 (30%), Positives = 51/109 (46%), Gaps = 13/109 (11%)

Query: 989   LDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDG----VP 1044
             L  G+R +PP           L S + +  G  L +  AF+G P P+V W   G      
Sbjct: 33320 LKAGIRGIPPKIEA-------LPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQ 33372

Query: 1045  TKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFG--EARYDIHVR 1091
              +GR  I  + + +  +I   ++ D G+Y + L NEFG   A  +IH+R
Sbjct: 33373 EQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIR 33421



 Score = 50.8 bits (120), Expect = 8e-06
 Identities = 46/197 (23%), Positives = 84/197 (42%), Gaps = 8/197 (4%)

Query: 330 FLGEMKPVKVTERQTAVFEIRLSK-KEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKI 388
           F   ++ V V E  TA FE  +S    P   W  +G+ +       + +S       L I
Sbjct: 8   FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTI 67

Query: 389 KDARLSDSGEFSAEA----GNLVQKAQLTI--DRIPIKFVSNLKNVRVKERSRACLECEL 442
                ++SG +S +A    G     A+L +  +  P  FV  L+++ V++ S+  L+  +
Sbjct: 68  PAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRV 127

Query: 443 TSKDV-TLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEY 501
           T      +++ +DG  +     + ++ EG    L+I +A   D G Y+V A         
Sbjct: 128 TGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATS 187

Query: 502 YSTAIVTVEERLATVKS 518
            +  +V  EE +   K+
Sbjct: 188 TAELLVQGEEEVPAKKT 204



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 25/96 (26%), Positives = 49/96 (51%)

Query: 1207  KDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSG 1266
             K+   AP F++  +   +  GQ+   TC   G P P +  +K ++ I+ +S    + +  
Sbjct: 33128 KELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRN 33187

Query: 1267  VCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTV 1302
             V +L I   ++ DSG Y++  +N  G+  ++ +L V
Sbjct: 33188 VYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV 33223



 Score = 50.1 bits (118), Expect = 1e-05
 Identities = 29/91 (31%), Positives = 45/91 (49%), Gaps = 2/91 (2%)

Query: 616 AITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEE--ERVSMERGEDQALLTISNCVRE 673
           ++ V  G TA  +    G P+P+V+W++DG  ++      V +   + +A LTI    + 
Sbjct: 14  SVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKA 73

Query: 674 DSGLILLKLKNDHGSATATLHLSVLDRPKPP 704
           +SG   LK  N  G AT+T  L V     PP
Sbjct: 74  NSGRYSLKATNGSGQATSTAELLVKAETAPP 104



 Score = 50.1 bits (118), Expect = 1e-05
 Identities = 84/364 (23%), Positives = 140/364 (38%), Gaps = 55/364 (15%)

Query: 384   HTLKIKD-------ARLSDSGEFSAEAGNLVQKAQLTIDRIPIKFVSN-LKNVRVKERSR 435
             HTL  KD       AR+S  G   ++ G  V  A++ +  I I  VS  + +   +E   
Sbjct: 31527 HTLIKKDLNMVVSAARISCGGAIRSQKG--VSVAKVKVASIEIGPVSGQIMHAVGEEGGH 31584

Query: 436   ACLECELTSKDVTLR--WKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAM 493
                 C++ + D + +  W    + L +  KY + +E   A L ++D    D G Y    +
Sbjct: 31585 VKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVV 31644

Query: 494   QD-GDPTEYYSTAIVTVEE-------RLATVKSGMSDVHAATGSPAELCVVLNDEKV--- 542
              D G+ + Y    +  V E       R        +D       P E  + L ++     
Sbjct: 31645 NDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVG 31704

Query: 543   EGV---------------WLKDGKEITDLPGMQIVK-----QGAVHKLIFPSMGPEHEGK 582
             E V               W K G++I   PG    K        +++L   S+  + + +
Sbjct: 31705 ENVRFGVTITVHPEPHVTWYKSGQKIK--PGDNDKKYTFESDKGLYQLTINSVTTDDDAE 31762

Query: 583   YTFRAKGTESEAS------VFIADPPTIDP--SVLEALAAHAITVKVGHTAHIKVPFRGK 634
             YT  A+    E S      V +  PPT      + + L A+A   + G +   ++   G 
Sbjct: 31763 YTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANA-ECQEGQSVCFEIRVSGI 31821

Query: 635   PLPKVTWYKDGMEVTEEERVSM-ERGEDQALLTISNCVREDSGLILLKLKNDHGSATATL 693
             P P + W KDG  ++    + +   G D   L I + + ED+G   +   N  GS +   
Sbjct: 31822 PPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQA 31881

Query: 694   HLSV 697
             HL V
Sbjct: 31882 HLQV 31885



 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 8/117 (6%)

Query: 1213 PRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVI 1272
            P FV  L+  TV +G    +     G P P V  Y+    I ++  F  +    + +L+I
Sbjct: 104  PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLI 163

Query: 1273 PTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDD------KSVV--ASITESLQKK 1321
                 +DSG YSV   N +G+  S+  L V  +++      K++V  A I+ES Q +
Sbjct: 164  AEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTR 220



 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 28/99 (28%), Positives = 44/99 (44%), Gaps = 3/99 (3%)

Query: 997   PPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTK---GRETITK 1053
             PP  +    +  RL ++   + G ++C     SG PPP + W+KDG P       E I +
Sbjct: 31787 PPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHE 31846

Query: 1054  SKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRV 1092
               ++    I  T   D+G YR+   N  G      H++V
Sbjct: 31847 GLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 31885



 Score = 47.8 bits (112), Expect = 7e-05
 Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 3/93 (3%)

Query: 1213  PRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITA---NSKFWYNSTSGVCT 1269
             P F  PL   T   G++         +P P VT YK    I     + K+ + S  G+  
Sbjct: 31690 PEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQ 31749

Query: 1270  LVIPTCTLKDSGDYSVLVENELGKDRSSCTLTV 1302
             L I + T  D  +Y+V+  N+ G+D     LTV
Sbjct: 31750 LTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 31782



 Score = 47.4 bits (111), Expect = 9e-05
 Identities = 33/109 (30%), Positives = 46/109 (42%), Gaps = 5/109 (4%)

Query: 1212 APRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSK-FWYNSTSGVCTL 1270
            AP+    ++  TV +G D       +G P P    YK  V I  + + +WY     VC L
Sbjct: 2077 APKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCEL 2136

Query: 1271 VIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASITESLQ 1319
            VI   T +DS    V   N  G+  S   L V  K     + + T+ LQ
Sbjct: 2137 VIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQ----LITFTQELQ 2181



 Score = 47.4 bits (111), Expect = 9e-05
 Identities = 62/288 (21%), Positives = 102/288 (35%), Gaps = 37/288 (12%)

Query: 1029 SGSPPPDVIWQKDG--VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARY 1086
            +G+ P  V W KD   + + G+  I+  +N +   +    + DSG Y     NE G+   
Sbjct: 8177 TGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSC 8236

Query: 1087 DIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWY--- 1143
               + + +   PP+  +   E   TV  T  +S  ++        +      T  WY   
Sbjct: 8237 TAQLNIKERLIPPSFTKRLSE---TVEETEGNSFKLEGR------VAGSQPITVAWYKNN 8287

Query: 1144 ------TAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDL 1197
                  +  E  F N   V  +        R    N+ G         T  ++ D    L
Sbjct: 8288 IEIQPTSNCEITFKNNTLVLQV--------RKAGMNDAG-------LYTCKVSNDAGSAL 8332

Query: 1198 SAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANS 1257
                     K+ +  P F   L P TV  G+   ++C   G+    +   K    I  + 
Sbjct: 8333 CTS--SIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSD 8390

Query: 1258 KFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDK 1305
            +  ++  SG   L +      DSGDY     N  G D +   +T+ DK
Sbjct: 8391 RCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDK 8438



 Score = 47.4 bits (111), Expect = 9e-05
 Identities = 55/226 (24%), Positives = 100/226 (44%), Gaps = 30/226 (13%)

Query: 220   RKLKEMKKKVEVEAIRILK-------PLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGT 272
             R +K++K++ +   +R+L+       PL +K   V   V F   + +  P   + W K  
Sbjct: 31671 RTMKKIKRRTDT--MRLLERPPEFTLPLYNKTAYVGENVRFGVTITVH-PEPHVTWYKSG 31727

Query: 273   EPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSL----SVGDKRMSAELTVLDEPL 328
             + ++   +  KY  +     Y L I++V  +D   Y++      G+    A+LTV   P 
Sbjct: 31728 QKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPP 31787

Query: 329   KFLGEMKPV--------KVTERQTAVFEIRLSK-KEPNFVWKFNGKELKRDDKYEITVSE 379
                  ++P+        +  E Q+  FEIR+S    P   W+ +G+ L      EI    
Sbjct: 31788 PTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEII--H 31845

Query: 380   DGLT-HTLKIKDARLSDSGEF----SAEAGNLVQKAQLTIDRIPIK 420
             +GL  + L I+D    D+G +    +  AG+   +A L ++R+  K
Sbjct: 31846 EGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYK 31891



 Score = 45.4 bits (106), Expect = 4e-04
 Identities = 69/296 (23%), Positives = 111/296 (37%), Gaps = 39/296 (13%)

Query: 1032  PPPDVIWQK--DGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIH 1089
             P  +VIW K  + +   GR  I         +I +    D+G Y   L +   + +  +H
Sbjct: 12489 PGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVH 12548

Query: 1090  VRVADFPRPPTNLRLFE-EVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAER 1148
                A+F   P NL + E E    V      S  VQ          KRD  T         
Sbjct: 12549 ELAAEFISKPQNLEILEGEKAEFVCSISKESFPVQ---------WKRDDKTLE------- 12592

Query: 1149  VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKD 1208
                +KY V  +  G+K       R  +     L    T+++     +  +A L   EK  
Sbjct: 12593 -SGDKYDV--IADGKK-------RVLVVKDATLQDMGTYVVMVGAAR-AAAHLTVIEKL- 12640

Query: 1209  WRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVC 1268
                  R V PLK   V   Q+    C  +         ++ +  I  +SK+       V 
Sbjct: 12641 -----RIVVPLKDTRVKEQQEVVFNCE-VNTEGAKAKWFRNEEAIFDSSKYIILQKDLVY 12694

Query: 1269  TLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASI--TESLQKKS 1322
             TL I    L D  +Y+V + N  G++  S    + +++D  +V  +   E+++KKS
Sbjct: 12695 TLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKS 12750



 Score = 45.4 bits (106), Expect = 4e-04
 Identities = 74/329 (22%), Positives = 131/329 (39%), Gaps = 40/329 (12%)

Query: 369   RDDKYEITVSEDGLTHTLKIKDARLSDSG--EFSAEAGNLVQKAQLTIDRIPIKFVSNLK 426
             R+ K ++T + + L+       A +  +   E S E  +  +K + T+     + ++  +
Sbjct: 32512 REVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTL---AARILTKPR 32568

Query: 427   NVRVKERSRACLECELTSKDV-TLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDG 485
             ++ V E   A   C+   + V T+ W + GQ+L    ++ +     ++   I   Q SD 
Sbjct: 32569 SMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDE 32628

Query: 486   GEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDEKVEGV 545
             G Y+VV        E   T  +T+++   T K+  S     +  P     V + E V   
Sbjct: 32629 GNYSVVVENSEGKQEAEFT--LTIQKARVTEKAVTSPPRVKSPEPR----VKSPEAV--- 32679

Query: 546   WLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTID 605
               K  K +          + +  K + P+     E K T     TE    + ++ PP I 
Sbjct: 32680 --KSPKRVKS-------PEPSHPKAVSPT-----ETKPT----PTEKVQHLPVSAPPKI- 32720

Query: 606   PSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQAL- 664
                L+A A+  I  K+       V  R K   +VTWYKDG ++ E          D    
Sbjct: 32721 TQFLKAEASKEI-AKLTCVVESSV-LRAK---EVTWYKDGKKLKENGHFQFHYSADGTYE 32775

Query: 665   LTISNCVREDSGLILLKLKNDHGSATATL 693
             L I+N    D G  + ++  + G++   L
Sbjct: 32776 LKINNLTESDQGEYVCEISGEGGTSKTNL 32804



 Score = 45.1 bits (105), Expect = 5e-04
 Identities = 32/106 (30%), Positives = 42/106 (39%)

Query: 1197  LSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITAN 1256
             ++ K +P   +     P  VT L+  TV             G PRPT    K    IT  
Sbjct: 32836 VTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQG 32895

Query: 1257  SKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTV 1302
              K+  +   G   L I      DSG Y+  V+N  G   SSC LT+
Sbjct: 32896 GKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTI 32941



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 46/213 (21%), Positives = 81/213 (38%), Gaps = 6/213 (2%)

Query: 489  TVVAMQDGDPTEYYSTAIVTVEERLATVKSGMS---DVHAATGSPAELCVVLNDEKVEGV 545
            +V   + G       +AI T+++ L+   S       V A T  P+E  V      +   
Sbjct: 822  SVPKTEHGYEASIAGSAIATLQKELSATSSAQKITKSVKAPTVKPSETRVRAEPTPLPQF 881

Query: 546  WLKDGKEI-TDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTI 604
               D  +      G+++ K+  V            E  +   AK TE+       + P  
Sbjct: 882  PFADTPDTYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVT 941

Query: 605  DPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQAL 664
             P+++  L    +TV  G +  ++    G P P VTWY++  ++       +      A 
Sbjct: 942  PPTLVSGLKN--VTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIAR 999

Query: 665  LTISNCVREDSGLILLKLKNDHGSATATLHLSV 697
            L I     EDSG       N+ G+ + + +L+V
Sbjct: 1000 LMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 1032



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 73/336 (21%), Positives = 119/336 (35%), Gaps = 70/336 (20%)

Query: 1030 GSPPPDVIWQKDG---VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARY 1086
            G P P+  W  DG   V     + + K       +I     SDSG + ++ QN  G +  
Sbjct: 1482 GRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSI 1541

Query: 1087 DI--HVRVADFPRPP--------TNLRLFEEVPNTVTLTWNHSPDVQ------------- 1123
             +   V   +    P         N++    +   V  T N +PD+              
Sbjct: 1542 SVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKY 1601

Query: 1124 -------EDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTG-----------------L 1159
                     GEA   I    +  + WYTA     + + T                    +
Sbjct: 1602 PKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLI 1661

Query: 1160 LPGRKYYFRVVARNEIGDSEPLDSR---DTWLINKDQIQDLSAKLKPYEKKDWRHAPRFV 1216
            +P   Y  + +A  E+   EPL  R   + W   +  + D   + KP+ KK        +
Sbjct: 1662 IPRGTYRAKEIAAPEL---EPLHLRYGQEQW--EEGDLYDKEKQQKPFFKKK-------L 1709

Query: 1217 TPLKPHTVLRGQ-DCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTC 1275
            T L+         +C +T   +G+P   V        + A ++    +  G C+L     
Sbjct: 1710 TSLRLKRFGPAHFECRLTP--IGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVA 1767

Query: 1276 TLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVV 1311
              +DSG  +    N+ G D +S TL V  KD+KS+V
Sbjct: 1768 YSRDSGIITCRATNKYGTDHTSATLIV--KDEKSLV 1801



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 62/334 (18%), Positives = 120/334 (35%), Gaps = 32/334 (9%)

Query: 1014 MVVRAGTALCIHAAFSGSPPPDVIWQKDG--VPTKGRETITKSKNHSQFLINSTKRSDSG 1071
            + V++G      A  SG P P + W K+   + T  +            L+      D+ 
Sbjct: 3248 VTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAA 3307

Query: 1072 VYRILLQNEFGEARYD--IHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH 1129
            VY    +N++G A     + V V +   P   + ++   P  +T   +      +     
Sbjct: 3308 VYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYP--PAIITPLQDTVTSEGQPARFQ 3365

Query: 1130 YIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLI 1189
              +   D   + WY+  +++  +++        R   F    + EI ++ P D      +
Sbjct: 3366 CRVSGTDLKVS-WYSKDKKIKPSRFF-------RMTQFEDTYQLEIAEAYPEDEGTYTFV 3417

Query: 1190 NKDQIQDLSA---------------KLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTC 1234
              + +  +S+               +++   + + + AP     ++P  V  G     TC
Sbjct: 3418 ASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTC 3477

Query: 1235 AFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKD 1294
                 P      +K    I  + K    S+  + +L I    + D G+Y+    NE G  
Sbjct: 3478 EIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSV 3537

Query: 1295 RSSCTLTV---YDKDDKSVVASITESLQKKSKHL 1325
              + TLTV   Y     S   S+T  + K +K +
Sbjct: 3538 SCTATLTVTEAYPPTFLSRPKSLTTFVGKAAKFI 3571



 Score = 42.0 bits (97), Expect = 0.004
 Identities = 29/111 (26%), Positives = 47/111 (42%), Gaps = 2/111 (1%)

Query: 588   KGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGME 647
             K +E +  V    P T+D +    L   +  V  G      +  + KP  +V WY +G+E
Sbjct: 32354 KTSERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVE 32413

Query: 648   VTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSAT--ATLHLS 696
             + E  ++          L I +C  +DSG       N  G A+  ATL ++
Sbjct: 32414 LQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVT 32464



 Score = 40.0 bits (92), Expect = 0.015
 Identities = 33/111 (29%), Positives = 45/111 (40%), Gaps = 15/111 (13%)

Query: 1002  PKFDLSARLKSHMV---VRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRE-----TITK 1053
             P+F L    K+  V   VR G  + +H      P P V W K G   K  +     T   
Sbjct: 31690 PEFTLPLYNKTAYVGENVRFGVTITVH------PEPHVTWYKSGQKIKPGDNDKKYTFES 31743

Query: 1054  SKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRL 1104
              K   Q  INS    D   Y ++ +N++GE      + V   P PPT+  L
Sbjct: 31744 DKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHP-PPTDSTL 31793



 Score = 39.7 bits (91), Expect = 0.019
 Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 2/93 (2%)

Query: 1212 APRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANS--KFWYNSTSGVCT 1269
            AP F  PL+   VL G   T      G P P V+ ++    I+ ++      + + G   
Sbjct: 5    APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK 64

Query: 1270 LVIPTCTLKDSGDYSVLVENELGKDRSSCTLTV 1302
            L IP  T  +SG YS+   N  G+  S+  L V
Sbjct: 65   LTIPAVTKANSGRYSLKATNGSGQATSTAELLV 97



 Score = 39.7 bits (91), Expect = 0.019
 Identities = 62/301 (20%), Positives = 101/301 (33%), Gaps = 54/301 (17%)

Query: 1008 ARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKS---KNHSQFLINS 1064
            +R+K++ ++  G  +  H   SG P P + W KDG   K  E           +   I  
Sbjct: 1295 SRIKNYRILE-GMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPV 1353

Query: 1065 TKRSDSGVYRILLQNEFGEARYD--IHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDV 1122
                D G+Y     N  G A     ++V  A     PT +   E V    +L+       
Sbjct: 1354 VLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLS------- 1406

Query: 1123 QEDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLD 1182
                        R  S +    +  R+   + +   + P R           +     L+
Sbjct: 1407 -----------PRSVSRSPIRMSPARMSPARMSPARMSPAR-----------MSPGRRLE 1444

Query: 1183 SRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRP 1242
              D     + Q++ L             + P FV        L GQ        +G P P
Sbjct: 1445 ETD-----ESQLERL-------------YKPVFVLKPVSFKCLEGQTARFDLKVVGRPMP 1486

Query: 1243 -TVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLT 1301
             T   + G   +   +        G  +L+I   T  DSG+++V+ +N  G+   S  LT
Sbjct: 1487 ETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILT 1546

Query: 1302 V 1302
            V
Sbjct: 1547 V 1547



 Score = 39.7 bits (91), Expect = 0.019
 Identities = 49/220 (22%), Positives = 90/220 (40%), Gaps = 24/220 (10%)

Query: 80    EGDKAVFRARVQGNAKPHISWKRE-SGIPIKESAKIFYDSINKEHVLKLEPLTSDDSDNY 138
             EG    F  RV G   P + W+++   + +  + +I ++ ++  + L +     +D+  Y
Sbjct: 31808 EGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLD-YYALHIRDTLPEDTGYY 31866

Query: 139   KCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPKKKQKKVANEKEMLEILS-- 196
             +  A+N          L V    E++ +KK   K      +  QK++     M EILS  
Sbjct: 31867 RVTATNTAGSTSCQAHLQV----ERLRYKKQEFKSKEEHERHVQKQIDKTLRMAEILSGT 31922

Query: 197   ------KVPKKDFEKVCMEY----GFTDFRGLLRKLKEMKKKVEVEAIRILKPLEDKETK 246
                   +V K+   +  + Y         +G  R   E+++K E   +R+   + +    
Sbjct: 31923 ESVPLTQVAKEALREAAVLYKPAVSTKTVKGEFR--LEIEEKKEERKLRMPYDVPEPRKY 31980

Query: 247   VDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSL-GKYD 285
               TT+  D  ++   P   M W K    +R QY + GK D
Sbjct: 31981 KQTTIEEDQRIKQFVPMSDMKWYK---KIRDQYEMPGKLD 32017



 Score = 39.3 bits (90), Expect = 0.025
 Identities = 23/89 (25%), Positives = 38/89 (42%), Gaps = 3/89 (3%)

Query: 618   TVKVGHTAHIKVPFRGKPLPKVTWYKDGMEV---TEEERVSMERGEDQALLTISNCVRED 674
             T  VG      V     P P VTWYK G ++     +++ + E  +    LTI++   +D
Sbjct: 31700 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDD 31759

Query: 675   SGLILLKLKNDHGSATATLHLSVLDRPKP 703
                  +  +N +G  +    L+V   P P
Sbjct: 31760 DAEYTVVARNKYGEDSCKAKLTVTLHPPP 31788



 Score = 38.5 bits (88), Expect = 0.043
 Identities = 28/106 (26%), Positives = 42/106 (39%), Gaps = 1/106 (0%)

Query: 67  PEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHV-L 125
           P F +  Q V   EG  A F A + G   P +SW R+  +    +      S +     L
Sbjct: 6   PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65

Query: 126 KLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLK 171
            +  +T  +S  Y   A+N    A  T  LLV       +F + L+
Sbjct: 66  TIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQ 111



 Score = 38.5 bits (88), Expect = 0.043
 Identities = 32/145 (22%), Positives = 60/145 (41%), Gaps = 10/145 (6%)

Query: 17    EFSSSTTHVQTFSQTTKIVGEEVVRRKSSSIVEFFSLVTRSSNIPAGDSVPEFVEKPQPV 76
             ++   +++ + F +  + V +   RR    I        R+  +   +  PEF       
Sbjct: 31646 DYGEDSSYAELFVKGVREVYDYYCRRTMKKIKR------RTDTMRLLERPPEFTLPLYNK 31699

Query: 77    TAPEGDKAVFRARVQGNAKPHISWKRESGIPIK---ESAKIFYDSINKEHVLKLEPLTSD 133
             TA  G+   F   +  + +PH++W + SG  IK      K  ++S    + L +  +T+D
Sbjct: 31700 TAYVGENVRFGVTITVHPEPHVTWYK-SGQKIKPGDNDKKYTFESDKGLYQLTINSVTTD 31758

Query: 134   DSDNYKCIASNDHADAIYTVSLLVT 158
             D   Y  +A N + +      L VT
Sbjct: 31759 DDAEYTVVARNKYGEDSCKAKLTVT 31783



 Score = 37.7 bits (86), Expect = 0.074
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 81    GDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKLEPLTSDDSDNYKC 140
             G+       V G  +P+ISW ++ G P+K++ ++  +      VL ++    DD   Y  
Sbjct: 24326 GEDLKIEIPVIGRPRPNISWVKD-GEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTV 24384

Query: 141   IASNDHADAIYTVSLLVTE 159
              A+N    A   +S++V E
Sbjct: 24385 TATNSAGTATENLSVIVLE 24403



 Score = 37.4 bits (85), Expect = 0.096
 Identities = 26/98 (26%), Positives = 38/98 (38%), Gaps = 1/98 (1%)

Query: 1210 RHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCT 1269
            +  P  V   +P  VL G+     C   G P+P V  Y     I  + +F      G+  
Sbjct: 1838 KQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRY-DGIHY 1896

Query: 1270 LVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDD 1307
            L I  C   D+G+  V  EN  G       L +  ++D
Sbjct: 1897 LDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQRED 1934



 Score = 37.0 bits (84), Expect = 0.13
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 1029  SGSPPPDVIWQKDG--VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFG 1082
             +G P P  IW KDG  +   G+  +++ K      I+ T  SDSG+Y   ++N  G
Sbjct: 32876 TGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAG 32931



 Score = 35.4 bits (80), Expect = 0.37
 Identities = 25/90 (27%), Positives = 39/90 (43%), Gaps = 4/90 (4%)

Query: 1014 MVVRAGTALCIHAAFSGSPPPDVIWQKDG----VPTKGRETITKSKNHSQFLINSTKRSD 1069
            +VV  G+     A  SG P P+V W +DG      T     I+ S   ++  I +  +++
Sbjct: 15   VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKAN 74

Query: 1070 SGVYRILLQNEFGEARYDIHVRVADFPRPP 1099
            SG Y +   N  G+A     + V     PP
Sbjct: 75   SGRYSLKATNGSGQATSTAELLVKAETAPP 104



 Score = 35.4 bits (80), Expect = 0.37
 Identities = 31/119 (26%), Positives = 50/119 (42%), Gaps = 4/119 (3%)

Query: 54    VTRSSNIPAGDSVPEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAK 113
             +T  S++P     P F E+ + +       A    +V G+ KP + W R+    I +  K
Sbjct: 30917 ITPKSDVPI--QAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLK 30974

Query: 114   I-FYDSINKEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLK 171
                 +     H L +  +T DD+  Y+  A+N       T SL V E   K+   K L+
Sbjct: 30975 YRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEV-EVPAKIHLPKTLE 31032



 Score = 34.3 bits (77), Expect = 0.82
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 7/95 (7%)

Query: 1016 VRAGTALCIHAAFSGSPPPDVIWQKDG---VPTK-GRETITKSKNHSQFLINSTKRSDSG 1071
            ++ G+ L +    +G+P PD++W K+    VP K  +  I  +K  +   I+ST   DS 
Sbjct: 1567 IKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSA 1626

Query: 1072 VYRILLQNEFGE--ARYDIHVRVADFPRPPTNLRL 1104
             Y     N+ G    R  ++V V +F  P    +L
Sbjct: 1627 WYTATAINKAGRDTTRCKVNVEV-EFAEPEPERKL 1660



 Score = 34.3 bits (77), Expect = 0.82
 Identities = 25/115 (21%), Positives = 40/115 (34%)

Query: 1211 HAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTL 1270
            + P F++  K  T   G+     C   G P       K    ++ +  +  +       L
Sbjct: 3549 YPPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHIL 3608

Query: 1271 VIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASITESLQKKSKHL 1325
             +   T++D G YS    N+ G D     L + DK          +S   K  HL
Sbjct: 3609 ELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKELEPVQSAINKKVHL 3663



 Score = 33.9 bits (76), Expect = 1.1
 Identities = 30/134 (22%), Positives = 62/134 (46%), Gaps = 12/134 (8%)

Query: 296   VISNVNMNDAGIYSLSVGDKR-----MSAELTVLDEPLKFLGEMKPV----KVTERQTAV 346
             VI+N+   +  ++ +   +++      S  + ++ + L    ++KP      V   Q   
Sbjct: 23189 VITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLK 23248

Query: 347   FEIRLS-KKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGN 405
              E+ +S + +P   W  +G  LK+  +  +T S D LT TL IK+    D G++     N
Sbjct: 23249 IEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLD-LT-TLSIKETHKDDGGQYGITVAN 23306

Query: 406   LVQKAQLTIDRIPI 419
             +V +   +I+ + +
Sbjct: 23307 VVGQKTASIEIVTL 23320



 Score = 33.5 bits (75), Expect = 1.4
 Identities = 36/161 (22%), Positives = 65/161 (40%), Gaps = 12/161 (7%)

Query: 973  FRIRAVNEAGVG-EPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGS 1031
            + ++A N +G      EL       PP      +   RL+S M VR G+ + +    +G 
Sbjct: 78   YSLKATNGSGQATSTAELLVKAETAPP------NFVQRLQS-MTVRQGSQVRLQVRVTGI 130

Query: 1032 PPPDVIWQKDGVPTKGR--ETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIH 1089
            P P V + +DG   +      I++  +    LI      DSG Y +   N  G A     
Sbjct: 131  PTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAE 190

Query: 1090 VRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHY 1130
            + V      P   +  + + +T  ++ +    +++  EAH+
Sbjct: 191  LLVQGEEEVPA--KKTKTIVSTAQISESRQTRIEKKIEAHF 229



 Score = 33.1 bits (74), Expect = 1.8
 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 1/69 (1%)

Query: 76    VTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKLEPLTSDDS 135
             V A  GD       V G  KP ++WK+   I +K++ ++ +++     +L +      DS
Sbjct: 21075 VIAKAGDNIKVEIPVLGRPKPTVTWKKGDQI-LKQTQRVNFETTATSTILNINECVRSDS 21133

Query: 136   DNYKCIASN 144
               Y   A N
Sbjct: 21134 GPYPLTARN 21142



 Score = 33.1 bits (74), Expect = 1.8
 Identities = 33/135 (24%), Positives = 53/135 (39%), Gaps = 17/135 (12%)

Query: 26    QTFSQT--TKIVGEEVVRRKSSSIVEFFSLVTR----SSNIPAGD-SVPEFVEKPQ---- 74
             QT+S    +K    EV + K  S++EF          S  +  G  +V E +  P+    
Sbjct: 27507 QTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLS 27566

Query: 75    -----PVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKLEP 129
                   VT   G         +G  KP ISW ++ G+P+KES  + +     +  L ++ 
Sbjct: 27567 DIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKD-GLPLKESEFVRFSKTENKITLSIKN 27625

Query: 130   LTSDDSDNYKCIASN 144
                +    Y  I  N
Sbjct: 27626 AKKEHGGKYTVILDN 27640



 Score = 33.1 bits (74), Expect = 1.8
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 2/44 (4%)

Query: 356   PNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEF 399
             P   WK     LK  D+  IT ++D    TL +KD+   DSG +
Sbjct: 28677 PKVTWKLEEMRLKETDRVSITTTKD--RTTLTVKDSMRGDSGRY 28718



 Score = 32.7 bits (73), Expect = 2.4
 Identities = 64/277 (23%), Positives = 104/277 (37%), Gaps = 48/277 (17%)

Query: 1036  VIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEF---GEARYDIHVRV 1092
             V W KDG   K      K K +             G  RIL+ N+     EA Y   VR 
Sbjct: 12404 VKWFKDGAEIK------KGKKYDII--------SKGAVRILVINKCLLDDEAEYSCEVRT 12449

Query: 1093  ADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYII-MKRDASTATWYTAAERVF- 1150
             A      T L   EE   T  L    + +V E      +  + +  +   WY   E +  
Sbjct: 12450 ARTSGMLTVLE--EEAVFTKNLA---NIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIE 12504

Query: 1151  SNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSR--DTWLINKDQIQDLSAKLKPYEKKD 1208
             + +Y +  L  GRK    V+    + D+   + R   +    K ++ +L+A+        
Sbjct: 12505 TGRYEI--LTEGRKRIL-VIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAE-------- 12553

Query: 1209  WRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVC 1268
                   F++  +   +L G+     C+      P V   + D  + +  K+   +     
Sbjct: 12554 ------FISKPQNLEILEGEKAEFVCSISKESFP-VQWKRDDKTLESGDKYDVIADGKKR 12606

Query: 1269  TLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDK 1305
              LV+   TL+D G Y V+V    G  R++  LTV +K
Sbjct: 12607 VLVVKDATLQDMGTYVVMV----GAARAAAHLTVIEK 12639



 Score = 32.3 bits (72), Expect = 3.1
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 280   SLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSV----GDKRMSAELTVLDEPLKFLGEMK 335
             SL K  ++   +  +L++ NVN  D+G Y L+V    G K     + VLD P    G  +
Sbjct: 21901 SLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTP----GPPQ 21956

Query: 336   PVKVTE 341
              +KV E
Sbjct: 21957 DLKVKE 21962



 Score = 32.0 bits (71), Expect = 4.0
 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 1247 YKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTL 1300
            Y  DV + +N K+   S  G   L +   T +D G+YS +++ +    +++C L
Sbjct: 2300 YHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGK----KTTCKL 2349



 Score = 32.0 bits (71), Expect = 4.0
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 1244 VTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENE-LGKDRSSCTLTV 1302
            VT YKG   +T + K+ + +      + I   T  D G YSV+   E  G+ RS+  L +
Sbjct: 8864 VTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELYL 8923

Query: 1303 YDKDDK 1308
              K+ K
Sbjct: 8924 TTKEIK 8929



 Score = 32.0 bits (71), Expect = 4.0
 Identities = 57/243 (23%), Positives = 90/243 (37%), Gaps = 27/243 (11%)

Query: 1067  RSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDG 1126
             RS+  V+ + L++   E   ++ +   DF    T+  LF + P  V  T        E+G
Sbjct: 12244 RSEGKVHTLTLRDVKLEDAGEVQLTAKDFK---THANLFVKEP-PVEFTKPLEDQTVEEG 12299

Query: 1127  EAHYII--MKRDASTATWY-TAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
                 +   + R+ +   W+    E + S KY +     GR      V +  I D  P D 
Sbjct: 12300 ATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVA--DGR------VRKLVIHDCTPEDI 12351

Query: 1184  RDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPT 1243
             +      KD     +  + P   +       F+ PL    V   +     C  L      
Sbjct: 12352 KTYTCDAKDFKTSCNLNVVPPHVE-------FLRPLTDLQVREKEMARFECE-LSRENAK 12403

Query: 1244  VTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVY 1303
             V  +K    I    K+   S   V  LVI  C L D  +YS     E+   R+S  LTV 
Sbjct: 12404 VKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSC----EVRTARTSGMLTVL 12459

Query: 1304  DKD 1306
             +++
Sbjct: 12460 EEE 12462



 Score = 32.0 bits (71), Expect = 4.0
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 11/70 (15%)

Query: 262   PNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAEL 321
             PNV  +W K    LR +  +   D     ++  L I N N ND+G Y+L++ +   +A L
Sbjct: 26216 PNV--LWSKPDTDLRTRAYVDTTD-----SRTSLTIENANRNDSGKYTLTIQNVLSAASL 26268

Query: 322   T----VLDEP 327
             T    VLD P
Sbjct: 26269 TLVVKVLDTP 26278



 Score = 32.0 bits (71), Expect = 4.0
 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 9/70 (12%)

Query: 262   PNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSV----GDKRM 317
             P    +W K    L +     + D+    +   L + N N NDAG Y+L+V    G K +
Sbjct: 28385 PTPTAVWSKPDSNLSL-----RADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSI 28439

Query: 318   SAELTVLDEP 327
             +  + VLD P
Sbjct: 28440 TFTVKVLDTP 28449



 Score = 31.6 bits (70), Expect = 5.3
 Identities = 50/244 (20%), Positives = 91/244 (37%), Gaps = 37/244 (15%)

Query: 11   QEHVSMEFSSSTTHVQTFSQTTKIVGEEVVRRKSSSIVEFFSLVT--RSSNIPAGDSVPE 68
            +E    E  +  T  +   +  + V EE +   S  +    + VT  +   I     +P 
Sbjct: 9511 EEEREEEEEAEVTEYEVMEEPEEYVVEEKLHIISKRVEAEPAEVTERQEKKIVLKPKIPA 9570

Query: 69   FVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKLE 128
             +E+P P   PE  K +   +      P         +P +    +    +  + +   E
Sbjct: 9571 KIEEPPPAKVPEAPKKIVPEKKVPAPVPKKEKVPPPKVPEEPKKPVPEKKVPPKVIKMEE 9630

Query: 129  PLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPP---APKKKQKKV 185
            PL +  ++ +  I                   QE+     + KK APP    P++ ++ V
Sbjct: 9631 PLPAKVTERHMQIT------------------QEEKVLVAVTKKEAPPKARVPEEPKRAV 9672

Query: 186  ANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVEV-----EAIRILKPL 240
              EK    +L   PK++ E        T+FR   R +KE K  +E      + I+ +  +
Sbjct: 9673 PEEK----VLKLKPKREEEPPAK---VTEFR--KRVVKEEKVSIEAPKREPQPIKEVTIM 9723

Query: 241  EDKE 244
            E+KE
Sbjct: 9724 EEKE 9727



 Score = 31.6 bits (70), Expect = 5.3
 Identities = 33/129 (25%), Positives = 54/129 (41%), Gaps = 11/129 (8%)

Query: 224   EMKKKVEVEAIRI-LKPLEDKETKVDTTVVFDCIME-LKDPNVKMIWIKGTEPLRIQYSL 281
             E ++K+   ++ + +K +E    K  TTV F  I+  +  P  K  W      ++     
Sbjct: 17500 ECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAK--WTTDGSEIKTDEH- 17556

Query: 282   GKYDVKQMGTKYMLVISNVNMNDAGIYSLSV----GDKRMSAELTVLDEPLKFLGEMKPV 337
               Y V+      +L I N    D G Y ++V    G K ++  LTVLD P    G +  +
Sbjct: 17557 --YTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINIL 17614

Query: 338   KVTERQTAV 346
              VT     +
Sbjct: 17615 DVTPEHMTI 17623



 Score = 30.8 bits (68), Expect = 9.0
 Identities = 26/82 (31%), Positives = 39/82 (47%), Gaps = 5/82 (6%)

Query: 277 IQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSL----SVGDKRMSAELTVLDEPLKFLG 332
           IQ SL  + + Q G  Y L+I+     D+G YS+    SVG    +AEL V  E      
Sbjct: 144 IQSSLD-FQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAK 202

Query: 333 EMKPVKVTERQTAVFEIRLSKK 354
           + K +  T + +   + R+ KK
Sbjct: 203 KTKTIVSTAQISESRQTRIEKK 224


>gi|110349717 titin isoform novex-2 [Homo sapiens]
          Length = 27118

 Score =  423 bits (1087), Expect = e-118
 Identities = 299/1086 (27%), Positives = 497/1086 (45%), Gaps = 54/1086 (4%)

Query: 121  KEHVLKLEPLTSDDSDNYKCIASNDHADAIYTV------------SLLVTEGQEKMDFKK 168
            ++ +L ++    +D+ NY C   +   D    V            +L + EG EK +F  
Sbjct: 6210 RKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEG-EKAEFVC 6268

Query: 169  MLKKRAPPAPKKKQKKVANEKEMLEILSKVPKKDF---EKVCMEYG-FTDFRGLLRKLKE 224
             + K + P   K+  K     +  ++++   K+     +    + G +    G  R    
Sbjct: 6269 SISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAH 6328

Query: 225  MKKKVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKY 284
            +     +E +RI+ PL+D   K    VVF+C  E+     K  W +  E +   +   KY
Sbjct: 6329 L---TVIEKLRIVVPLKDTRVKEQQEVVFNC--EVNTEGAKAKWFRNEEAI---FDSSKY 6380

Query: 285  DVKQMGTKYMLVISNVNMNDAGIYSLSVGDKR-----MSAELTVLDEPLKFLGEMKPVKV 339
             + Q    Y L I + +++D   Y++S+ + R      +A L V +E L+ +  +K ++ 
Sbjct: 6381 IILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIET 6440

Query: 340  TERQTAVFEIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEF 399
             E+++  F  ++++      W  NG+E+  D++    V  D   H L IKD    D GE+
Sbjct: 6441 MEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRV--DKYKHMLTIKDCGFPDEGEY 6498

Query: 400  SAEAGNLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLM 459
               AG     A+L I   P +FV +L++  V E   A   C+L+ +   ++W ++G+ + 
Sbjct: 6499 IVTAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIK 6558

Query: 460  HGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSG 519
             G KY    +G    LII+D +L D  EY    ++D       S A + VEE    +   
Sbjct: 6559 EGKKYKFEKDGSIHRLIIKDCRLDDECEYAC-GVEDRK-----SRARLFVEEIPVEIIRP 6612

Query: 520  MSDVHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEH 579
              D+  A G+       LN +KVE  WL++   +      Q++ +G +H+L    + P  
Sbjct: 6613 PQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRD 6672

Query: 580  EGKYTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKV 639
            +G+Y F AK  E+ A + +A  P I        A   + V VG    + VP+   P  + 
Sbjct: 6673 QGEYRFIAKDKEARAKLELAAAPKIKT------ADQDLVVDVGKPLTMVVPYDAYPKAEA 6726

Query: 640  TWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLD 699
             W+K+   ++ +   +++   +Q    I    + D G   + L+N HG A   ++L V+D
Sbjct: 6727 EWFKENEPLSTK---TIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVID 6783

Query: 700  RPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVT 759
             P P +  +E  E     V + W+ P  +GG  +  ++VERR + +K+W+   +      
Sbjct: 6784 VPGPVRN-LEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDRAESCE 6842

Query: 760  NFSTNKVEEGKAYQFRILAVNSEGVSDPLETEE-VFAGNPIEPPGFASQPQVTDVTKEAV 818
               T   + G  Y FR+ A N  G  +P+ET+  V A +  + PG      +TDV +  V
Sbjct: 6843 FTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGV 6902

Query: 819  TITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIA 878
            ++TW  P  DGGA +  Y++E R K S  W        +    TV  ++E  EY FRV A
Sbjct: 6903 SLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRA 6962

Query: 879  VNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYI 936
             N+ G G+PS  +  V   DP++ P    +L  SD + SS+ L W  P +  G P  GYI
Sbjct: 6963 QNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYI 7022

Query: 937  LEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAM 996
            +E   E    W +C    +    Y V GL +  KY +R+ A N+AGV +P E+   + A 
Sbjct: 7023 IERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTAD 7082

Query: 997  PPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIW--QKDGVPTKGRETITKS 1054
                 P  DLSA  K  + V     + I    +G P P   W      + T  R  +   
Sbjct: 7083 DAFVEPTMDLSA-FKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTL 7141

Query: 1055 KNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTL 1114
              +++ +I+ ++RSD G+Y + L+N       +I V V   P  P  L+  +   ++V L
Sbjct: 7142 SAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHL 7201

Query: 1115 TWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNE 1174
            TW    D        Y++ KR+ S  TW    + V   ++TV  L+ G++Y F+V ARN+
Sbjct: 7202 TWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNK 7261

Query: 1175 IGDSEP 1180
             G  EP
Sbjct: 7262 CGPGEP 7267



 Score =  380 bits (977), Expect = e-105
 Identities = 300/1056 (28%), Positives = 483/1056 (45%), Gaps = 93/1056 (8%)

Query: 288   QMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVF 347
             +MG KY   ++ VN+     YS S+ +      + + D  L+   ++K   VT R  A  
Sbjct: 23103 KMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPD--LELADDLKKT-VTIRAGASL 23159

Query: 348   EIRLS---KKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKD-ARLSDSGEFSAEA 403
              + +S   +  P   W   G +L      + T S     ++L I D     D+G+++ EA
Sbjct: 23160 RLMVSVSGRPPPVITWSKQGIDLASRAIIDTTES-----YSLLIVDKVNRYDAGKYTIEA 23214

Query: 404   GNLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWK---KDGQLLMH 460
              N   K   T+            +V+VKE SR           VT+ W+    DG   ++
Sbjct: 23215 ENQSGKKSATVLVKVYDTPGPCPSVKVKEVSR---------DSVTITWEIPTIDGGAPVN 23265

Query: 461   GTKYSMNHEGKRA---------ELIIEDAQLSDGGEYTVVAMQD-----GDPTEYYSTAI 506
                        RA         + +   + L +G  Y    + +     G+P E  S A+
Sbjct: 23266 NYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCE-TSDAV 23324

Query: 507   VTVEERLATVKSGMSDVHAATGSPA-ELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQG 565
             +  E  L   K  + DV  +T + A E  +     ++ G  L+  K  T+     +  + 
Sbjct: 23325 LVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKP 23384

Query: 566   AVHKLIFPSMGPEHEGKYTFRAKG-------TESEASVFIAD---PPTIDPSVLEALAAH 615
              V +    S+    +  +  RA+         E+  +V + D    PTID S +     H
Sbjct: 23385 TVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLRVLPTIDLSTMPQKTIH 23444

Query: 616   AITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDS 675
                V  G    + +P  G+P P  +W+  G ++ E ERV++E     A LTI      D+
Sbjct: 23445 ---VPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDT 23501

Query: 676   GLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQ 735
             G   L+LKN  G+ + T+ + +LD+P PP G ++  E+  + + + W+ P+ +GG P++ 
Sbjct: 23502 GEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPELDGGAPLSG 23561

Query: 736   FIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFA 795
             ++VE+R   +  W+ + E   + T F   ++ EG  Y FR+ A N  G+   L++E +  
Sbjct: 23562 YVVEQRDAHRPGWLPVSESVTRST-FKFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIEC 23620

Query: 796   GNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDP 855
              + I  PG     Q+ DV+++ +T+TW  P  DGG+ V GYIVER++  ++ WV VNK P
Sbjct: 23621 RSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVP 23680

Query: 856   IQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSS 915
             +  T+    GL E  EYE RV A+N  G G+PS PS  +VA DP+ PPG  Q+  V+D++
Sbjct: 23681 VTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTT 23740

Query: 916   NSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFF 973
              +S+SLAW  P +  G   +GY++EM+  D  EW+KC   P     YT+  L +  +Y F
Sbjct: 23741 RTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREYTLTHLPQGAEYRF 23800

Query: 974   RIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPP 1033
             R+ A N  G GEP E+   V+       P ++L  R +  + VR G  + +     G P 
Sbjct: 23801 RVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPF 23860

Query: 1034  PDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVA 1093
             P   W K+G     R  I  S+ H++ +I    R DSG Y ++L+N+ G+    I VRV 
Sbjct: 23861 PICKWTKEGQDISKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVI 23920

Query: 1094  DFPRPPTNLRLFEEVP-NTVTLTWNHSPDVQEDGEAH---YIIMKRDASTATWYTAAERV 1149
               P  P     ++++   +V ++W    D   DG A    YI+ +R+   A WYT   RV
Sbjct: 23921 GSPNSPEGPLEYDDIQVRSVRVSWRPPAD---DGGADILGYILERREVPKAAWYTIDSRV 23977

Query: 1150  FSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDW 1209
                   V GL    +Y+FRV A N+ G S+PL S +                 P   K  
Sbjct: 23978 RGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEE-----------------PVTPKTP 24020

Query: 1210  RHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRP------TVTLYKGDVNITANSKFWYNS 1263
              + P    P  P  VL   D T +   L   RP       VT Y  +   T+  K+  ++
Sbjct: 24021 LNPPE--PPSNPPEVL---DVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHN 24075

Query: 1264  TSGVCTLVIPTCTLKDSGDYS--VLVENELGKDRSS 1297
              + + T +     L    +Y   ++ +N++G   +S
Sbjct: 24076 KTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETS 24111



 Score =  377 bits (967), Expect = e-104
 Identities = 245/766 (31%), Positives = 380/766 (49%), Gaps = 52/766 (6%)

Query: 448   TLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIV 507
             +L W K    L+  T+Y      +  E       L+  G     +     PTEY      
Sbjct: 12830 SLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAG-----SSPPSKPTEY------ 12878

Query: 508   TVEERLATVKSGMSDVHAATGSPAELCVVL----NDEKVEGVWLKDGKEITDLPGMQIVK 563
              V  R+     G  +V   T S   L           K+ G ++    E   LPG + V+
Sbjct: 12879 -VTARMPVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFV----EACKLPGDKWVR 12933

Query: 564   -QGAVHKLI---FPSMGPEHEGKYTFRA----------KGTESEASVFIAD--PPTIDPS 607
                A H++    + + G E + +Y FRA              S+    +A+  PP ID S
Sbjct: 12934 CNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLS 12993

Query: 608   VLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTI 667
             V        +TVK G    +     GKP+P V+W KDG  +   E + M    +   L +
Sbjct: 12994 VA---MKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLEL 13050

Query: 668   SNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKD 727
              +  R+DSG   +  +N  GS +AT+ L VLD+P PP   V+  ++      + W+ P +
Sbjct: 13051 FSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPAS-VKINKMYSDRAMLSWEPPLE 13109

Query: 728   NGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDP 787
             +GG  +T +IV++R   + +W ++      +T+ S  K+ EG  YQFRI A N  GV DP
Sbjct: 13110 DGGSEITNYIVDKRETSRPNWAQVSATV-PITSCSVEKLIEGHEYQFRICAENKYGVGDP 13168

Query: 788   LETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNL 847
             + TE   A NP +PPG    P ++++TK+ +T++W  P  DGG+P+ GY++E+R+  +  
Sbjct: 13169 VFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVN 13228

Query: 848   WVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQ 907
             W  VN+ PI        GL E TEYEFRV A+NKAGPG+PS  S +  A+DP  PPG   
Sbjct: 13229 WTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGPPA 13288

Query: 908   DLHVSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIP--ISGTCYTVG 963
                V D++ SS+SL+W +PA   G P  GY++E++  D+  W +C  +P  +  T + V 
Sbjct: 13289 FPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRC-NLPQNLQKTRFEVT 13347

Query: 964   GLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALC 1023
             GL+E  +Y FR+ AVN+ G  +P ++            P+ +L A L+  +++RAG  + 
Sbjct: 13348 GLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTMR 13407

Query: 1024  IHAAFSGSPPPDVIWQKDGVPTKGRETI-TKSKNHSQFL-INSTKRSDSGVYRILLQNEF 1081
             ++    G PPP + W K  V  + R  +  KS +   FL   +  + D+G Y + L+N  
Sbjct: 13408 LYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSC 13467

Query: 1082  GEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDAST 1139
             G+  Y I V+V D P PP N+ + E   ++  +TW   P + + G    +Y++ KRDA  
Sbjct: 13468 GKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTW--EPPIIDGGSPIINYVVQKRDAER 13525

Query: 1140  ATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRD 1185
              +W T         + V  L  G+ Y+FRV A NE G  +P ++RD
Sbjct: 13526 KSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGETRD 13571



 Score =  372 bits (954), Expect = e-102
 Identities = 280/973 (28%), Positives = 457/973 (46%), Gaps = 72/973 (7%)

Query: 262   PNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSL----SVGDKRM 317
             P   + W+K  EPL+      + +V++  T  +L I   N +D G Y++    S G    
Sbjct: 18034 PRPNISWVKDGEPLK---QTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATE 18090

Query: 318   SAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVW--KFNGKELKRDDKYEI 375
             +  + VL++P   +G   PV+  E  +A F + +S + P +    + +   +++ D    
Sbjct: 18091 NLSVIVLEKPGPPVG---PVRFDE-VSADFVV-ISWEPPAYTGGCQISNYIVEKRDTTTT 18145

Query: 376   T---VSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKA-----QLTIDRIPIK------- 420
             T   VS      T+KI   +     +F   A N   K+     +  I + P K       
Sbjct: 18146 TWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGT 18205

Query: 421   -FVSNLKNVR--------VKERSRACLECELTSKDV-TLRWKKDGQLLMHGTKYSMN--H 468
              FV+++   +        V +     +   L  K+  ++ W K  +  +  TK+      
Sbjct: 18206 PFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLD 18265

Query: 469   EGKRAELIIEDAQLSDGGEYT-----VVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDV 523
             EG   E  +    +   G+ +      VA    DP       ++T        K    D 
Sbjct: 18266 EGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKKPAYD- 18324

Query: 524   HAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVH--KLIFPSMGPEHEG 581
                 GS     +V   +  +G W+K     T++   +    G V   +  F  +     G
Sbjct: 18325 ---GGSKITGYIVEKKDLPDGRWMK--ASFTNVLETEFTVSGLVEDQRYEFRVIARNAAG 18379

Query: 582   KYTFRAKGTESEASVFIADPP--TIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKV 639
              ++  +  + +  +    D P  ++DP   + +  HA     G T  ++   RGKP+P V
Sbjct: 18380 NFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHA-----GETFVLEADIRGKPIPDV 18434

Query: 640   TWYKDGMEVTE-EERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVL 698
              W KDG E+ E   R+ ++    +  L + +C+R D G  +LKL N  G+ +  + + VL
Sbjct: 18435 VWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVL 18494

Query: 699   DRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKV 758
             DRP PP+G ++   ++    ++ W  P  +GG  ++ +I+E+R   + SW ++   + + 
Sbjct: 18495 DRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQV-STEVQA 18553

Query: 759   TNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAV 818
              N+   K+  G  Y FR++AVN  G+ +PLE+  V A NP +PPG  S P+V+ +TK+++
Sbjct: 18554 LNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSM 18613

Query: 819   TITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIA 878
              +TW  P  DGG  + GYI+E+R K    W   NK  +   +  V GL E   YEFRV A
Sbjct: 18614 VVTWARPVDDGGTEIEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAA 18673

Query: 879   VNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDPPSGYI 936
              N AG G+PS PS    A D + PPG   +  V+D+S SS+SLAW +P    G P  GY+
Sbjct: 18674 ENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYV 18733

Query: 937   LEMRAEDTKEWSKCT-KIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRA 995
             +E++     EW+ CT    + G  +TV  L E  +Y FRI A+N  GVGEP  L   V A
Sbjct: 18734 VEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVA 18793

Query: 996   MPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQK-DGVPTKGRETITKS 1054
                   P+ +L A L+  +V+RA   L +     G P P+V W+K +G+ T  R  I  +
Sbjct: 18794 QERIEPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT-DRAQIEVT 18852

Query: 1055  KNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTL 1114
              + +  +I++  R DSG Y + L+N  G     ++VRV D P  P NL + E   ++VTL
Sbjct: 18853 SSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTL 18912

Query: 1115  TWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVAR 1172
             +W   P + + G    +YI+ KR+ +   + T         + +  L  G  YYFRV+A 
Sbjct: 18913 SW--EPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKTTFRIENLQEGCSYYFRVLAS 18970

Query: 1173  NEIGDSEPLDSRD 1185
             NE G   P ++ +
Sbjct: 18971 NEYGIGLPAETTE 18983



 Score =  369 bits (946), Expect = e-101
 Identities = 203/577 (35%), Positives = 321/577 (55%), Gaps = 11/577 (1%)

Query: 617   ITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSG 676
             +  + G +  ++    GKP P + WYKD  E+     V +E   D A + I +  R +SG
Sbjct: 20577 VKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSG 20636

Query: 677   LILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQF 736
                LKL+N  GSA+AT+ + +LD+P PP G +EF  ++   + + W+ P D+GG  +T +
Sbjct: 20637 CYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHY 20696

Query: 737   IVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAG 796
             IVE+R   +  W  + E   +    +T K+ +G  Y FR+ AVN  G+ +PLE++ V A 
Sbjct: 20697 IVEKRETSRVVWSMVSEHLEECI-ITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAK 20755

Query: 797   NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
             N    PG    P+VT +TK ++T+ W+ P  DGG+ + GY +E+R K S  W  V K+ I
Sbjct: 20756 NAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETI 20815

Query: 857   QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
             + T+  V GL E+++Y++RV AVN AG G  S PS    A DP+ PPG    + ++DS+ 
Sbjct: 20816 RDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTK 20875

Query: 917   SSISLAWREPA--EGDPPSGYILEMRAEDTKEWSK-CTKIPISGTCYTVGGLIERQKYFF 973
             SSI+L W +P    G   +GY++E+R  + +EW+   TK  +  T Y V  L     Y+F
Sbjct: 20876 SSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYF 20935

Query: 974   RIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPP 1033
             R+ AVN AG GEP+E+++ V+A     AP+ DL   L++ ++ +AG  + +   F G PP
Sbjct: 20936 RVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPP 20995

Query: 1034  PDVIWQKD--GVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYD-IHV 1090
             P V W+KD   + +  R +I  + + S   I    R+D+G Y + ++N  GE +   + V
Sbjct: 20996 PTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSV 21055

Query: 1091  RVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAER 1148
             +V D P     L++      TVTL W+  P + + G    +Y+I KRDA+  TW   + +
Sbjct: 21056 KVLDTPAACQKLQVKHVSRGTVTLLWD--PPLIDGGSPIINYVIEKRDATKRTWSVVSHK 21113

Query: 1149  VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRD 1185
               S  + +  L     ++FRV+A NEIG  EP ++ +
Sbjct: 21114 CSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTE 21150



 Score =  361 bits (927), Expect = 2e-99
 Identities = 200/602 (33%), Positives = 315/602 (52%), Gaps = 12/602 (1%)

Query: 590   TESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVT 649
             +ES   + + D       +++      I VK G    I     G+PLP ++W KDG+E+ 
Sbjct: 19467 SESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIE 19526

Query: 650   EEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVE 709
             E  R  +   ++  LLT+ +C+R D+G  +L LKN  G+ +  ++  VLD+P PP G +E
Sbjct: 19527 ERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLE 19586

Query: 710   FLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEG 769
                L+     + W  P+++GG  +  +IVE+R     +W  I E + ++T+    K+ +G
Sbjct: 19587 INGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWT-ICEGELQMTSCKVTKLLKG 19645

Query: 770   KAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDG 829
               Y FR+  VN  GV +PLE+  + A +P   P   +  ++T VTKE++T+ W+ P  DG
Sbjct: 19646 NEYIFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDG 19705

Query: 830   GAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSV 889
             G+ + GYI+ERR+K S  WV VNK P+   +    GL E  EYE+RV A N AG   PS 
Sbjct: 19706 GSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSE 19765

Query: 890   PSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEW 947
              S  + A+DPV  P       + DS  ++I++AW +P    G P +GY +E +  D  +W
Sbjct: 19766 TSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDW 19825

Query: 948   SKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLS 1007
              K +   + GT YT+ GL    +Y FR+++VN+ G  +P +      A      P FD+ 
Sbjct: 19826 -KTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDID 19884

Query: 1008  ARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKR 1067
             + ++  ++V+AG +  +   F G P P+V+W K     + R  +  + + +   I +  R
Sbjct: 19885 SEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRTSLTIENANR 19944

Query: 1068  SDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQE-DG 1126
             +DSG Y + +QN    A   + V+V D P PPTN+ + +    +  L+W    DV E DG
Sbjct: 19945 NDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSW----DVPENDG 20000

Query: 1127  EA---HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
              A   +Y I KR+AS   W +         Y VT L  G  YYFRV   NE G   P ++
Sbjct: 20001 GAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAET 20060

Query: 1184  RD 1185
             ++
Sbjct: 20061 KE 20062



 Score =  358 bits (918), Expect = 2e-98
 Identities = 222/650 (34%), Positives = 334/650 (51%), Gaps = 19/650 (2%)

Query: 552   EITDLPGMQIVKQGAVH--KLIFPSMGPEHEGKYTFR--AKGT--------ESEASVFIA 599
             E  DLP    +K   V+  +  F        GKY FR  AK T        ES  ++   
Sbjct: 14006 EKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICK 14065

Query: 600   DPPTIDPSVLEALAAHAITVKVGHTAHIK-VPFRGKPLPKVTWYKDGMEVTEEERVSMER 658
             D       VL+      +T+K G T  +  +   GKPLPK +W K G ++   +   +  
Sbjct: 14066 DEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITS 14125

Query: 659   GEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCV 718
                 ++LTI    R+D+G   +   N  G+    + ++VLD P PP G VE   +S    
Sbjct: 14126 TPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPP-GPVEISNVSAEKA 14184

Query: 719   HMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILA 778
              + W  P ++GG P+  +I+E+R   +  W  + E D +       K+ +G  Y FR+ A
Sbjct: 14185 TLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSE-DIQSCRHVATKLIQGNEYIFRVSA 14243

Query: 779   VNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIV 838
             VN  G  +P+++E V   +   PPG   +P+V++VTK   T++W  P  DGG+ + GY V
Sbjct: 14244 VNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHV 14303

Query: 839   ERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKD 898
             ERR+K S  WV   K P+   +C V GL E + YEFRV A N+AG G PS  S SV+ KD
Sbjct: 14304 ERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKD 14363

Query: 899   PVKPPGLVQDLHVSDSSNSSISLAWREP--AEGDPPSGYILEMRAEDTKEWSK-CTKIPI 955
                PPG   + HV+D++  S SLAW +P    G   +GY++E +    + W K  T   +
Sbjct: 14364 AAYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTAL 14423

Query: 956   SGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMV 1015
               T + V  L  ++KY FRI A+N+AGVGEP  +   V  +    AP F+L A L+  +V
Sbjct: 14424 RITQFVVPDLQTKEKYNFRISAINDAGVGEPAVI-PDVEIVEREMAPDFELDAELRRTLV 14482

Query: 1016  VRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRI 1075
             VRAG ++ I     G P P+V W KD +  K R  I  +++ +  +I    R D+G + +
Sbjct: 14483 VRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESFTLLIIPECNRYDTGKFVM 14542

Query: 1076  LLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKR 1135
              ++N  G+    ++VRV D P P  NLR  +   ++VTL W+           +YI+ KR
Sbjct: 14543 TIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKR 14602

Query: 1136  DASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRD 1185
             +A+  ++ TA  +     Y VTGL  G +Y+FRV+A NE G  EP ++ +
Sbjct: 14603 EATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTE 14652



 Score =  355 bits (910), Expect = 2e-97
 Identities = 278/985 (28%), Positives = 444/985 (45%), Gaps = 97/985 (9%)

Query: 262   PNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSV----GDKRM 317
             P   + W K   PL+    +   D   + T   L I   + +D G Y ++V    G K  
Sbjct: 16952 PKPTITWTKDGLPLKQTTRINVTDSLDLTT---LSIKETHKDDGGQYGITVANVVGQKTA 17008

Query: 318   SAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVWKF---NGKELKRDDKYE 374
             S E+  LD+P    G   PVK  +   +   I LS   P +       N    KRD    
Sbjct: 17009 SIEIVTLDKPDPPKG---PVKFDD--VSAESITLSWNPPLYTGGCQITNYIVQKRDTTTT 17063

Query: 375   I--TVSEDGLTHTLKIKDARLSDSGEFSAEAGNLV-QKAQLTIDRIPIKF---------- 421
             +   VS      TLK+   +     +F   A N   Q   L  D I  ++          
Sbjct: 17064 VWDVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGT 17123

Query: 422   -----VSNLKNV-----RVKERSRACLECELTSKDV-TLRWKKDGQLLMHGTKYSMNHEG 470
                  +S    V      V       +   L  K+  ++ W K  + ++H T++   +  
Sbjct: 17124 PFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQN-- 17181

Query: 471   KRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMS-DVHAATGS 529
                        L +G EY             Y+  IV V +     +  ++ D     G+
Sbjct: 17182 -----------LEEGIEYEF---------RVYAENIVGVGKASKNSECYVARDPCDPPGT 17221

Query: 530   PAELCVVLNDEKVEGVWLKD----GKEIT-------DLPGMQIVKQGAVHKLI--FPSMG 576
             P  + V  N+  ++  W K     G  IT       DLP  + +K    + +   F   G
Sbjct: 17222 PEPIMVKRNEITLQ--WTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSG 17279

Query: 577   PEHEGKYTFR----------AKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAH 626
                + +Y FR          +K ++S   +   D   +    ++      I V  G T  
Sbjct: 17280 LTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFR 17339

Query: 627   IKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDH 686
             ++    GKPLP + W +   E+ E  R  ++  + +ALL + + +R D G  +L+  N  
Sbjct: 17340 LEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVA 17399

Query: 687   GSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKK 746
             GS +  +++ VLDRP PP+G V+   ++     + W  P  +GG  ++ ++VE+R   + 
Sbjct: 17400 GSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRL 17459

Query: 747   SWIKIGEVDGKVTN-FSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFA 805
             +W  +      VTN     K+ EG  Y FRI+AVN  GV +PLE+  V   NP   PG  
Sbjct: 17460 AWTVVASE--VVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPP 17517

Query: 806   SQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDG 865
                +VT++ K+++T+ WN P  DGG+ ++GYIVE+R +    W+  NK  I   +  V G
Sbjct: 17518 KSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTG 17577

Query: 866   LLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWRE 925
             L ED EYEFRV A N AG G+PS  +    A DPV  PG   + H+ D++ +SI+LAW +
Sbjct: 17578 LTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGK 17637

Query: 926   PA--EGDPPSGYILEMRAEDTKEWSKCT-KIPISGTCYTVGGLIERQKYFFRIRAVNEAG 982
             P    G    GY++E+   D +EW   T +  +  T + +  L E Q+Y  R+ A+N+ G
Sbjct: 17638 PIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVG 17697

Query: 983   VGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDG 1042
             +GE   +   V+      AP+ DL + L+  +VVRAG +  IH  F G P P++ W ++ 
Sbjct: 17698 LGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREE 17757

Query: 1043  VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNL 1102
                  +  I K  N++Q  I++  R+D+G Y + L+N  G     + V+V D P PP NL
Sbjct: 17758 GEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNL 17817

Query: 1103  RLFEEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLL 1160
              + E   ++  L W   P + + G    +Y+I KR+++   +   + +     + V  L 
Sbjct: 17818 AVKEVRKDSAFLVW--EPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKTSFKVENLT 17875

Query: 1161  PGRKYYFRVVARNEIGDSEPLDSRD 1185
              G  YYFRV+A NE G   P+++ D
Sbjct: 17876 EGAIYYFRVMAENEFGVGVPVETVD 17900



 Score =  352 bits (902), Expect = 2e-96
 Identities = 208/628 (33%), Positives = 317/628 (50%), Gaps = 22/628 (3%)

Query: 580   EGK-YTFRA-------KGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPF 631
             EGK YTFR        +GT SE +V   D        L+ L       K      +K+P 
Sbjct: 13642 EGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPI 13701

Query: 632   RGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATA 691
             +GKP P V+W K    +  + RVS+E       L + +C + D+G   + LKN  G+   
Sbjct: 13702 KGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEG 13761

Query: 692   TLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKI 751
             T+ + V+ +P  P G ++F E++   + +KW  PKD+GG  +T +I+E+R      W+  
Sbjct: 13762 TISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTC 13821

Query: 752   GEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVT 811
                  K T F   ++ EG  Y FR+ A N  GV + L++E + A +P + P     P + 
Sbjct: 13822 ASAVQKTT-FRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIV 13880

Query: 812   DVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTE 871
             DV  ++V++TW  P + GG+P+ GY +E +++ S LW   NK PI+     V GL E  E
Sbjct: 13881 DVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLE 13940

Query: 872   YEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EG 929
             YEFRV+A+N AG G+PS+PS  VVA DP+ PPG  + +++   + +S++L W EP    G
Sbjct: 13941 YEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINI---TRNSVTLIWTEPKYDGG 13997

Query: 930   DPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAG-VGEPVE 988
                +GYI+E R   +K W K   + +    +TV  L+E  KY FRIRA N AG +  P E
Sbjct: 13998 HKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSE 14057

Query: 989   LDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHA-AFSGSPPPDVIWQKDGVPTKG 1047
               + +       AP   L   +K  + ++AG  + ++A +  G P P   W K G   + 
Sbjct: 14058 STETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRP 14117

Query: 1048  RE--TITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLF 1105
              +   IT +   S   I    R D+G Y I   N FG     + V V D P PP  + + 
Sbjct: 14118 SDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPPGPVEIS 14177

Query: 1106  EEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGR 1163
                    TLTW  +P +++ G     YI+ KR+ S   W   +E + S ++  T L+ G 
Sbjct: 14178 NVSAEKATLTW--TPPLEDGGSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKLIQGN 14235

Query: 1164  KYYFRVVARNEIGDSEPLDSRDTWLINK 1191
             +Y FRV A N  G  EP+ S    ++++
Sbjct: 14236 EYIFRVSAVNHYGKGEPVQSEPVKMVDR 14263



 Score =  352 bits (902), Expect = 2e-96
 Identities = 217/667 (32%), Positives = 334/667 (50%), Gaps = 19/667 (2%)

Query: 528   GSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAV--HKLIFPSMGPEHEGKYTF 585
             GS     +V   E  EG W+K     T++        G V  H+  F  +     G ++ 
Sbjct: 16162 GSKITGYIVEKKELPEGRWMK--ASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSE 16219

Query: 586   RAKGTESEASVFIADPPTI--DPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYK 643
              ++ T +  +    DPP I  DP   + +  HA     G +  +     GKP+P + W K
Sbjct: 16220 PSESTGAITARDEVDPPRISMDPKYKDTIVVHA-----GESFKVDADIYGKPIPTIQWIK 16274

Query: 644   DGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKP 703
                E++   R+ ++  +    L++ + VR DSG  +LK KN  G  + T+++ VLDRP P
Sbjct: 16275 GDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGP 16334

Query: 704   PQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFST 763
             P+G V    ++     + WK P  +GG  +  +IVERR   +  W  + + + +  +   
Sbjct: 16335 PEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVV-DANVQTLSCKV 16393

Query: 764   NKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWN 823
              K+ EG  Y FRI+AVN  GV +PLE+E V A NP   P     P+VT VTK+++ + W 
Sbjct: 16394 TKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWE 16453

Query: 824   APTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAG 883
              P  DGG+ +LGY++E+R K    W   +K  I   +  V GL+E+ +YEFRV A N AG
Sbjct: 16454 RPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAG 16513

Query: 884   PGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDPPSGYILEMRA 941
               +PS PS+   A DP+  PG   +  V D + SS+ L+W +P    G    GYI+E   
Sbjct: 16514 LSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCD 16573

Query: 942   EDTKEWSKCT-KIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPA 1000
                 EW+ CT    I+ T   V  L+E+ +Y FRI A+N+AGVGE  ++   +       
Sbjct: 16574 VSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLE 16633

Query: 1001  APKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQF 1060
             AP  DL   L+  + +RAG +L +     G P P+V W K     +    I  + + +  
Sbjct: 16634 APDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTSL 16693

Query: 1061  LINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSP 1120
             ++++  R DSG Y + L+N  G     + VRV D P PP NL++ E   ++V++TW   P
Sbjct: 16694 VLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITW--EP 16751

Query: 1121  DVQEDGE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDS 1178
              + + G    +YI+ KR+A+  ++         N + +  L  G  YYFRV A NE G  
Sbjct: 16752 PLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIG 16811

Query: 1179  EPLDSRD 1185
              P  + D
Sbjct: 16812 LPAQTAD 16818



 Score =  351 bits (901), Expect = 2e-96
 Identities = 205/589 (34%), Positives = 309/589 (52%), Gaps = 19/589 (3%)

Query: 608   VLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKD--GMEVTEEERVSMERGEDQALL 665
             VL+   +  +TVK G T  ++   RGKP P+V W KD    ++T   RV ++   D +  
Sbjct: 11897 VLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKF 11956

Query: 666   TISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAP 725
             +++   R D G  ++   N  GS  A   ++VLD+P P +  ++ +++S     + W  P
Sbjct: 11957 SLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRN-LKIVDVSSDRCTVCWDPP 12015

Query: 726   KDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVS 785
             +D+GG  +  +I+E+    +  W             +  ++ EG  Y FR+ A N  G  
Sbjct: 12016 EDDGGCEIQNYILEKCETKRMVWSTYSATV-LTPGTTVTRLIEGNEYIFRVRAENKIGTG 12074

Query: 786   DPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGS 845
              P E++ V A    + PG    P+VT V+KE +T+ WN P  DGG  + GY +E+++K S
Sbjct: 12075 PPTESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHS 12134

Query: 846   NLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGL 905
               WVPVNK  I   +  V  LL D EY+FRV A N+ G G+PS+PS  VVAKDP++PPG 
Sbjct: 12135 TRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGP 12194

Query: 906   VQDLHVSDSSNSSISLAWREPA--EGDPPSGYILEMR-----AEDTKEWSKC-TKIPISG 957
               +  V D++  SI+L W +P    G P  GY++EMR     A   + W +C     +  
Sbjct: 12195 PTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVR 12254

Query: 958   TCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVR 1017
               +TV  L E Q+Y FR+ A N+ G+G P EL + ++       P+ DL A ++  ++VR
Sbjct: 12255 KEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVIVR 12314

Query: 1018  AGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLI--NSTKRSDSGVYRI 1075
             AG  + + A   G P P V W+K G+    R+      +   FL+  NST R DSG Y +
Sbjct: 12315 AGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNST-RDDSGKYSL 12373

Query: 1076  LLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGE--AHYIIM 1133
              L N  GE    ++VRV D P P ++L++ +    +  ++W  +P   + G    HYI+ 
Sbjct: 12374 TLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSW--APPENDGGSQVTHYIVE 12431

Query: 1134  KRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLD 1182
             KR+A   TW T    V    + VT L+PG +YYFRV A NE G   P D
Sbjct: 12432 KREADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTD 12480



 Score =  348 bits (892), Expect = 3e-95
 Identities = 218/651 (33%), Positives = 325/651 (49%), Gaps = 40/651 (6%)

Query: 581   GKYTFRAKGTES------EASVFIAD------PPTIDPSVLEALAAHAITVKVGHTAHIK 628
             G+Y FR K   +       A+V   D      PP+ID           + V+ G   +I 
Sbjct: 9780  GEYEFRVKAVNAAGVSKPSATVGPCDCQRPDMPPSID-------LKEFMEVEEGTNVNIV 9832

Query: 629   VPFRGKPLPKVTWYK------DGME-VTEEERVSMERGEDQALLTISNCVREDSGLILLK 681
                +G P P +TW+K      D  E V  +  V+    +D   L I    R D+GL  + 
Sbjct: 9833  AKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTIT 9892

Query: 682   LKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERR 741
               N+ G+A+  + L+VL RP PP G ++F  +S   + + W  PKD+GG  +T +++E+R
Sbjct: 9893  AVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEKR 9952

Query: 742   AVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEP 801
                +K+W+ +   + K   ++  K+ EG  Y FRI+A N  G+ +PL++E   A N    
Sbjct: 9953  EANRKTWVHVSS-EPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFSV 10011

Query: 802   PGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQ---- 857
             PG   +P V+ VT+ ++T+ W  P  DGG+PV GY +E +   S  W  VN+DPI+    
Sbjct: 10012 PGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTL 10071

Query: 858   GTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNS 917
             G    V GL+E ++Y+FRV A+N AG G  S+PS    A+DP+ PPG      V+D + S
Sbjct: 10072 GVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPGPPFP-KVTDWTKS 10130

Query: 918   SISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRI 975
             S  L W  P +  G   +GYI+E + E  +EW K     + GT   V GL E   Y FR+
Sbjct: 10131 SADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRV 10190

Query: 976   RAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPD 1035
             RAVN AG+GEP E+   +       +P   L A ++  +VV AG  + I A  SG PPP 
Sbjct: 10191 RAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPT 10250

Query: 1036  VIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADF 1095
             V W  +        TI  +   S  +I + +RS  GVY +L +NE GE +  I V V D 
Sbjct: 10251 VTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDV 10310

Query: 1096  PRPPTNLRLFEEVPN-TVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKY 1154
             P P     L   + N +  LTW    D       +Y+I KR++    W      V     
Sbjct: 10311 PGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNA 10370

Query: 1155  TVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINK-----DQIQDLSAK 1200
             TV GL+ G+ Y+FR+ A N IG    +++ +  +I +     ++ +DL  K
Sbjct: 10371 TVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPERPEDLEVK 10421



 Score =  348 bits (892), Expect = 3e-95
 Identities = 210/595 (35%), Positives = 309/595 (51%), Gaps = 17/595 (2%)

Query: 598   IADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSME 657
             IA   TI PS+   L  +  +++ G    I++P  G+P P ++W KDG  + +  RV++E
Sbjct: 17999 IAKDLTIQPSL--KLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVE 18056

Query: 658   RGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSC 717
                   +L I    ++D G   +   N  G+AT  L + VL++P PP G V F E+S   
Sbjct: 18057 ETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVSADF 18116

Query: 718   VHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRIL 777
             V + W+ P   GG  ++ +IVE+R     +W  +     + T     K++ G  YQFRI 
Sbjct: 18117 VVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTT-IKITKLKTGTEYQFRIF 18175

Query: 778   AVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYI 837
             A N  G S PL+++ V    P + PG    P VT ++K+ + + W+ P  DGG  ++GY 
Sbjct: 18176 AENRYGKSAPLDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYH 18235

Query: 838   VERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAK 897
             +E+++K S LWV +NK PIQ TK    GL E  EYEF+V A N  G G+PS  S   VA+
Sbjct: 18236 LEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVAR 18295

Query: 898   DPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIPI 955
             DP  PPG  + + +   + ++++L W++PA   G   +GYI+E +      W K +   +
Sbjct: 18296 DPCDPPGRPEAIVI---TRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNV 18352

Query: 956   SGTCYTVGGLIERQKYFFRIRAVNEAG-VGEPVELDKGVRAMPPPAAPKFDLSARLKSHM 1014
               T +TV GL+E Q+Y FR+ A N AG   EP +    + A     AP   L  + K  +
Sbjct: 18353 LETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVI 18412

Query: 1015  VVRAGTALCIHAAFSGSPPPDVIWQKDG---VPTKGRETITKSKNHSQFLINSTKRSDSG 1071
             VV AG    + A   G P PDV+W KDG     T  R  I  +   +  ++    R+D G
Sbjct: 18413 VVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGG 18472

Query: 1072  VYRILLQNEFGEARYDIHVRVADFPRPPTN-LRLFEEVPNTVTLTWNHSPDVQEDGE--A 1128
              Y + L N  G     I V+V D P PP   L++         L WN  P +Q+ G   +
Sbjct: 18473 QYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWN--PPLQDGGANIS 18530

Query: 1129  HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
             HYII KR+ S  +W   +  V +  Y VT LLPG +Y FRV+A N+ G  EPL+S
Sbjct: 18531 HYIIEKRETSRLSWTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLES 18585



 Score =  345 bits (885), Expect = 2e-94
 Identities = 290/986 (29%), Positives = 433/986 (43%), Gaps = 117/986 (11%)

Query: 268   WIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEP 327
             WIK T    ++ +       Q   KY   IS +N  DAG     VG+  +  ++ +++  
Sbjct: 14414 WIKDTTGTALRITQFVVPDLQTKEKYNFRISAIN--DAG-----VGEPAVIPDVEIVER- 14465

Query: 328   LKFLGEMKP---VKVTERQTAVFEIRLS---------KKEPNFVWKFNGKELKRDDKYEI 375
                  EM P   +    R+T V    LS         +  P   W  +   LK     E 
Sbjct: 14466 -----EMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIEN 14520

Query: 376   TVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPIKFVSNLKNVRVKERSR 435
             T S       L I +    D+G+F            +TI+  P    S   NVRV +   
Sbjct: 14521 TESFT----LLIIPECNRYDTGKFV-----------MTIEN-PAGKKSGFVNVRVLDTPG 14564

Query: 436   ACLEC---ELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRA--------------ELIIE 478
               L     ++T   VTL W  D  L+  G++ +     KR               +   +
Sbjct: 14565 PVLNLRPTDITKDSVTLHW--DLPLIDGGSRITNYIVEKREATRKSYSTATTKCHKCTYK 14622

Query: 479   DAQLSDGGEYTVVAMQD-----GDPTEYYSTAIVTVEERLATVKS-GMSDVHAAT----- 527
                LS+G EY    M +     G+PTE  +T  V   E  +   S  + D+  +T     
Sbjct: 14623 VTGLSEGCEYFFRVMAENEYGIGEPTE--TTEPVKASEAPSPPDSLNIMDITKSTVSLAW 14680

Query: 528   -------GSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHE 580
                    GS     V+    K    W      IT + G++ V +           G E  
Sbjct: 14681 PKPKHDGGSKITGYVIEAQRKGSDQWT----HITTVKGLECVVRNLTE-------GEE-- 14727

Query: 581   GKYTFRAKGTES-------EASVFIADPPTIDPSV-LEALAAHAITVKVGHTAHIKVPFR 632
               YTF+     S       E+   I    T+ P + L  +    +  K G    +++P  
Sbjct: 14728 --YTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVL 14785

Query: 633   GKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATAT 692
             G+P P VTW K    + + +RV+ E      +L I+ CVR DSG   L  +N  G     
Sbjct: 14786 GRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEVGDV 14845

Query: 693   LHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIG 752
             + + V D P PP G ++F E+S   V   W  P+++GG P++ ++VE R     +W+++ 
Sbjct: 14846 ITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELA 14905

Query: 753   EVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTD 812
                 + T +   ++  G  YQFR+ A N  GV   + +  + A  P + PG    PQVT 
Sbjct: 14906 TTVIRTT-YKATRLTTGLEYQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTPQVTA 14964

Query: 813   VTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEY 872
             VTK+++TI+W+ P  DGG+P+LGY VER+++   LW  V+K  + G      GL +   Y
Sbjct: 14965 VTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAY 15024

Query: 873   EFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREP--AEGD 930
             EFRVIA N AG  +PS PS  ++A DP+ PPG    L++   +  +++L W +P    G 
Sbjct: 15025 EFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNI---TRHTVTLKWAKPEYTGGF 15081

Query: 931   PPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAG-VGEPVEL 989
               + YI+E R      W K     I    +TV GL E   Y FR+ A N AG +  P E 
Sbjct: 15082 KITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEP 15141

Query: 990   DKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRE 1049
                +       APK  +  + K  ++++AG A  + A  SG PPP + W KDG   +G  
Sbjct: 15142 SDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTA 15201

Query: 1050  TI-TKSKNHSQFLIN-STKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTN-LRLFE 1106
              +  K  + S  L+N  + R DSG Y +   N  G A++  +V+V D P PP   L + E
Sbjct: 15202 KLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTE 15261

Query: 1107  EVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRK 1164
                    L+W   P + + G    HYI+ KR+ S   W   A  V   K  VT LL G +
Sbjct: 15262 VTSEKCVLSW--FPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNE 15319

Query: 1165  YYFRVVARNEIGDSEPLDSRDTWLIN 1190
             Y FRV+A N+ G  EPL+S     +N
Sbjct: 15320 YIFRVMAVNKYGVGEPLESEPVLAVN 15345



 Score =  341 bits (874), Expect = 3e-93
 Identities = 190/575 (33%), Positives = 298/575 (51%), Gaps = 8/575 (1%)

Query: 617   ITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSG 676
             + +K G    ++    G+P P + W KDG E+    ++ ++  +    L   +  R DSG
Sbjct: 15166 VILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSG 15225

Query: 677   LILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQF 736
                L   N  G A    ++ VLDRP PP+G +   E++     + W  P D+GG  +  +
Sbjct: 15226 AYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHY 15285

Query: 737   IVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAG 796
             IV++R   + +W  +   + +VT     K+ +G  Y FR++AVN  GV +PLE+E V A 
Sbjct: 15286 IVQKRETSRLAWTNVAS-EVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLESEPVLAV 15344

Query: 797   NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
             NP  PP     P+VT +TK+++ + W  P  DGG+ ++ YIVERR K    W+  NK  +
Sbjct: 15345 NPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTL 15404

Query: 857   QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
                +  V GL E  EYEFR++A N AG   PS  S    A D V  PG   +  V D+S 
Sbjct: 15405 TDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFKPGPPGNPRVLDTSR 15464

Query: 917   SSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCT-KIPISGTCYTVGGLIERQKYFF 973
             SSIS+AW +P    G   +GY++E+   +  EW   T    +  T YT+ GL E Q+Y  
Sbjct: 15465 SSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKI 15524

Query: 974   RIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPP 1033
             RI A+N  G+GEP  +    +A      P+ +L A L+  + +RA   L +     G P 
Sbjct: 15525 RIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPA 15584

Query: 1034  PDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVA 1093
             P+V W +D   +  + +I  + +++  ++ +  R DSG Y + ++N  G     ++VRV 
Sbjct: 15585 PEVKWARDHGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVL 15644

Query: 1094  DFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFS 1151
             D P PP +L++ E    +VTLTW+  P + + G    +YI+ KR+++   + T A     
Sbjct: 15645 DTPGPPQDLKVKEVTKTSVTLTWD--PPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHK 15702

Query: 1152  NKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDT 1186
               + V  L  G  YYFRV+A NE G   P ++ ++
Sbjct: 15703 TSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAES 15737



 Score =  340 bits (872), Expect = 5e-93
 Identities = 197/589 (33%), Positives = 296/589 (50%), Gaps = 11/589 (1%)

Query: 601   PPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGE 660
             PP+++   L+      + VK G T       RG P+P   W  DG E+  +E  ++E   
Sbjct: 11202 PPSVE---LDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDN 11258

Query: 661   DQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHM 720
               ++LTI NC+R D+G   + + N  GS T  +HL+VLD P PP G +  L+++   + +
Sbjct: 11259 FSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTI 11318

Query: 721   KWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVN 780
              W+ PKD+GG PV  +IVE++   K +W  +     K T      +++G  Y FR+ A N
Sbjct: 11319 SWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSK-TKLKIPHLQKGCEYVFRVRAEN 11377

Query: 781   SEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVER 840
               GV  PL++    A +   PP    +P VTD+T+ A T++W  P  DGG+P+ GY +ER
Sbjct: 11378 KIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMER 11437

Query: 841   RKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPV 900
             R+  +  WV VNK PI   K  V GL E   YEFRV A N AG  +PS  S  + A  P+
Sbjct: 11438 REV-TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPI 11496

Query: 901   KPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGT 958
             KPPG   +  + D S  +  L W +P    G P  GY++E +   T +W++  K  +   
Sbjct: 11497 KPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQ 11556

Query: 959   C-YTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVR 1017
             C + V GLIE  +Y FRI+A N  G GEP EL + V A      P+ +L    +  + VR
Sbjct: 11557 CAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVR 11616

Query: 1018  AGTALCIHAAFSGSPPPDVIWQKDG--VPTKGRETITKSKNHSQFLINSTKRSDSGVYRI 1075
              G  + I A   G P PD+ W K+G  +  + R  + +     +  I    R+D G Y I
Sbjct: 11617 VGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYII 11676

Query: 1076  LLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKR 1135
               +N  G A+    V V D P P  NL++        T++W +  D       ++I+  R
Sbjct: 11677 SAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYR 11736

Query: 1136  DASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSR 1184
               +   W   A  V + +     LL   +YYFRV A N++G    ++++
Sbjct: 11737 KPNQKGWSIVASDV-TKRLIKANLLANNEYYFRVCAENKVGVGPTIETK 11784



 Score =  335 bits (859), Expect = 2e-91
 Identities = 196/574 (34%), Positives = 306/574 (53%), Gaps = 14/574 (2%)

Query: 617   ITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGE--DQALLTISNCVRED 674
             + +K G +  IK   +G+P+P+VTW+KDG+E+  E+R++ME  +      L + +  R+ 
Sbjct: 21663 LIIKSGESLRIKALVQGRPVPRVTWFKDGVEI--EKRMNMEITDVLGSTSLFVRDATRDH 21720

Query: 675   SGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVT 734
              G+  ++ KN  GSA A + + V D P    G + F  ++G  + + W AP ++G  P+T
Sbjct: 21721 RGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPIT 21780

Query: 735   QFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVF 794
              +I+E+R   + +W  I E   +  +++  K+  G  YQFR+ AVN  GV  PL+++ V 
Sbjct: 21781 HYIIEKRETSRLAWALI-EDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVV 21839

Query: 795   AGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPV-NK 853
             A      P     P+ +++T  ++T+TW  P  DGG+ +  YI+ERR+K S  WV V +K
Sbjct: 21840 AQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISK 21899

Query: 854   DPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSD 913
              PI  T+  V GL E  EYEF V+A N AG G  S  S  +  ++PV PPG    + V+D
Sbjct: 21900 RPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTD 21959

Query: 914   SSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKY 971
             +S +++SL W +P    G    GYI+EM   D  +W K        T YTV  L   ++Y
Sbjct: 21960 TSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEY 22019

Query: 972   FFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGS 1031
              FR+ A+N AG G+  E+   ++A+    AP+ D+ A  K   VVRAG ++ +  A+ G 
Sbjct: 22020 KFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGR 22079

Query: 1032  PPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVR 1091
             P P  +W K       R  I  + + S   + +  R+D+G Y + ++N  G       V+
Sbjct: 22080 PTPTAVWSKPDSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVK 22139

Query: 1092  VADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA---HYIIMKRDASTATWYTAAER 1148
             V D P PP  +   +    + TL W+ +P +  DG A   HY++ KR+AS  +W   +E+
Sbjct: 22140 VLDTPGPPGPITFKDVTRGSATLMWD-APLL--DGGARIHHYVVEKREASRRSWQVISEK 22196

Query: 1149  VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLD 1182
                  + V  L  G  YYFRV A NE G  EP +
Sbjct: 22197 CTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYE 22230



 Score =  331 bits (849), Expect = 2e-90
 Identities = 210/619 (33%), Positives = 310/619 (50%), Gaps = 26/619 (4%)

Query: 582   KYTFRAKGTESEASVFIADPPTIDPSVLEA---------LAAHAITVKVGHTAHIKVPFR 632
             +Y+FR      +    I+DP  +   V+           L  +  TV  G    + VPF 
Sbjct: 15811 EYSFRVSAQNEKG---ISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFI 15867

Query: 633   GKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATAT 692
             G+P P VTW+KD + + +  RV+ E  E+ +LLTI +  RED G  ++KL N  G A  T
Sbjct: 15868 GRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIET 15927

Query: 693   LHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIG 752
             L++ VLD+P PP G V+  E++   + + W  PK +GG  +  +IVE+R     +W  + 
Sbjct: 15928 LNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVS 15987

Query: 753   EVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTD 812
                 + T     +++ G  YQFRI A N  G S  L +E   A  P + PG    P VT 
Sbjct: 15988 ATVARTT-IKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTL 16046

Query: 813   VTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEY 872
              +++++ + WN P  DGG+ V+GY +ER+++ S LWV +NK PI  TK    GL E  EY
Sbjct: 16047 SSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEY 16106

Query: 873   EFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGD 930
             EFRV A N  G G+PS  S   VA+DP  PPG  + + V   + +S++L W++P    G 
Sbjct: 16107 EFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIV---TRNSVTLQWKKPTYDGGS 16163

Query: 931   PPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGV-GEPVEL 989
               +GYI+E +      W K +   I  T + V GL+E  +Y FR+ A N AGV  EP E 
Sbjct: 16164 KITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSES 16223

Query: 990   DKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQK--DGVPTKG 1047
                + A      P+  +  + K  +VV AG +  + A   G P P + W K    +    
Sbjct: 16224 TGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTA 16283

Query: 1048  RETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEE 1107
             R  I  +   +   +    R DSG Y +  +N  GE    ++V+V D P PP    +   
Sbjct: 16284 RLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISG 16343

Query: 1108  V-PNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRK 1164
             V     TL W   P +Q+ G    +YI+ +R+ S   W      V +    VT LL G +
Sbjct: 16344 VTAEKCTLAW--KPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNE 16401

Query: 1165  YYFRVVARNEIGDSEPLDS 1183
             Y FR++A N+ G  EPL+S
Sbjct: 16402 YTFRIMAVNKYGVGEPLES 16420



 Score =  331 bits (848), Expect = 3e-90
 Identities = 261/933 (27%), Positives = 421/933 (45%), Gaps = 67/933 (7%)

Query: 290   GTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEI 349
             G +Y+  + +VN   A   S S  D +++ E    +EPL  +       +  +  A F +
Sbjct: 19845 GAEYVFRVKSVNKVGASDPSDS-SDPQIAKERE--EEPLFDIDSEMRKTLIVKAGASFTM 19901

Query: 350   RL---SKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNL 406
              +    +  PN +W     +L+     + T S   LT    I++A  +DSG+++    N+
Sbjct: 19902 TVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRTSLT----IENANRNDSGKYTLTIQNV 19957

Query: 407   VQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRW---KKDGQLLMHGTK 463
             +  A LT+    +       N+ V++         +T +   L W   + DG   +    
Sbjct: 19958 LSAASLTLVVKVLDTPGPPTNITVQD---------VTKESAVLSWDVPENDGGAPVKNYH 20008

Query: 464   YSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERL---ATVKSGM 520
                    K+A + + +    +   Y V  +Q+G    YY       E  +   A  K G+
Sbjct: 20009 IEKREASKKAWVSVTNN--CNRLSYKVTNLQEG--AIYYFRVSGENEFGVGIPAETKEGV 20064

Query: 521   SDVHAATGSPAELCVV-LNDEKVEGVWLK---DGK--------EITDLPGMQIVKQGAVH 568
               +      P +L V  ++ + V   WLK   DG         E  +      VK     
Sbjct: 20065 K-ITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKCAVAK 20123

Query: 569   KLIFPSMGPEHEGKYTFRA-----KGTESEASVFIA-------DPPTIDPSVLEALAAHA 616
                    G     +Y FR       G      + +        +PP ID   ++   +H 
Sbjct: 20124 STHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEID---MKNFPSHT 20180

Query: 617   ITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSG 676
             + V+ G    + +P  GKPLPKVT  +DG+ +    R + E   +   + +   V  D+G
Sbjct: 20181 VYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAG 20240

Query: 677   LILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQF 736
                +   N  G+  A +++ VLDRP PP G V   +++   V +KW+ PK +GG  VT +
Sbjct: 20241 RYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNY 20300

Query: 737   IVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAG 796
             I+ +R      W ++     + T     K+  G+ YQFRI A N  G+SD +++  V   
Sbjct: 20301 ILLKRETSTAVWTEVSATVAR-TMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVK 20359

Query: 797   NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
              P   PG  S P VT+VT+E++T+ W+ P  +GG+ V+GY +E + + S LW   NK  I
Sbjct: 20360 LPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVI 20419

Query: 857   QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
             + T   V  +     YEFRV A N AG G+PS PS  V+A D  +PP   +++ ++D S 
Sbjct: 20420 RTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPP---RNVRITDISK 20476

Query: 917   SSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFR 974
             +S+SL+W++PA   G   +GYI+E R      W+K +   ++ T + + GL +  +Y FR
Sbjct: 20477 NSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFR 20536

Query: 975   IRAVNEAG-VGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPP 1033
             + A N  G +  P E+   +  +     P  DL       +  RAGT++ + A  SG P 
Sbjct: 20537 VFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPA 20596

Query: 1034  PDVIWQKDG--VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVR 1091
             P + W KD   + T     +  + + +  LI    R +SG Y + L+N  G A   I V+
Sbjct: 20597 PTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQ 20656

Query: 1092  VADFPRPPTNLRLFEEV-PNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVF 1150
             + D P PP     F+ V    +TL W    D       HYI+ KR+ S   W   +E + 
Sbjct: 20657 ILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLE 20716

Query: 1151  SNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
                 T T ++ G +Y FRV A N+ G  EPL+S
Sbjct: 20717 ECIITTTKIIKGNEYIFRVRAVNKYGIGEPLES 20749



 Score =  330 bits (846), Expect = 6e-90
 Identities = 206/622 (33%), Positives = 309/622 (49%), Gaps = 19/622 (3%)

Query: 562   VKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKV 621
             +K+G  ++    ++    +GK +F  K    +  +    PPT+     + L     T++V
Sbjct: 10476 LKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELA---PPTLHLDFRDKL-----TIRV 10527

Query: 622   GHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLK 681
             G    +   + GKP PKV+W+KD  +V E++R  ++       L      R DSG   + 
Sbjct: 10528 GEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVV 10587

Query: 682   LKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERR 741
             ++N  GS      ++V+DRP PP G V F E++   + + WK P D+GG  +T +I+E++
Sbjct: 10588 VENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKK 10647

Query: 742   AVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEP 801
              VGK  W+ +     K T    +K+ EGK Y FRI A N  G+SDPL ++ + A +    
Sbjct: 10648 EVGKDVWMPVTSASAKTT-CKVSKLLEGKDYIFRIHAENLYGISDPLVSDSMKAKDRFRV 10706

Query: 802   PGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQG-TK 860
             P    QP VT+VTK++  +TWN P  DGG P+  YI+E+R+  S  W  V KDPI   TK
Sbjct: 10707 PDAPDQPIVTEVTKDSALVTWNKP-HDGGKPITNYILEKRETMSKRWARVTKDPIHPYTK 10765

Query: 861   CTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSIS 920
               V  LLE  +YEFRV A N+ G G PS PS  V AKDP+  P    +    D++ +S+ 
Sbjct: 10766 FRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVD 10825

Query: 921   LAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPIS--GTCYTVGGLIERQKYFFRIR 976
             L W+ P    G    GYI+E +    +EW +    P S   T Y V GL + Q Y FR+ 
Sbjct: 10826 LTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVL 10885

Query: 977   AVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDV 1036
             AVN AG  +P  + + V        P+  L A +     ++ G  L + A   G P P V
Sbjct: 10886 AVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKV 10945

Query: 1037  IWQKD--GVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVAD 1094
              W+K+    PTK R  +T     S+  I +    D G+Y + ++N  G     + V V D
Sbjct: 10946 TWKKEDRDAPTKARIDVTPV--GSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLD 11003

Query: 1095  FPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKY 1154
              P PP +L + E   ++  LTW    D       +Y++ +RD ++A W   +       +
Sbjct: 11004 KPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSH 11063

Query: 1155  TVTGLLPGRKYYFRVVARNEIG 1176
                 L  G +Y FRV A N+ G
Sbjct: 11064 FAKHLNEGNQYLFRVAAENQYG 11085



 Score =  326 bits (836), Expect = 8e-89
 Identities = 262/890 (29%), Positives = 401/890 (45%), Gaps = 86/890 (9%)

Query: 356  PNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEA----GNLVQKAQ 411
            P  VW     EL   DK  + +   G    L IKDA   D G +   A    G+    A+
Sbjct: 8829 PTKVWTKEEGEL---DKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAAR 8885

Query: 412  LTIDRIPIKFVSNLKNVRVKERSRACLECELTSKD----VT--LRWKKDGQLLMHGTKYS 465
            + +  +P   V +LK V V  R    L       D    +T  +  +KD +  MH  +  
Sbjct: 8886 VEVFDVPGP-VLDLKPV-VTNRKMCLLNWSDPEDDGGSEITGFIIERKDAK--MHTWRQP 8941

Query: 466  MNHEGKRAELIIEDAQLSDGGEYT--VVAMQD---GDPTEYYSTAIV------TVEERLA 514
            +  E  + ++      L +G EY   V+A      G P E      V      T  ERL 
Sbjct: 8942 IETERSKCDI----TGLLEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLT 8997

Query: 515  TVKSGMSDVHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPS 574
              +   S +      P           ++G  ++  K   D P  + V +       F  
Sbjct: 8998 YTERTKSTITLDWKEPRSN----GGSPIQGYIIE--KRRHDKPDFERVNKRLCPTTSFLV 9051

Query: 575  MGPEHEGKYTFRAKGT----ESEAS----VFIAD---PPTIDPSVLEALAAHAITVKVGH 623
               +    Y FR K      ESE S    V I D   PPTI   +  ++    I VK G 
Sbjct: 9052 ENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRL--SVRGDTIKVKAGE 9109

Query: 624  TAHIKVPFRGKPLPKVTWYK---------DGMEVTEEERVSMERGEDQALLTISNCVRED 674
              HI     G P+PK+ W K         D +++T+EE   + R E +  L+I   VRED
Sbjct: 9110 PVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEE---VSRSEAKTELSIPKAVRED 9166

Query: 675  SGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVT 734
             G   +   N  GS    +H+ V DRP PP+  +   ++     ++ W AP DNGG  +T
Sbjct: 9167 KGTYTVTASNRLGSVFRNVHVEVYDRPSPPRN-LAVTDIKAESCYLTWDAPLDNGGSEIT 9225

Query: 735  QFIVERRAVGKKS--WIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEE 792
             +++++R   +K   W ++     +   +   K+     Y+FR+ AVN  G+SD  ++++
Sbjct: 9226 HYVIDKRDASRKKAEWEEVTNTAVE-KRYGIWKLIPNGQYEFRVRAVNKYGISDECKSDK 9284

Query: 793  VFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLW---- 848
            V   +P   PG   +P+V   TK ++ ++W  P  +GG+P+ GY +E+R++GS  W    
Sbjct: 9285 VVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVS 9344

Query: 849  -VPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQ 907
              P+ K  ++G +  V  LLE  +Y+FR +A+N AG G PS PS   VA DP+ PPG   
Sbjct: 9345 RAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPPGPPS 9404

Query: 908  DLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTK-IPISGTC-YTVG 963
               V D + SSISL W+ PA+  G P  GYI+EM+ E T +W +  +   +  TC   V 
Sbjct: 9405 CPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCECVVP 9464

Query: 964  GLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALC 1023
             L E +KY FR++AVNEAG  EP +    + A      P+  +    +  +V +AG+ + 
Sbjct: 9465 NLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIR 9524

Query: 1024 IHAAFSGSPPPDVIWQKDGVPTKGRE----------TITKSKNHSQFLINSTKRSDSGVY 1073
            I A   G P P   W+ DG   K  +           +  ++N S  +I   KRS +G Y
Sbjct: 9525 IPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHTGKY 9584

Query: 1074 RILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIM 1133
             I  +N+ G+   +  V+V D P PP +L++ +    +  L+W    D   D    Y+I 
Sbjct: 9585 SITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIE 9644

Query: 1134 KRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
            KR      W        S  + V  LL  ++Y+FRV A N  G   P+++
Sbjct: 9645 KRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVET 9694



 Score =  326 bits (836), Expect = 8e-89
 Identities = 217/659 (32%), Positives = 323/659 (49%), Gaps = 43/659 (6%)

Query: 562   VKQGAVHKLIFPSMGPEHEGKYTFRAKGT---------ESEASVFIADPPTIDPSVLEAL 612
             V+ G   +L F       + +Y FR K           E+ +SV I +P     + L  +
Sbjct: 22288 VEAGHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGI 22347

Query: 613   AAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVR 672
                 IT K G    I VP  G+P PKVTW  + M + E +RVS+   +D+  LT+ + +R
Sbjct: 22348 TNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMR 22407

Query: 673   EDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRP 732
              DSG   L L+N  G  T ++ + V+ RP P  G +E   +S     + W  PKD GG  
Sbjct: 22408 GDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGGGTE 22467

Query: 733   VTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEE 792
             +T +IVE+R  G  +W  +     K T      + +   Y FR+ + N  GVS PLE+  
Sbjct: 22468 ITNYIVEKRESGTTAWQLVNS-SVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESAP 22526

Query: 793   VFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVN 852
             + A +P  PP   ++P+V  V+  A++I W  P  DGG+ ++GY VE++++ + LWV  N
Sbjct: 22527 IIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKEN 22586

Query: 853   KDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVS 912
             K P       V GL+E  EY+FR  A+N AG  + S  S  ++A++PV  PG  +   V+
Sbjct: 22587 KVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRPE---VT 22643

Query: 913   DSSNSSISLAWREPA--EGDPPSGYILEMRAED---TKEWSKCTKIPISGTCYTVGGLIE 967
             D + S++SL W  PA   G    GYI+E +         W KC    +S   +TV  L E
Sbjct: 22644 DVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSE 22703

Query: 968   RQKYFFRIRAVNEAGVGEPVELDKGVRAMPPP------AAPKFDLSARLKSHMV-VRAGT 1020
                Y FR+ A N AGV     + KG  +  P       A PK +L ARL   +V +RAG+
Sbjct: 22704 GDTYEFRVLAKNAAGV-----ISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGS 22758

Query: 1021  ALCIHAAFSGSPPPDVIWQKDG--VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQ 1078
              L + AA  G P P +IW K    +    + ++  +   +  +I    RSDSG Y + ++
Sbjct: 22759 DLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVK 22818

Query: 1079  NEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA---HYIIMKR 1135
             N  G     + V+V D P P   L +        TL W+     QEDG A   HYI+ +R
Sbjct: 22819 NASGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLP---QEDGGAEITHYIVERR 22875

Query: 1136  DASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIG-----DSEPLDSRDTWLI 1189
             + S   W        +  Y VT L+   +Y FRV A N+ G     +SEP+ +R+++ I
Sbjct: 22876 ETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTI 22934



 Score =  325 bits (833), Expect = 2e-88
 Identities = 227/759 (29%), Positives = 365/759 (48%), Gaps = 54/759 (7%)

Query: 587   AKGTESEASVFIADPPTIDPSVLEA-LAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDG 645
             +KG+ES   V   D      + L+A L    +T++ G    +     GKP PK+ W K  
Sbjct: 22721 SKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGD 22780

Query: 646   MEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQ 705
              E+   E+VS++    +A   I  C R DSG   L +KN  G+   ++ + VLD P P  
Sbjct: 22781 KELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPC- 22839

Query: 706   GRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNK 765
             G++    ++     + W  P+++GG  +T +IVERR   + +W+ I E +    ++   +
Sbjct: 22840 GKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWV-IVEGECPTLSYVVTR 22898

Query: 766   VEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAP 825
             + +   Y FR+ AVN  G   P+E+E + A N    P     P+     KE + I W  P
Sbjct: 22899 LIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKP 22958

Query: 826   TQDGGAPVLGYIVERRKKGSNLWVPVNKD-PIQGTKCTVDGLLEDTEYEFRVIAVNKAGP 884
               DGG  +  Y+V++R+K S  W  VNKD  +  T+  V  L+E  +Y+FRV AVN AG 
Sbjct: 22959 ESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGN 23018

Query: 885   GQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAE 942
              +PS  S+ +  ++P   PG      V D++  SISLAW +P    G    GY+LEM+ +
Sbjct: 23019 SEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEK 23078

Query: 943   DTKEWSKC-TKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAA 1001
             DT +W +  T   I  T +TV  L   QKY FR+ AVN  G+ E  E    +  +     
Sbjct: 23079 DTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEI 23138

Query: 1002  PKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFL 1061
             P  +L+  LK  + +RAG +L +  + SG PPP + W K G+    R  I  ++++S  +
Sbjct: 23139 PDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSLLI 23198

Query: 1062  INSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPD 1121
             ++   R D+G Y I  +N+ G+    + V+V D P P  ++++ E   ++VT+TW   P 
Sbjct: 23199 VDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITW-EIPT 23257

Query: 1122  VQEDGEA---HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDS 1178
             +  DG A   +YI+ KR+A+   + T   +     Y ++GL+ G  YYFRV+  N  G  
Sbjct: 23258 I--DGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIG 23315

Query: 1179  EPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLG 1238
             EP ++ D  L+++                          PL P   L   D T +   L 
Sbjct: 23316 EPCETSDAVLVSE-------------------------VPLVP-AKLEVVDVTKSTVTLA 23349

Query: 1239  NPRPTVTLYKGDVNIT--------ANSKFWYNSTSGVCTLVIPTCTLKDSGD---YSVLV 1287
               +P   LY G   +T        A ++ W    +   T++  T T  + G+   + +  
Sbjct: 23350 WEKP---LYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRA 23406

Query: 1288  ENELGKDRSSCTLTVYDKDDKSVVASI-TESLQKKSKHL 1325
             +NE G      T+T     D  V+ +I   ++ +K+ H+
Sbjct: 23407 QNEKGVSEPRETVTAVTVQDLRVLPTIDLSTMPQKTIHV 23445



 Score =  325 bits (832), Expect = 2e-88
 Identities = 195/607 (32%), Positives = 305/607 (50%), Gaps = 16/607 (2%)

Query: 592   SEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEE 651
             S A   +A    I+P V  A ++++  V+VG    I+VP  G+P P +TW KDG+ + + 
Sbjct: 16911 SLAVPIVAKDLVIEPDVKPAFSSYS--VQVGQDLKIEVPISGRPKPTITWTKDGLPLKQT 16968

Query: 652   ERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFL 711
              R+++    D   L+I    ++D G   + + N  G  TA++ +  LD+P PP+G V+F 
Sbjct: 16969 TRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFD 17028

Query: 712   ELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKA 771
             ++S   + + W  P   GG  +T +IV++R      W  +     + T     K++ G  
Sbjct: 17029 DVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTT-LKVTKLKTGTE 17087

Query: 772   YQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGA 831
             YQFRI A N  G S  LE++ + A  P + PG    P  T ++K+++ I W+ P  +GG+
Sbjct: 17088 YQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGS 17147

Query: 832   PVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPS 891
             PV+GY +ER+++ S LW  VNK  I  T+     L E  EYEFRV A N  G G+ S  S
Sbjct: 17148 PVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNS 17207

Query: 892   SSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSK 949
                VA+DP  PPG  + + V     + I+L W +P    G   +GYI+E R      W K
Sbjct: 17208 ECYVARDPCDPPGTPEPIMV---KRNEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMK 17264

Query: 950   CTKIPISGTCYTVGGLIERQKYFFRIRAVNEAG-VGEPVELDKGVRAMPPPAAPKFDLSA 1008
              +   +  T +TV GL E Q+Y FR+ A N AG + +P +    + A      P+  +  
Sbjct: 17265 ASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDP 17324

Query: 1009  RLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDG--VPTKGRETITKSKNHSQFLINSTK 1066
             + +  +VV AG    + A   G P P + W +    +    R  I  +   +  ++    
Sbjct: 17325 KFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAI 17384

Query: 1067  RSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTN-LRLFEEVPNTVTLTWNHSPDVQED 1125
             R D G Y +   N  G   + ++V+V D P PP   +++        +LTW  SP +Q+ 
Sbjct: 17385 RIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTW--SPPLQDG 17442

Query: 1126  GE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
             G   +HY++ KR+ S   W   A  V +N   VT LL G +Y FR++A N+ G  EPL+S
Sbjct: 17443 GSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPLES 17502

Query: 1184  RDTWLIN 1190
                 + N
Sbjct: 17503 APVLMKN 17509



 Score =  318 bits (816), Expect = 2e-86
 Identities = 196/641 (30%), Positives = 304/641 (47%), Gaps = 25/641 (3%)

Query: 557   PGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEA--------SVFIADPPTIDPSV 608
             P  +  +   V  L     G +   KY FR     +           V+ A    + P +
Sbjct: 12538 PADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKI 12597

Query: 609   LEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTIS 668
             L       IT+K G    I+    GKP P   W K   EV     +++ + +  ++L I 
Sbjct: 12598 L---MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIK 12654

Query: 669   NCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDN 728
             +  R+DSG   L  +N  G+ T  + + V+D P PPQ   +  ++      + W  P ++
Sbjct: 12655 DVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHIPLED 12714

Query: 729   GGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPL 788
             GG  +T +IVE+  V +  W+       K T+    K+  G+ Y FR+ A N  G+S+PL
Sbjct: 12715 GGSNITNYIVEKCDVSRGDWVTALASVTK-TSCRVGKLIPGQEYIFRVRAENRFGISEPL 12773

Query: 789   ETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLW 848
              + ++ A  P   P      +VT V K+ + + W+ P  DGG+P++GY++ER+++ S LW
Sbjct: 12774 TSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLW 12833

Query: 849   VPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQD 908
             V  N   ++ T+    GL+E  EY FR+ A+NKAG   PS P+  V A+ PV PPG  + 
Sbjct: 12834 VKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKPE- 12892

Query: 909   LHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIP--ISGTCYTVGG 964
               V D + S++SL W  P    G    GY +E       +W +C   P  I    YT  G
Sbjct: 12893 --VIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATG 12950

Query: 965   LIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCI 1024
             L E+ +Y FR  A     +  P E    V  +     P+ DLS  +KS + V+AGT +C+
Sbjct: 12951 LEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCL 13010

Query: 1025  HAAFSGSPPPDVIWQKDGVPTKGRETI--TKSKNHSQFLINSTKRSDSGVYRILLQNEFG 1082
              A   G P P V W+KDG   K  E I     +N     + S  R DSG Y I  +N  G
Sbjct: 13011 DATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSG 13070

Query: 1083  EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTA 1140
                  I ++V D P PP ++++ +   +   L+W   P +++ G    +YI+ KR+ S  
Sbjct: 13071 SKSATIKLKVLDKPGPPASVKINKMYSDRAMLSW--EPPLEDGGSEITNYIVDKRETSRP 13128

Query: 1141  TWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPL 1181
              W   +  V     +V  L+ G +Y FR+ A N+ G  +P+
Sbjct: 13129 NWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPV 13169



 Score =  317 bits (812), Expect = 5e-86
 Identities = 193/605 (31%), Positives = 291/605 (48%), Gaps = 26/605 (4%)

Query: 598   IADPPTIDPSVLEALA-----------AHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGM 646
             ++DP TI P  ++ L               +TV++GH  H+++P++GKP P ++W KDG+
Sbjct: 21238 LSDPVTIGPITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGL 21297

Query: 647   EVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQG 706
              + E E V   + E++  L+I N  +E  G   + L N        + +  L  P  P+G
Sbjct: 21298 PLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKG 21357

Query: 707   RVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKV 766
              + F E+    V + W  P+DNGG  +T + +E+R   + +W  +     + T    N V
Sbjct: 21358 PIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCSSVARTTFKVPNLV 21417

Query: 767   EEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPT 826
             ++ + YQFR+ A N  GVS PL +  + A +    PG   +P + +VT + +++TW+AP 
Sbjct: 21418 KDAE-YQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPV 21476

Query: 827   QDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQ 886
              DGG+ V G+ VE++++ S LW  VN  PI G +    GL+E  +Y+FRV A N AG   
Sbjct: 21477 YDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGLSS 21536

Query: 887   PSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDT 944
             PS PS   +A  PV PPG    +   D +  +I+L W  P    G    GY +E R +  
Sbjct: 21537 PSDPSKFTLAVSPVDPPGTPDYI---DVTRETITLKWNPPLRDGGSKIVGYSIEKR-QGN 21592

Query: 945   KEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKG-VRAMPPPAAPK 1003
             + W +C    +S   YTV GL    +Y FRI A N  G   P     G +        P 
Sbjct: 21593 ERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPI 21652

Query: 1004  FDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRET--ITKSKNHSQFL 1061
              +        +++++G +L I A   G P P V W KDGV  + R    IT     +   
Sbjct: 21653 VEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLF 21712

Query: 1062  INSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPD 1121
             +    R   GVY +  +N  G A+ +I V+V D P        F  +       W  +P 
Sbjct: 21713 VRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAP- 21771

Query: 1122  VQEDGEA---HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDS 1178
                DG A   HYII KR+ S   W    ++  +  YT   L+ G +Y FRV A N+ G  
Sbjct: 21772 -LNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVG 21830

Query: 1179  EPLDS 1183
              PLDS
Sbjct: 21831 RPLDS 21835



 Score =  313 bits (801), Expect = 9e-85
 Identities = 262/892 (29%), Positives = 399/892 (44%), Gaps = 90/892 (10%)

Query: 356  PNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTID 415
            P   W  +GKE+K  D+  +T+  D ++  L++  +  +D+G ++    N +  A  +I+
Sbjct: 8111 PTVSWHKDGKEVKASDR--LTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASIN 8168

Query: 416  RIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRAEL 475
               I      K+++  + +++   C+LT +        DG   +          G+R  +
Sbjct: 8169 VKVIGLPGPCKDIKASDITKS--SCKLTWEPPEF----DGGTPILHYVLERREAGRRTYI 8222

Query: 476  IIEDAQ---------LSDGGEY--TVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVH 524
             +   +         L   GEY   V A+      EY       + +          DV 
Sbjct: 8223 PVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVE 8282

Query: 525  AATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVK---------QGAVHKLIFPSM 575
                +   + +       +G     G +I      +I K         +  V  L + + 
Sbjct: 8283 VHNPTAEAMTITWKPPLYDG-----GSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAK 8337

Query: 576  GPEHEGKYTFRAKGTESEASVFI---ADPPT--IDP-SVLEALAAHAITVKVGHTAHIKV 629
            G E   +Y FR +  E+ A +     A PPT  +DP    + +   ++ VK G    +  
Sbjct: 8338 GLEEGKEYQFRVRA-ENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDA 8396

Query: 630  PFRGKPLPKVTWYKDGM--------------------EVTEEE--------RVSME---R 658
               G P P +TW KD                      EV EEE        R+S++   +
Sbjct: 8397 SISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKK 8456

Query: 659  GEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCV 718
            GE Q  L + + +R D GL ++K++NDHG A A   +SVLD P PP   V F ++  + V
Sbjct: 8457 GESQ--LRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFV-FEDIRKTSV 8513

Query: 719  HMKWKAPKDNGGRPVTQFIVERRAVGK--KSWIKIGEVDGKVTNFSTNKVEEGKAYQFRI 776
              KW+ P D+GG  +  + +E++   K    WI +     +   +S  K+ EGK Y FR+
Sbjct: 8514 LCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTL-RHCKYSVTKLIEGKEYLFRV 8572

Query: 777  LAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGY 836
             A N  G   P  ++ + A +P  PP    +P V DVT  ++ + WN P +D G+P+LGY
Sbjct: 8573 RAENRFGPGPPCVSKPLVAKDPFGPPDAPDKPIVEDVTSNSMLVKWNEP-KDNGSPILGY 8631

Query: 837  IVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVA 896
             +E+R+  S  W  VNK  +   K  VDGLLE   Y FRV A N AGPG+ S PS    A
Sbjct: 8632 WLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTA 8691

Query: 897  KDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIP 954
             DP+ PPG      V+D+S+++I L W  PA   G    GY ++ +   T EWS+CT+  
Sbjct: 8692 HDPISPPG-PPIPRVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKM 8750

Query: 955  ISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHM 1014
            I    YTV  + E   Y  R+ AVN AG G P E  + V    P   P  +L   +K  +
Sbjct: 8751 IKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGE-TQPVTVAEPQEPPAVELDVSVKGGI 8809

Query: 1015 VVRAGTALCIHAAFSGSPPPDVIWQK-DGVPTKGRETITKSKNHSQFLINSTKRSDSGVY 1073
             + AG  L I A  +G P P  +W K +G   K R  I      S+ +I    R D G Y
Sbjct: 8810 QIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSELIIKDALRKDHGRY 8869

Query: 1074 RILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH---Y 1130
             I   N  G       V V D P P  +L+          L W+   D ++DG +    +
Sbjct: 8870 VITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWS---DPEDDGGSEITGF 8926

Query: 1131 IIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLD 1182
            II ++DA   TW    E   S K  +TGLL G++Y FRV+A+N+ G   P++
Sbjct: 8927 IIERKDAKMHTWRQPIETERS-KCDITGLLEGQEYKFRVIAKNKFGCGPPVE 8977



 Score =  308 bits (790), Expect = 2e-83
 Identities = 202/595 (33%), Positives = 288/595 (48%), Gaps = 19/595 (3%)

Query: 598   IADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSME 657
             IA    I PSV   L  H   VK      I VPF+G+P   V W KDG  + E  RV++ 
Sbjct: 19082 IARDIEIKPSV--ELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVS 19139

Query: 658   RGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSC 717
               +    L+I    +ED G   L + N  GS T  + + VLDRP PP G +   E+S   
Sbjct: 19140 SSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPP-GPIRIDEVSCDS 19198

Query: 718   VHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRIL 777
             + + W  P+ +GG  ++ +IVE++     +W  + +   + T+    ++  G  YQFR+ 
Sbjct: 19199 ITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVAR-TSIKIVRLTTGSEYQFRVC 19257

Query: 778   AVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYI 837
             A N  G S   E+  V A  P  PPG    P+V   TK  + +TW  P  DGG+ V+GY 
Sbjct: 19258 AENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYH 19317

Query: 838   VERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAK 897
             +E +++ S LW   NK  I  T+  V GL E   YE+RV A N AG G+ S     V A+
Sbjct: 19318 LEYKERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPAR 19377

Query: 898   DPVKPPGLVQDLHVSDSSNSSISLAWREP--AEGDPPSGYILEMRAEDTKEWSKCTKIPI 955
             DP  PPG  +   V++ +  S+SL W +P    G   +GYI+E R      W KC    I
Sbjct: 19378 DPCDPPGQPE---VTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNI 19434

Query: 956   SGTCYTVGGLIERQKYFFRIRAVNEA-GVGEPVELDKGVRAMPPPAAPKFDLSARLKSHM 1014
               T + V  L E Q+Y FR+ A N A  V EP E    +        P+  +  + +  +
Sbjct: 19435 QETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVI 19494

Query: 1015  VVRAGTALCIHAAFSGSPPPDVIWQKDG--VPTKGRETITKSKNHSQFLINSTKRSDSGV 1072
             VV+AG  L I+A  +G P P + W KDG  +  + R  I  + NH+   +    R D+G 
Sbjct: 19495 VVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQ 19554

Query: 1073  YRILLQNEFGEARYDIHVRVADFPRPPTN-LRLFEEVPNTVTLTWNHSPDVQEDGEA--- 1128
             Y + L+N  G     ++ +V D P PP   L +        +L+W      QEDG A   
Sbjct: 19555 YVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRP---QEDGGADID 19611

Query: 1129  HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
             +YI+ KR+ S   W      +      VT LL G +Y FRV   N+ G  EPL+S
Sbjct: 19612 YYIVEKRETSHLAWTICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLES 19666



 Score =  293 bits (751), Expect = 6e-79
 Identities = 187/608 (30%), Positives = 301/608 (49%), Gaps = 25/608 (4%)

Query: 587  AKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGM 646
            ++ TE   +V   + P I    L+      +TVK G    +     GKP PK+TW K  M
Sbjct: 7368 SRPTEEIQAVDTQEAPEI---FLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADM 7424

Query: 647  EVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQG 706
             + +++R+++E    ++ +TI +  R D+G  +++  N  G ATA + ++VLD+P PP  
Sbjct: 7425 ILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAA 7484

Query: 707  RVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKV 766
              +  +++     + W  P+D+GG  +T ++VERRA   + W K+     K TNF   K+
Sbjct: 7485 -FDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTV-KDTNFKATKL 7542

Query: 767  EEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPT 826
               K Y FR+ A N  GV +P++   + A    +PPG  ++ + +D+TK+AVT+TW  P 
Sbjct: 7543 IPNKEYIFRVAAENMYGVGEPVQASPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPD 7602

Query: 827  QDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQ 886
             DGG+P+ GY VER    ++ WV  NK P++ T   V GL    +Y FRV+A N AGPG+
Sbjct: 7603 DDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGK 7662

Query: 887  PSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDT 944
            PS  +  ++ KDP+ PP       V D   +S+ L W +P    G     Y++EM    T
Sbjct: 7663 PSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGT 7722

Query: 945  KEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGV---RAMPPPAA 1001
             EW +  +  +  T + + GL+E Q+Y FR+RAVN+AG  EP E    V     + PP+ 
Sbjct: 7723 DEWVRVAE-GVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSP 7781

Query: 1002 PKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFL 1061
            P++     +  +    A     +     GSP  + I +K  V  KG +T+  +   ++  
Sbjct: 7782 PRWLEVINITKN---TADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCT 7838

Query: 1062 INSTKRSDSGVYRILLQNEFGEARY---DIHVRVAD---FPRPPTNLRLFEEVPNTVTLT 1115
            +         V+R+  +N  G++ Y   +  V   D    P PP  L + +     V L 
Sbjct: 7839 VTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLK 7898

Query: 1116 WNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFSN-KYTVTGLLPGRKYYFRVVAR 1172
            W   P   + G     Y+I K++     W  A +    +  + VT ++ G +  F+V A 
Sbjct: 7899 W--EPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAE 7956

Query: 1173 NEIGDSEP 1180
            NE G   P
Sbjct: 7957 NEAGVGHP 7964



 Score =  285 bits (729), Expect = 2e-76
 Identities = 315/1307 (24%), Positives = 527/1307 (40%), Gaps = 123/1307 (9%)

Query: 68   EFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKL 127
            EF+ KPQ +   EG+KA F   +   + P + WKR+    ++   K    +  K+ VL +
Sbjct: 6248 EFISKPQNLEILEGEKAEFVCSISKESFP-VQWKRDDKT-LESGDKYDVIADGKKRVLVV 6305

Query: 128  EPLTSDDSDNYKCIASNDHADAIYTV-----------SLLVTEGQEKM-------DFKKM 169
            +  T  D   Y  +     A A  TV              V E QE +       +  K 
Sbjct: 6306 KDATLQDMGTYVVMVGAARAAAHLTVIEKLRIVVPLKDTRVKEQQEVVFNCEVNTEGAKA 6365

Query: 170  LKKRAPPAPKKKQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKV 229
               R   A     K +  +K+++  L        ++       T+ RG   K       V
Sbjct: 6366 KWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVK-SAANLIV 6424

Query: 230  EVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPL----RIQYSLGKYD 285
            E E +RI++PL+D ET    +V F C  ++   NV + W K  E +    R+ Y + KY 
Sbjct: 6425 EEEDLRIVEPLKDIETMEKKSVTFWC--KVNRLNVTLKWTKNGEEVPFDNRVSYRVDKY- 6481

Query: 286  VKQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTA 345
                  K+ML I +    D G Y ++ G  +  AEL +++ P +F+  ++   VTE   A
Sbjct: 6482 ------KHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDA 6535

Query: 346  VFEIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGN 405
            VF  +LS+++ N  W  NG+E+K   KY+    +DG  H L IKD RL D  E++    +
Sbjct: 6536 VFSCQLSREKANVKWYRNGREIKEGKKYKF--EKDGSIHRLIIKDCRLDDECEYACGVED 6593

Query: 406  LVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYS 465
               +A+L ++ IP++ +   +++     +      EL    V ++W ++  +++ G K+ 
Sbjct: 6594 RKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQ 6653

Query: 466  MNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHA 525
            M  EGK   L I D +  D GEY  +A +D +       A          +K+   D+  
Sbjct: 6654 MMSEGKIHRLQICDIKPRDQGEYRFIA-KDKEARAKLELAAAP------KIKTADQDLVV 6706

Query: 526  ATGSPAELCVVLND-EKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYT 584
              G P  + V  +   K E  W K+ + ++    +    +    +++    G +   K  
Sbjct: 6707 DVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKT-IDTTAEQTSFRILEAKKGDKGRYKIV 6765

Query: 585  FRAKGTESEA----SVFIADPPTIDPSVLEAL-----AAHAITVKVGHTAHIKVPFRGKP 635
             + K  ++E      V     P  +  V E        A    +  G +  I      + 
Sbjct: 6766 LQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRD 6825

Query: 636  LPKVTWY--KDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATL 693
            + + TW    D  E  E     +++G  + L  +S   R  +G     ++ D+     + 
Sbjct: 6826 IKRKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGE---PVETDNPVEARSK 6882

Query: 694  HLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGE 753
            +    D P PP   V   +++   V + W+ P+ +GG  +T +++E R      W     
Sbjct: 6883 Y----DVPGPPLN-VTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMT 6937

Query: 754  VDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDP-LETEEVFAGNPIEPPGFASQPQVTD 812
            V  +  + +   V EG+ Y FR+ A N  GV  P   T  V   +PIE P        +D
Sbjct: 6938 VRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSD 6997

Query: 813  VTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEY 872
             T+ +V + W  P +DGG+P+LGYI+ER ++G + W+  N   +      V GL +  +Y
Sbjct: 6998 QTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKY 7057

Query: 873  EFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPP 932
             +RV A NKAG   PS     + A D    P +  DL    +    + +    P     P
Sbjct: 7058 LYRVSAENKAGVSDPSEILGPLTADDAFVEPTM--DL---SAFKDGLEVIVPNPITILVP 7112

Query: 933  S-GYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDK 991
            S GY        T  W    K+  +G         +R K    + A  E  +      DK
Sbjct: 7113 STGY-----PRPTATWCFGDKVLETG---------DRVK-MKTLSAYAELVISPSERSDK 7157

Query: 992  GVRAMPPPAAPKFDLSARLKSHMVVRAG----------TALCIHAAFS------GSPPPD 1035
            G+  +      K  +S  +  +++ R            T   +H  +       GSP   
Sbjct: 7158 GIYTLKLENRVK-TISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTG 7216

Query: 1036 VIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGE---ARYDIHVRV 1092
             + +K  V  K    +       +F +    +    ++++  +N+ G    A  D  V +
Sbjct: 7217 YVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNM 7276

Query: 1093 ---ADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERV 1149
               A  P PP N++  +   N++ LTW+   +        YI+ +    +  W    E V
Sbjct: 7277 STPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGEPV 7336

Query: 1150 FSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDW 1209
               K  VTGL  G+ Y +RV A N  G S+P  SR T     ++IQ +  +  P    D 
Sbjct: 7337 AETKMEVTGLEEGKWYAYRVKALNRQGASKP--SRPT-----EEIQAVDTQEAPEIFLD- 7388

Query: 1210 RHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCT 1269
                  V  L   TV  G    +     G P P +T  K D+ +  + +    +     T
Sbjct: 7389 ------VKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKST 7442

Query: 1270 LVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASITE 1316
            + I      D+G Y +   N  G+  +   + V DK        IT+
Sbjct: 7443 VTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITD 7489



 Score =  273 bits (699), Expect = 6e-73
 Identities = 160/493 (32%), Positives = 252/493 (51%), Gaps = 15/493 (3%)

Query: 701  PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTN 760
            P PP+  +E + ++ +   +KW  P+ +GG P+T +IVE+R V +K W  + +   K T 
Sbjct: 7779 PSPPRW-LEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTV-DTTVKDTK 7836

Query: 761  FSTNKVEEGKAYQFRILAVNSEGVSDPLETEE-VFAGNPIEPPGFASQPQVTDVTKEAVT 819
             +   + EG  Y FR+ A N+ G SD  E E+ V A +    PG      V DVTK  V 
Sbjct: 7837 CTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVD 7896

Query: 820  ITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAV 879
            + W  P  DGG P+  Y++E++++    WV   K         V  ++E TE +F+V A 
Sbjct: 7897 LKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAE 7956

Query: 880  NKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYIL 937
            N+AG G PS P+  +  +DP  PP    DLHV+D+    I++AW+ P +  G P  GY +
Sbjct: 7957 NEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHV 8016

Query: 938  EMRAEDTKEWSKCTKIPISGTCYTV-GGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAM 996
            EM    T++W +    PI    + V  G++  ++Y  R+RAVN  GV EP E+ + V A 
Sbjct: 8017 EMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAK 8076

Query: 997  PPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKN 1056
             P   P  DL       ++V  G  L I   F   P P V W KDG   K  + +T   +
Sbjct: 8077 DPDCKPTIDLETH---DIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKND 8133

Query: 1057 H--SQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTL 1114
            H  +   +  + R+D+G+Y I L+N+ G A   I+V+V   P P  +++  +   ++  L
Sbjct: 8134 HISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKL 8193

Query: 1115 TWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVAR 1172
            TW   P   + G    HY++ +R+A   T+           +TV  L+P  +Y+FRV A 
Sbjct: 8194 TW--EPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAV 8251

Query: 1173 NEIGDSEPLDSRD 1185
            N++G  E ++ ++
Sbjct: 8252 NKVGGGEYIELKN 8264



 Score =  255 bits (652), Expect = 2e-67
 Identities = 168/569 (29%), Positives = 270/569 (47%), Gaps = 36/569 (6%)

Query: 617   ITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSG 676
             I V+ G    + +P +GKP P   W K+G ++++  R  +   E    L I    R DSG
Sbjct: 23841 IFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISK--RAMIATSETHTELVIKEADRGDSG 23898

Query: 677   LILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQF 736
                L L+N  G     + + V+  P  P+G +E+ ++    V + W+ P D+GG  +  +
Sbjct: 23899 TYDLVLENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGY 23958

Query: 737   IVERRAVGKKSWIKIGEVDGKV--TNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVF 794
             I+ERR V K +W  I   D +V  T+     ++E   Y FR+ A N  G+S PL++EE  
Sbjct: 23959 ILERREVPKAAWYTI---DSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPV 24015

Query: 795   AG----NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVP 850
                   NP EPP  ++ P+V DVTK +V+++W+ P  DGG+ V GY +ER++  ++ WV 
Sbjct: 24016 TPKTPLNPPEPP--SNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVR 24073

Query: 851   VNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLH 910
              NK  I  T  TV GL+ D EY+FR+IA N  G  + S  S  VV KDP   P    +L 
Sbjct: 24074 HNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELE 24133

Query: 911   VSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIER 968
             +   S  S++L W +P    G    GY +E R      W K  K  I    +T+GGL+E 
Sbjct: 24134 ILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEA 24193

Query: 969   QKYFFRIRAVNEAGVGEPVELDKGVRA-MPPPAAPKFDLSARLKSHMVVRAGTALCIHAA 1027
              +Y FR+ A NE G+  P      ++  +    AP   +   +K  +  + G A  +   
Sbjct: 24194 TEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAP--GIRKEMKD-VTTKLGEAAQLSCQ 24250

Query: 1028  FSGSPPPDVIWQKDG---VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEA 1084
               G P PD+ W + G   + ++  +  +  + H+   + + ++ D GVY  +  NE GE 
Sbjct: 24251 IVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHT-LTVMTEEQEDEGVYTCIATNEVGEV 24309

Query: 1085  RYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYT 1144
                  + +   P+      L E+    V  T             H + + R     TW+ 
Sbjct: 24310 ETSSKLLLQATPQFHPGYPLKEKYYGAVGSTL----------RLHVMYIGRPVPAMTWF- 24358

Query: 1145  AAERVFSNKYTVTGLLPGRKYYFRVVARN 1173
               +++  N   +T  +   ++Y  +V +N
Sbjct: 24359 HGQKLLQNSENIT--IENTEHYTHLVMKN 24385



 Score =  252 bits (643), Expect = 2e-66
 Identities = 205/799 (25%), Positives = 359/799 (44%), Gaps = 50/799 (6%)

Query: 438   LECELTSKD-VTLRWKK---DG--QLLMHGTKYSMNHEG---KRAELIIEDAQLSDGG-- 486
             LE    SKD VTL+W+K   DG  ++L +  +Y  + +    K  +  I+D Q + GG  
Sbjct: 24132 LEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLL 24191

Query: 487   -----EYTVVAMQDGDPTEYYSTAIVTVEERLAT-----VKSGMSDVHAATGSPAEL-CV 535
                  E+ V A  +   +    TA+ +++ +L +     ++  M DV    G  A+L C 
Sbjct: 24192 EATEYEFRVFAENETGLSRPRRTAM-SIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQ 24250

Query: 536   VLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKG----TE 591
             ++     +  W + GKE+      ++   G  H L   +   E EG YT  A       E
Sbjct: 24251 IVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVE 24310

Query: 592   SEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEE 651
             + + + +   P   P        +     VG T  + V + G+P+P +TW+     +   
Sbjct: 24311 TSSKLLLQATPQFHPGYPLKEKYYGA---VGSTLRLHVMYIGRPVPAMTWFHGQKLLQNS 24367

Query: 652   ERVSMERGEDQALLTISNCVRED-SGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEF 710
             E +++E  E    L + N  R+  +G   ++L N  G+  A L + + D+P  P G +  
Sbjct: 24368 ENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVI 24427

Query: 711   LELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGK 770
               L  +   + WK P D+GG  +T ++VE+    + +  ++      VT      + E  
Sbjct: 24428 EALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENA 24487

Query: 771   AYQFRILAVNSEGVSDPLETEEV-FAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDG 829
              Y FR+ A N+ G+SDPLE   V    +P E PG   +P +T VTK++  + W  P  DG
Sbjct: 24488 GYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDG 24547

Query: 830   GAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSV 889
             GA +  Y +E+R+K  N W+ V  + I+ T  +V  L+E  EYEFRV   N  G  + S 
Sbjct: 24548 GAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSE 24607

Query: 890   PSSSVVAKD--PVKPPGLVQDL-HVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKE 946
              S  +  K   P++ P   ++L +++    S+ +L  +      P   +  + + E   +
Sbjct: 24608 ISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGK-EIIAD 24666

Query: 947   WSKCTKIPISGTCY--TVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKF 1004
               K       G  +   +  + +     +++RA N+ G         G  ++      K 
Sbjct: 24667 GLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGG------SVSGTASLEVEVPAKI 24720

Query: 1005  DLSARLKSHMVVRA--GTALCIHAAFSGSPPPDVIWQK--DGVPTKGRETITKSKNHSQF 1060
              L   L+    V A  G  + I   FSG P P + WQK  D +   G   +  +++ +  
Sbjct: 24721 HLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSL 24780

Query: 1061  LI-NSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHS 1119
             +  N  +R D+G Y +  +N FG  +  + + VAD P PP  +++ +   ++V LTW   
Sbjct: 24781 VFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEP 24840

Query: 1120  PDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSE 1179
                      +YI+ ++ A+TA  +    +    +YTV  L     Y FRV+A N+ G S+
Sbjct: 24841 ASDGGSKITNYIV-EKCATTAERWLRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSK 24899

Query: 1180  PLDSRDTWLINKDQIQDLS 1198
             P +  +  +  +D+ + ++
Sbjct: 24900 PSEPSEPTITKEDKTRAMN 24918



 Score =  243 bits (621), Expect = 7e-64
 Identities = 306/1277 (23%), Positives = 500/1277 (39%), Gaps = 142/1277 (11%)

Query: 68   EFVEKPQPVTAPEGDKAVFRARV-QGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLK 126
            EF +  +  T  EG  AV    V + NAK  + W + +G  I +S K    +  +   L 
Sbjct: 5981 EFTKPLEDQTVEEGATAVLECEVSRENAK--VKWFK-NGTEILKSKKYEIVADGRVRKLV 6037

Query: 127  LEPLTSDDSDNYKCIASN-----------DHADAIYTVSLLVTEGQEKMDFK-------- 167
            +   T +D   Y C A +            H + +  ++ L    +E   F+        
Sbjct: 6038 IHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFECELSRENA 6097

Query: 168  --KMLKKRAPPAPKKKQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEM 225
              K  K  A     KK   ++     + +++K    D  +   E       G+L  L+E 
Sbjct: 6098 KVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEE- 6156

Query: 226  KKKVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYD 285
                  EA+   K L + E     T+   C  E+  P  ++IW KG E +      G+Y+
Sbjct: 6157 ------EAV-FTKNLANIEVSETDTIKLVC--EVSKPGAEVIWYKGDEEI---IETGRYE 6204

Query: 286  VKQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTA 345
            +   G K +LVI N ++ DAG Y+  +   R   ++ V +   +F+ + + +++ E + A
Sbjct: 6205 ILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKA 6264

Query: 346  VFEIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGN 405
             F   +SK+     WK + K L+  DKY++    DG    L +KDA L D G +    G 
Sbjct: 6265 EFVCSISKESFPVQWKRDDKTLESGDKYDVIA--DGKKRVLVVKDATLQDMGTYVVMVGA 6322

Query: 406  LVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYS 465
                A LT+    ++ V  LK+ RVKE+      CE+ ++    +W ++ + +   +KY 
Sbjct: 6323 ARAAAHLTVIE-KLRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYI 6381

Query: 466  MNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHA 525
            +  +     L I DA L D   Y V ++ +       S A + VEE    +   + D+  
Sbjct: 6382 ILQKDLVYTLRIRDAHLDDQANYNV-SLTNHRGENVKSAANLIVEEEDLRIVEPLKDIET 6440

Query: 526  ATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTF 585
                       +N   V   W K+G+E+     +        H L     G   EG+Y  
Sbjct: 6441 MEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIV 6500

Query: 586  RAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDG 645
             A   +S A + I + PT     +E L    +T         ++    +    V WY++G
Sbjct: 6501 TAGQDKSVAELLIIEAPT---EFVEHLEDQTVTEFDDAVFSCQL---SREKANVKWYRNG 6554

Query: 646  MEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQ 705
             E+ E ++   E+      L I +C  +D       +++    A   +    ++  +PPQ
Sbjct: 6555 REIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQ 6614

Query: 706  GRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAV--GKKSWIKIGEVDGKVTNFST 763
               + LE  G+ V    +  KD   +   Q++     V  G K  +     +GK+     
Sbjct: 6615 ---DILEAPGADVVFLAELNKD---KVEVQWLRNNMVVVQGDKHQMMS---EGKIHRLQI 6665

Query: 764  NKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWN 823
              ++     ++R +A + E  +      E+ A   I+    A Q  V DV K    +   
Sbjct: 6666 CDIKPRDQGEYRFIAKDKEARAKL----ELAAAPKIKT---ADQDLVVDVGKPLTMVV-- 6716

Query: 824  APTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAG 883
                    P   Y      K    W   N +P+  TK T+D   E T   FR++   K  
Sbjct: 6717 --------PYDAY-----PKAEAEWFKEN-EPLS-TK-TIDTTAEQTS--FRILEAKKGD 6758

Query: 884  PGQPSV-------PSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSG 934
             G+  +        +   +    +  PG V++L V+++ +  +SLAW EP    G    G
Sbjct: 6759 KGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIG 6818

Query: 935  YILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQ-KYFFRIRAVNEAGVGEPVELDKGV 993
            Y++E R    K W   T    S   +TV GL +   +Y FR+ A N  G GEPVE D  V
Sbjct: 6819 YVVERRDIKRKTWVLATDRAESCE-FTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPV 6877

Query: 994  RAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPD----------VIWQKDGV 1043
             A      P   L+  +    V R G +L          PP+          VI  +D  
Sbjct: 6878 EARSKYDVPGPPLNVTITD--VNRFGVSLTWE-------PPEYDGGAEITNYVIELRDKT 6928

Query: 1044 PTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDI---HVRVAD---FPR 1097
              +    +T         +          +R+  QN  G  +       V+VAD    P 
Sbjct: 6929 SIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPS 6988

Query: 1098 PPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTAAERVFSN-KY 1154
            PP NL   ++  ++V L W   P +++ G     YII + +     W     ++     Y
Sbjct: 6989 PPVNLTSSDQTQSSVQLKWE--PPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTY 7046

Query: 1155 TVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPR 1214
             VTGL  G KY +RV A N+ G S+P +     L   D   + +  L  ++       P 
Sbjct: 7047 KVTGLEKGNKYLYRVSAENKAGVSDPSEILGP-LTADDAFVEPTMDLSAFKDGLEVIVPN 7105

Query: 1215 FVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPT 1274
             +T L P T              G PRPT T   GD  +    +    + S    LVI  
Sbjct: 7106 PITILVPST--------------GYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISP 7151

Query: 1275 CTLKDSGDYSVLVENEL 1291
                D G Y++ +EN +
Sbjct: 7152 SERSDKGIYTLKLENRV 7168



 Score =  208 bits (529), Expect = 3e-53
 Identities = 167/633 (26%), Positives = 273/633 (43%), Gaps = 66/633 (10%)

Query: 699  DRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKV 758
            D P PP  R+E  +++   V + W  P D+GG P+T + VER       W++  ++  K 
Sbjct: 7576 DPPGPPT-RLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKD 7634

Query: 759  TNFSTNKVEEGKAYQFRILAVNSEGVSDPLE-TEEVFAGNPIEPPGFASQPQVTDVTKEA 817
            T +    +   K Y+FR+LA N  G   P + TE +   +PI+PP    +P V DV K +
Sbjct: 7635 TTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTS 7694

Query: 818  VTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVI 877
            V + W  P  DGGA +  Y++E  K G++ WV V  + +  T+  + GL+E  EY FRV 
Sbjct: 7695 VRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRV-AEGVPTTQHLLPGLMEGQEYSFRVR 7753

Query: 878  AVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGY 935
            AVNKAG  +PS PS  V+ ++ + PP   + L V + + ++  L W  P +  G P + Y
Sbjct: 7754 AVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNY 7813

Query: 936  ILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRA 995
            I+E R    K W +     +  T  TV  L E   Y FR+ A N  G  +  E++  V A
Sbjct: 7814 IVEKRDVRRKGW-QTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLA 7872

Query: 996  M-------PPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPD---------VIWQ 1039
                    PP A    D++ R               H      PP +         VI +
Sbjct: 7873 KDTFTTPGPPYALAVVDVTKR---------------HVDLKWEPPKNDGGRPIQRYVIEK 7917

Query: 1040 KDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADF---- 1095
            K+ + T+  +    +     F +          +++  +NE G         +       
Sbjct: 7918 KERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPT 7977

Query: 1096 --PRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTAAERVFS 1151
              P PP +L + +     + + W   P  +  G     Y +      T  W     R   
Sbjct: 7978 SPPSPPLDLHVTDAGRKHIAIAWK--PPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIK 8035

Query: 1152 N-KYTVT-GLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDW 1209
            + K+ V  G++P ++Y  RV A N IG SEP +  +  ++ KD     +  L+ ++    
Sbjct: 8036 DLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISEN-VVAKDPDCKPTIDLETHDI--- 8091

Query: 1210 RHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCT 1269
                          V+ G+  ++   F   P PTV+ +K    + A+ +    +      
Sbjct: 8092 -------------IVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAH 8138

Query: 1270 LVIPTCTLKDSGDYSVLVENELGKDRSSCTLTV 1302
            L +P     D+G Y++ +EN+LG   +S  + V
Sbjct: 8139 LEVPKSVRADAGIYTITLENKLGSATASINVKV 8171



 Score =  208 bits (529), Expect = 3e-53
 Identities = 143/432 (33%), Positives = 213/432 (49%), Gaps = 26/432 (6%)

Query: 762   STNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTIT 821
             + N+ + GK   + +   NS G         V     ++ PG     +V +VTK +VT+T
Sbjct: 15615 NVNRFDSGK---YILTVENSSGSKSAFVNVRV-----LDTPGPPQDLKVKEVTKTSVTLT 15666

Query: 822   WNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNK 881
             W+ P  DGG+ +  YIVE+R+     +  V  +    T   VD L E   Y FRV+A N+
Sbjct: 15667 WDPPLLDGGSKIKNYIVEKRESTRKAYSTVATN-CHKTSWKVDQLQEGCSYYFRVLAENE 15725

Query: 882   AGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEM 939
              G G P+  + SV A +   PPG +    + D + +S+SL+W +P    G    GYI+EM
Sbjct: 15726 YGIGLPAETAESVKASERPLPPGKIT---LMDVTRNSVSLSWEKPEHDGGSRILGYIVEM 15782

Query: 940   RAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPP 999
             + + + +W+ C  + ++    T+ GLI+ ++Y FR+ A NE G+ +P +L   V A    
Sbjct: 15783 QTKGSDKWATCATVKVTEA--TITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLV 15840

Query: 1000  AAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKG--RETITKSKNH 1057
               P F L   L +   V AG  L +   F G P P V W KD VP K   R     ++N+
Sbjct: 15841 IPPAFKL---LFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENN 15897

Query: 1058  SQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTN-LRLFEEVPNTVTLTW 1116
             S   I    R D G Y + L N  GEA   ++V V D P PPT  +++ E   +++TL+W
Sbjct: 15898 SLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTADSITLSW 15957

Query: 1117  NHSPDVQEDGEA--HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNE 1174
                P   + G +  +YI+ KRD ST TW   +  V         L  G +Y FR+ A N 
Sbjct: 15958 G--PPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFRIAAENR 16015

Query: 1175  IGDSEPLDSRDT 1186
              G S  L+S  T
Sbjct: 16016 YGKSTYLNSEPT 16027



 Score =  204 bits (518), Expect = 6e-52
 Identities = 122/391 (31%), Positives = 190/391 (48%), Gaps = 6/391 (1%)

Query: 797  NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
            N I  P    + +  D+TK++V +TW  P  DGG+P+ GY+VE+R+     W  V  D +
Sbjct: 7178 NVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV-MDFV 7236

Query: 857  QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
               + TV  L++  EY F+V A NK GPG+P+     V    P   P   +++   D + 
Sbjct: 7237 TDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWRDRTA 7296

Query: 917  SSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFR 974
            +SI L W  P    G    GYI+E     + +W  C + P++ T   V GL E + Y +R
Sbjct: 7297 NSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGE-PVAETKMEVTGLEEGKWYAYR 7355

Query: 975  IRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPP 1034
            ++A+N  G  +P    + ++A+    AP+  L  +L + + V+AGT + + A  +G P P
Sbjct: 7356 VKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEP 7415

Query: 1035 DVIWQKDGVPTKG--RETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRV 1092
             + W K  +  K   R TI      S   I  +KRSD+G Y I   N  G A   + V V
Sbjct: 7416 KITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 7475

Query: 1093 ADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSN 1152
             D P PP    + +    +  LTWN   D       +Y++ +R   +  W+  +  V   
Sbjct: 7476 LDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKDT 7535

Query: 1153 KYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
             +  T L+P ++Y FRV A N  G  EP+ +
Sbjct: 7536 NFKATKLIPNKEYIFRVAAENMYGVGEPVQA 7566



 Score =  201 bits (512), Expect = 3e-51
 Identities = 144/532 (27%), Positives = 249/532 (46%), Gaps = 31/532 (5%)

Query: 168  KMLKKRAPPAPKKKQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKK 227
            K   K     P  K + V+  K    +L  +   D  +      +T   G L    E K 
Sbjct: 2780 KWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGE------YTAVVGQL----ECKA 2829

Query: 228  KVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVK 287
            K+ VE + I K +++ E     T  F+C  E+   NV  +W+K    + +     K+ + 
Sbjct: 2830 KLFVETLHITKTMKNIEVPETKTASFEC--EVSHFNVPSMWLKNGVEIEMSE---KFKIV 2884

Query: 288  QMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVF 347
              G  + L+I N +  D+  Y+   G+ ++SA LTV   P+     +K +   E+ T  F
Sbjct: 2885 VQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVT--PIMITSMLKDINAEEKDTITF 2942

Query: 348  EIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLV 407
            E+ ++ +  ++ W  NG E+K  DK ++   +  LTH+L I++    D+ +++  AG   
Sbjct: 2943 EVTVNYEGISYKWLKNGVEIKSTDKCQMRTKK--LTHSLNIRNVHFGDAADYTFVAGKAT 3000

Query: 408  QKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMN 467
              A L ++   I+F  ++K+++V E+ RA  ECE++  D+T++W KD Q L    +  + 
Sbjct: 3001 STATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQ 3060

Query: 468  HEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAAT 527
             E     L+I   ++SD G+YTVVA  +       STA + VE R   ++S   +V    
Sbjct: 3061 KEKYVHRLLIPSTRMSDAGKYTVVAGGN------VSTAKLFVEGRDVRIRSIKKEVQVIE 3114

Query: 528  GSPAELCVVLNDEKVEGVWLKDGKEIT--DLPGMQIVKQGAVHKLIFPSMGPEHEGKYTF 585
               A +   +N++ V+  W KDG EI        + V +  +H++          G+YTF
Sbjct: 3115 KQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTF 3174

Query: 586  RAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDG 645
             A    S  ++++  P    P VL+ L    +TV+ G  A       G+P PK++WYK+ 
Sbjct: 3175 VAGRNRSSVTLYVNAPE--PPQVLQEL--QPVTVQSGKPARFCAVISGRPQPKISWYKEE 3230

Query: 646  MEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSV 697
              ++   +        +  L +     ED+ +   + KND+G AT +  LSV
Sbjct: 3231 QLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSV 3282



 Score =  201 bits (512), Expect = 3e-51
 Identities = 137/438 (31%), Positives = 208/438 (47%), Gaps = 44/438 (10%)

Query: 802  PGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKC 861
            PG     + +D+TK +  +TW  P  DGG P+L Y++ERR+ G   ++PV     +    
Sbjct: 8175 PGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENK-LSW 8233

Query: 862  TVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISL 921
            TV  L+ + EY FRV AVNK G G+     + V+A+DP +PP    D+ V + +  ++++
Sbjct: 8234 TVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTI 8293

Query: 922  AWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVN 979
             W+ P    G    GYI+E  A+  + W +C +  +    YT  GL E ++Y FR+RA N
Sbjct: 8294 TWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAEN 8353

Query: 980  EAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQ 1039
             AG+ EP       +A+ P  APK      L++ + V+ G  + + A+ SGSP P + W 
Sbjct: 8354 AAGISEPSRATPPTKAVDPIDAPK----VILRTSLEVKRGDEIALDASISGSPYPTITWI 8409

Query: 1040 KDG------------------------------VPTKGRETITKS-KNHSQFLINSTKRS 1068
            KD                               +P   R +I  S K  SQ  +  + R 
Sbjct: 8410 KDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRP 8469

Query: 1069 DSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNT-VTLTWNHSPDVQEDGE 1127
            D G+Y I ++N+ G A+    V V D P PP N  +FE++  T V   W    D      
Sbjct: 8470 DHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINF-VFEDIRKTSVLCKWEPPLDDGGSEI 8528

Query: 1128 AHYIIMKRDAS--TATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRD 1185
             +Y + K+D +   + W      +   KY+VT L+ G++Y FRV A N  G   P  S+ 
Sbjct: 8529 INYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKP 8588

Query: 1186 TWLINKDQIQDLSAKLKP 1203
              L+ KD      A  KP
Sbjct: 8589 --LVAKDPFGPPDAPDKP 8604



 Score =  201 bits (510), Expect = 5e-51
 Identities = 167/595 (28%), Positives = 274/595 (46%), Gaps = 38/595 (6%)

Query: 600   DPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERG 659
             + P +D   L++     I V+ G +A I +PF+G+P P++TW ++  E T+  +V +E+G
Sbjct: 17715 EAPELD---LDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTD--KVQIEKG 17769

Query: 660   EDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVH 719
              +   L+I NC R D+G  +LKL+N  GS +A + + VLD P PPQ  +   E+      
Sbjct: 17770 VNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQN-LAVKEVRKDSAF 17828

Query: 720   MKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAV 779
             + W+ P  +GG  V  +++++R   +K++  +     K T+F    + EG  Y FR++A 
Sbjct: 17829 LVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSK-TSFKVENLTEGAIYYFRVMAE 17887

Query: 780   NSEGVSDPLET-EEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIV 838
             N  GV  P+ET + V A  P  PPG  +   +TDV++ + ++ W  P  DGG+ VLGY+V
Sbjct: 17888 NEFGVGVPVETVDAVKAAEPPSPPGKVT---LTDVSQTSASLMWEKPEHDGGSRVLGYVV 17944

Query: 839   ERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKD 898
             E + KG+  W  V +  +      V GL    EY+FRV A N+ G   P V    V+AKD
Sbjct: 17945 EMQPKGTEKWSIVAESKV--CNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKD 18002

Query: 899   PVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGT 958
                 P L    + + S  +   L    P  G P          E  K+    T++ +  T
Sbjct: 18003 LTIQPSLKLPFN-TYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQ---TTRVNVEET 18058

Query: 959   C-YTVGGLIERQKYFF---RIRAVNEAGVG-EPVELDKGVRAMPPPAAPKFDLSARLKSH 1013
                TV  + E  K  F    + A N AG   E + +    +  PP    +FD    + + 
Sbjct: 18059 ATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFD---EVSAD 18115

Query: 1014  MVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVY 1073
              VV +       A   G    + I +K    T     ++ +   +   I   K      +
Sbjct: 18116 FVVISWEP---PAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQF 18172

Query: 1074  RILLQNEFGE-ARYDIHVRVADF----PRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGE- 1127
             RI  +N +G+ A  D    +  +    P PP    +     + + + W H P V + G  
Sbjct: 18173 RIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQW-HEP-VNDGGTK 18230

Query: 1128  -AHYIIMKRDASTATWYTAAER-VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEP 1180
                Y + +++ ++  W    +  +   K+  TGL  G +Y F+V A N +G  +P
Sbjct: 18231 IIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKP 18285



 Score =  200 bits (509), Expect = 7e-51
 Identities = 157/596 (26%), Positives = 262/596 (43%), Gaps = 26/596 (4%)

Query: 600   DPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERG 659
             +PP +   +L+A  A    +KVG T  +    +G P PKVTW K+  +   + R+ +   
Sbjct: 10909 EPPEL---ILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPV 10965

Query: 660   EDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVH 719
               +  L I N   ED G+  L ++N  GS T ++ + VLD+P PP+  +E  E+     +
Sbjct: 10966 GSK--LEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRD-LEVSEIRKDSCY 11022

Query: 720   MKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAV 779
             + WK P D+GG  +T ++VERR V    W  +     K ++F+ + + EG  Y FR+ A 
Sbjct: 11023 LTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHFAKH-LNEGNQYLFRVAAE 11081

Query: 780   NSEGVSDPLETEE-VFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIV 838
             N  G    +ET + + A +P+ PPG        DV K  V++ WN P +DGG+P+ GY+V
Sbjct: 11082 NQYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLV 11141

Query: 839   ERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKD 898
             E +++G+  W+      +   +C V GL +   Y FRV A N  G G P   +  +  ++
Sbjct: 11142 EYQEEGTQDWIKFK--TVTNLECVVTGLQQGKTYRFRVKAENIVGLGLPDT-TIPIECQE 11198

Query: 899   PVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDP-PSGYILEMRAEDTKEWSKCTKIPI 955
              + PP +  D+ + +          R PA   G P P+       +E   +     +   
Sbjct: 11199 KLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDN 11258

Query: 956   SGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMV 1015
               +  T+   + R    ++I   N AG  + V +   V  +P P     ++      HM 
Sbjct: 11259 FSSVLTIKNCLRRDTGEYQITVSNAAG-SKTVAVHLTVLDVPGPPTGPINILDVTPEHMT 11317

Query: 1016  VRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRI 1075
             +             GSP  + I +K          ++   + ++  I   ++    V+R+
Sbjct: 11318 ISWQPP----KDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRV 11373

Query: 1076  LLQNEFG-----EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHY 1130
               +N+ G     ++   +       P PP    + +   N  T++W   P          
Sbjct: 11374 RAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWT-LPKSDGGSPITG 11432

Query: 1131  IIMKRDASTATWYTAAERVFSN-KYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRD 1185
               M+R   T  W    +   ++ K+ VTGL  G  Y FRV A N  G S+P  S D
Sbjct: 11433 YYMERREVTGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSD 11488



 Score =  196 bits (497), Expect = 2e-49
 Identities = 174/653 (26%), Positives = 280/653 (42%), Gaps = 42/653 (6%)

Query: 567  VHKLIFPSMGPEHEGKYTFRAKGTESEASV---------FIADPPTIDPSVLEALAAHAI 617
            V +L +   G E   KY +R    E++A V           AD   ++P++  +     +
Sbjct: 7041 VPELTYKVTGLEKGNKYLYRVSA-ENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGL 7099

Query: 618  TVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGL 677
             V V +   I VP  G P P  TW      +   +RV M+     A L IS   R D G+
Sbjct: 7100 EVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGI 7159

Query: 678  ILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFI 737
              LKL+N   + +  + ++V+ RP  P+  ++F +++   VH+ W+ P D+GG P+T ++
Sbjct: 7160 YTLKLENRVKTISGEIDVNVIARPSAPK-ELKFGDITKDSVHLTWEPPDDDGGSPLTGYV 7218

Query: 738  VERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEE-VFAG 796
            VE+R V +K+W K+ +    +  F+   + +GK Y F++ A N  G  +P   +E V   
Sbjct: 7219 VEKREVSRKTWTKVMDFVTDL-EFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMS 7277

Query: 797  NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
             P   P      +  D T  ++ +TW+ P  DGG+ + GYIVER  +GS+ WV    +P+
Sbjct: 7278 TPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACG-EPV 7336

Query: 857  QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
              TK  V GL E   Y +RV A+N+ G  +PS P+  + A D  + P +  D+ +     
Sbjct: 7337 AETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLT 7396

Query: 917  SSISLAWREPAE-GDPPSGYILEMRAEDTKEWSK---CTKIPISGTCYTVGGLIERQKYF 972
                     PA     P   I   +A+   +  K      +P   T  T+          
Sbjct: 7397 VKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKST-VTIVDSKRSDTGT 7455

Query: 973  FRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSP 1032
            + I AVN  G    V     +    PPAA  FD++       ++             GS 
Sbjct: 7456 YIIEAVNVCGRATAVVEVNVLDKPGPPAA--FDITDVTNESCLLTWNPP----RDDGGSK 7509

Query: 1033 PPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFG---------- 1082
              + + ++    ++    ++ +   + F       +   ++R+  +N +G          
Sbjct: 7510 ITNYVVERRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQASPI 7569

Query: 1083 EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATW 1142
             A+Y       D P PPT L   +   + VTLTW    D        Y + + D  T  W
Sbjct: 7570 TAKYQF-----DPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKW 7624

Query: 1143 YTAAER-VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQI 1194
                +  V    Y V GL   +KY FRV+A N  G  +P  S +  LI KD I
Sbjct: 7625 VRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILI-KDPI 7676



 Score =  196 bits (497), Expect = 2e-49
 Identities = 143/520 (27%), Positives = 238/520 (45%), Gaps = 28/520 (5%)

Query: 698   LDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGK 757
             L+ P+PP    E L+++ S V + W  PKD+GG  VT + +ER+      W++  +    
Sbjct: 24021 LNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQIT 24080

Query: 758   VTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEE-VFAGNPIEPPGFASQPQVTDVTKE 816
              T ++   +     YQFRI+A N  G+S+     E V   +P + P    + ++  ++K+
Sbjct: 24081 TTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKD 24140

Query: 817   AVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRV 876
             +VT+ W  P  DGG  +LGY VE R+ G + W   NK+ I+  + T+ GLLE TEYEFRV
Sbjct: 24141 SVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRV 24200

Query: 877   IAVNKAGPGQPSVPSSSVVAK-DPVKPPGLVQDLH-----VSDSSNSSISLAWREPAEGD 930
              A N+ G  +P   + S+  K    + PG+ +++      + +++  S  +  R      
Sbjct: 24201 FAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGR------ 24254

Query: 931   PPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKY--FFRIRAVNEAGVGEPVE 988
              P   I   R       S+  K+   G  +T+  + E Q+    +   A NE G     E
Sbjct: 24255 -PLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVG-----E 24308

Query: 989   LDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGR 1048
             ++   + +   A P+F     LK       G+ L +H  + G P P + W       +  
Sbjct: 24309 VETSSKLLLQ-ATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNS 24367

Query: 1049  ETIT-KSKNHSQFLI--NSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLF 1105
             E IT ++  H   L+  N  +++ +G Y++ L N FG     + V + D P  PT   + 
Sbjct: 24368 ENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVI 24427

Query: 1106  EEV-PNTVTLTWNHSPDVQEDGEAHYIIMKRDAST-ATWYTAAERVFSNKYTVTGLLPGR 1163
             E +  N+  ++W    D       +Y++ K +A   A W   +  +      +  L    
Sbjct: 24428 EALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENA 24487

Query: 1164  KYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKP 1203
              YYFRV A+N  G S+PL+     +I K   +   A  KP
Sbjct: 24488 GYYFRVSAQNTFGISDPLEVSSVVII-KSPFEKPGAPGKP 24526



 Score =  195 bits (496), Expect = 2e-49
 Identities = 163/617 (26%), Positives = 271/617 (43%), Gaps = 43/617 (6%)

Query: 701   PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTN 760
             P PP+   E   ++   + + W  P  +GG  +  +IVERR    + WIK  +       
Sbjct: 15350 PDPPKNP-EVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLR 15408

Query: 761   FSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVF-AGNPIEPPGFASQPQVTDVTKEAVT 819
             +  + + EG  Y+FRI+A N+ G+S P  T   + A + +  PG    P+V D ++ +++
Sbjct: 15409 YKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFKPGPPGNPRVLDTSRSSIS 15468

Query: 820   ITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDP-IQGTKCTVDGLLEDTEYEFRVIA 878
             I WN P  DGG+ + GY+VE      + W  V     ++ T  T+ GL E+ EY+ R+ A
Sbjct: 15469 IAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYA 15528

Query: 879   VNKAGPGQPSVPSSSVVAKDPVKPPG--LVQDLHVSDSSNSSISLAWREPAEGDPPSGYI 936
             +N  G G+P++   +  A+D + PP   L  DL    +  +  +L    P +G P     
Sbjct: 15529 MNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPE-- 15586

Query: 937   LEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAM 996
             ++   +  +   K +    S     + G + R      I  V  +   +   ++  VR +
Sbjct: 15587 VKWARDHGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVN--VRVL 15644

Query: 997   PPPAAPKFDLSARLKSHMVVRAGTALCIHAAF--SGSPPPDVIWQKDGVPTKGRETITKS 1054
               P  P+      LK   V +    L         GS   + I +K     K   T+  +
Sbjct: 15645 DTPGPPQ-----DLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATN 15699

Query: 1055  KNHSQFLINSTKRSDSGVYRILLQNEFG---EARYDIHVRVADFPRPPTNLRLFEEVPNT 1111
              + + + ++  +   S  +R+L +NE+G    A     V+ ++ P PP  + L +   N+
Sbjct: 15700 CHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITLMDVTRNS 15759

Query: 1112  VTLTWNHSPDVQEDGEAH---YIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFR 1168
             V+L+W      + DG +    YI+  +   +  W T A  V   + T+TGL+ G +Y FR
Sbjct: 15760 VSLSWEKP---EHDGGSRILGYIVEMQTKGSDKWATCAT-VKVTEATITGLIQGEEYSFR 15815

Query: 1169  VVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQ 1228
             V A+NE G S+P              + LS    P   KD    P F       TVL G+
Sbjct: 15816 VSAQNEKGISDP--------------RQLSV---PVIAKDLVIPPAFKLLFNTFTVLAGE 15858

Query: 1229  DCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVE 1288
             D  +   F+G P P VT +K +V +   ++    ST     L I     +D G Y V + 
Sbjct: 15859 DLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLT 15918

Query: 1289  NELGKDRSSCTLTVYDK 1305
             N  G+   +  + V DK
Sbjct: 15919 NSAGEAIETLNVIVLDK 15935



 Score =  193 bits (491), Expect = 8e-49
 Identities = 124/393 (31%), Positives = 189/393 (48%), Gaps = 9/393 (2%)

Query: 799   IEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQG 858
             ++ PG     +V+++ K++  +TW  P  DGG+ +  Y+VERR   S  W P++    + 
Sbjct: 11002 LDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKK 11061

Query: 859   TKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSS 918
             +      L E  +Y FRV A N+ G G        + A DP+ PPG  +DLH  D   + 
Sbjct: 11062 SHFAKH-LNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTE 11120

Query: 919   ISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIR 976
             +SL W +P    G P +GY++E + E T++W K   +  +     V GL + + Y FR++
Sbjct: 11121 VSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKTV--TNLECVVTGLQQGKTYRFRVK 11178

Query: 977   AVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDV 1036
             A N  G+G P +    +        P  +L  +L   +VV+AGT +   A   G P P  
Sbjct: 11179 AENIVGLGLP-DTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTA 11237

Query: 1037  IWQKDGVPTKGRETIT-KSKNHSQFL-INSTKRSDSGVYRILLQNEFGEARYDIHVRVAD 1094
              W  DG   K  E  T ++ N S  L I +  R D+G Y+I + N  G     +H+ V D
Sbjct: 11238 KWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLD 11297

Query: 1095  FPRPPTN-LRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNK 1153
              P PPT  + + +  P  +T++W    D       +YI+ K+D    TW   +      K
Sbjct: 11298 VPGPPTGPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTK 11357

Query: 1154  YTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDT 1186
               +  L  G +Y FRV A N+IG   PLDS  T
Sbjct: 11358 LKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPT 11390



 Score =  193 bits (491), Expect = 8e-49
 Identities = 194/806 (24%), Positives = 335/806 (41%), Gaps = 105/806 (13%)

Query: 546   WLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTID 605
             W KDG  +    G+++  Q  +  L   S+  +  G YT  A+ +    S       TI 
Sbjct: 13024 WKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSA------TIK 13077

Query: 606   PSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKD----GMEVT-----EEERVSM 656
               VL+         K G  A +K+         ++W       G E+T     + E    
Sbjct: 13078 LKVLD---------KPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRP 13128

Query: 657   ERGEDQALLTISNC-----VREDSGLILLKLKNDHGSATATL-HLSVLDRPKPPQGRVE- 709
                +  A + I++C     +        +  +N +G         ++   P  P GR + 
Sbjct: 13129 NWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDP 13188

Query: 710   --FLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVE 767
                  ++   + + WK P D+GG P+T +++E+R     +W K+              ++
Sbjct: 13189 PVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQ 13248

Query: 768   EGKAYQFRILAVNSEGVSDPLETEEV-FAGNPIEPPGFASQPQVTDVTKEAVTITWNAPT 826
             EG  Y+FR+ A+N  G   P +  +  +A +P  PPG  + P+V D T+ +V+++W  P 
Sbjct: 13249 EGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGPPAFPKVYDTTRSSVSLSWGKPA 13308

Query: 827   QDGGAPVLGYIVERRKKGSNLWVPVN-KDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPG 885
              DGG+P++GY+VE ++  S+ WV  N    +Q T+  V GL+EDT+Y+FRV AVNK G  
Sbjct: 13309 YDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLMEDTQYQFRVYAVNKIGYS 13368

Query: 886   QPSVPSSSVVAKDPVKPPG--LVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRAED 943
              PS        KD + PP   L  DL  +    + +++    P +G PP           
Sbjct: 13369 DPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTMRLYVPVKGRPPPKIT------- 13421

Query: 944   TKEWSKCTKIPISGTCYTVGGLIERQKY--FFRIRAVNEAGVGEPV----------ELDK 991
                WSK    P       +G  I+   +  F R   VN+   G+ +          E   
Sbjct: 13422 ---WSK----PNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTI 13474

Query: 992   GVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETI 1051
              V+ +  P  P   ++  +K      A           GSP  + + QK     K   T+
Sbjct: 13475 VVKVLDTPGPP---VNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTV 13531

Query: 1052  TKSKNHSQFLINSTKRSDSGVYRILLQNEFG-----EARYDIHVRVADFPRPPTNLRLFE 1106
             T   + + F + + +   S  +R+  +NE+G     E R    V+ +  P P  +L++  
Sbjct: 13532 TTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGETRDA--VKASQTPGPVVDLKVRS 13589

Query: 1107  EVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTAT--WYTAAERVFSNKYTVTGLLPGRK 1164
                ++ ++ W        DG +  I    D  T    W    + + S +Y+   L  G++
Sbjct: 13590 VSKSSCSIGWKKP---HSDGGSRIIGYVVDFLTEENKWQRVMKSL-SLQYSAKDLTEGKE 13645

Query: 1165  YYFRVVARNEIGDSEPLDSRDTWLINKDQI--QDLSAKLKP---YEKKDWRHAPRFVTPL 1219
             Y FRV A NE G+  P    +  ++ +D +   DL  K  P   Y  K+  +  R   P+
Sbjct: 13646 YTFRVSAENENGEGTP---SEITVVARDDVVAPDLDLKGLPDLCYLAKENSNF-RLKIPI 13701

Query: 1220  KPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKD 1279
             K                 G P P+V+  KG+  +  +++    S++   TL++  C   D
Sbjct: 13702 K-----------------GKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSD 13744

Query: 1280  SGDYSVLVENELGKDRSSCTLTVYDK 1305
             +G Y++ ++N  G    + ++ V  K
Sbjct: 13745 AGKYTITLKNVAGTKEGTISIKVVGK 13770



 Score =  193 bits (490), Expect = 1e-48
 Identities = 138/458 (30%), Positives = 214/458 (46%), Gaps = 43/458 (9%)

Query: 749   IKIGEVDGKV------------TNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAG 796
             +K G+VDG++            T+   + V    + ++ +   NS G      T  V   
Sbjct: 16669 VKWGKVDGEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRV--- 16725

Query: 797   NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
               ++ P      +VT++TK++V+ITW  P  DGG+ +  YIVE+R+     +  V  +  
Sbjct: 16726 --LDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTN-C 16782

Query: 857   QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
                   +D L E   Y FRV A N+ G G P+  +  +   +  +PPG +    V D + 
Sbjct: 16783 HKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKIT---VDDVTR 16839

Query: 917   SSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFR 974
             +S+SL+W +P    G     YI+EM+A+ +++WS+C ++       T   L + ++Y FR
Sbjct: 16840 NSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVIT--NLTQGEEYLFR 16897

Query: 975   IRAVNEAGVGEPVELDKGVRA----MPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSG 1030
             + AVNE G  +P  L   + A    + P   P F       S   V+ G  L I    SG
Sbjct: 16898 VVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAF-------SSYSVQVGQDLKIEVPISG 16950

Query: 1031  SPPPDVIWQKDGVPTK--GRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDI 1088
              P P + W KDG+P K   R  +T S + +   I  T + D G Y I + N  G+    I
Sbjct: 16951 RPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASI 17010

Query: 1089  HVRVADFPRPPTNLRLFEEV-PNTVTLTWNHSPDVQEDG--EAHYIIMKRDASTATWYTA 1145
              +   D P PP     F++V   ++TL+WN  P +   G    +YI+ KRD +T  W   
Sbjct: 17011 EIVTLDKPDPPKGPVKFDDVSAESITLSWN--PPLYTGGCQITNYIVQKRDTTTTVWDVV 17068

Query: 1146  AERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
             +  V      VT L  G +Y FR+ A N  G S  L+S
Sbjct: 17069 SATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALES 17106



 Score =  191 bits (486), Expect = 3e-48
 Identities = 152/474 (32%), Positives = 218/474 (45%), Gaps = 34/474 (7%)

Query: 730   GRPVTQF-IVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVS--- 785
             G P+  F IV  R   K +W K+G +D  V     + V+      F ++  ++   S   
Sbjct: 12316 GCPIRLFAIVRGRPAPKVTWRKVG-IDNVVRKGQVDLVD---TMAFLVIPNSTRDDSGKY 12371

Query: 786   -----DPLETEEVFAG-NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVE 839
                  +P   + VF     ++ PG  S  +V+DVTK +  ++W  P  DGG+ V  YIVE
Sbjct: 12372 SLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVE 12431

Query: 840   RRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDP 899
             +R+     W  V  + ++ T   V  L+   EY FRV AVN+ GPG P+     V+A DP
Sbjct: 12432 KREADRKTWSTVTPE-VKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDP 12490

Query: 900   VKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAED--TKEWSKCTKIPI 955
             +  P   + L V++ + +S +LAW  P    G    GYI   R E+     W++ +   +
Sbjct: 12491 LSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYS--VV 12548

Query: 956   SGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMV 1015
                   V GL E +KY FR+ A N  GV  P E +    A      PK      +   + 
Sbjct: 12549 KDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKI----LMPEQIT 12604

Query: 1016  VRAGTALCIHAAFSGSPPPDVIWQK--DGVPTKGRETITKSKNHSQFLINSTKRSDSGVY 1073
             ++AG  L I A   G P P   W+K  D V T     + K+ + S  +I    R DSG Y
Sbjct: 12605 IKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYY 12664

Query: 1074  RILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEV-PNTVTLTWNHSPDVQEDGEA---H 1129
              +  +N  G     I V V D P PP       ++  +  +L+W H P   EDG +   +
Sbjct: 12665 SLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSW-HIP--LEDGGSNITN 12721

Query: 1130  YIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
             YI+ K D S   W TA   V      V  L+PG++Y FRV A N  G SEPL S
Sbjct: 12722 YIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPLTS 12775



 Score =  191 bits (485), Expect = 4e-48
 Identities = 165/599 (27%), Positives = 252/599 (42%), Gaps = 54/599 (9%)

Query: 609   LEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTIS 668
             L+A     I V  G    I     GKP P VTW  +  E T  +  ++E     + + I 
Sbjct: 10221 LDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMN--ERTLPQEATIETTAISSSMVIK 10278

Query: 669   NCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDN 728
             NC R   G+  L  KN+ G    T+ + VLD P P         L+     + W +P+D+
Sbjct: 10279 NCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDD 10338

Query: 729   GGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPL 788
             GG P+T +++E+R   +++W  +     +  N +   + +GKAY FRI A NS G+   +
Sbjct: 10339 GGSPITNYVIEKRESDRRAWTPVTYTVTR-QNATVQGLIQGKAYFFRIAAENSIGMGPFV 10397

Query: 789   ETEEVFA-GNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNL 847
             ET E      PI  P      +V +VTK  VT+TWN P  DGG+ ++ Y++E R  G+  
Sbjct: 10398 ETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEK 10457

Query: 848   WVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQ 907
             +  V  D +   K TV GL E   YE+RV AVN  G G+PS  +  +  KD + PP L  
Sbjct: 10458 FHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHL 10517

Query: 908   DLH--VSDSSNSSISLAWREPAEGDPPSGYILEMR--AEDTKEWSKCTKIPI-------- 955
             D    ++     + +L  R   +  P   +  +     ED +   K T   +        
Sbjct: 10518 DFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAK 10577

Query: 956   ---SGT-CYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLK 1011
                SG  C  V      +K F ++  V+  G              PP     FD     K
Sbjct: 10578 RSDSGKYCVVVENSTGSRKGFCQVNVVDRPG--------------PPVGPVSFD--EVTK 10621

Query: 1012  SHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSG 1071
              +MV+     L       GS   + I +K  V       +T +   +   ++        
Sbjct: 10622 DYMVISWKPPL----DDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDY 10677

Query: 1072  VYRILLQNEFG--------EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQ 1123
             ++RI  +N +G          +     RV D P  P    + E   ++  +TWN   D  
Sbjct: 10678 IFRIHAENLYGISDPLVSDSMKAKDRFRVPDAPDQPI---VTEVTKDSALVTWNKPHDGG 10734

Query: 1124  EDGEAHYIIMKRDASTATWYTAAERVFS--NKYTVTGLLPGRKYYFRVVARNEIGDSEP 1180
             +    +YI+ KR+  +  W    +       K+ V  LL G +Y FRV A NEIG  +P
Sbjct: 10735 KP-ITNYILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDP 10792



 Score =  191 bits (484), Expect = 5e-48
 Identities = 126/394 (31%), Positives = 187/394 (47%), Gaps = 11/394 (2%)

Query: 797   NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
             N ++ PG     +VT+VTKE  TI+W  P  +GG+ +  +IVE RK     W  V  D  
Sbjct: 11692 NVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVT 11751

Query: 857   QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
             +  +     LL + EY FRV A NK G G      + ++A +P+  PG  ++LH++D   
Sbjct: 11752 K--RLIKANLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGK 11809

Query: 917   SSISLAWREP--AEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFR 974
             + + L WR P    G P   Y +E R + + +W +  K  I  T Y V   +E Q Y FR
Sbjct: 11810 TFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFR 11869

Query: 975   IRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPP 1034
             ++  NE G  + V+ ++ V        P  DL  +L   + V+AG  + + A   G P P
Sbjct: 11870 VQTKNEGGESDWVKTEE-VVVKEDLQKPVLDL--KLSGVLTVKAGDTIRLEAGVRGKPFP 11926

Query: 1035  DVIWQKDGVPT----KGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHV 1090
             +V W KD   T      R  I    + S+F +   KRSD G Y +   N  G       V
Sbjct: 11927 EVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATV 11986

Query: 1091  RVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVF 1150
              V D P P  NL++ +   +  T+ W+   D       +YI+ K +     W T +  V 
Sbjct: 11987 NVLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVL 12046

Query: 1151  SNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSR 1184
             +   TVT L+ G +Y FRV A N+IG   P +S+
Sbjct: 12047 TPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESK 12080



 Score =  189 bits (481), Expect = 1e-47
 Identities = 158/580 (27%), Positives = 258/580 (44%), Gaps = 42/580 (7%)

Query: 619   VKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLI 678
             V+ G +  + + ++G+P P   W K    ++   R  +   +  + LT+ NC R D+G  
Sbjct: 22064 VRAGASIRLFIAYQGRPTPTAVWSKPDSNLSL--RADIHTTDSFSTLTVENCNRNDAGKY 22121

Query: 679   LLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIV 738
              L ++N+ GS + T  + VLD P PP G + F +++     + W AP  +GG  +  ++V
Sbjct: 22122 TLTVENNSGSKSITFTVKVLDTPGPP-GPITFKDVTRGSATLMWDAPLLDGGARIHHYVV 22180

Query: 739   ERRAVGKKSWIKIGEVDGKVTN--FSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAG 796
             E+R   ++SW  I E   K T   F  N + EG  Y FR+ AVN  GV +P E  E    
Sbjct: 22181 EKREASRRSWQVISE---KCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVA 22237

Query: 797   NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
                E P    +  V D +K +  + W  P  DGG+ + GY++E R+KGS+ WV       
Sbjct: 22238 T--EQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGH--T 22293

Query: 857   QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPP-----GLVQDLHV 911
             +    TV+ L+E TEYEFRV A N AG  +P    SSV+ K+P   P     G+   L +
Sbjct: 22294 KQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQL-I 22352

Query: 912   SDSSNSSISLAWREPAEGDPP---SGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIER 968
             +  + S  ++    P  G P    +  + EMR ++T   S  T      T  TV   +  
Sbjct: 22353 TCKAGSPFTI--DVPISGRPAPKVTWKLEEMRLKETDRVSITT--TKDRTTLTVKDSMRG 22408

Query: 969   QKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAF 1028
                 + +   N AGV +   +   V   P P     ++S+      V+  G         
Sbjct: 22409 DSGRYFLTLENTAGV-KTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEP----KDG 22463

Query: 1029  SGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEAR-YD 1087
              G+   + I +K    T   + +  S   +Q  +    +     +R+  +N FG ++  +
Sbjct: 22464 GGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE 22523

Query: 1088  IHVRVADF----PRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH---YIIMKRDASTA 1140
                 +A+     P  PT   ++    N +++ W    +   DG +    Y + K++ +T 
Sbjct: 22524 SAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWE---EPYHDGGSKIIGYWVEKKERNTI 22580

Query: 1141  TWYTAAE-RVFSNKYTVTGLLPGRKYYFRVVARNEIGDSE 1179
              W    +       Y VTGL+ G +Y FR  A N  G S+
Sbjct: 22581 LWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSK 22620



 Score =  189 bits (480), Expect = 2e-47
 Identities = 192/770 (24%), Positives = 305/770 (39%), Gaps = 73/770 (9%)

Query: 570   LIFPSMGPEHEGKYTFRAKGTESEAS------VFIADPPTIDPSVLEALAAHAITVKVGH 623
             L+ P       G YT  A      AS      V     P + P   E+++A  +T+    
Sbjct: 9876  LVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSW-- 9933

Query: 624   TAHIKVPFRGKPLPKVTWYK-DGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKL 682
                   P +     K+T Y  +  E   +  V +     +   TI   +     +  +  
Sbjct: 9934  -----FPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMA 9988

Query: 683   KNDHGSA--------TATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVT 734
             +N +G          TA    SV   P  P        ++ + + + W+ P+ +GG PVT
Sbjct: 9989  QNKYGIGEPLDSEPETARNLFSVPGAPDKPT----VSSVTRNSMTVNWEEPEYDGGSPVT 10044

Query: 735   QFIVERRAVGKKSWIKIGEVDGKV----TNFSTNKVEEGKAYQFRILAVNSEGVSDP-LE 789
              + +E +    K W ++     K      ++    + EG  YQFR+ A+N+ GV    L 
Sbjct: 10045 GYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLP 10104

Query: 790   TEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWV 849
             ++   A +PI PPG    P+VTD TK +  + W+ P +DGG+ V GYIVE +++G   W 
Sbjct: 10105 SDPATARDPIAPPG-PPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWE 10163

Query: 850   PVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDL 909
                   ++GTK  V GL E   Y+FRV AVN AG G+P   +  +  KD +  P L  D 
Sbjct: 10164 KGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDA 10223

Query: 910   HVSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIE 967
              V D          R  A   G PP      M      + +      IS +   +     
Sbjct: 10224 SVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSSM-VIKNCQR 10282

Query: 968   RQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAA 1027
               +  + + A NEAG  +   +   V  +P P    F       +H +      L   + 
Sbjct: 10283 SHQGVYSLLAKNEAGERKKTII-VDVLDVPGPVGTPF------LAHNLTNESCKLTWFSP 10335

Query: 1028  FS--GSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFG--- 1082
                 GSP  + + +K     +    +T +       +    +  +  +RI  +N  G   
Sbjct: 10336 EDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGP 10395

Query: 1083  --EARYDIHVRVA-DFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDA 1137
               E    + +R     P  P +L + E   NTVTLTWN  P   + G    +Y++  R  
Sbjct: 10396 FVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWN--PPKYDGGSEIINYVLESRLI 10453

Query: 1138  STATWYTAA-ERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQD 1196
              T  ++    + + S KYTV GL  G  Y +RV A N +G  +P                
Sbjct: 10454 GTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKP---------------- 10497

Query: 1197  LSAKLKPYEKKDWRHAPRFVTPLKPHTVLR-GQDCTMTCAFLGNPRPTVTLYKGDVNITA 1255
              S   KP   KD    P      +    +R G+   +T  + G P+P V+ +K + ++  
Sbjct: 10498 -SFCTKPITCKDELAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLE 10556

Query: 1256  NSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDK 1305
             + +    +T     L        DSG Y V+VEN  G  +  C + V D+
Sbjct: 10557 DDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDR 10606



 Score =  188 bits (477), Expect = 3e-47
 Identities = 110/321 (34%), Positives = 176/321 (54%), Gaps = 12/321 (3%)

Query: 590  TESEASVFIADP---PTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGM 646
            +E   +V   DP   PTID      L  H I V  G    I VPFR  P+P V+W+KDG 
Sbjct: 8067 SEISENVVAKDPDCKPTID------LETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGK 8120

Query: 647  EVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQG 706
            EV   +R++M+     A L +   VR D+G+  + L+N  GSATA++++ V+  P P + 
Sbjct: 8121 EVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKD 8180

Query: 707  RVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKV 766
             ++  +++ S   + W+ P+ +GG P+  +++ERR  G++++I +   + K++    + +
Sbjct: 8181 -IKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLI 8239

Query: 767  EEGKAYQFRILAVNSEGVSDPLETEE-VFAGNPIEPPGFASQPQVTDVTKEAVTITWNAP 825
              G+ Y FR+ AVN  G  + +E +  V A +P +PP      +V + T EA+TITW  P
Sbjct: 8240 PNGE-YFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPP 8298

Query: 826  TQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPG 885
              DGG+ ++GYI+E+  KG   W   N+  +     T  GL E  EY+FRV A N AG  
Sbjct: 8299 LYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGIS 8358

Query: 886  QPSVPSSSVVAKDPVKPPGLV 906
            +PS  +    A DP+  P ++
Sbjct: 8359 EPSRATPPTKAVDPIDAPKVI 8379



 Score =  187 bits (475), Expect = 6e-47
 Identities = 164/601 (27%), Positives = 274/601 (45%), Gaps = 52/601 (8%)

Query: 601   PPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGE 660
             PP I+   L+A     +T++   T  + VP +G+P P+V W +D  E    ++ S+E   
Sbjct: 15552 PPEIE---LDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGE--SLDKASIESTS 15606

Query: 661   DQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHM 720
                LL + N  R DSG  +L ++N  GS +A +++ VLD P PPQ  ++  E++ + V +
Sbjct: 15607 SYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQD-LKVKEVTKTSVTL 15665

Query: 721   KWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVN 780
              W  P  +GG  +  +IVE+R   +K++  +     K T++  ++++EG +Y FR+LA N
Sbjct: 15666 TWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHK-TSWKVDQLQEGCSYYFRVLAEN 15724

Query: 781   SEGVSDPLET-EEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVE 839
               G+  P ET E V A     PPG   +  + DVT+ +V+++W  P  DGG+ +LGYIVE
Sbjct: 15725 EYGIGLPAETAESVKASERPLPPG---KITLMDVTRNSVSLSWEKPEHDGGSRILGYIVE 15781

Query: 840   RRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDP 899
              + KGS+ W       ++ T+ T+ GL++  EY FRV A N+ G   P   S  V+AKD 
Sbjct: 15782 MQTKGSDKWATC--ATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDL 15839

Query: 900   VKPPGLV-----------QDLHVSDS--SNSSISLAWREPAEGDPPSGYILEMRAEDTKE 946
             V PP              +DL V        + ++ W    + + P      + AE T+ 
Sbjct: 15840 VIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWH---KDNVPLKQTTRVNAESTEN 15896

Query: 947   WSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVE-LDKGVRAMPPPAAPKFD 1005
              S  T   I   C    G        + ++  N A  GE +E L+  V   P P      
Sbjct: 15897 NSLLT---IKDACREDVG-------HYVVKLTNSA--GEAIETLNVIVLDKPGPPTGPVK 15944

Query: 1006  LSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINST 1065
             +       + +  G          GS   + I +K    T   + ++ +   +       
Sbjct: 15945 MDEVTADSITLSWGPP----KYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRL 16000

Query: 1066  KRSDSGVYRILLQNEFGEARY-DIHVRVADF----PRPPTNLRLFEEVPNTVTLTWNHSP 1120
             K      +RI  +N +G++ Y +    VA +    P PP    +     +++ + WN   
Sbjct: 16001 KTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPI 16060

Query: 1121  DVQEDGEAHYIIMKRDASTATWYTAAER-VFSNKYTVTGLLPGRKYYFRVVARNEIGDSE 1179
                      Y + +++ ++  W    +  +   K+  TGL  G +Y FRV A N +G  +
Sbjct: 16061 SDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGK 16120

Query: 1180  P 1180
             P
Sbjct: 16121 P 16121



 Score =  187 bits (474), Expect = 8e-47
 Identities = 184/687 (26%), Positives = 294/687 (42%), Gaps = 94/687 (13%)

Query: 560   QIVKQGAVHKLIFPSMGPEHEGKYTFRAKGT------------ESEASVFIADPPTIDPS 607
             +I K   + +  F   G     +Y FR K              ES  +  I  PP ++  
Sbjct: 11547 RINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVE-- 11604

Query: 608   VLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTI 667
              L+      ITV+VG T  I    +G+P P +TW K+G  +  E+RV + +   +  L I
Sbjct: 11605 -LDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQI 11663

Query: 668   SNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKD 727
                VR D G  ++  KN  G A  +  ++VLDRP P Q          +C  + W+ P D
Sbjct: 11664 KEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCT-ISWENPLD 11722

Query: 728   NGGRPVTQFIVERRAVGKKSW-IKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSD 786
             NGG  +T FIVE R   +K W I   +V  ++   +     E   Y FR+ A N  GV  
Sbjct: 11723 NGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIKANLLANNE---YYFRVCAENKVGVGP 11779

Query: 787   PLETEE-VFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGS 845
              +ET+  + A NPI+ PG      + D  K  V + W  P  DGG+P L Y VERR KGS
Sbjct: 11780 TIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGS 11839

Query: 846   NLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGL 905
             + W  V+K  I+ T   VD  +E+  YEFRV   N+ G     V +  VV K+ ++ P  
Sbjct: 11840 DDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESD-WVKTEEVVVKEDLQKP-- 11896

Query: 906   VQDLHVSD----SSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYT 961
             V DL +S      +  +I L   E      P   +   + +D  + ++  ++ I     +
Sbjct: 11897 VLDLKLSGVLTVKAGDTIRL---EAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADS 11953

Query: 962   VGGLIERQKYF----FRIRAVNEAG----------VGEP----------VELDKGVRAMP 997
                 + + K      + + A N AG          + +P          V  D+      
Sbjct: 11954 SKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDRCTVCWD 12013

Query: 998   PPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNH 1057
             P   P+ D    ++++++ +  T   + + +S +           V T G  T+T+    
Sbjct: 12014 P---PEDDGGCEIQNYILEKCETKRMVWSTYSAT-----------VLTPG-TTVTRLIEG 12058

Query: 1058  SQFLINSTKRSDSGVYRILLQNEFG-----EARYDIHVRVADFPRPPTNLRLFEEVPNTV 1112
             +++           ++R+  +N+ G     E++  I     D P  P    + +     +
Sbjct: 12059 NEY-----------IFRVRAENKIGTGPPTESKPVIAKTKYDKPGRPDPPEVTKVSKEEM 12107

Query: 1113  TLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTAAERVF-SNKYTVTGLLPGRKYYFRV 1169
             T+ WN  P   + G++   Y + K++  +  W    +      +  V  LLP  +Y FRV
Sbjct: 12108 TVVWN--PPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRV 12165

Query: 1170  VARNEIGDSEP-LDSRDTWLINKDQIQ 1195
              A NEIG  EP L SR   ++ KD I+
Sbjct: 12166 KAENEIGIGEPSLPSRP--VVAKDPIE 12190



 Score =  185 bits (470), Expect = 2e-46
 Identities = 136/460 (29%), Positives = 206/460 (44%), Gaps = 20/460 (4%)

Query: 730   GRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLE 789
             GRP  +    R        ++I E     T  S +  +   A ++ +   NS G      
Sbjct: 17745 GRPTPEITWSREEGEFTDKVQI-EKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFV 17803

Query: 790   TEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWV 849
             T +V     ++ PG      V +V K++  + W  P  DGGA V  Y++++R+     + 
Sbjct: 17804 TVKV-----LDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYA 17858

Query: 850   PVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDL 909
              V+      T   V+ L E   Y FRV+A N+ G G P     +V A +P  PPG V   
Sbjct: 17859 NVSSK-CSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVT-- 17915

Query: 910   HVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIE 967
              ++D S +S SL W +P    G    GY++EM+ + T++WS   +  +     T  GL  
Sbjct: 17916 -LTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVT--GLSS 17972

Query: 968   RQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAA 1027
              Q+Y FR++A NE G  +P  L   V A      P   L     S   ++AG  L I   
Sbjct: 17973 GQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYS---IQAGEDLKIEIP 18029

Query: 1028  FSGSPPPDVIWQKDGVPTKG--RETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEAR 1085
               G P P++ W KDG P K   R  + ++   +   I    + D G Y +   N  G A 
Sbjct: 18030 VIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTAT 18089

Query: 1086  YDIHVRVADFPRPPTNLRLFEEVP-NTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYT 1144
              ++ V V + P PP     F+EV  + V ++W           ++YI+ KRD +T TW+ 
Sbjct: 18090 ENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHM 18149

Query: 1145  AAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSR 1184
              +  V      +T L  G +Y FR+ A N  G S PLDS+
Sbjct: 18150 VSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSK 18189



 Score =  184 bits (467), Expect = 5e-46
 Identities = 129/458 (28%), Positives = 206/458 (44%), Gaps = 17/458 (3%)

Query: 732   PVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETE 791
             P   + +  R + +++ I+   +   +   +  +  +G    + +LA N  G     E +
Sbjct: 10249 PTVTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGV---YSLLAKNEAG-----ERK 10300

Query: 792   EVFAGNPIEPPGFASQPQVT-DVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVP 850
             +    + ++ PG    P +  ++T E+  +TW +P  DGG+P+  Y++E+R+     W P
Sbjct: 10301 KTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTP 10360

Query: 851   VNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLH 910
             V    +     TV GL++   Y FR+ A N  G G     S ++V ++P+  P   +DL 
Sbjct: 10361 VTYT-VTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPERPEDLE 10419

Query: 911   VSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIER 968
             V + + ++++L W  P    G     Y+LE R   T+++ K T   +    YTV GL E 
Sbjct: 10420 VKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEG 10479

Query: 969   QKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAF 1028
               Y +R+ AVN  G G+P    K +      A P   L  R K  + +R G A  +   +
Sbjct: 10480 DTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDK--LTIRVGEAFALTGRY 10537

Query: 1029  SGSPPPDVIWQKD--GVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARY 1086
             SG P P V W KD   V    R  I  +           KRSDSG Y ++++N  G  + 
Sbjct: 10538 SGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKG 10597

Query: 1087  DIHVRVADFPRPPTNLRLFEEVPNT-VTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTA 1145
                V V D P PP     F+EV    + ++W    D       +YII K++     W   
Sbjct: 10598 FCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPV 10657

Query: 1146  AERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
                       V+ LL G+ Y FR+ A N  G S+PL S
Sbjct: 10658 TSASAKTTCKVSKLLEGKDYIFRIHAENLYGISDPLVS 10695



 Score =  183 bits (465), Expect = 8e-46
 Identities = 173/660 (26%), Positives = 266/660 (40%), Gaps = 74/660 (11%)

Query: 582   KYTFRAKGT----ESEASVFIADPPTID----PSVLEALAAH-AITVKVGHTAHIKVPFR 632
             KY FR K      ESE S    + P  D    P V   + A   +  K G    I    +
Sbjct: 9471  KYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIK 9530

Query: 633   GKPLPKVTW---------YKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLK 683
             G+P PK +W          KDG+    E+   +E  E+ +++ I  C R  +G   +  K
Sbjct: 9531  GRPTPKSSWEFDGKAKKAMKDGVHDIPED-AQLETAENSSVIIIPECKRSHTGKYSITAK 9589

Query: 684   NDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAV 743
             N  G  TA   + V+D P PP+         GSC  + WK P D+GG  +  +++E+R +
Sbjct: 9590  NKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSC-RLSWKMPDDDGGDRIKGYVIEKRTI 9648

Query: 744   GKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLET-EEVFAGNPIEPP 802
               K+W K+    G  T    + + E + Y FR+ A N  G+  P+ET +   A +PI PP
Sbjct: 9649  DGKAWTKVNPDCGSTTFVVPDLLSE-QQYFFRVRAENRFGIGPPVETIQRTTARDPIYPP 9707

Query: 803   GFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVE-------RRKKGSNLWVPVNKDP 855
                 + ++  +TK  V ++W  P  DGG+PV  YIVE         KK +  W   NK  
Sbjct: 9708  DPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEA--WRQCNKRD 9765

Query: 856   IQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPG--LVQDLHVSD 913
             ++  + TV+ L+E  EYEFRV AVN AG  +PS        + P  PP   L + + V +
Sbjct: 9766  VEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQRPDMPPSIDLKEFMEVEE 9825

Query: 914   SSNSSI----------SLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVG 963
              +N +I          +L W +     P +        E     +   K+ +  TC  V 
Sbjct: 9826  GTNVNIVAKIKGVPFPTLTWFKAPPKKPDN-------KEPVLYDTHVNKLVVDDTCTLVI 9878

Query: 964   GLIERQKY-FFRIRAVNEAGVGEPVELDKGVRAMP-PPAAPKFDLSARLKSHMVVRAGTA 1021
                 R     + I AVN  G     E+   V   P PP  P      + +S    +   +
Sbjct: 9879  PQSRRSDTGLYTITAVNNLGTASK-EMRLNVLGRPGPPVGP-----IKFESVSADQMTLS 9932

Query: 1022  LCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEF 1081
                     GS   + + +K     K    ++       + I         V+RI+ QN++
Sbjct: 9933  WFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKY 9992

Query: 1082  G-----EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRD 1136
             G     ++  +    +   P  P    +     N++T+ W             Y +  +D
Sbjct: 9993  GIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKD 10052

Query: 1137  ASTATWYTA-----AERVFSNKYTVTGLLPGRKYYFRVVARNEIG------DSEPLDSRD 1185
              ++  W                Y VTGL+ G  Y FRV A N  G       S+P  +RD
Sbjct: 10053 TTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARD 10112



 Score =  182 bits (463), Expect = 1e-45
 Identities = 168/649 (25%), Positives = 276/649 (42%), Gaps = 83/649 (12%)

Query: 582   KYTFRAKGTESEASVFIADPPTIDPSV------------LEALAAHAITVKVGHTAHIKV 629
             +Y FR     SE    + +P T+  SV            L+A     + ++   T  + V
Sbjct: 18768 EYNFRICAINSEG---VGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFV 18824

Query: 630   PFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSA 689
               +G+P P+V W K    +T+  R  +E      +L I N  R DSG   L L+N+ GS 
Sbjct: 18825 TIKGRPEPEVKWEKAEGILTD--RAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSK 18882

Query: 690   TATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWI 749
             TA +++ VLD P  P   +   E+    V + W+ P  +GG  +T +IVE+R   +K++ 
Sbjct: 18883 TAFVNVRVLDSPSAPVN-LTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYA 18941

Query: 750   KIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEE-VFAGNPIEPPGFASQP 808
              I     K T F    ++EG +Y FR+LA N  G+  P ET E V    P  PPG  +  
Sbjct: 18942 TITNNCTKTT-FRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVT-- 18998

Query: 809   QVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLE 868
              + DVT+   TI W  P  DGG+ + GY+VE + KGS  W    +  ++  + T+ GL  
Sbjct: 18999 -LVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQ--VKTLEATISGLTA 19055

Query: 869   DTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE 928
               EY FRV AVN+ G   P      V+A+D    P +    H       + ++  RE  +
Sbjct: 19056 GEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFH-------TFNVKAREQLK 19108

Query: 929   GDPPSGYILEMRAEDTKEWSK-------CTKIPISG----TCYTVGGLIERQKYFFRIRA 977
              D P     + R + T  W K        T++ +S     T  ++    +     + +  
Sbjct: 19109 IDVP----FKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCV 19164

Query: 978   VNEAG-VGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPP--- 1033
              N AG +  P+ +   V   P P  P             +R     C     S +PP   
Sbjct: 19165 SNSAGSITVPITII--VLDRPGPPGP-------------IRIDEVSCDSITISWNPPEYD 19209

Query: 1034  -----PDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARY-D 1087
                   + I +K    +     ++++   +   I          +R+  +N +G++ Y +
Sbjct: 19210 GGCQISNYIVEKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSE 19269

Query: 1088  IHVRVADF----PRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWY 1143
                 VA++    P PP   ++     +T+ +TW    +        Y +  ++ S+  W 
Sbjct: 19270 SSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWS 19329

Query: 1144  TAAERVFSN-KYTVTGLLPGRKYYFRVVARNEIG------DSEPLDSRD 1185
              A + + ++ +  V+GL  G  Y +RV A N  G        EP+ +RD
Sbjct: 19330 KANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARD 19378



 Score =  176 bits (447), Expect = 1e-43
 Identities = 152/630 (24%), Positives = 264/630 (41%), Gaps = 70/630 (11%)

Query: 701   PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTN 760
             P PP+ + E   ++ +   + WK P D+GG  +T + VERR      W++  +       
Sbjct: 14267 PGPPE-KPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDLR 14325

Query: 761   FSTNKVEEGKAYQFRILAVNSEGVSDPLE-TEEVFAGNPIEPPGFASQPQVTDVTKEAVT 819
                  ++EG  Y+FR+ A N  G+  P E ++ V   +   PPG  S P VTD TK++ +
Sbjct: 14326 CKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSAS 14385

Query: 820   ITWNAPTQDGGAPVLGYIVERRKKGSNLWVP-VNKDPIQGTKCTVDGLLEDTEYEFRVIA 878
             + W  P  DGG  + GY+VE +K G   W+       ++ T+  V  L    +Y FR+ A
Sbjct: 14386 LAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQFVVPDLQTKEKYNFRISA 14445

Query: 879   VNKAGPGQPSV-PSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPP----- 932
             +N AG G+P+V P   +V ++      L  +L  +    + +S+    P +G P      
Sbjct: 14446 INDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTW 14505

Query: 933   --SGYILEMRA--EDTKEWS-----KCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGV 983
                   L+ RA  E+T+ ++     +C +        T+     ++  F  +R ++  G 
Sbjct: 14506 TKDNINLKNRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGP 14565

Query: 984   G---EPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQK 1040
                  P ++ K    +     P  D  +R+ +++V                       +K
Sbjct: 14566 VLNLRPTDITKDSVTLHWDL-PLIDGGSRITNYIV-----------------------EK 14601

Query: 1041  DGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFG---EARYDIHVRVADFPR 1097
                  K   T T   +   + +          +R++ +NE+G          V+ ++ P 
Sbjct: 14602 REATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASEAPS 14661

Query: 1098  PPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH---YIIMKRDASTATWYTAAERVFSNKY 1154
             PP +L + +   +TV+L W   P  + DG +    Y+I  +   +  W T    V   + 
Sbjct: 14662 PPDSLNIMDITKSTVSLAW---PKPKHDGGSKITGYVIEAQRKGSDQW-THITTVKGLEC 14717

Query: 1155  TVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPR 1214
              V  L  G +Y F+V+A N  G S P +SR   +  +  + +L  +   Y+K     A  
Sbjct: 14718 VVRNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLR-GIYQKLVIAKA-- 14774

Query: 1215  FVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPT 1274
                         G +  +    LG P+PTVT  KGD  +    +  + +T+    L I  
Sbjct: 14775 ------------GDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINE 14822

Query: 1275  CTLKDSGDYSVLVENELGKDRSSCTLTVYD 1304
             C   DSG Y +   N +G+     T+ V+D
Sbjct: 14823 CVRSDSGPYPLTARNIVGEVGDVITIQVHD 14852



 Score =  174 bits (442), Expect = 4e-43
 Identities = 163/600 (27%), Positives = 259/600 (43%), Gaps = 61/600 (10%)

Query: 609   LEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTIS 668
             L+A     + ++ G T  + VP +G+P PK+TW K  + + +   + ++  +    L   
Sbjct: 13390 LDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCE 13449

Query: 669   NCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDN 728
             N  + D+G  +L L+N  G    T+ + VLD P PP   V   E+S    ++ W+ P  +
Sbjct: 13450 NVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVN-VTVKEISKDSAYVTWEPPIID 13508

Query: 729   GGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPL 788
             GG P+  ++V++R   +KSW  +     K T+F    +EEGK+Y FR+ A N  G+ DP 
Sbjct: 13509 GGSPIINYVVQKRDAERKSWSTVTTECSK-TSFRVANLEEGKSYFFRVFAENEYGIGDPG 13567

Query: 789   ETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLW 848
             ET +    +  + PG     +V  V+K + +I W  P  DGG+ ++GY+V+   +  N W
Sbjct: 13568 ETRDAVKAS--QTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTE-ENKW 13624

Query: 849   VPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGL--- 905
               V K      + +   L E  EY FRV A N+ G G PS    +VVA+D V  P L   
Sbjct: 13625 QRVMKS--LSLQYSAKDLTEGKEYTFRVSAENENGEGTPS--EITVVARDDVVAPDLDLK 13680

Query: 906   -VQDLHVSDSSNSSISLAWREPAEGDP-PSGYILEMRAEDTKEWSKCTKIPIS--GTCYT 961
              + DL      NS+  L  + P +G P PS  +   + ED         +  S   T   
Sbjct: 13681 GLPDLCYLAKENSNFRL--KIPIKGKPAPS--VSWKKGEDPLATDTRVSVESSAVNTTLI 13736

Query: 962   VGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAP-KFDLSARLKSHMVVRAGT 1020
             V    +     + I   N AG  E     K V     P  P KFD        +   A T
Sbjct: 13737 VYDCQKSDAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFD-------EVTAEAMT 13789

Query: 1021  ALCIHAAFSGSPPPD---------VIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSG 1071
                       +PP D         ++ ++D V  K   T   +   + F +         
Sbjct: 13790 -------LKWAPPKDDGGSEITNYILEKRDSVNNKW-VTCASAVQKTTFRVTRLHEGMEY 13841

Query: 1072  VYRILLQNEFG----------EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPD 1121
              +R+  +N++G           AR+     V D P PP    + +   ++V+LTW     
Sbjct: 13842 TFRVSAENKYGVGEGLKSEPIVARHPFD--VPDAPPPP---NIVDVRHDSVSLTWTDPKK 13896

Query: 1122  VQEDGEAHYIIMKRDASTATWYTAAER-VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEP 1180
                     Y +  ++ ++  W  A +  +    + VTGL  G +Y FRV+A N  G  +P
Sbjct: 13897 TGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKP 13956



 Score =  174 bits (440), Expect = 7e-43
 Identities = 143/479 (29%), Positives = 208/479 (43%), Gaps = 77/479 (16%)

Query: 743  VGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPP 802
            V KKS + I  VD K ++  T  +E          AVN  G         V   N ++ P
Sbjct: 7437 VPKKSTVTI--VDSKRSDTGTYIIE----------AVNVCG-----RATAVVEVNVLDKP 7479

Query: 803  GFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCT 862
            G  +   +TDVT E+  +TWN P  DGG+ +  Y+VERR   S +W  ++   ++ T   
Sbjct: 7480 GPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSST-VKDTNFK 7538

Query: 863  VDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLA 922
               L+ + EY FRV A N  G G+P V +S + AK    PPG    L  SD +  +++L 
Sbjct: 7539 ATKLIPNKEYIFRVAAENMYGVGEP-VQASPITAKYQFDPPGPPTRLEPSDITKDAVTLT 7597

Query: 923  WREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNE 980
            W EP +  G P +GY +E    DT +W +C K+P+  T Y V GL  ++KY FR+ A N 
Sbjct: 7598 WCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENL 7657

Query: 981  AGVG------EPVELDKGVRAMPPPAAP-----------------KFDLSARLKSHMV-- 1015
            AG G      EP+ +   +    PP  P                 + D  A+++S+++  
Sbjct: 7658 AGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEM 7717

Query: 1016 VRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRI 1075
            ++ GT   +  A             +GVPT            +Q L+          +R+
Sbjct: 7718 LKTGTDEWVRVA-------------EGVPT------------TQHLLPGLMEGQEYSFRV 7752

Query: 1076 LLQNEFGEARYD-----IHVRVADFP-RPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH 1129
               N+ GE+        +  R   +P  PP  L +     NT  L W            +
Sbjct: 7753 RAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITN 7812

Query: 1130 YIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWL 1188
            YI+ KRD     W T    V   K TVT L  G  Y FRV A N IG S+  +  D+ L
Sbjct: 7813 YIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVL 7871



 Score =  174 bits (440), Expect = 7e-43
 Identities = 141/466 (30%), Positives = 208/466 (44%), Gaps = 32/466 (6%)

Query: 730   GRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFST-------NKVEEGKAYQFRILAVNSE 782
             GRP  +    +  V  +   +IG +D K T+F T       NK + GK   + +   NS 
Sbjct: 13414 GRPPPKITWSKPNVNLRD--RIG-LDIKSTDFDTFLRCENVNKYDAGK---YILTLENSC 13467

Query: 783   GVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRK 842
             G     + E       ++ PG      V +++K++  +TW  P  DGG+P++ Y+V++R 
Sbjct: 13468 G-----KKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRD 13522

Query: 843   KGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKP 902
                  W  V  +    T   V  L E   Y FRV A N+ G G P     +V A    + 
Sbjct: 13523 AERKSWSTVTTE-CSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGETRDAVKAS---QT 13578

Query: 903   PGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCY 960
             PG V DL V   S SS S+ W++P    G    GY+++   E+ K W +  K       Y
Sbjct: 13579 PGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTEENK-WQRVMKS--LSLQY 13635

Query: 961   TVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGT 1020
             +   L E ++Y FR+ A NE G G P E+   V A     AP  DL        + +  +
Sbjct: 13636 SAKDLTEGKEYTFRVSAENENGEGTPSEIT--VVARDDVVAPDLDLKGLPDLCYLAKENS 13693

Query: 1021  ALCIHAAFSGSPPPDVIWQK--DGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQ 1078
                +     G P P V W+K  D + T  R ++  S  ++  ++   ++SD+G Y I L+
Sbjct: 13694 NFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLK 13753

Query: 1079  NEFGEARYDIHVRVADFPRPPTNLRLFEEV-PNTVTLTWNHSPDVQEDGEAHYIIMKRDA 1137
             N  G     I ++V   P  PT    F+EV    +TL W    D       +YI+ KRD+
Sbjct: 13754 NVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDS 13813

Query: 1138  STATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
                 W T A  V    + VT L  G +Y FRV A N+ G  E L S
Sbjct: 13814 VNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKS 13859



 Score =  172 bits (437), Expect = 1e-42
 Identities = 175/656 (26%), Positives = 265/656 (40%), Gaps = 95/656 (14%)

Query: 701  PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIG-----EVD 755
            P PP G+ + L  +   + + W  P DNGG P+T + +E+R  G   W ++      +V 
Sbjct: 9294 PGPP-GKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVG 9352

Query: 756  GKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLE-TEEVFAGNPIEPPGFASQPQVTDVT 814
             K   F+  ++ EG  YQFR +A+N+ G+  P E ++   AG+PI PPG  S P+V D T
Sbjct: 9353 LKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPPGPPSCPEVKDKT 9412

Query: 815  KEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDP--IQGTKCTVDGLLEDTEY 872
            K ++++ W  P +DGG+P+ GYIVE +++G+  W  VN+    I   +C V  L E  +Y
Sbjct: 9413 KSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCECVVPNLKELRKY 9472

Query: 873  EFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA----E 928
             FRV AVN+AG  +PS  +  + A D  + P +  D+   D          R PA     
Sbjct: 9473 RFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGR 9532

Query: 929  GDPPSGYILEMRAE----------------DTKEWSKCTKIPISGTCYTVGGLIERQKYF 972
              P S +  + +A+                +T E S    IP     +T        KY 
Sbjct: 9533 PTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHT-------GKY- 9584

Query: 973  FRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALC--IHAAFSG 1030
              I A N+AG       +  V+ M  P  PK      LK   + R    L   +     G
Sbjct: 9585 -SITAKNKAG---QKTANCRVKVMDVPGPPK-----DLKVSDITRGSCRLSWKMPDDDGG 9635

Query: 1031 SPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFG-------- 1082
                  + +K  +  K    +      + F++          +R+  +N FG        
Sbjct: 9636 DRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETI 9695

Query: 1083 ---EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIM-----K 1134
                AR  I+      P PP  L++     NTV L+W    +       HYI+       
Sbjct: 9696 QRTTARDPIYP-----PDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDP 9750

Query: 1135 RDASTATWYTAAER-VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQ 1193
                   W    +R V   ++TV  L+ G +Y FRV A N  G S+P             
Sbjct: 9751 TGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKP------------- 9797

Query: 1194 IQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNI 1253
                SA + P + +     P  +   +   V  G +  +     G P PT+T +K     
Sbjct: 9798 ----SATVGPCDCQR-PDMPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKK 9852

Query: 1254 TANSKFWYNST-------SGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTV 1302
              N +     T          CTLVIP     D+G Y++   N LG       L V
Sbjct: 9853 PDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNV 9908



 Score =  172 bits (437), Expect = 1e-42
 Identities = 178/792 (22%), Positives = 321/792 (40%), Gaps = 74/792 (9%)

Query: 546   WLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFI------A 599
             W+K  +E+++   ++I        L          G Y  +AK    E SV +       
Sbjct: 16272 WIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDR 16331

Query: 600   DPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERG 659
               P   P V+  + A   T+        K P +      + +  +  E +      ++  
Sbjct: 16332 PGPPEGPVVISGVTAEKCTLAW------KPPLQDGGSDIINYIVERRETSRLVWTVVDAN 16385

Query: 660   EDQALLTISNCVREDSGLILLKLKNDHG--------SATATLHLSVLDRPKPPQGRVEFL 711
                    ++  +  +     +   N +G           A     V D PK P    E  
Sbjct: 16386 VQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAP----EVT 16441

Query: 712   ELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIK-----IGEVDGKVTNFSTNKV 766
              ++   + + W+ P  +GG  +  +++E+R      W +     IGE+  +VT    N  
Sbjct: 16442 TVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENH- 16500

Query: 767   EEGKAYQFRILAVNSEGVSDPLETEEVF-AGNPIEPPGFASQPQVTDVTKEAVTITWNAP 825
                  Y+FR+ A N+ G+S+P        A +PI  PG  + P+V D+T+ +V ++W+ P
Sbjct: 16501 ----DYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKP 16556

Query: 826   TQDGGAPVLGYIVERRKKGSNLWVPVNKDP-IQGTKCTVDGLLEDTEYEFRVIAVNKAGP 884
               DGG  + GYIVE+       W        I  T   V+ LLE  EY FR+ A+NKAG 
Sbjct: 16557 IYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGV 16616

Query: 885   GQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN--SSISLAWREPAEGDPPSGYILEMRAE 942
             G+ +     ++ ++ ++ P +  DL +    N  +  SL    P +G P +  +   + +
Sbjct: 16617 GEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRP-TPEVKWGKVD 16675

Query: 943   DTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAP 1002
                  +    +  S T   +  +       + +   N +G          VR +  P+ P
Sbjct: 16676 GEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVT---VRVLDTPSPP 16732

Query: 1003  KFDLSARLKSHMVVRAGTALCIHAAF--SGSPPPDVIWQKDGVPTKGRETITKSKNHSQF 1060
                    LK   + +   ++         GS   + I +K     K    +  + + + +
Sbjct: 16733 -----VNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSW 16787

Query: 1061  LINSTKRSDSGVYRILLQNEFG---EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWN 1117
              I+  +   S  +R+  +NE+G    A+    ++VA+ P+PP  + + +   N+V+L+W 
Sbjct: 16788 KIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKITVDDVTRNSVSLSWT 16847

Query: 1118  HSPDVQEDGEAHYI--IMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEI 1175
                  + DG +  I  I++  A  +  ++   RV S +  +T L  G +Y FRVVA NE 
Sbjct: 16848 KP---EHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVITNLTQGEEYLFRVVAVNEK 16904

Query: 1176  GDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCA 1235
             G S+P  S    ++ KD + +   K            P F +    ++V  GQD  +   
Sbjct: 16905 GRSDPR-SLAVPIVAKDLVIEPDVK------------PAFSS----YSVQVGQDLKIEVP 16947

Query: 1236  FLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDR 1295
               G P+PT+T  K  + +   ++     +  + TL I      D G Y + V N +G+  
Sbjct: 16948 ISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKT 17007

Query: 1296  SSCTLTVYDKDD 1307
             +S  +   DK D
Sbjct: 17008 ASIEIVTLDKPD 17019



 Score =  171 bits (432), Expect = 6e-42
 Identities = 170/661 (25%), Positives = 275/661 (41%), Gaps = 101/661 (15%)

Query: 701  PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTN 760
            P PP   +  ++++   V +KW+ PK++GGRP+ ++++E++      W+K G+  G   N
Sbjct: 7879 PGPPYA-LAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCN 7937

Query: 761  FSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFA-GNPIEPPGFASQPQVTDVTKEAVT 819
            F    V EG   QF++ A N  GV  P E  E+ +  +P  PP       VTD  ++ + 
Sbjct: 7938 FRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIA 7997

Query: 820  ITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVD-GLLEDTEYEFRVIA 878
            I W  P ++GG+P++GY VE    G+  W+ VN  PI+  K  V+ G++ D EY  RV A
Sbjct: 7998 IAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRA 8057

Query: 879  VNKAGPGQPSVPSSSVVAKDPVKPPGL---VQDLHVSDSSNSSISLAWREPAEGDPPSGY 935
            VN  G  +PS  S +VVAKDP   P +     D+ V +    SI + +R  A   P   +
Sbjct: 8058 VNAIGVSEPSEISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFR--AVPVPTVSW 8115

Query: 936  ILEMRAEDTKEWSKCTKIPISGTCYT----VGGLIERQKYFFRIRAVNEAGVGEPVELDK 991
                  +D KE     ++ +     +    V   +      + I   N+ G      ++ 
Sbjct: 8116 -----HKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLG-SATASINV 8169

Query: 992  GVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAA-FSGSPP--PDVIWQKDGVPTKGR 1048
             V  +P P          +K+  + ++   L      F G  P    V+ +++     GR
Sbjct: 8170 KVIGLPGPCKD-------IKASDITKSSCKLTWEPPEFDGGTPILHYVLERREA----GR 8218

Query: 1049 ET---ITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVR---VADFPR----P 1098
             T   +   +N   + +     +    +R+   N+ G   Y I ++   +A  P+    P
Sbjct: 8219 RTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEY-IELKNPVIAQDPKQPPDP 8277

Query: 1099 PTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTAAERVFSN-KYT 1155
            P ++ +       +T+TW   P + + G     YII K       W    E +     YT
Sbjct: 8278 PVDVEVHNPTAEAMTITWK--PPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYT 8335

Query: 1156 VTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRF 1215
              GL  G++Y FRV A N  G SEP                 S    P +  D   AP+ 
Sbjct: 8336 AKGLEEGKEYQFRVRAENAAGISEP-----------------SRATPPTKAVDPIDAPKV 8378

Query: 1216 V--TPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWY------------ 1261
            +  T L+   V RG +  +  +  G+P PT+T  K D N+    +               
Sbjct: 8379 ILRTSLE---VKRGDEIALDASISGSPYPTITWIK-DENVIVPEEIKKRAAPLVRRRKGE 8434

Query: 1262 ------------------NSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVY 1303
                              NS  G   L +      D G Y + VEN+ G  ++ CT++V 
Sbjct: 8435 VQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVL 8494

Query: 1304 D 1304
            D
Sbjct: 8495 D 8495



 Score =  169 bits (427), Expect = 2e-41
 Identities = 217/939 (23%), Positives = 367/939 (39%), Gaps = 112/939 (11%)

Query: 430   VKERSRACLECELTSK-DVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEY 488
             VK R +  ++     +   T+ W+KDGQ L   T+ +++       L I++A   D G Y
Sbjct: 19101 VKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTY 19160

Query: 489   TVVAMQDGDPTEYYSTAIVTVEERLA---TVKSGMSDVHAATGSPAEL---CVVLNDEKV 542
              +             T IV           +     D    + +P E    C + N    
Sbjct: 19161 ELCVSNSAGSITVPITIIVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQISN---- 19216

Query: 543   EGVWLKDGKEITDLPGMQIVKQGAVH---KLIFPSMGPEHEGKYTFR---AKGTESEASV 596
                ++ + KE T      IV Q       K++  + G E++ +        K + SE+S 
Sbjct: 19217 ---YIVEKKETTSTT-WHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSA 19272

Query: 597   FIADPPTIDPS------VLEA-----LAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDG 645
              +A+ P   P       V+ A     L    + V  G +  I      K    + W K  
Sbjct: 19273 VVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKAN 19332

Query: 646   MEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQ 705
               +  + ++ +  G D+ L+       E+   I        G  + +        P  P 
Sbjct: 19333 KILIADTQMKVS-GLDEGLMYEYRVYAENIAGI--------GKCSKSCEPVPARDPCDPP 19383

Query: 706   GRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNK 765
             G+ E   ++   V +KW  P  +GG  +T +IVERR +    W+K    + + T F   +
Sbjct: 19384 GQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQETYFEVTE 19443

Query: 766   VEEGKAYQFRILAVNS-EGVSDPLE-TEEVFAGNPIEPPGFASQPQVTDV--TKEAVTIT 821
             + E + Y+FR+ A N+ + VS+P E T  +   + +EPP      +  DV   K    + 
Sbjct: 19444 LTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLK 19503

Query: 822   WNAPTQDGGAPVLGYI---VERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIA 878
              NA       PV+ +    +E  ++     +  +   +   K   D +  DT    + + 
Sbjct: 19504 INADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVK---DCIRRDTG---QYVL 19557

Query: 879   VNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYI 936
               K   G  SV  +  V   P  P G    L ++  +    SL+W  P E  G     YI
Sbjct: 19558 TLKNVAGTRSVAVNCKVLDKPGPPAG---PLEINGLTAEKCSLSWGRPQEDGGADIDYYI 19614

Query: 937   LEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAM 996
             +E R      W+ C    +  T   V  L++  +Y FR+  VN+ GVGEP+E    ++A+
Sbjct: 19615 VEKRETSHLAWTICEG-ELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLE-SVAIKAL 19672

Query: 997   PPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETIT---- 1052
              P   P    S  + S  V +    LC        P  D   +  G   + RE  +    
Sbjct: 19673 DPFTVPSPPTSLEITS--VTKESMTLCW-----SRPESDGGSEISGYIIERREKNSLRWV 19725

Query: 1053  --KSKNHSQFLINST--KRSDSGVYRILLQNEFG---EARYDIHVRVAD---FPRPPTNL 1102
                 K      + ST  +      YR+  +N  G    +     +R  D    P PP+  
Sbjct: 19726 RVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKP 19785

Query: 1103  RLFEEVPNTVTLTWNHSPDVQEDGEAH---YIIMKRDASTATWYTAAERVFSNKYTVTGL 1159
             ++ +    T+T+ W        DG A    Y +  + +    W T+ + +   +YT++GL
Sbjct: 19786 KIVDSGKTTITIAWVKP---LFDGGAPITGYTVEYKKSDDTDWKTSIQSLRGTEYTISGL 19842

Query: 1160  LPGRKYYFRVVARNEIGDSEPLDSRDTWLI---NKDQIQDLSAKLKPYEKKDWRHAPRFV 1216
               G +Y FRV + N++G S+P DS D  +     ++ + D+ ++++              
Sbjct: 19843 TTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMR-------------- 19888

Query: 1217  TPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCT 1276
                K   V  G   TMT  F G P P V   K D ++   ++ + ++T    +L I    
Sbjct: 19889 ---KTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDL--RTRAYVDTTDSRTSLTIENAN 19943

Query: 1277  LKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASIT 1315
               DSG Y++ ++N L    +S TL V   D      +IT
Sbjct: 19944 RNDSGKYTLTIQNVL--SAASLTLVVKVLDTPGPPTNIT 19980



 Score =  167 bits (424), Expect = 5e-41
 Identities = 248/1114 (22%), Positives = 419/1114 (37%), Gaps = 162/1114 (14%)

Query: 262   PNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSL----SVGDKRM 317
             P  K+ W K    LR +  L   D+K       L   NVN  DAG Y L    S G K  
Sbjct: 13416 PPPKITWSKPNVNLRDRIGL---DIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEY 13472

Query: 318   SAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEP---------NFVWKFNGKELK 368
             +  + VLD P        PV VT ++ +     ++ + P         N+V +    E K
Sbjct: 13473 TIVVKVLDTP------GPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERK 13526

Query: 369   R---------DDKYEITVSEDGLTHTLKI---KDARLSDSGEFSAEAGNLVQKAQLTIDR 416
                          + +   E+G ++  ++    +  + D GE + +A    Q     +D 
Sbjct: 13527 SWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGE-TRDAVKASQTPGPVVD- 13584

Query: 417   IPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKK---DGQLLMHGTKYSMNHEGKRA 473
                          +K RS +   C       ++ WKK   DG   + G       E  + 
Sbjct: 13585 -------------LKVRSVSKSSC-------SIGWKKPHSDGGSRIIGYVVDFLTEENKW 13624

Query: 474   ELIIEDAQL-------SDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKS----GMSD 522
             + +++   L       ++G EYT     + +  E   + I  V             G+ D
Sbjct: 13625 QRVMKSLSLQYSAKDLTEGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPD 13684

Query: 523   VH--AATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHK-LIFPSMGPEH 579
             +   A   S   L + +  +    V  K G++         V+  AV+  LI        
Sbjct: 13685 LCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSD 13744

Query: 580   EGKYTFRAKGT----ESEASVFIADPPTID--PSVLEALAAHAITVKVGHTAHIKVPFRG 633
              GKYT   K      E   S+ +   P I   P   + + A A+T+K         P + 
Sbjct: 13745 AGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWA-------PPKD 13797

Query: 634   KPLPKVTWY-KDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSA--- 689
                 ++T Y  +  +    + V+      +    ++           +  +N +G     
Sbjct: 13798 DGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGL 13857

Query: 690   -----TATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVG 744
                   A     V D P PP      +++    V + W  PK  GG P+T + +E +   
Sbjct: 13858 KSEPIVARHPFDVPDAPPPPN----IVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERN 13913

Query: 745   KKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDP-LETEEVFAGNPIEPPG 803
                W +  +   ++ +F    + EG  Y+FR++A+N  GV  P L +E V A +PI+PPG
Sbjct: 13914 SLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPG 13973

Query: 804   FASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTV 863
                +P+V ++T+ +VT+ W  P  DGG  + GYIVE+R   S  W+  N   +     TV
Sbjct: 13974 ---KPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTV 14030

Query: 864   DGLLEDTEYEFRVIAVNKAGP-GQPSVPSSSVVAKDPVKPPGLVQDLHVSD-----SSNS 917
               L+E  +YEFR+ A N AG    PS  + +++ KD  + P +V D  + D     + ++
Sbjct: 14031 TDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDT 14090

Query: 918   SISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRA 977
              +  A     +  P S +    +     + ++ T  P S +  T+     +    + I A
Sbjct: 14091 IVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTS-SMLTIKYATRKDAGEYTITA 14149

Query: 978   VNEAGVG-EPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDV 1036
              N  G   E V++   V  +P P  P       + +    +A           GSP    
Sbjct: 14150 TNPFGTKVEHVKVT--VLDVPGPPGP-----VEISNVSAEKATLTWTPPLEDGGSPIKSY 14202

Query: 1037  IWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEAR--YDIHVRVAD 1094
             I +K          +++     + +     + +  ++R+   N +G+        V++ D
Sbjct: 14203 ILEKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQSEPVKMVD 14262

Query: 1095  F---PRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFS 1151
                 P PP    +     NT T++W    D        Y + +R+  +  W  A +   S
Sbjct: 14263 RFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVS 14322

Query: 1152  N-KYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWR 1210
             + +  VTGL  G  Y FRV A N  G   P ++ D+ L+                 KD  
Sbjct: 14323 DLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLM-----------------KDAA 14365

Query: 1211  HAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNIT--------ANSKFWYN 1262
             + P    P  PH      D T   A L   +P    Y G + IT           + W  
Sbjct: 14366 YPPG--PPSNPHVT----DTTKKSASLAWGKPH---YDGGLEITGYVVEHQKVGDEAWIK 14416

Query: 1263  STSG----VCTLVIPTCTLKDSGDYSVLVENELG 1292
              T+G    +   V+P    K+  ++ +   N+ G
Sbjct: 14417 DTTGTALRITQFVVPDLQTKEKYNFRISAINDAG 14450



 Score =  167 bits (423), Expect = 6e-41
 Identities = 166/658 (25%), Positives = 277/658 (42%), Gaps = 63/658 (9%)

Query: 562  VKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKV 621
            +++GA +KL   ++    EG        T +E      +PP ++   L+      I +  
Sbjct: 8761 IREGADYKLRVSAVNAAGEGPPGETQPVTVAEPQ----EPPAVE---LDVSVKGGIQIMA 8813

Query: 622  GHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLK 681
            G T  I     G+P+P   W K+  E+ +++RV ++    ++ L I + +R+D G  ++ 
Sbjct: 8814 GKTLRIPAVVTGRPVPTKVWTKEEGEL-DKDRVVIDNVGTKSELIIKDALRKDHGRYVIT 8872

Query: 682  LKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERR 741
              N  GS  A   + V D P P       +     C+ + W  P+D+GG  +T FI+ER+
Sbjct: 8873 ATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCL-LNWSDPEDDGGSEITGFIIERK 8931

Query: 742  AVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEP 801
                 +W +   ++ + +      + EG+ Y+FR++A N  G   P+E   + A +P+ P
Sbjct: 8932 DAKMHTWRQ--PIETERSKCDITGLLEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLGP 8989

Query: 802  PGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKC 861
            P    +   T+ TK  +T+ W  P  +GG+P+ GYI+E+R+     +  VNK     T  
Sbjct: 8990 PTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSF 9049

Query: 862  TVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISL 921
             V+ L E   YEFRV AVN+ G  +PS+P + V+  D V PP +   L V      +I +
Sbjct: 9050 LVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEV-PPTIKLRLSV---RGDTIKV 9105

Query: 922  AWREPAEGDPPSGYILEMRAEDTKEWSK-------------CTKIPIS----GTCYTVGG 964
               EP    P     L M      EWSK              TK  +S     T  ++  
Sbjct: 9106 KAGEPVH-IPADVTGLPM---PKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPK 9161

Query: 965  LIERQKYFFRIRAVNEAG-VGEPVELDKGVRAMPPPAAPKFDLSAR---LKSHMVVRAGT 1020
             +   K  + + A N  G V   V ++   R  PP      D+ A    L     +  G 
Sbjct: 9162 AVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGG 9221

Query: 1021 ALCIHAAFSGSPPPDVIWQKDGVPTKGR-ETITKSKNHSQFLINSTKRSDSGVYRILLQN 1079
            +   H          VI ++D    K   E +T +    ++ I     +    +R+   N
Sbjct: 9222 SEITHY---------VIDKRDASRKKAEWEEVTNTAVEKRYGIWKLIPNGQYEFRVRAVN 9272

Query: 1080 EFG---EARYDIHVRVAD---FPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIM 1133
            ++G   E + D  V + D    P PP   ++      ++ ++W    D        Y + 
Sbjct: 9273 KYGISDECKSD-KVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLE 9331

Query: 1134 KRDASTATWYTAAERVFSN------KYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRD 1185
            KR+  +  W   +    +       ++ V  LL G KY FR +A N  G   P +  D
Sbjct: 9332 KREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSD 9389



 Score =  165 bits (417), Expect = 3e-40
 Identities = 163/635 (25%), Positives = 271/635 (42%), Gaps = 78/635 (12%)

Query: 698   LDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGK 757
             +D  +PP+  V   ++S + V + W+ P  +GG  +T +IVERR +    W K    +  
Sbjct: 20460 IDACEPPRN-VRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVT 20518

Query: 758   VTNFSTNKVEEGKAYQFRILAVNSEG-------VSDPLETEEVFAGNPIEPPGFASQPQV 810
              T F  + + +   Y+FR+ A N+ G       V  P+   + + G  I+ P      + 
Sbjct: 20519 ETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGPVIDLP-----LEY 20573

Query: 811   TDVTK--EAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLE 868
             T+V K     ++   A      AP + +  + ++  +N  V V     + T      L++
Sbjct: 20574 TEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCV-----ENTTDLASILIK 20628

Query: 869   DTE------YEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLA 922
             D +      YE ++   N  G    ++    V   D   PPG    +     +   I+L 
Sbjct: 20629 DADRLNSGCYELKLR--NAMGSASATI---RVQILDKPGPPG--GPIEFKTVTAEKITLL 20681

Query: 923   WREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNE 980
             WR PA+  G   + YI+E R      WS  ++  +     T   +I+  +Y FR+RAVN+
Sbjct: 20682 WRPPADDGGAKITHYIVEKRETSRVVWSMVSE-HLEECIITTTKIIKGNEYIFRVRAVNK 20740

Query: 981   AGVGEPVELDKGV--RAMPPPAAPKF-DLSARLKSHMVVRAGTALCIHAAFSGSPPPDVI 1037
              G+GEP+E D  V   A   P  P   +++   K+ M V     +    A  GS      
Sbjct: 20741 YGIGEPLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPI----ADGGSDISGYF 20796

Query: 1038  WQKDGVPTKGRETITKS--KNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRV--- 1092
              +K    + G   + K   ++  Q +   T+ SD   YR+   N  G+  +         
Sbjct: 20797 LEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQ-YRVCAVNAAGQGPFSEPSEFYKA 20855

Query: 1093  ---ADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTAAE 1147
                 D P PP  +R+ +   +++TL W  S  V + G A   Y++  R      W T + 
Sbjct: 20856 ADPIDPPGPPAKIRIADSTKSSITLGW--SKPVYDGGSAVTGYVVEIRQGEEEEWTTVST 20913

Query: 1148  R--VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYE 1205
             +  V + +Y V+ L PG  YYFRV A N  G  EP++  +                 P +
Sbjct: 20914 KGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNE-----------------PVQ 20956

Query: 1206  KKDWRHAPRFVTPLKPHTVL---RGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYN 1262
              KD   AP     +   T +    G+D  +   F G P PTVT  K + N+ +++++   
Sbjct: 20957 AKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIE 21016

Query: 1263  STSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSS 1297
             +T     L IP  T  D+G Y + +EN +G+ +SS
Sbjct: 21017 NTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSS 21051



 Score =  165 bits (417), Expect = 3e-40
 Identities = 205/927 (22%), Positives = 345/927 (37%), Gaps = 119/927 (12%)

Query: 441   ELTSKDVTLRWK---KDGQLLMHGTKYSMN-HEGKRAELIIEDAQLSDGGEYTVVAMQDG 496
             ++T + +TL+W    +DG   + G  YS+   +G    +      +S+  +YTV  +  G
Sbjct: 21560 DVTRETITLKWNPPLRDGGSKIVG--YSIEKRQGNERWVRCNFTDVSEC-QYTVTGLSPG 21616

Query: 497   D----------------PTEYYSTAIVTVEERLATV----KSGMSDVHAATGSPAELCVV 536
             D                P    S  I+T +E +  +          +   +G    +  +
Sbjct: 21617 DRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKAL 21676

Query: 537   LNDEKVEGV-WLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGT----E 591
             +    V  V W KDG EI     M+I        L       +H G YT  AK      +
Sbjct: 21677 VQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAK 21736

Query: 592   SEASVFIADPP--TIDPSVLEALAAHAITV------KVGHTAHIKVPFRGKPLPKVTW-- 641
             +E  V + D P   + P     +    +T+        G           +   ++ W  
Sbjct: 21737 AEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWAL 21796

Query: 642   YKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRP 701
              +D  E      + +  G +     +S   +   G  L     D     A +  +V D P
Sbjct: 21797 IEDKCEAQSYTAIKLINGNEYQF-RVSAVNKFGVGRPL-----DSDPVVAQIQYTVPDAP 21850

Query: 702   KPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIK-IGEVDGKVTN 760
               P+       ++G+ + + W  P+ +GG  + Q+I+ERR      W+K I +     T 
Sbjct: 21851 GIPEPS----NITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETR 21906

Query: 761   FSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVF-AGNPIEPPGFASQPQVTDVTKEAVT 819
             F    + EG  Y+F ++A N+ GV        +     P+ PPG  +  +VTD +K  V+
Sbjct: 21907 FKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVS 21966

Query: 820   ITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAV 879
             + W+ P  DGG  ++GYI+E  K     W  VN +    T+ TV  L    EY+FRV A+
Sbjct: 21967 LEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAI 22026

Query: 880   NKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDS----SNSSISL------------AW 923
             N AG G     + ++ A D +  P L  D +   +    + +SI L             W
Sbjct: 22027 NGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVW 22086

Query: 924   REPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGV 983
              +P         I    +  T     C +        TV      +   F ++ ++  G 
Sbjct: 22087 SKPDSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGP 22146

Query: 984   GEPVELDKGVRAMPPPA--APKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKD 1041
               P+      R        AP  D  AR+  ++V                       +K 
Sbjct: 22147 PGPITFKDVTRGSATLMWDAPLLDGGARIHHYVV-----------------------EKR 22183

Query: 1042  GVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEAR-YDIH--VRVADFPRP 1098
                 +  + I++      F +N         +R+   NE+G    Y++   +   + P P
Sbjct: 22184 EASRRSWQVISEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPAP 22243

Query: 1099  PTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH---YIIMKRDASTATWYTAAERVFSNKYT 1155
             P  L + +   ++  L W   PD   DG +    Y++  R   +  W  A        +T
Sbjct: 22244 PRRLDVVDTSKSSAVLAWL-KPD--HDGGSRITGYLLEMRQKGSDFWVEAGHTK-QLTFT 22299

Query: 1156  VTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRF 1215
             V  L+   +Y FRV A+N+ G SEP ++  + +I + QI+  +A L              
Sbjct: 22300 VERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEP-TADLTGITN--------- 22349

Query: 1216  VTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTC 1275
                 +  T   G   T+     G P P VT    ++ +    +    +T    TL +   
Sbjct: 22350 ----QLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDS 22405

Query: 1276  TLKDSGDYSVLVENELGKDRSSCTLTV 1302
                DSG Y + +EN  G    S T+ V
Sbjct: 22406 MRGDSGRYFLTLENTAGVKTFSVTVVV 22432



 Score =  164 bits (416), Expect = 4e-40
 Identities = 230/1109 (20%), Positives = 416/1109 (37%), Gaps = 125/1109 (11%)

Query: 268   WIKGTEPLRIQYSLGKYDVKQMGT------KYMLVISNVNMNDAGIYSL----SVGDKRM 317
             ++ G  P  + +++ +  + Q  T         +VI N   +  G+YSL      G+++ 
Sbjct: 10242 YVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERKK 10301

Query: 318   SAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVWKFNGKELKRDDK----- 372
             +  + VLD P           +T     +          + +  +  ++ + D +     
Sbjct: 10302 TIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPV 10361

Query: 373   -YEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPIKFVSNLKNVRVK 431
              Y +T     +   ++ K      + E S   G  V+ ++  + R PI      +++ VK
Sbjct: 10362 TYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPERPEDLEVK 10421

Query: 432   ERSRACLECELTSKDVTLRWKKD----GQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGE 487
             E         +T   VTL W       G  +++    S     ++   +  D  LS   +
Sbjct: 10422 E---------VTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSR--K 10470

Query: 488   YTVVAMQDGDPTEYYSTAI--------------VTVEERLA------------TVKSGMS 521
             YTV  +++GD  EY  +A+              +T ++ LA            T++ G  
Sbjct: 10471 YTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIRVG-- 10528

Query: 522   DVHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEG 581
             +  A TG  +         K +  W KD  ++ +     I    A   L          G
Sbjct: 10529 EAFALTGRYS------GKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSG 10582

Query: 582   KYTFRAKGTES------EASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKP 635
             KY    + +        + +V     P + P   + +    + +        K P     
Sbjct: 10583 KYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISW------KPPLDDGG 10636

Query: 636   LPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLH- 694
                  +  +  EV ++  + +     +    +S  +     +  +  +N +G +   +  
Sbjct: 10637 SKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDYIFRIHAENLYGISDPLVSD 10696

Query: 695   -LSVLDRPKPPQGRVEFL--ELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKI 751
              +   DR + P    + +  E++     + W  P D GG+P+T +I+E+R    K W ++
Sbjct: 10697 SMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKPHD-GGKPITNYILEKRETMSKRWARV 10755

Query: 752   GEVD-GKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLE-TEEVFAGNPIEPPGFASQPQ 809
              +      T F    + EG  Y+FR+ A N  G+ DP   ++ VFA +PI  P     P+
Sbjct: 10756 TKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPE 10815

Query: 810   VTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDP--IQGTKCTVDGLL 867
               D T  +V +TW  P  DGG+ +LGYIVE +K G   W   N  P     TK  V GL 
Sbjct: 10816 AIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLR 10875

Query: 868   EDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA 927
             +   Y+FRV+AVN AG   P+     V+ KD ++PP L+ D +++   +  +    R  A
Sbjct: 10876 DGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSA 10935

Query: 928   --EGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGE 985
               +G P      +    D    ++    P+ G+   +          + +   N AG   
Sbjct: 10936 IIKGVPFPKVTWKKEDRDAPTKARIDVTPV-GSKLEIRNAAHEDGGIYSLTVENPAG--- 10991

Query: 986   PVELDKGVRAMPPPAAPK-FDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVP 1044
                +   V  +  P  P+  ++S   K    +     L       GS   + + ++  V 
Sbjct: 10992 SKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPL----DDGGSVITNYVVERRDVA 11047

Query: 1045  TKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARY---DIHVRVADF---PRP 1098
             +     ++ +              +  ++R+  +N++G   +      ++  D    P P
Sbjct: 11048 SAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGP 11107

Query: 1099  PTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH---YIIMKRDASTATWYTAAERVFSNKYT 1155
             P +L   +     V+L WN  PD   DG +    Y++  ++  T  W    + V + +  
Sbjct: 11108 PKDLHHVDVDKTEVSLVWN-KPD--RDGGSPITGYLVEYQEEGTQDWIKF-KTVTNLECV 11163

Query: 1156  VTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRF 1215
             VTGL  G+ Y FRV A N +G   P               D +  ++  EK         
Sbjct: 11164 VTGLQQGKTYRFRVKAENIVGLGLP---------------DTTIPIECQEKLVPPSVELD 11208

Query: 1216  VTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTC 1275
             V  ++   V  G          G P PT         I  +  +   + +    L I  C
Sbjct: 11209 VKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNC 11268

Query: 1276  TLKDSGDYSVLVENELGKDRSSCTLTVYD 1304
               +D+G+Y + V N  G    +  LTV D
Sbjct: 11269 LRRDTGEYQITVSNAAGSKTVAVHLTVLD 11297



 Score =  163 bits (412), Expect = 1e-39
 Identities = 149/604 (24%), Positives = 259/604 (42%), Gaps = 43/604 (7%)

Query: 598   IADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSME 657
             I + P ID   L+     ++  K G    + +PF+G+P P VTW KD   +  + R S+E
Sbjct: 20960 ILEAPEID---LDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIE 21016

Query: 658   RGEDQALLTISNCVREDSGLILLKLKNDHGS-ATATLHLSVLDRPKPPQGRVEFLELSGS 716
               +  +LLTI    R D+G  +L ++N  G   ++T+ + VLD P   Q +++   +S  
Sbjct: 21017 NTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQ-KLQVKHVSRG 21075

Query: 717   CVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRI 776
              V + W  P  +GG P+  +++E+R   K++W  +       T+F    + E   + FR+
Sbjct: 21076 TVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSS-TSFKLIDLSEKTPFFFRV 21134

Query: 777   LAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGY 836
             LA N  G+ +P ET E       E P       + D TK +V ++W  P  DGG+ +  Y
Sbjct: 21135 LAENEIGIGEPCETTEPV--KAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEY 21192

Query: 837   IVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVA 896
             +VER+ KG   W        +  +  V  L E +  EFRV A N+ G   P V    +  
Sbjct: 21193 VVERKGKGEQTWSHAGIS--KTCEIEVSQLKEQSVLEFRVFAKNEKGLSDP-VTIGPITV 21249

Query: 897   KDPVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPIS 956
             K+ +  P    ++ +SD   + +++        + P     + + + +  W K   +P+ 
Sbjct: 21250 KELIITP----EVDLSDIPGAQVTVRIGHNVHLELP----YKGKPKPSISWLK-DGLPLK 21300

Query: 957   GTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGV--RAMP-------PPAAPKFDLS 1007
              + +      E +       A  E G    V LD  V   A+P       PP+ PK  + 
Sbjct: 21301 ESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKGPIR 21360

Query: 1008  -ARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTK 1066
                +K+  V+ +     +     G        +K        + +  S   + F + +  
Sbjct: 21361 FDEIKADSVILSWD---VPEDNGGGEITCYSIEKRETSQTNWKMVCSSVARTTFKVPNLV 21417

Query: 1067  RSDSGVYRILLQNEFGEAR---YDIHVRVADF--PRPPTNLRLFEEVPNTVTLTWNHSPD 1121
             +     +R+  +N +G ++     I V    F  P PP    ++    + ++LTW+    
Sbjct: 21418 KDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWD--AP 21475

Query: 1122  VQEDGE--AHYIIMKRDASTATWYTA-AERVFSNKYTVTGLLPGRKYYFRVVARNEIGDS 1178
             V + G     + + K++ ++  W       +   +Y  TGL+ G  Y FRV A N  G S
Sbjct: 21476 VYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGLS 21535

Query: 1179  EPLD 1182
              P D
Sbjct: 21536 SPSD 21539



 Score =  162 bits (409), Expect = 3e-39
 Identities = 153/668 (22%), Positives = 271/668 (40%), Gaps = 55/668 (8%)

Query: 68   EFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKL 127
            +F+   + VTA E + AVF   +  +    + W +     +  +  +      K H +  
Sbjct: 5625 KFLTPLKDVTAKEKESAVFTVELSHD-NIRVKWFKNDQ-RLHTTRSVSMQDEGKTHSITF 5682

Query: 128  EPLTSDDSDNYKCIASNDHADAIYTV---------SLLVTEGQEKMDF------------ 166
            + L+ DD+   +  A    ++A  TV          L    G EK +             
Sbjct: 5683 KDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAP 5742

Query: 167  KKMLKKRAPPAPKKKQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMK 226
             K  K      P K     A+ K+ + IL K  K D  +   + G     G        K
Sbjct: 5743 VKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSG--------K 5794

Query: 227  KKVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIW-IKGTEPLRIQYSLGKYD 285
              +E   I++++PL   E     T  F+   E+ + ++   W +KG   L+        +
Sbjct: 5795 LDIEDREIKLVRPLHSVEVMETETARFET--EISEDDIHANWKLKGEALLQTP----DCE 5848

Query: 286  VKQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTA 345
            +K+ G  + LV+ N  ++  G       + + SA L V    +  L  +K V VT  +TA
Sbjct: 5849 IKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETA 5908

Query: 346  VFEIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGN 405
             F+  LS ++    W   GK+L+  DK  +    +G  HTL ++D +L D+GE    A +
Sbjct: 5909 TFDCELSYEDIPVEWYLKGKKLEPSDK--VVPRSEGKVHTLTLRDVKLEDAGEVQLTAKD 5966

Query: 406  LVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYS 465
                A L +   P++F   L++  V+E + A LECE++ ++  ++W K+G  ++   KY 
Sbjct: 5967 FKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYE 6026

Query: 466  MNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHA 525
            +  +G+  +L+I D    D   YT       D  ++ ++  + V          ++D+  
Sbjct: 6027 IVADGRVRKLVIHDCTPEDIKTYTC------DAKDFKTSCNLNVVPPHVEFLRPLTDLQV 6080

Query: 526  ATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTF 585
                 A     L+ E  +  W KDG EI       I+ +GAV  L+      + E +Y+ 
Sbjct: 6081 REKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSC 6140

Query: 586  RAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFR-GKPLPKVTWYKD 644
              +   +   + + +   +          +   ++V  T  IK+     KP  +V WYK 
Sbjct: 6141 EVRTARTSGMLTVLEEEAV-------FTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKG 6193

Query: 645  GMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPP 704
              E+ E  R  +     + +L I N   ED+G    +L +        +H    +    P
Sbjct: 6194 DEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKP 6253

Query: 705  QGRVEFLE 712
            Q  +E LE
Sbjct: 6254 Q-NLEILE 6260



 Score =  160 bits (406), Expect = 6e-39
 Identities = 256/1157 (22%), Positives = 432/1157 (37%), Gaps = 180/1157 (15%)

Query: 242   DKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVN 301
             ++  KV  T+    I++   P  K+ W K     R   +  + DV  +G+K  L I N  
Sbjct: 10922 EQHIKVGDTLRLSAIIK-GVPFPKVTWKKED---RDAPTKARIDVTPVGSK--LEIRNAA 10975

Query: 302   MNDAGIYSLSV----GDKRMSAELTVLDEPLKFLGEMKPVKVTE-RQTAVFEIRLSKKEP 356
               D GIYSL+V    G K +S ++ VLD+P    G  + ++V+E R+ + +   L+ KEP
Sbjct: 10976 HEDGGIYSLTVENPAGSKTVSVKVLVLDKP----GPPRDLEVSEIRKDSCY---LTWKEP 11028

Query: 357   ---------NFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGE---FSAEAG 404
                      N+V       ++R D      S    T   K   A+  + G    F   A 
Sbjct: 11029 LDDGGSVITNYV-------VERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAE 11081

Query: 405   NLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKK---DGQLLMHG 461
             N   +        PIK +  L         +     ++   +V+L W K   DG   + G
Sbjct: 11082 NQYGRGPFVETPKPIKALDPL---HPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITG 11138

Query: 462   TKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYY-------------STAIVT 508
                    EG +  +  +        E  V  +Q G    +              +T  + 
Sbjct: 11139 YLVEYQEEGTQDWIKFKTV---TNLECVVTGLQQGKTYRFRVKAENIVGLGLPDTTIPIE 11195

Query: 509   VEERLATVKSGM-----SDVHAATGSPAELCVVLNDEKV-EGVWLKDGKEITDLPGMQIV 562
              +E+L      +       +    G+      ++    V    W  DG EI       + 
Sbjct: 11196 CQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVE 11255

Query: 563   KQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVF-------IADPPTIDPSVLEALAAH 615
                    L   +      G+Y           +V        +  PPT   ++L+    H
Sbjct: 11256 TDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEH 11315

Query: 616   AITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDS 675
                     T   + P      P + +  +  +  ++    +  G  +  L I +  +   
Sbjct: 11316 M-------TISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCE 11368

Query: 676   GLILLKLKNDHG-----SATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGG 730
              +  ++ +N  G      +T T+       P PP G+    +++ +   + W  PK +GG
Sbjct: 11369 YVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPP-GKPVVTDITENAATVSWTLPKSDGG 11427

Query: 731   RPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPL-E 789
              P+T + +ERR V  K W+++ +       F    + EG  Y+FR+ A N  G+S P   
Sbjct: 11428 SPITGYYMERREVTGK-WVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPS 11486

Query: 790   TEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWV 849
             ++ + A  PI+PPG    P++ D ++E   + W  P  DGG+P+LGY+VE +K G+  W 
Sbjct: 11487 SDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWN 11546

Query: 850   PVNKDP-IQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQD 908
              +NKD  I+     V GL+E  EY FR+ A N  G G+P   + SV+AKD + PP +  D
Sbjct: 11547 RINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELD 11606

Query: 909   LHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIER 968
             +   D     +    R  A         ++ R E    W+K             G ++ R
Sbjct: 11607 VTCRDVITVRVGQTIRILAR--------VKGRPEPDITWTK------------EGKVLVR 11646

Query: 969   QKYFFRIRAVN--EAGVGEPVELDKGVRAMPPPAAPKFDLSARLKS---------HMVVR 1017
             +K    I+ +   E  + E V  D G          K+ +SA+  S         +++ R
Sbjct: 11647 EKRVDLIQDLPRVELQIKEAVRADHG----------KYIISAKNSSGHAQGSAIVNVLDR 11696

Query: 1018  AGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETIT---------KSKNHSQFLINSTKR- 1067
              G    +           + W+       G   IT           K  S    + TKR 
Sbjct: 11697 PGPCQNLKVTNVTKENCTISWENP--LDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRL 11754

Query: 1068  -------SDSGVYRILLQNEFG-----EARYDI-HVRVADFPRPPTNLRLFEEVPNTVTL 1114
                    ++   +R+  +N+ G     E +  I  +   D P  P NL + ++    V L
Sbjct: 11755 IKANLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYL 11814

Query: 1115  TWNHSPDVQEDGEAHYIIMKRDASTATWYTAAE-RVFSNKYTVTGLLPGRKYYFRVVARN 1173
              W             Y + +R   +  W    +  +    Y V   +  + Y FRV  +N
Sbjct: 11815 KWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKN 11874

Query: 1174  EIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPH---TVLRGQDC 1230
             E G+S+ + + +  ++ K+ +Q      KP            V  LK     TV  G   
Sbjct: 11875 EGGESDWVKTEE--VVVKEDLQ------KP------------VLDLKLSGVLTVKAGDTI 11914

Query: 1231  TMTCAFLGNPRPTV--TLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVE 1288
              +     G P P V  T  K   ++T + +   ++ +      +      D G Y V   
Sbjct: 11915 RLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTAT 11974

Query: 1289  NELGKDRSSCTLTVYDK 1305
             N  G   +  T+ V DK
Sbjct: 11975 NTAGSFVAYATVNVLDK 11991



 Score =  160 bits (406), Expect = 6e-39
 Identities = 157/655 (23%), Positives = 275/655 (41%), Gaps = 61/655 (9%)

Query: 661   DQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDR-----PKPPQGRVEFLELSG 715
             ++ ++T +  ++ +  +  ++  N +G        SV+ +     P PP G  E  +++ 
Sbjct: 20716 EECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPP-GIPEVTKITK 20774

Query: 716   SCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFR 775
             + + + W  P  +GG  ++ + +E+R      W K+ +   + T      + E   YQ+R
Sbjct: 20775 NSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYR 20834

Query: 776   ILAVNSEGVSDPLETEEVF-AGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVL 834
             + AVN+ G     E  E + A +PI+PPG  ++ ++ D TK ++T+ W+ P  DGG+ V 
Sbjct: 20835 VCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVT 20894

Query: 835   GYIVERRKKGSNLWVPVN-KDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSS 893
             GY+VE R+     W  V+ K  ++ T+  V  L     Y FRV AVN AG G+P   +  
Sbjct: 20895 GYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEP 20954

Query: 894   VVAKDPVKPPGLVQD--LHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCT 951
             V AKD ++ P +  D  L  S  + +   +    P +G PP         +D K      
Sbjct: 20955 VQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWR---KDEKNLGSDA 21011

Query: 952   KIPISGT----CYTVGGLIERQ--KYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFD 1005
             +  I  T      T+  +      KY   I    E GVGEP      V+ +  PAA +  
Sbjct: 21012 RYSIENTDSSSLLTIPQVTRNDTGKYILTI----ENGVGEPKSSTVSVKVLDTPAACQ-- 21065

Query: 1006  LSARLKSHMVVRAGTALCIHAAF--SGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLIN 1063
                +L+   V R    L         GSP  + + +K     +    ++   + + F + 
Sbjct: 21066 ---KLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSSTSFKLI 21122

Query: 1064  STKRSDSGVYRILLQNEFG---EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSP 1120
                      +R+L +NE G          V+ A+ P P  +L + +    +V L+W   P
Sbjct: 21123 DLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWT-KP 21181

Query: 1121  DVQEDGEA---HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGD 1177
             D   DG +    Y++ ++     TW  A     + +  V+ L       FRV A+NE G 
Sbjct: 21182 DF--DGGSVITEYVVERKGKGEQTWSHAGISK-TCEIEVSQLKEQSVLEFRVFAKNEKGL 21238

Query: 1178  SEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVT---PLKPHTVLRGQDCTMTC 1234
             S+P+                   + P   K+    P       P    TV  G +  +  
Sbjct: 21239 SDPVT------------------IGPITVKELIITPEVDLSDIPGAQVTVRIGHNVHLEL 21280

Query: 1235  AFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVEN 1289
              + G P+P+++  K  + +  +    ++ T    TL I     +  G Y+V+++N
Sbjct: 21281 PYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDN 21335



 Score =  154 bits (389), Expect = 5e-37
 Identities = 157/664 (23%), Positives = 267/664 (40%), Gaps = 60/664 (9%)

Query: 68   EFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKL 127
            + ++KP+ VTA E     F   V  +  P + W  +S + IK S K    S  K H L L
Sbjct: 2750 KIIKKPKDVTALENATVAFEVSVSHDTVP-VKWFHKS-VEIKPSDKHRLVSERKVHKLML 2807

Query: 128  EPLTSDDSDNYKCIASNDHADA-IYTVSLLVTEGQEKMDFKKMLKKRAPPAPKKKQKKVA 186
            + ++  D+  Y  +       A ++  +L +T+  + ++            P+ K     
Sbjct: 2808 QNISPSDAGEYTAVVGQLECKAKLFVETLHITKTMKNIE-----------VPETKTASFE 2856

Query: 187  NEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVE---------------- 230
             E     + S   K   E    E      +G L +L  M    E                
Sbjct: 2857 CEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSA 2916

Query: 231  ---VEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVK 287
               V  I I   L+D   +   T+ F+  +  +  + K  W+K    ++   S  K  ++
Sbjct: 2917 TLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYK--WLKNGVEIK---STDKCQMR 2971

Query: 288  QMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVF 347
                 + L I NV+  DA  Y+   G    +A L V    ++F   +K +KV E++ A+F
Sbjct: 2972 TKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMF 3031

Query: 348  EIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLV 407
            E  +S+ +    W  + +EL+  D+  I + ++   H L I   R+SD+G+++  AG  V
Sbjct: 3032 ECEVSEPDITVQWMKDDQELQITDR--IKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNV 3089

Query: 408  QKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMN 467
              A+L ++   ++  S  K V+V E+ RA +E E+   DV   W KDG  +    +    
Sbjct: 3090 STAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHK 3149

Query: 468  H--EGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHA 525
            +  E +   + I + + SD GEYT VA ++      Y  A          V   +  V  
Sbjct: 3150 YVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNA-----PEPPQVLQELQPVTV 3204

Query: 526  ATGSPAELCVVLNDEKVEGV-WLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYT 584
             +G PA  C V++      + W K+ + ++     + +  G  + L+     PE    YT
Sbjct: 3205 QSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYT 3264

Query: 585  FRAKG----TESEASVFIADPPTIDPSVLEALAAHAITVKV-------GHTAHIKVPFRG 633
              AK       + AS+ +  P  + P     +   AI   +       G  A  +    G
Sbjct: 3265 CEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSG 3324

Query: 634  KPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATL 693
              L KV+WY    ++       M + ED   L I+    ED G       N  G  ++T 
Sbjct: 3325 TDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTA 3383

Query: 694  HLSV 697
            +LS+
Sbjct: 3384 NLSL 3387



 Score =  152 bits (385), Expect = 2e-36
 Identities = 151/601 (25%), Positives = 256/601 (42%), Gaps = 58/601 (9%)

Query: 600   DPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERG 659
             + P ID   L+      I ++ G +  + VP +G+P P+V W K   E+ +   + +   
Sbjct: 16633 EAPDID---LDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSS 16689

Query: 660   EDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVH 719
                  L + N  R DSG   L L+N  G+ +A + + VLD P PP   ++  E++   V 
Sbjct: 16690 FTS--LVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVN-LKVTEITKDSVS 16746

Query: 720   MKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTN-----KVEEGKAYQF 774
             + W+ P  +GG  +  +IVE+R   +KS+  +      VTN   N     +++EG +Y F
Sbjct: 16747 ITWEPPLLDGGSKIKNYIVEKREATRKSYAAV------VTNCHKNSWKIDQLQEGCSYYF 16800

Query: 775   RILAVNSEGVSDPLETEE-VFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPV 833
             R+ A N  G+  P +T + +      +PPG  +   V DVT+ +V+++W  P  DGG+ +
Sbjct: 16801 RVTAENEYGIGLPAQTADPIKVAEVPQPPGKIT---VDDVTRNSVSLSWTKPEHDGGSKI 16857

Query: 834   LGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSS 893
             + YIVE + K S  W    +  ++  +  +  L +  EY FRV+AVN+ G   P   +  
Sbjct: 16858 IQYIVEMQAKHSEKWSECAR--VKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVP 16915

Query: 894   VVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKI 953
             +VAKD V  P  V+    S S      L    P  G P          +D     + T+I
Sbjct: 16916 IVAKDLVIEPD-VKPAFSSYSVQVGQDLKIEVPISGRPKPTITW---TKDGLPLKQTTRI 16971

Query: 954   PISGTC-YTVGGLIERQK---YFFRIRAVNEAGVG----EPVELDKGVRAMPPPAAPKFD 1005
              ++ +   T   + E  K     + I   N  G      E V LDK     PP    KFD
Sbjct: 16972 NVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDK---PDPPKGPVKFD 17028

Query: 1006  ----LSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFL 1061
                  S  L  +  +  G          G    + I QK    T   + ++ +   +   
Sbjct: 17029 DVSAESITLSWNPPLYTG----------GCQITNYIVQKRDTTTTVWDVVSATVARTTLK 17078

Query: 1062  INSTKRSDSGVYRILLQNEFGEA-RYDIHVRVADF----PRPPTNLRLFEEVPNTVTLTW 1116
             +   K      +RI  +N +G++   +    VA +    P PP          +++ + W
Sbjct: 17079 VTKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQW 17138

Query: 1117  NHSPDVQEDGEAHYIIMKRDASTATWYTAAERVF-SNKYTVTGLLPGRKYYFRVVARNEI 1175
             +   +        Y + +++ ++  W    + +    ++    L  G +Y FRV A N +
Sbjct: 17139 HEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIV 17198

Query: 1176  G 1176
             G
Sbjct: 17199 G 17199



 Score =  151 bits (381), Expect = 5e-36
 Identities = 228/1018 (22%), Positives = 388/1018 (38%), Gaps = 103/1018 (10%)

Query: 224   EMKKKVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQY---- 279
             EM + V+ + I     LE  E  +D  +    I +  +    +I  KG  P  + +    
Sbjct: 20950 EMNEPVQAKDI-----LEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDE 21004

Query: 280   ----SLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSVGD-----KRMSAELTVLDEPLKF 330
                 S  +Y ++   +  +L I  V  ND G Y L++ +     K  +  + VLD P   
Sbjct: 21005 KNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAAC 21064

Query: 331   LGEMKPVKVTERQTAVFE-----IRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHT 385
               +   VK   R T         I       N+V       +++ D  + T S   ++H 
Sbjct: 21065 --QKLQVKHVSRGTVTLLWDPPLIDGGSPIINYV-------IEKRDATKRTWSV--VSHK 21113

Query: 386   LKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSK 445
                   +L D  E +     ++ + ++ I   P +    +K   V    R     + T  
Sbjct: 21114 CSSTSFKLIDLSEKTPFFFRVLAENEIGIGE-PCETTEPVKAAEVPAPIRDLSMKDSTKT 21172

Query: 446   DVTLRWKK---DGQLLMHGTKYSMNHEGKRAELI----------IEDAQLSDGG--EYTV 490
              V L W K   DG  ++  T+Y +  +GK  +            IE +QL +    E+ V
Sbjct: 21173 SVILSWTKPDFDGGSVI--TEYVVERKGKGEQTWSHAGISKTCEIEVSQLKEQSVLEFRV 21230

Query: 491   VAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAAT-----GSPAELCVVLNDEKVEGV 545
              A  +   ++  +   +TV+E + T +  +SD+  A      G    L +    +    +
Sbjct: 21231 FAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSI 21290

Query: 546   -WLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIA----D 600
              WLKDG  + +   ++  K      L   +   EH GKYT          +V I      
Sbjct: 21291 SWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLG 21350

Query: 601   PPT--IDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSME- 657
             PP+    P   + + A ++ +         VP       ++T Y      T +    M  
Sbjct: 21351 PPSKPKGPIRFDEIKADSVILS------WDVP-EDNGGGEITCYSIEKRETSQTNWKMVC 21403

Query: 658   RGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDR-----PKPPQGRVEFLE 712
                 +    + N V++      ++ +N +G +   +   ++ +     P PP G+     
Sbjct: 21404 SSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPP-GKPVIYN 21462

Query: 713   LSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAY 772
             ++   + + W AP  +GG  VT F VE++      W K+         +    + EG  Y
Sbjct: 21463 VTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDY 21522

Query: 773   QFRILAVNSEGVSDPLETEE-VFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGA 831
             QFR+ A NS G+S P +  +   A +P++PPG    P   DVT+E +T+ WN P +DGG+
Sbjct: 21523 QFRVYAENSAGLSSPSDPSKFTLAVSPVDPPG---TPDYIDVTRETITLKWNPPLRDGGS 21579

Query: 832   PVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGP-GQPSVP 890
              ++GY +E+R +G+  WV  N   +   + TV GL     YEFR+IA N  G    PS  
Sbjct: 21580 KIVGYSIEKR-QGNERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQS 21638

Query: 891   SSSVVAKDPVKPPGLVQDLHVSDS--SNSSISLAWREPAEGDP-PSGYILEMRAEDTKEW 947
             S  ++ +D   PP +       D     S  SL  +   +G P P     +   E  K  
Sbjct: 21639 SGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRM 21698

Query: 948   SKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLS 1007
             +      +  T   V       +  + + A N +G  +  E+   V+  P         +
Sbjct: 21699 NMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAK-AEIKVKVQDTPGKVVGPIRFT 21757

Query: 1008  ARLKSHMV------VRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRE-TITKSKNHSQF 1060
                   M       +  G A   H          + W       + +  T  K  N +++
Sbjct: 21758 NITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIKLINGNEY 21817

Query: 1061  LINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSP 1120
                 +  +  GV R L   +       I   V D P  P    +     N++TLTW    
Sbjct: 21818 QFRVSAVNKFGVGRPL---DSDPVVAQIQYTVPDAPGIPEPSNI---TGNSITLTWARPE 21871

Query: 1121  DVQEDGEAHYIIMKRDASTATWYTAAER--VFSNKYTVTGLLPGRKYYFRVVARNEIG 1176
                      YI+ +R+  +  W     +  +   ++ VTGL  G +Y F V+A N  G
Sbjct: 21872 SDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAG 21929



 Score =  147 bits (371), Expect = 7e-35
 Identities = 156/631 (24%), Positives = 257/631 (40%), Gaps = 77/631 (12%)

Query: 702   KPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNF 761
             KP   RV   + + + V + W  P+D GG  VT +++E + V +  W K      K+  +
Sbjct: 23730 KPQNPRVT--DTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREY 23787

Query: 762   STNKVEEGKAYQFRILAVNSEGVSDPLETE-EVFAGNPIEPPGFASQPQVTD--VTKEAV 818
             +   + +G  Y+FR+LA N+ G  +P E    V     +E P +    +  +    ++  
Sbjct: 23788 TLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQGG 23847

Query: 819   TITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVN--------KDPIQGTKCTVDGLLEDT 870
              I    P +    P+  +  E +       +  +        K+  +G   T D +LE  
Sbjct: 23848 VIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTELVIKEADRGDSGTYDLVLE-- 23905

Query: 871   EYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE-- 928
                      NK G  + +V     V   P  P G    L   D    S+ ++WR PA+  
Sbjct: 23906 ---------NKCG--KKAVYIKVRVIGSPNSPEG---PLEYDDIQVRSVRVSWRPPADDG 23951

Query: 929   GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVE 988
             G    GYILE R      W       + GT   V GL E  +Y FR+ A N+ G+ +P++
Sbjct: 23952 GADILGYILERREVPKAAWYTIDS-RVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLK 24010

Query: 989   LDKGVRAMPP--PAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQK-DGVPT 1045
              ++ V    P  P  P  +    L    V ++  +L      S S P D    +  G   
Sbjct: 24011 SEEPVTPKTPLNPPEPPSNPPEVLD---VTKSSVSL------SWSRPKDDGGSRVTGYYI 24061

Query: 1046  KGRETIT-KSKNHSQFLINSTKRSDSGV-------YRILLQNEFGEARYD------IHVR 1091
             + +ET T K   H++  I +T  + +G+       +RI+ QN+ G +         +   
Sbjct: 24062 ERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKD 24121

Query: 1092  VADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA-HYIIMKRDASTATWYTA-AERV 1149
               D P  P  L +     ++VTL W   P+     E   Y +  R +  + W  +  ER+
Sbjct: 24122 PFDKPSQPGELEILSISKDSVTLQWE-KPECDGGKEILGYWVEYRQSGDSAWKKSNKERI 24180

Query: 1150  FSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDW 1209
                ++T+ GLL   +Y FRV A NE G S P          +     +  KL   E    
Sbjct: 24181 KDKQFTIGGLLEATEYEFRVFAENETGLSRP----------RRTAMSIKTKLTSGE---- 24226

Query: 1210  RHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCT 1269
               AP     +K  T   G+   ++C  +G P P +  Y+    +  + K+  +S     T
Sbjct: 24227 --APGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHT 24284

Query: 1270  LVIPTCTLKDSGDYSVLVENELGKDRSSCTL 1300
             L + T   +D G Y+ +  NE+G+  +S  L
Sbjct: 24285 LTVMTEEQEDEGVYTCIATNEVGEVETSSKL 24315



 Score =  146 bits (368), Expect = 1e-34
 Identities = 152/685 (22%), Positives = 274/685 (40%), Gaps = 60/685 (8%)

Query: 68   EFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKL 127
            +F    + VT PE  +A F   +   A  ++ W +   I IK S K    +  K+H+L +
Sbjct: 5182 DFAVPLKDVTVPERRQARFECVLTREA--NVIWSKGPDI-IKSSDKFDIIADGKKHILVI 5238

Query: 128  EPLTSDDSDNYKCIASNDHADAIYTVSLL------------VTEGQEKMDFKKMLKKRAP 175
                 DD   Y          A   V+ +            V EG+      ++  ++  
Sbjct: 5239 NDSQFDDEGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVKEGETATFVCELSHEKMH 5298

Query: 176  PAPKKKQKKVANEKEML-EILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVEVEAI 234
                K   K+   + +L     K  K + ++V ++    D   +  ++KE+    +++ +
Sbjct: 5299 VVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLD----DISQIKAQVKELSSTAQLKVL 5354

Query: 235  R----ILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMG 290
                     L DK       +   C +  KD  VK  W K  E +       KY +K  G
Sbjct: 5355 EADPYFTVKLHDKTAVEKDEITLKCEVS-KDVPVK--WFKDGEEI---VPSPKYSIKADG 5408

Query: 291  TKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIR 350
             + +L I   ++ D G Y    G  +  A +TV    +K    +  V+V   +TA FEI 
Sbjct: 5409 LRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIE 5468

Query: 351  LSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKA 410
            LS+ + +  WK  G+ L      EI   EDG  H L + + +L  +GE S +A N    A
Sbjct: 5469 LSEPDVHGQWKLKGQPLTASPDCEII--EDGKKHILILHNCQLGMTGEVSFQAANAKSAA 5526

Query: 411  QLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEG 470
             L +  +P+ F++ L +V+V E+  A  ECE++ +  T RW K  Q +    ++ +  +G
Sbjct: 5527 NLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDG 5586

Query: 471  KRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSP 530
             +  ++I+ A   D  +Y   A       + +++  + +E       + + DV A     
Sbjct: 5587 TKHSMVIKSAAFEDEAKYMFEA------EDKHTSGKLIIEGIRLKFLTPLKDVTAKEKES 5640

Query: 531  AELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGT 590
            A   V L+ + +   W K+ + +     + +  +G  H + F  +  +   +    A G 
Sbjct: 5641 AVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGM 5700

Query: 591  ESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTE 650
             SEA + + +    DP     L  +    K       ++     P   V W+KDG E+  
Sbjct: 5701 SSEAKLTVLEG---DPYFTGKLQDYTGVEKDEVILQCEISKADAP---VKWFKDGKEIKP 5754

Query: 651  EERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRP---KPPQGR 707
             +   ++    + +L +   ++ D G    +   D G+   +  L + DR      P   
Sbjct: 5755 SKNAVIKADGKKRMLILKKALKSDIG----QYTCDCGTDKTSGKLDIEDREIKLVRPLHS 5810

Query: 708  VEFL---------ELSGSCVHMKWK 723
            VE +         E+S   +H  WK
Sbjct: 5811 VEVMETETARFETEISEDDIHANWK 5835



 Score =  143 bits (361), Expect = 1e-33
 Identities = 192/826 (23%), Positives = 330/826 (39%), Gaps = 134/826 (16%)

Query: 67   PEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESA-KIFYDSINKEHVL 125
            P+ V  P+PV   EG+ A FR RV G  +P ++W     +  K    ++ YD I   H L
Sbjct: 1795 PDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGI---HYL 1851

Query: 126  KLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPK------ 179
             +    S D+   K  A N      + V L   E Q++ DF+ +L++   P P+      
Sbjct: 1852 DIVDCKSYDTGEVKVTAENPEGVIEHKVKL---EIQQREDFRSVLRRAPEPRPEFHVHEP 1908

Query: 180  -------------------------KKQKKVANEK---EMLEILSKVPKKDFEKVCMEYG 211
                                     K+ +++ +EK   E  E+ SK  ++  E       
Sbjct: 1909 GKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAIT 1968

Query: 212  FTDFRGLLR--KLKEMKKKVEVEAIRILKPLEDKETK----------------------- 246
              + +   +    +E+ +K + E +   K L ++E K                       
Sbjct: 1969 AVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPS 2028

Query: 247  VDTTVVFDCIME---------------LKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGT 291
            ++   +F+ I                 +  P+ +  W K    ++I+ S   Y       
Sbjct: 2029 MEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNG--VKIERSDRIYWYWPEDN 2086

Query: 292  KYMLVISNVNMNDAGIYSLSV----GDKRMSAELTVLDEPL-KFLGEMKPVKVTERQT-A 345
               LVI +V   D+    +      G+    A L V  + L  F  E++ V   E+ T A
Sbjct: 2087 VCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMA 2146

Query: 346  VFEIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSA---E 402
             FE   S+      W  +G E+   DKY +    D   H L I     SD+ ++S    E
Sbjct: 2147 TFECETSEPFVKVKWYKDGMEVHEGDKYRM--HSDRKVHFLSILTIDTSDAEDYSCVLVE 2204

Query: 403  AGNLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGT 462
              N+   A+L ++   ++FV  L+++ V E     LEC ++ +++  +W  +   L    
Sbjct: 2205 DENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNG 2264

Query: 463  KYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSD 522
            KY++     R  L ++D    D GEY+ V   DG  T    T  + ++ R   +  G+SD
Sbjct: 2265 KYTITSRRGRQNLTVKDVTKEDQGEYSFVI--DGKKT----TCKLKMKPRPIAILQGLSD 2318

Query: 523  VHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGK 582
                 G   +L V ++ E VEGVW+KDG+E+     + IV     H L+   M  E  G 
Sbjct: 2319 QKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGN 2378

Query: 583  YTFR----AKGTESEASVFIAD--PPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPL 636
            Y+F        T    SV+  D   P  D +V+E         K      + VP     +
Sbjct: 2379 YSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEG-------TKAVLECKVSVP----DV 2427

Query: 637  PKVTWYKDGMEVTEEERV-SMERGEDQALLTISNCVREDSG---LILLKLKNDHGSATAT 692
              V WY +  ++  ++RV ++ +G  Q L+ I+     D G   LI+ +++ +   +   
Sbjct: 2428 TSVKWYLNDEQIKPDDRVQAIVKGTKQRLV-INRTHASDEGPYKLIVGRVETNCNLSVEK 2486

Query: 693  LHL--SVLDRPKPPQGRVEF-LELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWI 749
            + +   + D        V F +ELS S + + W   KD   +P +++ +E      K  +
Sbjct: 2487 IKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNF-KDKEIKPSSKYKIEAHGKIYKLTV 2545

Query: 750  --KIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEV 793
               + + +GK T ++   +  GK      L V    +S PL  + V
Sbjct: 2546 LNMMKDDEGKYTFYAGENMTSGK------LTVAGGAISKPLTDQTV 2585



 Score =  143 bits (360), Expect = 1e-33
 Identities = 157/639 (24%), Positives = 271/639 (42%), Gaps = 54/639 (8%)

Query: 701   PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTN 760
             P  P GR E + ++ + V +KWK P  +GG  +T +IVE++ +    W+K    +   T 
Sbjct: 18297 PCDPPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETE 18356

Query: 761   FSTNKVEEGKAYQFRILAVNSEG-VSDPLETE-EVFAGNPIEPPGFASQPQVTDVTKEAV 818
             F+ + + E + Y+FR++A N+ G  S+P ++   + A + I+ P  +  P+  DV     
Sbjct: 18357 FTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHA 18416

Query: 819   TITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLED---TEYEFR 875
               T+       G P+   +    K G  L     +  I+ T      +++D   T+    
Sbjct: 18417 GETFVLEADIRGKPIPDVVWS--KDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQY 18474

Query: 876   VIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPS 933
             ++ ++  G G  S+P +  V   P  P G    L V+  +     LAW  P +  G   S
Sbjct: 18475 ILKLSNVG-GTKSIPITVKVLDRPGPPEG---PLKVTGVTAEKCYLAWNPPLQDGGANIS 18530

Query: 934   GYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGV 993
              YI+E R      W++ +   +    Y V  L+   +Y FR+ AVN+ G+GEP+E     
Sbjct: 18531 HYIIEKRETSRLSWTQVST-EVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESGPVT 18589

Query: 994   RAMP-----PPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQK-DGVPTKG 1047
                P     PP+ P  ++SA  K  MVV     +       G+     I +K D    + 
Sbjct: 18590 ACNPYKPPGPPSTP--EVSAITKDSMVVTWARPV----DDGGTEIEGYILEKRDKEGVRW 18643

Query: 1048  RETITKSKNHSQFLINSTKRSDSGVYRILLQNEFG---EARYDIHVRVADF---PRPPTN 1101
              +   K+    +  +       S  +R+  +N  G    +   +  R  D    P PP+N
Sbjct: 18644 TKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSN 18703

Query: 1102  LRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTAAER--VFSNKYTVT 1157
              ++ +   ++V+L W  S  + + G     Y++  ++A+   W T      +   ++TVT
Sbjct: 18704 PKVTDTSRSSVSLAW--SKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTVT 18761

Query: 1158  GLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVT 1217
              L    +Y FR+ A N  G  EP     + ++ +++I+    +L    +K        V 
Sbjct: 18762 KLKENTEYNFRICAINSEGVGEPATLPGS-VVAQERIEPPEIELDADLRK--------VV 18812

Query: 1218  PLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTL 1277
              L+    LR     +     G P P V   K +  +T  ++     TS    LVI   T 
Sbjct: 18813 VLRASATLR-----LFVTIKGRPEPEVKWEKAEGILTDRAQI--EVTSSFTMLVIDNVTR 18865

Query: 1278  KDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASITE 1316
              DSG Y++ +EN  G   +   + V D     V  +I E
Sbjct: 18866 FDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIRE 18904



 Score =  141 bits (356), Expect = 4e-33
 Identities = 163/756 (21%), Positives = 295/756 (39%), Gaps = 74/756 (9%)

Query: 581   GKYTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVT 640
             GKYT   +   S AS+ +       P     +    +T K        VP      P   
Sbjct: 19948 GKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVT-KESAVLSWDVPENDGGAPVKN 20006

Query: 641   WYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHG---SATATLHLSV 697
             ++ +  E +++  VS+    ++    ++N          +  +N+ G    A     + +
Sbjct: 20007 YHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVKI 20066

Query: 698   LDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGK 757
              ++P PP+ ++    +S   V + W  P+ +GG  +  ++VE    G+K+W+K      K
Sbjct: 20067 TEKPSPPE-KLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKCAVA--K 20123

Query: 758   VTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETE-EVFAGNPIEPPGFASQ--PQVTDVT 814
              T+   + + E   Y FR+ A N  G+SDP E    V     +EPP    +  P  T   
Sbjct: 20124 STHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYV 20183

Query: 815   KEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYE- 873
             +    +  + P    G P+    + R        VP+       T+ T + L  + +   
Sbjct: 20184 RAGSNLKVDIPIS--GKPLPKVTLSRDG------VPLKATMRFNTEITAENLTINLKESV 20235

Query: 874   ------FRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA 927
                   + + A N +G  +  +  + VV   P  P G V    +SD +  S++L W  P 
Sbjct: 20236 TADAGRYEITAANSSGTTKAFI--NIVVLDRPGPPTGPVV---ISDITEESVTLKWEPPK 20290

Query: 928   E--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGE 985
                G   + YIL  R   T  W++ +   ++ T   V  L   ++Y FRI+A N  G+ +
Sbjct: 20291 YDGGSQVTNYILLKRETSTAVWTEVSAT-VARTMMKVMKLTTGEEYQFRIKAENRFGISD 20349

Query: 986   PVELDKGVRAMP-----PPAAPKFDLSAR----LKSHMVVRAGTALCIHAAFSGSPPPDV 1036
              ++       +P     PP+ P      R    +  H  V  G +  +           +
Sbjct: 20350 HIDSACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSI 20409

Query: 1037  IWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIH---VRVA 1093
             +WQK        + + ++   + F + +        +R+  +N  G  +       V   
Sbjct: 20410 LWQK------ANKLVIRT---THFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAI 20460

Query: 1094  DFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAA-ERVFSN 1152
             D   PP N+R+ +   N+V+L+W             YI+ +RD     W  A+   V   
Sbjct: 20461 DACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTET 20520

Query: 1153  KYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHA 1212
             ++ ++GL    +Y FRV ARN +G                 I + S  + P    D    
Sbjct: 20521 QFIISGLTQNSQYEFRVFARNAVGS----------------ISNPSEVVGPITCIDSYGG 20564

Query: 1213  PRFVTPLKPHTVLR---GQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCT 1269
             P    PL+   V++   G    +     G P PT+  YK D  +  N+     +T+ + +
Sbjct: 20565 PVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLAS 20624

Query: 1270  LVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDK 1305
             ++I      +SG Y + + N +G   ++  + + DK
Sbjct: 20625 ILIKDADRLNSGCYELKLRNAMGSASATIRVQILDK 20660



 Score =  139 bits (349), Expect = 2e-32
 Identities = 190/815 (23%), Positives = 305/815 (37%), Gaps = 84/815 (10%)

Query: 528   GSPAELCVVLNDEKVEGV-WLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFR 586
             G P  L  ++       V W K G +     G Q+     +  L+ P+   +  GKY+  
Sbjct: 12316 GCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKG-QVDLVDTMAFLVIPNSTRDDSGKYSLT 12374

Query: 587   AKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGM 646
                   E +VF+       P  +  L    +T    H +    P       +VT Y   +
Sbjct: 12375 LVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSW--APPENDGGSQVTHYI--V 12430

Query: 647   EVTEEERVSMERGEDQALLT---ISNCVREDSGLILLKLKNDHGSATAT------LHLSV 697
             E  E +R +      +   T   ++N V  +     +   N++G    T      L    
Sbjct: 12431 EKREADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDP 12490

Query: 698   LDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKS--WIKIGEVD 755
             L  P PP+ ++E  E++ +   + W  P  +GG  +  +I   R   + +  W +   V 
Sbjct: 12491 LSEPDPPR-KLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYSVV- 12548

Query: 756   GKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVF-AGNPIEPPGFASQPQVTDVT 814
              K  +     ++EGK Y+FR+ A N+ GVS P E E V+ A   + PP      Q+T   
Sbjct: 12549 -KDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQIT--I 12605

Query: 815   KEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEF 874
             K    +   A       P   +     +  ++  + V+K          D   +D+ Y +
Sbjct: 12606 KAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGY-Y 12664

Query: 875   RVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPP 932
              + A N +G     +    + A  P +PP       +SD    + SL+W  P E  G   
Sbjct: 12665 SLTAENSSGTDTQKIKVVVMDAPGPPQPP-----FDISDIDADACSLSWHIPLEDGGSNI 12719

Query: 933   SGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKG 992
             + YI+E       +W          +C  VG LI  Q+Y FR+RA N  G+ EP+   K 
Sbjct: 12720 TNYIVEKCDVSRGDWVTALASVTKTSC-RVGKLIPGQEYIFRVRAENRFGISEPLTSPKM 12778

Query: 993   VRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETIT 1052
             V   P      F + +  K+  V +     CI  A+     PD      G P  G     
Sbjct: 12779 VAQFP------FGVPSEPKNARVTKVNKD-CIFVAWDR---PD---SDGGSPIIGYLIER 12825

Query: 1053  KSKNH------SQFLINSTKRSDSGV-------YRILLQNEFGEA---RYDIHVRVADFP 1096
             K +N       +  L+ ST+   +G+       +RI   N+ G +   +   +V      
Sbjct: 12826 KERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPV 12885

Query: 1097  RPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWY---TAAERVFSNK 1153
              PP    + +   +TV+L W             Y +         W    TA  ++   +
Sbjct: 12886 DPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEE 12945

Query: 1154  YTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQ---DLSAKLKPYEKKDWR 1210
             YT TGL    +Y FR +AR  +  S P +  D   I  + +    DLS  +K        
Sbjct: 12946 YTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLL----- 13000

Query: 1211  HAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTL 1270
                         TV  G +  +     G P PTV+  K    +             +CTL
Sbjct: 13001 ------------TVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTL 13048

Query: 1271  VIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDK 1305
              + +   KDSGDY++  EN  G   ++  L V DK
Sbjct: 13049 ELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDK 13083



 Score =  137 bits (346), Expect = 5e-32
 Identities = 219/998 (21%), Positives = 382/998 (38%), Gaps = 131/998 (13%)

Query: 262   PNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSV----GDKRM 317
             P  K+ W K    + I   + K  V  + T   LVI N   +D+G YSL++    G+K +
Sbjct: 12329 PAPKVTWRK----VGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAV 12384

Query: 318   SAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVWKFNGKELKRDDKYEITV 377
                + VLD P   + ++K   VT+    V          + V  +  ++ + D K   TV
Sbjct: 12385 FVNVRVLDTPGP-VSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTV 12443

Query: 378   SEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPIKFVSNLKNVRVKERSRAC 437
             + +    +  + +    +   F   A N       T    P+     L      +  R  
Sbjct: 12444 TPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPLSE---PDPPRKL 12500

Query: 438   LECELTSKDVTLRW---KKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQ 494
                E+T    TL W    +DG   + G   S   E + A+   E + + D     V  ++
Sbjct: 12501 EVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYSVVKD-LSLVVTGLK 12559

Query: 495   DGDPTEYYSTA--------------IVTVEERL----------ATVKSGMS---DVHAAT 527
             +G   ++   A              +   +E+L           T+K+G     + H   
Sbjct: 12560 EGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAH-VY 12618

Query: 528   GSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRA 587
             G P   C           W K   E+     + + K  +   LI   +  +  G Y+  A
Sbjct: 12619 GKPHPTC----------KWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTA 12668

Query: 588   K---GTESE---ASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTW 641
             +   GT+++     V  A  P   P  +  + A A ++    + HI +   G  +    +
Sbjct: 12669 ENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSL----SWHIPLEDGGSNI--TNY 12722

Query: 642   YKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHG-SATATLHLSVLDR 700
               +  +V+  + V+      +    +   +     +  ++ +N  G S   T    V   
Sbjct: 12723 IVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMVAQF 12782

Query: 701   P-----KPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVD 755
             P     +P   RV   +++  C+ + W  P  +GG P+  +++ER+      W+K  +  
Sbjct: 12783 PFGVPSEPKNARV--TKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVKANDTL 12840

Query: 756   GKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLE-TEEVFAGNPIEPPGFASQPQVTDVT 814
              + T +    + EG  Y FRI A+N  G S P + TE V A  P++PPG   +P+V DVT
Sbjct: 12841 VRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPG---KPEVIDVT 12897

Query: 815   KEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDP--IQGTKCTVDGLLEDTEY 872
             K  V++ W  P  DGG+ ++GY VE  K   + WV  N  P  I   + T  GL E  +Y
Sbjct: 12898 KSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQY 12957

Query: 873   EFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSI------------- 919
             +FR IA        PS PS  V       PP +  DL V+  S  ++             
Sbjct: 12958 QFRAIARTAVNISPPSEPSDPVTILAENVPPRI--DLSVAMKSLLTVKAGTNVCLDATVF 13015

Query: 920   -----SLAWR------EPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIER 968
                  +++W+      +PAEG      +   R   T E     +        T       
Sbjct: 13016 GKPMPTVSWKKDGTLLKPAEGIK----MAMQRNLCTLELFSVNRKDSGDYTITAENSSGS 13071

Query: 969   QKYFFRIRAVNEAGVGEPVELDK--GVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHA 1026
             +    +++ +++ G    V+++K    RAM     P  D  + + +++V +  T+    A
Sbjct: 13072 KSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWA 13131

Query: 1027  AFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARY 1086
               S + P         + +   E + +   + QF I +  +   G   +  +    +  Y
Sbjct: 13132 QVSATVP---------ITSCSVEKLIEGHEY-QFRICAENKYGVG-DPVFTEPAIAKNPY 13180

Query: 1087  DIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAA 1146
             D   R      PP    + ++    +T++W    D        Y++ KR+     W    
Sbjct: 13181 DPPGRC----DPPVISNITKD---HMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVN 13233

Query: 1147  ER-VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
              + +       TGL  G +Y FRV A N+ G  +P D+
Sbjct: 13234 RKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDA 13271



 Score =  137 bits (344), Expect = 9e-32
 Identities = 160/649 (24%), Positives = 257/649 (39%), Gaps = 75/649 (11%)

Query: 690   TATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWI 749
             T  L ++ +DRP  P+  +   +   + V++KW+ P  +GG P   + VERR  G   W 
Sbjct: 11785 TPILAINPIDRPGEPEN-LHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWE 11843

Query: 750   KIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQ 809
             ++ +   K T++  ++  E + Y+FR+   N  G SD ++TEEV     ++ P    +  
Sbjct: 11844 RVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLS 11903

Query: 810   VTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDP-IQGTKCTVDGLLE 868
                  K   TI   A  +    P + +  ++          V  D     +K ++     
Sbjct: 11904 GVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKR 11963

Query: 869   DTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE 928
                 ++ V A N AG     V  ++V   D    PG V++L + D S+   ++ W  P +
Sbjct: 11964 SDGGKYVVTATNTAGS---FVAYATVNVLDK---PGPVRNLKIVDVSSDRCTVCWDPPED 12017

Query: 929   --GDPPSGYILEMRAEDTKEWSKCTKIPIS-GTCYTVGGLIERQKYFFRIRAVNEAGVGE 985
               G     YILE        WS  +   ++ GT  TV  LIE  +Y FR+RA N+ G G 
Sbjct: 12018 DGGCEIQNYILEKCETKRMVWSTYSATVLTPGT--TVTRLIEGNEYIFRVRAENKIGTGP 12075

Query: 986   PVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPT 1045
             P E      + P  A  K+D   R     V +             +PP     + DG  +
Sbjct: 12076 PTE------SKPVIAKTKYDKPGRPDPPEVTKVSKE---EMTVVWNPP-----EYDGGKS 12121

Query: 1046  KGRETITKSKNHSQFLINSTKRS--------------DSGVYRILLQNEFGEARYDIHVR 1091
                  + K + HS   +   K +                  +R+  +NE G     +  R
Sbjct: 12122 ITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSR 12181

Query: 1092  VA------DFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH---YIIMKR----DAS 1138
                     + P PPTN R+ +   +++TL W        DG A    Y++  R    DAS
Sbjct: 12182 PVVAKDPIEPPGPPTNFRVVDTTKHSITLGWGKPV---YDGGAPIIGYVVEMRPKIADAS 12238

Query: 1139  TATWY---TAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQ 1195
                 +    AA ++   ++TVT L   ++Y FRV A+N++G   P               
Sbjct: 12239 PDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRP--------------A 12284

Query: 1196  DLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITA 1255
             +L   +KP E  +        +  K   V  G    +     G P P VT  K  ++   
Sbjct: 12285 ELKEAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVV 12344

Query: 1256  NSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYD 1304
               K   +    +  LVIP  T  DSG YS+ + N  G+      + V D
Sbjct: 12345 R-KGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLD 12392



 Score =  135 bits (341), Expect = 2e-31
 Identities = 152/639 (23%), Positives = 252/639 (39%), Gaps = 77/639 (12%)

Query: 712  ELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKA 771
            +++ + + +KW  PKDNG  P+  + +E+R V    W ++ +        + + + EG  
Sbjct: 8608 DVTSNSMLVKWNEPKDNGS-PILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLT 8666

Query: 772  YQFRILAVNSEG---VSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQD 828
            Y FR+ A N+ G    S P + +   A +PI PPG    P+VTD +   + + W  P  +
Sbjct: 8667 YVFRVCAENAAGPGKFSPPSDPKT--AHDPISPPG-PPIPRVTDTSSTTIELEWEPPAFN 8723

Query: 829  GGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPS 888
            GG  ++GY V+++  G+N W    +  I+  + TV  + E  +Y+ RV AVN AG G P 
Sbjct: 8724 GGGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPG 8783

Query: 889  VPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWS 948
                  VA +P +PP +  D+ V            R PA        ++  R   TK W+
Sbjct: 8784 ETQPVTVA-EPQEPPAVELDVSVKGGIQIMAGKTLRIPA--------VVTGRPVPTKVWT 8834

Query: 949  KCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPP-------AA 1001
            K             G L + +     +   +E  + + +  D G   +          AA
Sbjct: 8835 K-----------EEGELDKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAA 8883

Query: 1002 PK---FDLSARLKSHMVVRAGTALCIHAAFSGSPPPD---------VIWQKDGVPTKGRE 1049
             +   FD+   +     V     +C+    + S P D         +I +KD      R+
Sbjct: 8884 ARVEVFDVPGPVLDLKPVVTNRKMCL---LNWSDPEDDGGSEITGFIIERKDAKMHTWRQ 8940

Query: 1050 TITKSKNHSQFLINSTKRSDSGVYRILLQNEFG-----EARYDIHVRVADFPRPPTNLRL 1104
             I   ++     I          +R++ +N+FG     E    + V     P  P  L  
Sbjct: 8941 PIETERSKCD--ITGLLEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLTY 8998

Query: 1105 FEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVF-SNKYTVTGLLPGR 1163
             E   +T+TL W             YII KR      +    +R+  +  + V  L   +
Sbjct: 8999 TERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQ 9058

Query: 1164 KYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHT 1223
             Y FRV A NEIG+SEP  S    ++ +D     + KL+   + D               
Sbjct: 9059 MYEFRVKAVNEIGESEP--SLPLNVVIQDDEVPPTIKLRLSVRGD------------TIK 9104

Query: 1224 VLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANS------KFWYNSTSGVCTLVIPTCTL 1277
            V  G+   +     G P P +   K +  I   +      K   + +     L IP    
Sbjct: 9105 VKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVR 9164

Query: 1278 KDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASITE 1316
            +D G Y+V   N LG    +  + VYD+       ++T+
Sbjct: 9165 EDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTD 9203



 Score =  130 bits (328), Expect = 6e-30
 Identities = 143/631 (22%), Positives = 251/631 (39%), Gaps = 64/631 (10%)

Query: 701   PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTN 760
             P  P G  ++++++   + +KW  P  +GG  +  + +E+R  G + W++    D     
Sbjct: 21549 PVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVGYSIEKRQ-GNERWVRCNFTDVSECQ 21607

Query: 761   FSTNKVEEGKAYQFRILAVNSEGVSDPLETEE--VFAGNPIEPPGFASQPQVTD--VTKE 816
             ++   +  G  Y+FRI+A N+ G   P       +   +   PP     P+  D  + K 
Sbjct: 21608 YTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKS 21667

Query: 817   AVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRV 876
               ++   A  Q    P + +  +  +    + + +  D +  T   V     D    + V
Sbjct: 21668 GESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEIT-DVLGSTSLFVRDATRDHRGVYTV 21726

Query: 877   IAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAEGD--PPSG 934
              A N +G  +  +    V  +D   P  +V  +  ++ +   ++L W  P      P + 
Sbjct: 21727 EAKNASGSAKAEI---KVKVQDT--PGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITH 21781

Query: 935   YILEMRAEDTKEWS----KCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELD 990
             YI+E R      W+    KC         YT   LI   +Y FR+ AVN+ GVG P++ D
Sbjct: 21782 YIIEKRETSRLAWALIEDKC-----EAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSD 21836

Query: 991   KGVRAMP--PPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQK-DGVPTKG 1047
               V  +    P AP     + +  + +           +  GS     I ++ +   T+ 
Sbjct: 21837 PVVAQIQYTVPDAPGIPEPSNITGNSITLTWAR---PESDGGSEIQQYILERREKKSTRW 21893

Query: 1048  RETITKSK-NHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRV------ADFPRPPT 1100
              + I+K   + ++F +      +   + ++ +N  G        R+       + P PPT
Sbjct: 21894 VKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPT 21953

Query: 1101  NLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTA-AERVFSNKYTVT 1157
              +++ +    TV+L W  S  V + G     YII    A    W+   AE     +YTVT
Sbjct: 21954 VVKVTDTSKTTVSLEW--SKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVT 22011

Query: 1158  GLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQ----DLSAKLKPYEKKDWRHAP 1213
              L  G +Y FRV A N  G  +  +   T +   D++     D+ A  K           
Sbjct: 22012 DLQAGEEYKFRVSAINGAGKGDSCEVTGT-IKAVDRLTAPELDIDANFK----------- 22059

Query: 1214  RFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIP 1273
                   + H V  G    +  A+ G P PT    K D N++  +    ++T    TL + 
Sbjct: 22060 ------QTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADI--HTTDSFSTLTVE 22111

Query: 1274  TCTLKDSGDYSVLVENELGKDRSSCTLTVYD 1304
              C   D+G Y++ VEN  G    + T+ V D
Sbjct: 22112 NCNRNDAGKYTLTVENNSGSKSITFTVKVLD 22142



 Score =  130 bits (327), Expect = 8e-30
 Identities = 192/809 (23%), Positives = 309/809 (38%), Gaps = 115/809 (14%)

Query: 546   WLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTID 605
             W K   EI D   + +    +   L+  ++     GKYT   + +    S F+       
Sbjct: 16671 WGKVDGEIRDAAIIDVTS--SFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDT 16728

Query: 606   PSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTW----YKDGMEVTEEERVSMERGED 661
             PS    L    IT               K    +TW       G ++        E    
Sbjct: 16729 PSPPVNLKVTEIT---------------KDSVSITWEPPLLDGGSKIKNYIVEKREATRK 16773

Query: 662   QALLTISNCVRED----------SGLILLKLKNDHG---SATATLHLSVLDRPKPPQGRV 708
                  ++NC +            S    +  +N++G    A     + V + P+PP G++
Sbjct: 16774 SYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPP-GKI 16832

Query: 709   EFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEE 768
                +++ + V + W  P+ +GG  + Q+IVE +A   + W +   V  K        + +
Sbjct: 16833 TVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARV--KSLQAVITNLTQ 16890

Query: 769   GKAYQFRILAVNSEGVSDP--LETEEVFAGNPIEP---PGFASQP-QVTDVTKEAV---- 818
             G+ Y FR++AVN +G SDP  L    V     IEP   P F+S   QV    K  V    
Sbjct: 16891 GEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISG 16950

Query: 819   ----TITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEF 874
                 TITW   T+DG  P+        K+ + + V    D +  T  ++    +D   ++
Sbjct: 16951 RPKPTITW---TKDG-LPL--------KQTTRINVT---DSLDLTTLSIKETHKDDGGQY 16995

Query: 875   RVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREP--AEGDPP 932
              +   N  G    S+   ++   DP K P     +   D S  SI+L+W  P    G   
Sbjct: 16996 GITVANVVGQKTASIEIVTLDKPDPPKGP-----VKFDDVSAESITLSWNPPLYTGGCQI 17050

Query: 933   SGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKG 992
             + YI++ R   T  W       ++ T   V  L    +Y FRI A N  G    +E D  
Sbjct: 17051 TNYIVQKRDTTTTVWD-VVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPI 17109

Query: 993   VRAMP-----PPAAPKFDLSAR----LKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGV 1043
             V   P     PP  P     ++    ++ H  V  G +  I           ++W     
Sbjct: 17110 VAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILW----- 17164

Query: 1044  PTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQN--EFGEARYDIHVRVADFP-RPPT 1100
              TK  +TI    + +QF   + +      +R+  +N    G+A  +    VA  P  PP 
Sbjct: 17165 -TKVNKTII---HDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPG 17220

Query: 1101  NLRLFEEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTATWYTAA-ERVFSNKYTVT 1157
                      N +TL W  +  V + G     YI+ KRD     W  A+   V   ++TV+
Sbjct: 17221 TPEPIMVKRNEITLQW--TKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVS 17278

Query: 1158  GLLPGRKYYFRVVARNEIGD-SEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFV 1216
             GL   ++Y FRV+A+N  G  S+P DS    +  KD+++       P    D    P+F 
Sbjct: 17279 GLTEDQRYEFRVIAKNAAGAISKPSDSTGP-ITAKDEVE------LPRISMD----PKFR 17327

Query: 1217  TPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCT 1276
               +    V  G+   +     G P PT+   +GD  I  +++    +T     L++    
Sbjct: 17328 DTI---VVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAI 17384

Query: 1277  LKDSGDYSVLVENELGKDRSSCTLTVYDK 1305
               D G Y +   N  G       + V D+
Sbjct: 17385 RIDGGQYILRASNVAGSKSFPVNVKVLDR 17413



 Score =  130 bits (326), Expect = 1e-29
 Identities = 117/443 (26%), Positives = 200/443 (45%), Gaps = 28/443 (6%)

Query: 228  KVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVK 287
            K+ V    I KPL D+        VF+C  E+ +P+ K  W++  + L +  ++     +
Sbjct: 2568 KLTVAGGAISKPLTDQTVAESQEAVFEC--EVANPDSKGEWLRDGKHLPLTNNIRS---E 2622

Query: 288  QMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVF 347
              G K  L+I+   ++D G Y+  V   + SA+L V  E +K    +K + VTE Q AVF
Sbjct: 2623 SDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKV--EAVKIKKTLKNLTVTETQDAVF 2680

Query: 348  EIRLSKKEPNFV-WKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNL 406
             + L+      V W  NG  L+ ++KY I+V   G  ++L+IK+  + D   +    G L
Sbjct: 2681 TVELTHPNVKGVQWIKNGVVLESNEKYAISVK--GTIYSLRIKNCAIVDESVYGFRLGRL 2738

Query: 407  VQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSM 466
               A+L ++ +  K +   K+V   E +    E  ++   V ++W      +    K+ +
Sbjct: 2739 GASARLHVETV--KIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRL 2796

Query: 467  NHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAA 526
              E K  +L++++   SD GEYT V  Q     E  +   V   E L   K+ M ++   
Sbjct: 2797 VSERKVHKLMLQNISPSDAGEYTAVVGQ----LECKAKLFV---ETLHITKT-MKNIEVP 2848

Query: 527  TGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFR 586
                A     ++   V  +WLK+G EI      +IV QG +H+LI  +   E   +YTF 
Sbjct: 2849 ETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFV 2908

Query: 587  AKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGM 646
                +  A++ +   P +  S+L+ + A     K   T  + V + G       W K+G+
Sbjct: 2909 CGNDQVSATLTVT--PIMITSMLKDINAEE---KDTITFEVTVNYEG---ISYKWLKNGV 2960

Query: 647  EVTEEERVSMERGEDQALLTISN 669
            E+   ++  M   +    L I N
Sbjct: 2961 EIKSTDKCQMRTKKLTHSLNIRN 2983



 Score =  130 bits (326), Expect = 1e-29
 Identities = 162/646 (25%), Positives = 269/646 (41%), Gaps = 69/646 (10%)

Query: 701   PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTN 760
             P  P GR E + ++ + V ++WK P  +GG  +T +IVE++ + +  W+K    +   T+
Sbjct: 16133 PCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASFTNIIDTH 16192

Query: 761   FSTNKVEEGKAYQFRILAVNSEGV-SDPLE-TEEVFAGNPIEPPGFASQPQVTD--VTKE 816
             F    + E   Y+FR++A N+ GV S+P E T  + A + ++PP  +  P+  D  V   
Sbjct: 16193 FEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVVHA 16252

Query: 817   AVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRV 876
               +   +A       P + +I   ++  +   + +       +    D +  D+      
Sbjct: 16253 GESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSG---NY 16309

Query: 877   IAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSG 934
             I   K   G+ SV  +  V   P  P G V    +S  +    +LAW+ P +  G     
Sbjct: 16310 ILKAKNVAGERSVTVNVKVLDRPGPPEGPVV---ISGVTAEKCTLAWKPPLQDGGSDIIN 16366

Query: 935   YILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVR 994
             YI+E R      W+       + +C  V  L+E  +Y FRI AVN+ GVGEP+E +  V 
Sbjct: 16367 YIVERRETSRLVWTVVDANVQTLSC-KVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVA 16425

Query: 995   AMP--PPAAPKF-DLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETI 1051
               P   P APK  +++   K  M+V         A+  GS     + +K     + +E I
Sbjct: 16426 KNPFVVPDAPKAPEVTTVTKDSMIVVWERP----ASDGGSEILGYVLEK-----RDKEGI 16476

Query: 1052  TKSKNHSQFLINSTKRSDSGV-------YRILLQNEFG------EARYDIHVRVADFPRP 1098
               ++ H + LI   +   +G+       +R+  +N  G       + Y         P P
Sbjct: 16477 RWTRCHKR-LIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGP 16535

Query: 1099  PTNLRLFEEVPNTVTLTWNHSPDVQEDG--EAHYIIMKRDASTATWYTAAERVFSNKYT- 1155
             P N ++ +   ++V L+W  S  + + G     YI+ K D S   W         NK   
Sbjct: 16536 PNNPKVIDITRSSVFLSW--SKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNI 16593

Query: 1156  -VTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQ----DLSAKLKPYEKKDWR 1210
              V  LL   +Y FR+ A N+ G  E  D     +I +++++    DL  +L+        
Sbjct: 16594 EVEKLLEKHEYNFRICAINKAGVGEHADVPGP-IIVEEKLEAPDIDLDLELRKIINIRAG 16652

Query: 1211  HAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTL 1270
              + R   P+K                 G P P V   K D  I   +    + TS   +L
Sbjct: 16653 GSLRLFVPIK-----------------GRPTPEVKWGKVDGEIRDAAII--DVTSSFTSL 16693

Query: 1271  VIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASITE 1316
             V+      DSG Y++ +EN  G   +  T+ V D     V   +TE
Sbjct: 16694 VLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTE 16739



 Score =  129 bits (324), Expect = 2e-29
 Identities = 180/796 (22%), Positives = 290/796 (36%), Gaps = 82/796 (10%)

Query: 543   EGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPP 602
             E  W ++  E TD   +QI K     +L   +      GKY  + + +    S F+    
Sbjct: 17750 EITWSREEGEFTDK--VQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKV 17807

Query: 603   TIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQ 662
                P   + LA   +               G    K  +  D  E T +   ++     +
Sbjct: 17808 LDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVK-NYVIDKRESTRKAYANVSSKCSK 17866

Query: 663   ALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQ--GRVEFLELSGSCVHM 720
                 + N          +  +N+ G       +  +   +PP   G+V   ++S +   +
Sbjct: 17867 TSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASL 17926

Query: 721   KWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVN 780
              W+ P+ +GG  V  ++VE +  G + W  + E   KV N     +  G+ YQFR+ A N
Sbjct: 17927 MWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAE--SKVCNAVVTGLSSGQEYQFRVKAYN 17984

Query: 781   SEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGA------PVL 834
              +G SDP        G P+       QP        ++ + +N  +   G       PV+
Sbjct: 17985 EKGKSDPR-----VLGVPVIAKDLTIQP--------SLKLPFNTYSIQAGEDLKIEIPVI 18031

Query: 835   GYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEY-----------EFRVIAVNKAG 883
             G     R + +  WV   +   Q T+  V+     T             ++ V A N AG
Sbjct: 18032 G-----RPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAG 18086

Query: 884   PGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRA 941
                 ++  S +V + P  P G V+     + S   + ++W  PA   G   S YI+E R 
Sbjct: 18087 TATENL--SVIVLEKPGPPVGPVR---FDEVSADFVVISWEPPAYTGGCQISNYIVEKRD 18141

Query: 942   EDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMP---- 997
               T  W   +   ++ T   +  L    +Y FRI A N  G   P++    +   P    
Sbjct: 18142 TTTTTWHMVSAT-VARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEP 18200

Query: 998   -PPAAPKFDLSAR----LKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETIT 1052
              PP  P     ++    ++ H  V  G    I           ++W K    T  ++T  
Sbjct: 18201 GPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLN-KTPIQDTKF 18259

Query: 1053  KSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTV 1112
             K+    + L    K S   +  I   ++  E          D   PP          N V
Sbjct: 18260 KTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFV-----ARDPCDPPGRPEAIVITRNNV 18314

Query: 1113  TLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAA-ERVFSNKYTVTGLLPGRKYYFRVVA 1171
             TL W             YI+ K+D     W  A+   V   ++TV+GL+  ++Y FRV+A
Sbjct: 18315 TLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIA 18374

Query: 1172  RNEIGD-SEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDC 1230
             RN  G+ SEP DS    +  +D+I   +A L P  K                 V  G+  
Sbjct: 18375 RNAAGNFSEPSDSSGA-ITARDEIDAPNASLDPKYK-------------DVIVVHAGETF 18420

Query: 1231  TMTCAFLGNPRPTVTLYKGDVNITAN-SKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVEN 1289
              +     G P P V   K    +    ++    ST    TLV+  C   D G Y + + N
Sbjct: 18421 VLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSN 18480

Query: 1290  ELGKDRSSCTLTVYDK 1305
               G      T+ V D+
Sbjct: 18481 VGGTKSIPITVKVLDR 18496



 Score =  123 bits (309), Expect = 1e-27
 Identities = 159/650 (24%), Positives = 271/650 (41%), Gaps = 64/650 (9%)

Query: 693  LHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIG 752
            L +  L  P  P+ R+ + E + S + + WK P+ NGG P+  +I+E+R   K  + ++ 
Sbjct: 8982 LAVDPLGPPTSPE-RLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVN 9040

Query: 753  EVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVT- 811
            +     T+F    ++E + Y+FR+ AVN  G S+P     V   +   PP    +  V  
Sbjct: 9041 KRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRG 9100

Query: 812  DVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVP-----VNKDPIQG----TKCT 862
            D  K       + P    G P+    +E  K  + +  P     + K+ +      T+ +
Sbjct: 9101 DTIKVKAGEPVHIPADVTGLPMPK--IEWSKNETVIEKPTDALQITKEEVSRSEAKTELS 9158

Query: 863  VDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLA 922
            +   + + +  + V A N+ G    +V    V   D   PP   ++L V+D    S  L 
Sbjct: 9159 IPKAVREDKGTYTVTASNRLGSVFRNV---HVEVYDRPSPP---RNLAVTDIKAESCYLT 9212

Query: 923  WREPAE--GDPPSGYILEMRAEDTK--EWSKCTKIPISGTCYTVGGLIERQKYFFRIRAV 978
            W  P +  G   + Y+++ R    K  EW + T   +    Y +  LI   +Y FR+RAV
Sbjct: 9213 WDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKR-YGIWKLIPNGQYEFRVRAV 9271

Query: 979  NEAGVGEPVELDKGVRAMP-----PPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPP 1033
            N+ G+ +  + DK V   P     PP  PK  + AR K  M+V     L      +G  P
Sbjct: 9272 NKYGISDECKSDKVVIQDPYRLPGPPGKPK--VLARTKGSMLVSWTPPLD-----NGGSP 9324

Query: 1034 PDVIW---QKDGVP---TKGRETITK-SKNHSQFLINSTKRSDSGVYRILLQNEFG---- 1082
                W   +++G P      R  ITK      +F +          +R +  N  G    
Sbjct: 9325 ITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPP 9384

Query: 1083 EARYDIHVRVADF--PRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDAS 1138
                D  V       P PP+   + ++  ++++L W   P  ++ G     YI+  ++  
Sbjct: 9385 SEPSDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWK--PPAKDGGSPIKGYIVEMQEEG 9442

Query: 1139 TATWYTAAER---VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQ 1195
            T  W    E    + + +  V  L   RKY FRV A NE G+SEP D+  T  I    IQ
Sbjct: 9443 TTDWKRVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDT--TGEIPATDIQ 9500

Query: 1196 DLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTC-AFLGNPRPTVTLYKGDVNIT 1254
            +          +D     +  + ++   V++G+    +   F G  +  +     D+   
Sbjct: 9501 EEPEVFIDIGAQDCLVC-KAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPED 9559

Query: 1255 ANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYD 1304
            A  +   NS+     ++IP C    +G YS+  +N+ G+  ++C + V D
Sbjct: 9560 AQLETAENSS----VIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMD 9605



 Score =  122 bits (307), Expect = 2e-27
 Identities = 148/640 (23%), Positives = 248/640 (38%), Gaps = 83/640 (12%)

Query: 699   DRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKV 758
             +RP PP G++  ++++ + V + W+ P+ +GG  +  +IVE +  G   W     V  KV
Sbjct: 15742 ERPLPP-GKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATCATV--KV 15798

Query: 759   TNFSTNKVEEGKAYQFRILAVNSEGVSDPLETE-EVFAGNPIEPPGF----------ASQ 807
             T  +   + +G+ Y FR+ A N +G+SDP +    V A + + PP F          A +
Sbjct: 15799 TEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGE 15858

Query: 808   PQVTDVT---KEAVTITW---NAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKC 861
                 DV    +    +TW   N P +           E  +  S L +            
Sbjct: 15859 DLKVDVPFIGRPTPAVTWHKDNVPLKQ----TTRVNAESTENNSLLTIK----------- 15903

Query: 862   TVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISL 921
               D   ED  + + V   N AG    ++ + +V+  D   PP     + + + +  SI+L
Sbjct: 15904 --DACREDVGH-YVVKLTNSAGE---AIETLNVIVLDKPGPP--TGPVKMDEVTADSITL 15955

Query: 922   AWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVN 979
             +W  P    G   + YI+E R   T  W +     ++ T      L    +Y FRI A N
Sbjct: 15956 SWGPPKYDGGSSINNYIVEKRDTSTTTW-QIVSATVARTTIKACRLKTGCEYQFRIAAEN 16014

Query: 980   EAGVGEPVELDKGVRAMP-----PPAAPKFDLSAR----LKSHMVVRAGTALCIHAAFSG 1030
               G    +  +  V   P     PP  P   LS+R    ++ +  +  G +  I      
Sbjct: 16015 RYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLER 16074

Query: 1031  SPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYD--I 1088
                  ++W K       +  I ++K    F     +      +R+  +N  G  +     
Sbjct: 16075 KERNSILWVK-----LNKTPIPQTK----FKTTGLEEGVEYEFRVSAENIVGIGKPSKVS 16125

Query: 1089  HVRVADFP-RPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAA- 1146
                VA  P  PP          N+VTL W             YI+ K++     W  A+ 
Sbjct: 16126 ECYVARDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASF 16185

Query: 1147  ERVFSNKYTVTGLLPGRKYYFRVVARNEIGD-SEPLDSRDTWLINKDQIQDLSAKLKPYE 1205
               +    + VTGL+   +Y FRV+ARN  G  SEP +S    +  +D++      + P  
Sbjct: 16186 TNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGA-ITARDEVDPPRISMDPKY 16244

Query: 1206  KKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTS 1265
             K                 V  G+   +     G P PT+   KGD  ++  ++    ST 
Sbjct: 16245 KDTI-------------VVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTD 16291

Query: 1266  GVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDK 1305
                +L +      DSG+Y +  +N  G+   +  + V D+
Sbjct: 16292 FATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDR 16331



 Score =  122 bits (306), Expect = 2e-27
 Identities = 200/934 (21%), Positives = 332/934 (35%), Gaps = 131/934 (14%)

Query: 441   ELTSKDVTLRWKK---DGQLLMHGTKYSMNHEGKRA-------------ELIIEDAQLSD 484
             + T K  +L W K   DG L + G        G  A             + ++ D Q  +
Sbjct: 14378 DTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQFVVPDLQTKE 14437

Query: 485   GGEYTVVAMQD---GDPTEYYSTAIVTVE-----------ERLATVKSGMSD--VHAATG 528
                + + A+ D   G+P       IV  E            R   V++G+S        G
Sbjct: 14438 KYNFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKG 14497

Query: 529   SPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAK 588
              PA           E  W KD   + +   ++  +   +  LI P       GK+    +
Sbjct: 14498 RPAP----------EVTWTKDNINLKNRANIENTESFTL--LIIPECNRYDTGKFVMTIE 14545

Query: 589   GTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEV 648
                 + S F+       P  +  L    IT K   T H  +P              G  +
Sbjct: 14546 NPAGKKSGFVNVRVLDTPGPVLNLRPTDIT-KDSVTLHWDLPL----------IDGGSRI 14594

Query: 649   TE---EERVSMERGEDQALLTISNCVREDSGL-------ILLKLKNDHG---SATATLHL 695
             T    E+R +  +    A      C  + +GL         +  +N++G       T  +
Sbjct: 14595 TNYIVEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPV 14654

Query: 696   SVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVD 755
                + P PP   +  ++++ S V + W  PK +GG  +T +++E +  G   W  I  V 
Sbjct: 14655 KASEAPSPPDS-LNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITTVK 14713

Query: 756   GKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQP--QVTDV 813
             G         + EG+ Y F+++AVNS G S P E+  V        P    +   Q   +
Sbjct: 14714 G--LECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVI 14771

Query: 814   TKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCT----VDGLLED 869
              K    I    P      P + +     KKG  +     +   + T  +    ++  +  
Sbjct: 14772 AKAGDNIKVEIPVLGRPKPTVTW-----KKGDQILKQTQRVNFETTATSTILNINECVRS 14826

Query: 870   TEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE- 928
                 + + A N  G     +   ++   D   PP     +   + S+  ++ +W  P   
Sbjct: 14827 DSGPYPLTARNIVGEVGDVI---TIQVHDIPGPP--TGPIKFDEVSSDFVTFSWDPPEND 14881

Query: 929   -GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPV 987
              G P S Y++EMR  D+  W +     I  T Y    L    +Y FR++A N  GVG  +
Sbjct: 14882 GGVPISNYVVEMRQTDSTTWVELATTVIR-TTYKATRLTTGLEYQFRVKAQNRYGVGPGI 14940

Query: 988   ELDKGVRAMP-----PPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDG 1042
                  V   P     PP  P+  ++A  K  M +        H   S    P + +  + 
Sbjct: 14941 TSACIVANYPFKVPGPPGTPQ--VTAVTKDSMTISW------HEPLSDGGSPILGYHVER 14992

Query: 1043  VPTKGRETITKSKNHSQFLINSTKRSDSGV---YRILLQNEFGEARYD------IHVRVA 1093
                 G    T SK      I  +     G+   +R++ +N  G+++        + +   
Sbjct: 14993 KERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPI 15052

Query: 1094  DFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAA-ERVFSN 1152
             D P  P  L +     +TVTL W             YI+ KRD     W  A    +  N
Sbjct: 15053 DPPGKPVPLNITR---HTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILEN 15109

Query: 1153  KYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHA 1212
             ++TV+GL     Y FRV+A+N  G   P       +  +D ++  + K+K   K      
Sbjct: 15110 EFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVE--APKIKVDVK------ 15161

Query: 1213  PRFVTPLKPHTVLR-GQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLV 1271
                    K   +L+ G+   +     G P PT+   K    +   +K           LV
Sbjct: 15162 ------FKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLV 15215

Query: 1272  IPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDK 1305
                 T +DSG Y++   N  G  +    + V D+
Sbjct: 15216 NKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDR 15249



 Score =  121 bits (303), Expect = 5e-27
 Identities = 146/660 (22%), Positives = 265/660 (40%), Gaps = 56/660 (8%)

Query: 69   FVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKLE 128
            F ++ Q V A E D               + W ++ G+ + E  K    S  K H L + 
Sbjct: 2130 FTQELQDVVAKEKDTMATFECETSEPFVKVKWYKD-GMEVHEGDKYRMHSDRKVHFLSIL 2188

Query: 129  PLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPKKKQKKVANE 188
             + + D+++Y C+   D  + + T + L+ EG   ++F K L+    P     + +    
Sbjct: 2189 TIDTSDAEDYSCVLVED--ENVKTTAKLIVEG-AVVEFVKELQDIEVPESYSGELECIVS 2245

Query: 189  KEMLEILSKVPKKDFE-KVCMEYGFTDFRG--------------------LLRKLKEMKK 227
             E +E   K    D E K   +Y  T  RG                    +  K    K 
Sbjct: 2246 PENIE--GKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKL 2303

Query: 228  KVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVK 287
            K++   I IL+ L D++      V  +  + L+  +V+ +W+K  + ++    +     K
Sbjct: 2304 KMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLE--SVEGVWMKDGQEVQPSDRVHIVIDK 2361

Query: 288  QMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVF 347
            Q    +ML+I ++   DAG YS ++    +S    V    +  +  +K V V E   AV 
Sbjct: 2362 Q---SHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVL 2418

Query: 348  EIRLSKKEPNFV-WKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNL 406
            E ++S  +   V W  N +++K DD+ +  V   G    L I     SD G +    G +
Sbjct: 2419 ECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVK--GTKQRLVINRTHASDEGPYKLIVGRV 2476

Query: 407  VQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSM 466
                 L++++  IK +  L+++   E      E EL+   + + W    + +   +KY +
Sbjct: 2477 ETNCNLSVEK--IKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKI 2534

Query: 467  NHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAA 526
               GK  +L + +    D G+YT  A       E  ++  +TV      +   ++D   A
Sbjct: 2535 EAHGKIYKLTVLNMMKDDEGKYTFYA------GENMTSGKLTVAG--GAISKPLTDQTVA 2586

Query: 527  TGSPAEL-CVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTF 585
                A   C V N +  +G WL+DGK +     ++    G   +LI  +   +  G+YT+
Sbjct: 2587 ESQEAVFECEVANPDS-KGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTY 2645

Query: 586  RAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDG 645
            +   +++ A + +        +V        +TV     A   V      +  V W K+G
Sbjct: 2646 KVATSKTSAKLKV-------EAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNG 2698

Query: 646  MEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQ 705
            + +   E+ ++        L I NC   D  +   +L      A+A LH+  +   K P+
Sbjct: 2699 VVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRL--GRLGASARLHVETVKIIKKPK 2756



 Score =  121 bits (303), Expect = 5e-27
 Identities = 150/654 (22%), Positives = 261/654 (39%), Gaps = 83/654 (12%)

Query: 701   PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTN 760
             P  P G+ E ++++ S V + W  PK +GG  +  + VE   +    W++      ++  
Sbjct: 12884 PVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQ 12943

Query: 761   --FSTNKVEEGKAYQFRILAVNSEGVSDPLETEE---VFAGNPIEPPGFASQPQVTDVTK 815
               ++   +EE   YQFR +A  +  +S P E  +   + A N       +   +     K
Sbjct: 12944 EEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVK 13003

Query: 816   EAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVN--KDPIQGTKCTVD--GLLEDTE 871
                 +  +A       P + +     KK   L  P    K  +Q   CT++   +     
Sbjct: 13004 AGTNVCLDATVFGKPMPTVSW-----KKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDS 13058

Query: 872   YEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--G 929
              ++ + A N +G        S+ +    +  PG    + ++   +    L+W  P E  G
Sbjct: 13059 GDYTITAENSSGS------KSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGG 13112

Query: 930   DPPSGYILEMRAEDTKEWSKCTK-IPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVE 988
                + YI++ R      W++ +  +PI  T  +V  LIE  +Y FRI A N+ GVG+PV 
Sbjct: 13113 SEITNYIVDKRETSRPNWAQVSATVPI--TSCSVEKLIEGHEYQFRICAENKYGVGDPVF 13170

Query: 989   LDKGVRAMPPPAAPKFD---LSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPT 1045
              +  +   P     + D   +S   K HM V            S  PP D      G P 
Sbjct: 13171 TEPAIAKNPYDPPGRCDPPVISNITKDHMTV------------SWKPPAD----DGGSPI 13214

Query: 1046  KG-----RET--ITKSKNHSQFLINSTKRSDSGV-------YRILLQNEFG-----EARY 1086
              G     RET  +  +K + + +I  T ++ +G+       +R+   N+ G     +A  
Sbjct: 13215 TGYLLEKRETQAVNWTKVNRKPIIERTLKA-TGLQEGTEYEFRVTAINKAGPGKPSDASK 13273

Query: 1087  DIHVRVADFPR-PPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTA 1145
               + R   +P  PP   ++++   ++V+L+W             Y++  + A +  W   
Sbjct: 13274 AAYARDPQYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRC 13333

Query: 1146  --AERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKP 1203
                + +   ++ VTGL+   +Y FRV A N+IG S+P D  D     K   +D+   + P
Sbjct: 13334 NLPQNLQKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPD-----KHYPKDIL--IPP 13386

Query: 1204  YEKKDWRHAPRFVTPLKPHTVLR-GQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYN 1262
               + D          L+   +LR G    +     G P P +T  K +VN+         
Sbjct: 13387 EGELD--------ADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIK 13438

Query: 1263  STSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASITE 1316
             ST     L        D+G Y + +EN  GK   +  + V D     V  ++ E
Sbjct: 13439 STDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKE 13492



 Score =  121 bits (303), Expect = 5e-27
 Identities = 140/627 (22%), Positives = 244/627 (38%), Gaps = 83/627 (13%)

Query: 718   VHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRIL 777
             V + W  P  +GG  +T+++VER+  G+++W   G    K      ++++E    +FR+ 
Sbjct: 21174 VILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGI--SKTCEIEVSQLKEQSVLEFRVF 21231

Query: 778   AVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTIT------WNAPTQDGGA 831
             A N +G+SDP+    +     I  P    +  ++D+    VT+          P +    
Sbjct: 21232 AKNEKGLSDPVTIGPITVKELIITP----EVDLSDIPGAQVTVRIGHNVHLELPYKGKPK 21287

Query: 832   PVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPS 891
             P + ++ +      + +V  +K   + T  ++    ++   ++ VI  N     + +VP 
Sbjct: 21288 PSISWLKDGLPLKESEFVRFSKTENKIT-LSIKNAKKEHGGKYTVILDNAVC--RIAVPI 21344

Query: 892   SSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSK 949
             + +    P KP G ++     +    S+ L+W  P +  G   + Y +E R      W K
Sbjct: 21345 TVITLGPPSKPKGPIR---FDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNW-K 21400

Query: 950   CTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEP-----VELDKGVRAMPPPAAPKF 1004
                  ++ T + V  L++  +Y FR+RA N  GV +P     +      R   PP  P  
Sbjct: 21401 MVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVI 21460

Query: 1005  DLSARLKSHMVVRAGTALCIHA-AFSGSPPP-----------DVIWQKDGV-PTKGRETI 1051
                     + V   G +L   A  + G                ++WQK    P  GRE  
Sbjct: 21461 --------YNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGRE-- 21510

Query: 1052  TKSKNHSQFLINSTKRSDSGVYRILLQNEFG------EARYDIHVRVADFPRPPTNLRLF 1105
                     +            +R+  +N  G       +++ + V   D P  P  + + 
Sbjct: 21511 --------YRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVT 21562

Query: 1106  EEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGR 1163
              E   T+TL WN  P +++ G     Y I KR  +          V   +YTVTGL PG 
Sbjct: 21563 RE---TITLKWN--PPLRDGGSKIVGYSIEKRQGNERWVRCNFTDVSECQYTVTGLSPGD 21617

Query: 1164  KYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHT 1223
             +Y FR++ARN +G   P       ++ +D+       + P  +      P +   L    
Sbjct: 21618 RYEFRIIARNAVGTISPPSQSSGIIMTRDE------NVPPIVE----FGPEYFDGL---I 21664

Query: 1224  VLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDY 1283
             +  G+   +     G P P VT +K  V I            G  +L +   T    G Y
Sbjct: 21665 IKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVY 21724

Query: 1284  SVLVENELGKDRSSCTLTVYDKDDKSV 1310
             +V  +N  G  ++   + V D   K V
Sbjct: 21725 TVEAKNASGSAKAEIKVKVQDTPGKVV 21751



 Score =  120 bits (302), Expect = 7e-27
 Identities = 163/681 (23%), Positives = 272/681 (39%), Gaps = 74/681 (10%)

Query: 361   KFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPIK 420
             + N  EL R   + +    +G  +  +IK A +   GE    A +++ K  L    + + 
Sbjct: 11547 RINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELD 11606

Query: 421   FVS-NLKNVRVKERSRACLECE-LTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIE 478
                 ++  VRV +  R     +     D+T  W K+G++L+   +  +  +  R EL I+
Sbjct: 11607 VTCRDVITVRVGQTIRILARVKGRPEPDIT--WTKEGKVLVREKRVDLIQDLPRVELQIK 11664

Query: 479   DAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLN 538
             +A  +D G+Y + A       +   +AIV V +R      G       T    E C +  
Sbjct: 11665 EAVRADHGKYIISAKNSSGHAQ--GSAIVNVLDR-----PGPCQNLKVTNVTKENCTISW 11717

Query: 539   DEKVEGVWLKDGKEITDL---------PGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKG 589
             +  ++      G EIT+           G  IV      +LI  ++   +E  Y FR   
Sbjct: 11718 ENPLD----NGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIKANLLANNE--YYFRV-C 11770

Query: 590   TESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYK---DGM 646
              E++  V     PTI+      LA + I  + G   ++ +  +GK    + W +   DG 
Sbjct: 11771 AENKVGV----GPTIETKT-PILAINPID-RPGEPENLHIADKGKTFVYLKWRRPDYDGG 11824

Query: 647   EVTEEERVSME-RGED-----------QALLTISNCVREDSGLILLKLKNDHGSATATLH 694
                    V    +G D           +    +  CV        ++ KN+ G +     
Sbjct: 11825 SPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDWVKT 11884

Query: 695   LSVL---DRPKPPQGRVEFLELSGSCV-----HMKWKAPKDNGGRPVTQFIVERRA--VG 744
               V+   D  KP    V  L+LSG         ++ +A       P   +  ++ A  + 
Sbjct: 11885 EEVVVKEDLQKP----VLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLT 11940

Query: 745   KKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGF 804
             +   +KI +     + FS  K +     ++ + A N+ G      T      N ++ PG 
Sbjct: 11941 RSPRVKI-DTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATV-----NVLDKPGP 11994

Query: 805   ASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI-QGTKCTV 863
                 ++ DV+ +  T+ W+ P  DGG  +  YI+E+ +    +W   +   +  GT  TV
Sbjct: 11995 VRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGT--TV 12052

Query: 864   DGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAW 923
               L+E  EY FRV A NK G G P+  S  V+AK     PG      V+  S   +++ W
Sbjct: 12053 TRLIEGNEYIFRVRAENKIGTGPPT-ESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVW 12111

Query: 924   REPA--EGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEA 981
               P    G   +GY LE + + +  W    K  I      V  L+   +Y FR++A NE 
Sbjct: 12112 NPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEI 12171

Query: 982   GVGEPVELDKGVRAMPPPAAP 1002
             G+GEP    + V A  P   P
Sbjct: 12172 GIGEPSLPSRPVVAKDPIEPP 12192



 Score =  117 bits (294), Expect = 6e-26
 Identities = 148/628 (23%), Positives = 233/628 (37%), Gaps = 87/628 (13%)

Query: 713   LSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAY 772
             +S S   + WK P  +GG  +  ++V+      K W ++  +      +S   + EGK Y
Sbjct: 13590 VSKSSCSIGWKKPHSDGGSRIIGYVVDFLTEENK-WQRV--MKSLSLQYSAKDLTEGKEY 13646

Query: 773   QFRILAVNSEGVSDPLETEEVFAGNPIEPP-GFASQPQVTDVTKEAVTITWNAPTQDGGA 831
              FR+ A N  G   P E   V   + + P       P +  + KE        P +   A
Sbjct: 13647 TFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPA 13706

Query: 832   PVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPS 891
             P + +        ++  V V    +  T    D    D   ++ +   N AG  + ++ S
Sbjct: 13707 PSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAG-KYTITLKNVAGTKEGTI-S 13764

Query: 892   SSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSK 949
               VV K P  P G ++     + +  +++L W  P +  G   + YILE R     +W  
Sbjct: 13765 IKVVGK-PGIPTGPIK---FDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVT 13820

Query: 950   CTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSAR 1009
             C    +  T + V  L E  +Y FR+ A N+ GVGE      G+++ P  A   FD+   
Sbjct: 13821 CASA-VQKTTFRVTRLHEGMEYTFRVSAENKYGVGE------GLKSEPIVARHPFDVP-- 13871

Query: 1010  LKSHMVVRAGTALCIHAAFSGSPPPDVI----------W----QKDGVPTKGRETITKSK 1055
                                   PPP+++          W    +  G P  G     K +
Sbjct: 13872 -------------------DAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKER 13912

Query: 1056  NH-------------SQFLINSTKRSDSGVYRILLQNEFGEARYDIH---VRVADFPRPP 1099
             N                F +          +R++  N  G  +  +    V   D   PP
Sbjct: 13913 NSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPP 13972

Query: 1100  TNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAE-RVFSNKYTVTG 1158
                 +     N+VTL W             YI+ KRD  + +W  A    V    +TVT 
Sbjct: 13973 GKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTD 14032

Query: 1159  LLPGRKYYFRVVARNEIGD-SEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVT 1217
             L+ G KY FR+ A+N  G  S P +S +T +I KD+ +  +  L P  K           
Sbjct: 14033 LVEGGKYEFRIRAKNTAGAISAPSESTET-IICKDEYEAPTIVLDPTIKDGL-------- 14083

Query: 1218  PLKPHTVLRGQDCTMTC-AFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCT 1276
                  T+  G    +   + LG P P  +  K   +I  +      ST     L I   T
Sbjct: 14084 -----TIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYAT 14138

Query: 1277  LKDSGDYSVLVENELGKDRSSCTLTVYD 1304
              KD+G+Y++   N  G       +TV D
Sbjct: 14139 RKDAGEYTITATNPFGTKVEHVKVTVLD 14166



 Score =  109 bits (273), Expect = 2e-23
 Identities = 145/639 (22%), Positives = 241/639 (37%), Gaps = 71/639 (11%)

Query: 695   LSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEV 754
             ++V +RP+     +E  E++ + V + W  PK +GG  +  +++E R +G + + K+   
Sbjct: 10409 ITVPERPED----LEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTND 10464

Query: 755   DGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVT 814
             +     ++   ++EG  Y++R+ AVN  G   P      F   PI      + P +    
Sbjct: 10465 NLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPS-----FCTKPITCKDELAPPTLHLDF 10519

Query: 815   KEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYE- 873
             ++ +TI      + G A  L      + K    W     D ++  +  +         E 
Sbjct: 10520 RDKLTI------RVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEK 10573

Query: 874   ----------FRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAW 923
                       + V+  N  G  +     + V   D   PP  V  +   + +   + ++W
Sbjct: 10574 IKAKRSDSGKYCVVVENSTGSRKGFCQVNVV---DRPGPP--VGPVSFDEVTKDYMVISW 10628

Query: 924   REPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEA 981
             + P +  G   + YI+E +      W   T      TC  V  L+E + Y FRI A N  
Sbjct: 10629 KPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTC-KVSKLLEGKDYIFRIHAENLY 10687

Query: 982   GVGEPVELD--KGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQ 1039
             G+ +P+  D  K       P AP   +   +     +             G P  + I +
Sbjct: 10688 GISDPLVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNK----PHDGGKPITNYILE 10743

Query: 1040  KDGVPTKGRETITKSKNH--SQFLINSTKRSDSGVYRILLQNEFG------EARYDIHVR 1091
             K    +K    +TK   H  ++F +          +R+  +NE G       ++      
Sbjct: 10744 KRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKD 10803

Query: 1092  VADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTA---A 1146
                 P PP N    +   N+V LTW   P   + G     YI+  +      W  A    
Sbjct: 10804 PIAKPSPPVNPEAIDTTCNSVDLTWQ--PPRHDGGSKILGYIVEYQKVGDEEWRRANHTP 10861

Query: 1147  ERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEK 1206
             E     KY VTGL  G+ Y FRV+A N  G+S+P    +  L+ KD+++     L     
Sbjct: 10862 ESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLV-KDRLEPPELILD---- 10916

Query: 1207  KDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSG 1266
                          +   +  G    ++    G P P VT  K D +  A +K   + T  
Sbjct: 10917 ---------ANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRD--APTKARIDVTPV 10965

Query: 1267  VCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDK 1305
                L I     +D G YS+ VEN  G    S  + V DK
Sbjct: 10966 GSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDK 11004



 Score =  107 bits (268), Expect = 6e-23
 Identities = 144/617 (23%), Positives = 249/617 (40%), Gaps = 55/617 (8%)

Query: 217  GLLRKLKEMKKKVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLR 276
            G   K    K  VE   +R +K LE++ T V    ++      K+ +V  +W K  +   
Sbjct: 4890 GNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDV--VWRKDGKI-- 4945

Query: 277  IQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSV---GDKRMSAELTVLDEPLKFLGE 333
            +    G+     +G    L I++ +  DAG Y+++V    +   S+ + V++    +L  
Sbjct: 4946 VVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWL-- 5003

Query: 334  MKPVK---VTERQTAVFEIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKD 390
            +KP++   V  + TA+F   ++K  PN  W     E+  +   +  +  DG    LKIK+
Sbjct: 5004 VKPIRDQHVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKN 5063

Query: 391  ARLSDSGEFSAEAGNLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLR 450
            A   D  E++ E       A+LT+    ++ +  +++V + E+  A  + E++  D+  +
Sbjct: 5064 AMPEDIAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQ 5123

Query: 451  WKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVE 510
            WK  G+LL       +  EG +  L +   +L   GE    A+         +TAI+TV+
Sbjct: 5124 WKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQAL------NAITTAILTVK 5177

Query: 511  ERLATVKSGMSDVHAATGSPAEL-CVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHK 569
            E        + DV       A   CV+  +  V  +W K    I       I+  G  H 
Sbjct: 5178 EIELDFAVPLKDVTVPERRQARFECVLTREANV--IWSKGPDIIKSSDKFDIIADGKKHI 5235

Query: 570  LIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKV 629
            L+      + EG YT   +G ++ A +F+        S LE       TVK G TA    
Sbjct: 5236 LVINDSQFDDEGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQ-----TVKEGETATFVC 5290

Query: 630  PFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSA 689
                + +  V W+K+  ++     V +        L +     +D   I  ++K      
Sbjct: 5291 ELSHEKM-HVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVK----EL 5345

Query: 690  TATLHLSVLDRPK------PPQGRVEFLELSGSC-----VHMKWKAPKDNGGRPVTQFIV 738
            ++T  L VL+           +  VE  E++  C     V +KW     +G   V     
Sbjct: 5346 SSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKDVPVKW---FKDGEEIVPSPKY 5402

Query: 739  ERRAVGKKSWIKIGEVDGK-----VTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEV 793
              +A G +  +KI + D K     V +  T+K +     + R++ V       PL   EV
Sbjct: 5403 SIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEK-----PLYGVEV 5457

Query: 794  FAGNPIEPPGFASQPQV 810
            F G         S+P V
Sbjct: 5458 FVGETAHFEIELSEPDV 5474



 Score =  107 bits (266), Expect = 1e-22
 Identities = 168/748 (22%), Positives = 293/748 (39%), Gaps = 96/748 (12%)

Query: 232   EAIRILKPLEDKETKVDTTVVFDC-IMELKDPNVKMIWIK-GTEPLRIQYSLGKYDVKQM 289
             EA  I K ++D  TK+       C I+    P++K  W + G E ++ +    KY +   
Sbjct: 24226 EAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIK--WYRFGKELIQSR----KYKMSSD 24279

Query: 290   GTKYMLVISNVNMNDAGIYSL----SVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTA 345
             G  + L +      D G+Y+      VG+   S++L +   P    G   P+K       
Sbjct: 24280 GRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGY--PLKEKYYGAV 24337

Query: 346   VFEIRL-----SKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFS 400
                +RL      +  P   W F+G++L ++ +     + +  TH +     R + +G++ 
Sbjct: 24338 GSTLRLHVMYIGRPVPAMTW-FHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYK 24396

Query: 401   AEAGNLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMH 460
              +  N+       +D         +++   K      +E  L +  V + WK        
Sbjct: 24397 VQLSNVFGTVDAILD-------VEIQDKPDKPTGPIVIEALLKNSAV-ISWKPPAD---D 24445

Query: 461   GTKYSMNH--------EGKRAELIIEDAQLS---------DGGEYTVVAMQD----GDPT 499
             G  +  N+        EG   +L+     ++         + G Y  V+ Q+     DP 
Sbjct: 24446 GGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPL 24505

Query: 500   EYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVL-------NDEKVEGVWLKDGKE 552
             E  S  I+    +    K G       T    + CVV           K+   +L+  +E
Sbjct: 24506 EVSSVVII----KSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEK-RE 24560

Query: 553   ITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAK----GTESEASVFI------ADPP 602
                   + +  +  + + +F         +Y FR K    G ESE S         +D P
Sbjct: 24561 KKQNKWISVTTE-EIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVP 24619

Query: 603   TIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEE---RVSMERG 659
                P   E L    + V+    A +     G P P V WY+ G E+  +    R+   +G
Sbjct: 24620 IQAPHFKEEL--RNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKG 24677

Query: 660   EDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSV-----LDRPKPPQGRVEFLELS 714
                 L+ I++   +D+ +  ++  N  GS + T  L V     +  PK  +G      L 
Sbjct: 24678 GYHQLI-IASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALR 24736

Query: 715   GSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQF 774
             G  V +K   P      PV  +   +  +      ++       +    N VE   A  +
Sbjct: 24737 GEVVSIK--IPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFY 24794

Query: 775   RILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVL 834
              + A N  G+    +T E+   +  +PP      +V+DV++++V +TW  P  DGG+ + 
Sbjct: 24795 VVCAKNRFGIDQ--KTVELDVADVPDPPRGV---KVSDVSRDSVNLTWTEPASDGGSKIT 24849

Query: 835   GYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSV 894
              YIVE+    +  W+ V +   + T+ TV  L   T Y+FRVIA NK G  +PS PS   
Sbjct: 24850 NYIVEKCATTAERWLRVGQ--ARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPT 24907

Query: 895   VAKDPVKPPGLVQDLHVSDSSNSSISLA 922
             + K+  K   +  D  V ++   S++ A
Sbjct: 24908 ITKED-KTRAMNYDEEVDETREVSMTKA 24934



 Score = 98.2 bits (243), Expect = 5e-20
 Identities = 145/714 (20%), Positives = 274/714 (38%), Gaps = 108/714 (15%)

Query: 3    TIHSRQMLQEHVSMEFSSSTTHVQTFSQTTKIVGEEVVRRKSSSIVEFFSLVTRSSNIPA 62
            T+ +   L   VS EF   TT V     T K   EE    +S  +V   + +T     P 
Sbjct: 977  TVSTSCYLAVQVSEEFEKETTAV-----TEKFTTEEKRFVESRDVVMTDTSLTEEQAGPG 1031

Query: 63   GDSVPEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESA--KIFYDSIN 120
              + P F+ KP      EG   VF  +V GN KPH+ WK+ SG+P+      K+ Y+   
Sbjct: 1032 EPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKK-SGVPLTTGYRYKVSYNKQT 1090

Query: 121  KEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPKK 180
             E  L +    +DD+  Y  +  N H +   + SLL     E+ D++ ++K +     + 
Sbjct: 1091 GECKLVISMTFADDAGEYTIVVRNKHGETSASASLL-----EEADYELLMKSQQEMLYQT 1145

Query: 181  KQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVEVEAIRILKPL 240
            +      E ++ E        ++EK   EY         ++   ++KK+  + + +   +
Sbjct: 1146 QVTAFVQEPKVGETAPGFVYSEYEK---EYE--------KEQALIRKKMAKDTVVVRTYV 1194

Query: 241  EDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNV 300
            ED+E  + +          ++  +K           I+Y + K  ++++           
Sbjct: 1195 EDQEFHISS---------FEERLIK----------EIEYRIIKTTLEEL----------- 1224

Query: 301  NMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKE-PNFV 359
             + + G   ++V      A  +  D        +K  ++ E     F  ++S    P   
Sbjct: 1225 -LEEDGEEKMAVDISESEAVESGFDS------RIKNYRILEGMGVTFHCKMSGYPLPKIA 1277

Query: 360  WKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEA----GNLVQKAQLTID 415
            W  +GK +K  ++Y++   +DG   +L+I      D G ++A A    GN +   +L ++
Sbjct: 1278 WYKDGKRIKHGERYQMDFLQDGRA-SLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVE 1336

Query: 416  -RIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRAE 474
               P+   + +  +    R R+     ++   + +   +     M   + S         
Sbjct: 1337 PAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMS--------- 1387

Query: 475  LIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVH--AATGSPAE 532
                 A++S G       +++ D ++          ERL      +  V      G  A 
Sbjct: 1388 ----PARMSPGRR-----LEETDESQL---------ERLYKPVFVLKPVSFKCLEGQTAR 1429

Query: 533  LCV-VLNDEKVEGVWLKDGKEIT-DLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGT 590
              + V+     E  W  DG++I  D     ++K+     LI     P   G++T  A+  
Sbjct: 1430 FDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNR 1489

Query: 591  ESEASVFI-----ADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDG 645
               +S+ +     A    + P  +E L    + +K G    +KV   G P P + W K+ 
Sbjct: 1490 AGRSSISVILTVEAVEHQVKPMFVEKLKN--VNIKEGSRLEMKVRATGNPNPDIVWLKNS 1547

Query: 646  MEVTEEE--RVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSV 697
              +   +  ++ +E  + +A L I + V +DS        N  G  T    ++V
Sbjct: 1548 DIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNV 1601



 Score = 95.9 bits (237), Expect = 2e-19
 Identities = 152/639 (23%), Positives = 238/639 (37%), Gaps = 111/639 (17%)

Query: 430   VKERSRACLECELTSKDV-TLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEY 488
             VK  +  CL+  +  K + T+ WKKDG LL       M  +     L +      D G+Y
Sbjct: 13002 VKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDY 13061

Query: 489   TVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCV-VLNDEKVEGVW- 546
             T+             TA  +   + AT+K  + D     G PA + +  +  ++    W 
Sbjct: 13062 TI-------------TAENSSGSKSATIKLKVLD---KPGPPASVKINKMYSDRAMLSWE 13105

Query: 547   --LKDG----------KEITDLPGMQIVKQG------AVHKLIFPSMGPEHEGKYTFRAK 588
               L+DG          K  T  P    V         +V KLI       HE ++   A+
Sbjct: 13106 PPLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLI-----EGHEYQFRICAE 13160

Query: 589   G---------TESEASVFIADPP-TIDPSVLEALAAHAITVKVGHTAHIK-VPFRGKPLP 637
                       TE   +    DPP   DP V+  +    +TV     A     P  G  L 
Sbjct: 13161 NKYGVGDPVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLE 13220

Query: 638   K-----VTWYKDGMEVTEEERVS----MERGEDQALLTISNCVREDSGLILLKLKNDHGS 688
             K     V W K   +   E  +      E  E +  +T  N             K   G 
Sbjct: 13221 KRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAIN-------------KAGPGK 13267

Query: 689   ATATLHLSVLDRPKPPQGRVEF---LELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGK 745
              +     +    P+ P G   F    + + S V + W  P  +GG P+  ++VE +    
Sbjct: 13268 PSDASKAAYARDPQYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADS 13327

Query: 746   KSWIKIGEVDG-KVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLET-EEVFAGNPIEPPG 803
              +W++       + T F    + E   YQFR+ AVN  G SDP +  ++ +  + + PP 
Sbjct: 13328 DNWVRCNLPQNLQKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPE 13387

Query: 804   --FASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKC 861
                 +  + T + +  VT+    P +    P + +     K   NL   +  D       
Sbjct: 13388 GELDADLRKTLILRAGVTMRLYVPVKGRPPPKITW----SKPNVNLRDRIGLD------- 13436

Query: 862   TVDGLLEDTEYE--FRVIAVNKAGPGQPSVPSSSVVAKDP-------VKPPGLVQDLHVS 912
                  ++ T+++   R   VNK   G+  +   +   K         +  PG   ++ V 
Sbjct: 13437 -----IKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVK 13491

Query: 913   DSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQK 970
             + S  S  + W  P    G P   Y+++ R  + K WS  T    S T + V  L E + 
Sbjct: 13492 EISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTVTT-ECSKTSFRVANLEEGKS 13550

Query: 971   YFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSAR 1009
             YFFR+ A NE G+G+P E    V+A   P  P  DL  R
Sbjct: 13551 YFFRVFAENEYGIGDPGETRDAVKASQTP-GPVVDLKVR 13588



 Score = 92.8 bits (229), Expect = 2e-18
 Identities = 110/495 (22%), Positives = 193/495 (38%), Gaps = 34/495 (6%)

Query: 232  EAIRILKPLEDKETKV-DTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMG 290
            + I   + L+D   K  DT   F+C  E  +P VK+ W K    +   +   KY +    
Sbjct: 2126 QLITFTQELQDVVAKEKDTMATFEC--ETSEPFVKVKWYKDGMEV---HEGDKYRMHSDR 2180

Query: 291  TKYMLVISNVNMNDAGIYS-LSVGDKRM--SAELTVLDEPLKFLGEMKPVKVTERQTAVF 347
              + L I  ++ +DA  YS + V D+ +  +A+L V    ++F+ E++ ++V E  +   
Sbjct: 2181 KVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGEL 2240

Query: 348  EIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLV 407
            E  +S +     W  N  ELK + KY IT S  G    L +KD    D GE+S       
Sbjct: 2241 ECIVSPENIEGKWYHNDVELKSNGKYTIT-SRRG-RQNLTVKDVTKEDQGEYSFVIDGKK 2298

Query: 408  QKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMN 467
               +L +   PI  +  L + +V E     LE +++ + V   W KDGQ +    +  + 
Sbjct: 2299 TTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIV 2358

Query: 468  HEGKRAELIIEDAQLSDGGEYT----VVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDV 523
             + +   L+IED    D G Y+     + +        YS  ++T           + DV
Sbjct: 2359 IDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVIT----------PLKDV 2408

Query: 524  HAATGSPAEL-CVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGK 582
            +   G+ A L C V   +     W  + ++I     +Q + +G   +L+        EG 
Sbjct: 2409 NVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGP 2468

Query: 583  YTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWY 642
            Y       E+  ++ +         ++  L     T        +++   G     V W 
Sbjct: 2469 YKLIVGRVETNCNLSVE-----KIKIIRGLRDLTCTETQNVVFEVELSHSG---IDVLWN 2520

Query: 643  KDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPK 702
                E+    +  +E       LT+ N +++D G        +  S   T+    + +P 
Sbjct: 2521 FKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKPL 2580

Query: 703  PPQGRVEFLELSGSC 717
              Q   E  E    C
Sbjct: 2581 TDQTVAESQEAVFEC 2595



 Score = 88.2 bits (217), Expect = 5e-17
 Identities = 139/589 (23%), Positives = 233/589 (39%), Gaps = 79/589 (13%)

Query: 65   SVPEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHV 124
            + P    K +P+    G  A F   +Q        W + +G  I ES K    S   +++
Sbjct: 4527 AAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFK-AGREIYESDKCSIRS--SKYI 4583

Query: 125  LKLEPLTSD--DSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPA----- 177
              LE L +   D   Y C ASN++     T +L VT    +   +K+L +R P       
Sbjct: 4584 SSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTVPGGEKKVRKLLPERKPEPKEEVV 4643

Query: 178  --------PKKKQKKVANEKEMLEILSK--VPKKDFEKVCMEYGFTDFRGLLRKLKEMKK 227
                    P++++ KV  E + LE + K  VP+    K   E          RK+ E  K
Sbjct: 4644 LKSVLRKRPEEEEPKV--EPKKLEKVKKPAVPEPPPPKPVEEVEVPTVTKRERKIPEPTK 4701

Query: 228  KVEVEA----------------IRILKP--LEDKETKVDTTVVFDCI---MELKDPNVKM 266
              E++                 ++ +KP  +E + T +   V    +    E K P  + 
Sbjct: 4702 VPEIKPAIPLPAPEPKPKPEAEVKTIKPPPVEPEPTPIAAPVTVPVVGKKAEAKAPKEEA 4761

Query: 267  IWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSVGDKRMS-AELT--V 323
               KG              +K +  K     S +      +   S G+K    A  T  +
Sbjct: 4762 AKPKGP-------------IKGVPKK---TPSPIEAERRKLRPGSGGEKPPDEAPFTYQL 4805

Query: 324  LDEPLKFLGEMKPVKVTERQ----TAVFEIRLSKKEPNFVWKFNGKELKRDDKYEITVSE 379
               PLKF+ E+K + +TE +    +A+FE  +S       W  +G  ++   K+      
Sbjct: 4806 KAVPLKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIA-- 4863

Query: 380  DGLTHTLKIKDARLSDSGEFSA--EAGN--LVQKAQLTIDRIPIKFVSNL-KNVRVKERS 434
            DG    L I D +LSD+GE++     GN      A+L ++ +P++FV  L + V V +  
Sbjct: 4864 DGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQ 4923

Query: 435  RACLECELTSKDVTLRWKKDGQLLMHGT-KYSMNHEGKRAELIIEDAQLSDGGEYTVVAM 493
               L CEL +K+  + W+KDG++++    +      G    L I DA  +D G YT V +
Sbjct: 4924 PLYLSCEL-NKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYT-VTV 4981

Query: 494  QDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDEKVEGVWLKDGKEI 553
            ++ +  E  S+ +  VE     +   + D H      A     +  +     W K   EI
Sbjct: 4982 ENANNLE-CSSCVKVVEVIRDWLVKPIRDQHVKPKGTAIFACDIAKDTPNIKWFKGYDEI 5040

Query: 554  TDLPG--MQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIAD 600
               P    +I++ G    L   +  PE   +Y    +G    A + + +
Sbjct: 5041 PAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGE 5089



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 154/685 (22%), Positives = 262/685 (38%), Gaps = 91/685 (13%)

Query: 76   VTAPEGDKAVFRARVQGNAKPHISWK-RESGIPIKESAKIFYDSINKEHVLKLEPLTSDD 134
            + A E D   F   V       IS+K  ++G+ IK + K    +    H L +  +   D
Sbjct: 2932 INAEEKDTITFEVTVNYEG---ISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGD 2988

Query: 135  SDNYKCIASNDHADAIYTVSLLVTEGQEKM-DFKKMLKKRA--------PPAPKKKQK-- 183
            + +Y  +A    + A   V     E ++ + D K + KKRA        P    +  K  
Sbjct: 2989 AADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDD 3048

Query: 184  ---------KVANEKEMLEILSKVPK-KDFEKVCMEYG--------FTDFRGLLRKLKEM 225
                     K+  EK +  +L    +  D  K  +  G        F + R +  +++ +
Sbjct: 3049 QELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDV--RIRSI 3106

Query: 226  KKKVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYS-LGKY 284
            KK+V+V        +E +   V+         E+ + +V   W K    +  Q     KY
Sbjct: 3107 KKEVQV--------IEKQRAVVE--------FEVNEDDVDAHWYKDGIEINFQVQERHKY 3150

Query: 285  DVKQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTV-LDEPLKFLGEMKPVKVTERQ 343
             V++    + + IS    +DAG Y+   G  R S  L V   EP + L E++PV V   +
Sbjct: 3151 VVERR--IHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGK 3208

Query: 344  TAVFEIRLS-KKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAE 402
             A F   +S + +P   W    + L    K +     DG  +TL + +A   D+  ++ E
Sbjct: 3209 PARFCAVISGRPQPKISWYKEEQLLSTGFKCKFL--HDGQEYTLLLIEAFPEDAAVYTCE 3266

Query: 403  AGN----LVQKAQLTIDR------------IPIKFVSNLKNVRVKERSRACLECELTSKD 446
            A N        A L+++              P   ++ L++    E   A  +C ++  D
Sbjct: 3267 AKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTD 3326

Query: 447  VTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAI 506
            + + W    + +     + M       +L I +A   D G YT VA       +  STA 
Sbjct: 3327 LKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVA--SNAVGQVSSTAN 3384

Query: 507  VTVEERLATVKSGMSDVHAATGSPA--ELCVVLNDEKVEGVWLKDGKEIT---DLPGMQI 561
            +++E +    +S   DV  +  S A  +      + K+    +K  +  +   ++   + 
Sbjct: 3385 LSLEVQALDRQSSGKDVRESAKSQAVADSSFTKEESKISQKEIKSFQGSSYEYEVQVFES 3444

Query: 562  VKQGAVHKLI-FPSMGPEHEGKYTFRAKGTESE---ASVFIADPPTIDPSVLEALAAHAI 617
            V Q ++H           H    +  A+ TE     A     + P I       L    +
Sbjct: 3445 VSQSSIHTAASVQDTQLCHTASLSQIAESTELSKECAKESTGEAPKI------FLHLQDV 3498

Query: 618  TVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGL 677
            TVK G TA      +      VTW  +G ++ E ER+   +  +   LTI N    D GL
Sbjct: 3499 TVKCGDTAQFLCVLKDDSFIDVTWTHEGAKIEESERLKQSQNGNIQFLTICNVQLVDQGL 3558

Query: 678  ILLKLKNDHGSATATLHLSVLDRPK 702
                + ND G  T +  LSV   P+
Sbjct: 3559 YSCIVHNDCGERTTSAVLSVEGAPE 3583



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 147/715 (20%), Positives = 268/715 (37%), Gaps = 124/715 (17%)

Query: 72    KPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKLEPLT 131
             KP+ +T  EG+ A F     G   P ++W R+  + +  SA+    +   +   ++  + 
Sbjct: 26261 KPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQV-LSTSARHQVTTTKYKSTFEISSVQ 26319

Query: 132   SDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKR--------APPAPKKKQK 183
             + D  NY  +  N             +EG+++ +F   ++K         +PP  K  + 
Sbjct: 26320 ASDEGNYSVVVEN-------------SEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEP 26366

Query: 184   KVANEKEMLEILS-KVPKKDFEKVCMEYGFTDFRGL-LRKLKEMKKKVEVEAIRILKPLE 241
             +V + + +      K P+    K       T+ +     K++ +      +  + LK   
Sbjct: 26367 RVKSPEAVKSPKRVKSPEPSHPKAVSP---TETKPTPTEKVQHLPVSAPPKITQFLKAEA 26423

Query: 242   DKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVN 301
              KE    T VV   ++  K+    + W K  + L+ +    ++     GT Y L I+N+ 
Sbjct: 26424 SKEIAKLTCVVESSVLRAKE----VTWYKDGKKLK-ENGHFQFHYSADGT-YELKINNLT 26477

Query: 302   MNDAGIYSLSVGDKRMSAE--LTVLDEPLKFLGEM------------------------- 334
              +D G Y   +  +  +++  L  + +  K + E                          
Sbjct: 26478 ESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEP 26537

Query: 335   --------KPVKVTERQ--------TAVFEIRLS-KKEPNFVWKFNGKELKRDDKYEITV 377
                     KPV VT  Q         A F ++ + +  P  +W  +GK + +  KY++  
Sbjct: 26538 KAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKL-- 26595

Query: 378   SEDGLTHTLKIKDARLSDSGEFSA----EAGNLVQKAQLTIDRIP---IKFVSNLKNVRV 430
             SED     L+I     SDSG ++      AG++    +LTI  I     + VS  K   +
Sbjct: 26596 SEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEI 26655

Query: 431   KERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTV 490
               + +A ++ E++ K +     K  +      K ++  E  +  LI E+ + S       
Sbjct: 26656 TPQKKAVVQEEISQKALRSEEIKMSEAKSQ-EKLALKEEASKV-LISEEVKKSAATSLEK 26713

Query: 491   VAMQDGDPTEYYSTAIVTVEERL-ATVKSGMSDVHAATGSPAELCVVLNDEKVEGV-WLK 548
               + +    E   T+  + E R  A +K+  + +    G    L +  N      V W+ 
Sbjct: 26714 SIVHE----EITKTSQASEEVRTHAEIKAFSTQMSINEGQ--RLVLKANIAGATDVKWVL 26767

Query: 549   DGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTE---------------SE 593
             +G E+T+    +    G+   L         EG  T  +K  E               S+
Sbjct: 26768 NGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSD 26827

Query: 594   ASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEER 653
             A  FI+ P              +  +  G          G+P P++ W+K+ + ++    
Sbjct: 26828 APAFISQP-------------RSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSN 26874

Query: 654   VSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRV 708
             VS+ R  +   L I N    DSG   +K KN  G  +AT  L VL   + P   V
Sbjct: 26875 VSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREV 26929



 Score = 83.6 bits (205), Expect = 1e-15
 Identities = 80/296 (27%), Positives = 128/296 (43%), Gaps = 15/296 (5%)

Query: 417  IPIKFVSNLKNVRVKER----SRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKR 472
            +P+KFV  +K++ + E     S A  EC ++       W KDG  +    K+    +GK 
Sbjct: 4808 VPLKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKD 4867

Query: 473  AELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAE 532
             +L I D QLSD GEYT V ++ G+  +  +  +V  E  +  VK+   +V    G P  
Sbjct: 4868 RKLHIIDVQLSDAGEYTCV-LRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLY 4926

Query: 533  LCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQ--GAVHKLIFPSMGPEHEGKYTFRAKGT 590
            L   LN E+ + VW KDGK + + PG +IV    G +  L          G YT   +  
Sbjct: 4927 LSCELNKER-DVVWRKDGKIVVEKPG-RIVPGVIGLMRALTINDADDTDAGTYTVTVENA 4984

Query: 591  ES-EASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVT 649
             + E S  +     I   +++ +      VK   TA        K  P + W+K   E+ 
Sbjct: 4985 NNLECSSCVKVVEVIRDWLVKPIRDQ--HVKPKGTAIFACDI-AKDTPNIKWFKGYDEIP 5041

Query: 650  EE--ERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKP 703
             E  ++  + R  +   L I N + ED     ++++     A  TL    ++  KP
Sbjct: 5042 AEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGEREVELLKP 5097



 Score = 83.6 bits (205), Expect = 1e-15
 Identities = 150/648 (23%), Positives = 250/648 (38%), Gaps = 101/648 (15%)

Query: 699   DRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKV 758
             D+P  P G +E L +S   V ++W+ P+ +GG+ +  + VE R  G  +W K  +   K 
Sbjct: 24124 DKPSQP-GELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKD 24182

Query: 759   TNFSTNKVEEGKAYQFRILAVNSEGVSDPLETE-----EVFAGNPIEPPGFASQPQVTDV 813
               F+   + E   Y+FR+ A N  G+S P  T      ++ +G   E PG   + ++ DV
Sbjct: 24183 KQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSG---EAPGI--RKEMKDV 24237

Query: 814   TKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKC---------TVD 864
             T           T+ G A  L   +  R      W    K+ IQ  K          T+ 
Sbjct: 24238 T-----------TKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLT 24286

Query: 865   GLLEDTEYE--FRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLA 922
              + E+ E E  +  IA N+ G  + S  S  ++   P   PG         +  S++ L 
Sbjct: 24287 VMTEEQEDEGVYTCIATNEVGEVETS--SKLLLQATPQFHPGYPLKEKYYGAVGSTLRLH 24344

Query: 923   WREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGT---CYTVGGLIERQKYF--FRIRA 977
                     P   +    +     E      I I  T    + V   ++R+ +   ++++ 
Sbjct: 24345 VMYIGRPVPAMTWFHGQKLLQNSE-----NITIENTEHYTHLVMKNVQRKTHAGKYKVQL 24399

Query: 978   VNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDV- 1036
              N  G  + + LD  ++  P        + A LK+  V+            S  PP D  
Sbjct: 24400 SNVFGTVDAI-LDVEIQDKPDKPTGPIVIEALLKNSAVI------------SWKPPADDG 24446

Query: 1037  -IWQKDGVPTK-----GRETITKSKNHSQF---LINSTKRSDSGVY-RILLQNEFGEAR- 1085
               W  + V  K     G E    S   S     ++N T+  ++G Y R+  QN FG +  
Sbjct: 24447 GSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTE--NAGYYFRVSAQNTFGISDP 24504

Query: 1086  ---YDIHVRVADFPRP--PTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDAS 1138
                  + +  + F +P  P    +     ++  + W   P   + G    +Y + KR+  
Sbjct: 24505 LEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWK--PPASDGGAKIRNYYLEKREKK 24562

Query: 1139  TATWYTAA-ERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDL 1197
                W +   E +    ++V  L+ G +Y FRV   N  G+SE       W        ++
Sbjct: 24563 QNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESE-------W-------SEI 24608

Query: 1198  SAKLKPYEKKDWR-HAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITAN 1256
             S  + P  K D    AP F   L+   V    + T+ C   G+P+P V  Y+    I A+
Sbjct: 24609 SEPITP--KSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIAD 24666

Query: 1257  SKFW--YNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTV 1302
                +       G   L+I + T  D+  Y V   N+ G    + +L V
Sbjct: 24667 GLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEV 24714



 Score = 75.5 bits (184), Expect = 3e-13
 Identities = 136/655 (20%), Positives = 238/655 (36%), Gaps = 106/655 (16%)

Query: 52   SLVTRSSNIPAGDSVPEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISW-KRESGIPIKE 110
            S VT   N P     P+ +++ QPVT   G  A F A + G  +P ISW K E  +    
Sbjct: 3181 SSVTLYVNAP---EPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGF 3237

Query: 111  SAKIFYDSINKEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKML 170
              K  +D   +E+ L L     +D+  Y C A ND+  A  + SL V E  E +   + +
Sbjct: 3238 KCKFLHD--GQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSV-EVPEVVSPDQEM 3294

Query: 171  KKRAPPAPKKKQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVE 230
                P      Q  V +E +      +V   D                  K+    K  +
Sbjct: 3295 PVYPPAIITPLQDTVTSEGQPARFQCRVSGTDL-----------------KVSWYSKDKK 3337

Query: 231  VEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMG 290
            ++  R  +  + ++T                                Q  + +   +  G
Sbjct: 3338 IKPSRFFRMTQFEDT-------------------------------YQLEIAEAYPEDEG 3366

Query: 291  TKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIR 350
            T Y  V SN           +VG    +A L++  + L      K V+ + +  AV +  
Sbjct: 3367 T-YTFVASN-----------AVGQVSSTANLSLEVQALDRQSSGKDVRESAKSQAVADSS 3414

Query: 351  LSKKEPNFVWK----FNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFS--AEAG 404
             +K+E     K    F G   + + +   +VS+  +     ++D +L  +   S  AE+ 
Sbjct: 3415 FTKEESKISQKEIKSFQGSSYEYEVQVFESVSQSSIHTAASVQDTQLCHTASLSQIAEST 3474

Query: 405  NLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKD-VTLRWKKDGQLLMHGTK 463
             L ++          K   +L++V VK    A   C L     + + W  +G  +    +
Sbjct: 3475 ELSKECAKESTGEAPKIFLHLQDVTVKCGDTAQFLCVLKDDSFIDVTWTHEGAKIEESER 3534

Query: 464  YSMNHEGKRAELIIEDAQLSDGGEYTVVAMQD-GDPTEYYSTAIVTVEERLATVKSGMSD 522
               +  G    L I + QL D G Y+ +   D G+ T   ++A+++VE    ++      
Sbjct: 3535 LKQSQNGNIQFLTICNVQLVDQGLYSCIVHNDCGERT---TSAVLSVEGAPESI------ 3585

Query: 523  VHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGK 582
            +H       E    +  ++    +L   +E      +Q+ K     +L+  S  P +  K
Sbjct: 3586 LHERIEQEIE----MEMKEFSSSFLSAEEEGLHSAELQLSKINETLELL--SESPVYPTK 3639

Query: 583  YTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWY 642
            +    +GT     +FI +    D             + +G  A + V   G P PK+ W+
Sbjct: 3640 FDSEKEGT---GPIFIKEVSNAD-------------ISMGDVATLSVTVIGIPKPKIQWF 3683

Query: 643  KDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSV 697
             +G+ +T           D   L I     ED G       ND+G    + +L +
Sbjct: 3684 FNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKI 3738



 Score = 75.5 bits (184), Expect = 3e-13
 Identities = 142/714 (19%), Positives = 258/714 (36%), Gaps = 116/714 (16%)

Query: 14    VSMEFSSSTTHVQTFSQTTKIVGEEVVR---RKSSSIVEFFSLVTRSSNIPAGDSV---P 67
             +S E  +S T++Q   Q  K + E+V +    K S      S VTR +   A + +   P
Sbjct: 26488 ISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKP 26547

Query: 68    EFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKL 127
               V   Q  T      A F  +  G  +P   W ++ G  I +  K              
Sbjct: 26548 VIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKD-GKAITQGGKY------------- 26593

Query: 128   EPLTSDDSDNYKCIASNDHADA-IYTVSLLVTEGQEKMDFKKMLKKRAPPAPKKKQKKVA 186
               L+ D    +  I   D +D+ +YT ++  + G      K  +K         + +KV+
Sbjct: 26594 -KLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKA----IKDTEAQKVS 26648

Query: 187   NEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVEVEAIRILKPLEDKETK 246
              +K                               ++   KK V  E I   K L  +E  
Sbjct: 26649 TQKTS-----------------------------EITPQKKAVVQEEIS-QKALRSEE-- 26676

Query: 247   VDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAG 306
                              +KM   K  E L ++    K  + +   K     +  ++  + 
Sbjct: 26677 -----------------IKMSEAKSQEKLALKEEASKVLISEEVKKS----AATSLEKSI 26715

Query: 307   IYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVWKFNGKE 366
             ++       + S E+    E   F  +M    + E Q  V +  ++    +  W  NG E
Sbjct: 26716 VHEEITKTSQASEEVRTHAEIKAFSTQMS---INEGQRLVLKANIAGAT-DVKWVLNGVE 26771

Query: 367   LKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSA----EAGNLVQKAQLTIDRI---PI 419
             L   ++Y   VS  G   TL IK A   D G  +     + G +  +  LT+ +      
Sbjct: 26772 LTNSEEYRYGVS--GSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAP 26829

Query: 420   KFVSNLKNVRVKERSRACLECELTSK-DVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIE 478
              F+S  ++  + E       CE++ +    + W K+   +   +  S++       L I 
Sbjct: 26830 AFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIR 26889

Query: 479   DAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLN 538
             +A +SD G+YT+ A          ++ +V     L  V+    +V   T     L    +
Sbjct: 26890 NASVSDSGKYTIKAKNFRGQCSATASLMV-----LPLVEEPSREVVLRTSGDTSLQGSFS 26944

Query: 539   DEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFI 598
              + V+   +   K+             ++ ++ F SM  +             S + + I
Sbjct: 26945 SQSVQ---MSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGI 27001

Query: 599   ADPPTIDPSVLEALAAHA-------------ITVKVGHTAHIKVPFRGKPLPKVTWYKDG 645
             ++   ++ S  + L A               I++  G    +   F G+P P+VTW   G
Sbjct: 27002 SNMTQLESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGG 27061

Query: 646   MEVTEEE--RVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSV 697
              ++  +E  R  +E  +D   L I +  ++D GL  L L N+ GS +AT+++ +
Sbjct: 27062 RKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 27115



 Score = 73.9 bits (180), Expect = 9e-13
 Identities = 141/679 (20%), Positives = 253/679 (37%), Gaps = 92/679 (13%)

Query: 54   VTRSSNIPAGDSVP----EFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIK 109
            VT ++ +PA   +P      V   + VT  EG+       + G   P ++W RE    I+
Sbjct: 880  VTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYRED-YQIE 938

Query: 110  ESAKIFYDSINKEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKM 169
             S        +    L +    ++DS  + C A N+ A  + T   L  +  E+ +    
Sbjct: 939  SSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNE-AGTVSTSCYLAVQVSEEFE---- 993

Query: 170  LKKRAPPAPKKKQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKV 229
                       K+     EK   E    V  +D   V  +   T+        ++     
Sbjct: 994  -----------KETTAVTEKFTTEEKRFVESRDV--VMTDTSLTE--------EQAGPGE 1032

Query: 230  EVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQM 289
                  I KP+  K  +   +VVF C +   +P   + W K   PL   Y       KQ 
Sbjct: 1033 PAAPYFITKPVVQKLVE-GGSVVFGCQVG-GNPKPHVYWKKSGVPLTTGYRYKVSYNKQT 1090

Query: 290  GTKYMLVISNVNMNDAGIYSLSVGDKR--MSAELTVLDEP---LKFLGEMKPVKVTERQT 344
            G +  LVIS    +DAG Y++ V +K    SA  ++L+E    L    + + +  T+   
Sbjct: 1091 G-ECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEMLYQTQVTA 1149

Query: 345  AVFEIRLSKKEPNFVWKFNGKELKR---------------------DDKYEITVSEDGLT 383
             V E ++ +  P FV+    KE ++                     D ++ I+  E+ L 
Sbjct: 1150 FVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLI 1209

Query: 384  HTLKIKDARLSDSGEFSAEAGNLVQKAQLT-IDRIPIKFVSNLKNVRVKERSRACLECEL 442
              ++ +  + +   E   E G       ++  + +   F S +KN R+ E       C++
Sbjct: 1210 KEIEYRIIKTTLE-ELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKM 1268

Query: 443  TSKDVT-LRWKKDGQLLMHGTKYSMNH-EGKRAELIIEDAQLSDGGEYTVVAMQDGDPTE 500
            +   +  + W KDG+ + HG +Y M+  +  RA L I      D G YT  A      + 
Sbjct: 1269 SGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFA------SN 1322

Query: 501  YYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQ 560
                AI + +  +       +  +  T  P      L+   V          I   P   
Sbjct: 1323 IKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSV------SRSPIRMSPARM 1376

Query: 561  IVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVK 620
               + +  ++    M P    + T  ++       VF+  P  +    LE          
Sbjct: 1377 SPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKP--VSFKCLE---------- 1424

Query: 621  VGHTAHIKVPFRGKPLPKVTWYKDGMEVTEE--ERVSMERGEDQALLTISNCVREDSGLI 678
             G TA   +   G+P+P+  W+ DG ++  +   +V ++    Q+L+ +      DSG  
Sbjct: 1425 -GQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVP-ATPSDSGEW 1482

Query: 679  LLKLKNDHGSATATLHLSV 697
             +  +N  G ++ ++ L+V
Sbjct: 1483 TVVAQNRAGRSSISVILTV 1501



 Score = 68.2 bits (165), Expect = 5e-11
 Identities = 46/164 (28%), Positives = 76/164 (46%), Gaps = 7/164 (4%)

Query: 546 WLKDGKEITD--LPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRA---KGTESEASVFIAD 600
           W +DG+ I+   LPG+QI       KL  P++   + G+Y+ +A    G  +  +  +  
Sbjct: 39  WFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVK 98

Query: 601 PPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGE 660
             T  P+ ++ L   ++TV+ G    ++V   G P P V +Y+DG E+       + +  
Sbjct: 99  AETAPPNFVQRL--QSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEG 156

Query: 661 DQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPP 704
           D   L I+    EDSG   +   N  G AT+T  L V    + P
Sbjct: 157 DLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVP 200



 Score = 67.4 bits (163), Expect = 9e-11
 Identities = 105/466 (22%), Positives = 185/466 (39%), Gaps = 44/466 (9%)

Query: 867   LEDTEYEFRVIAVN---KAGPGQPSVPSSSV-----------VAKDPVKPPGLVQDLHVS 912
             +E+TE+   ++  N   K   G+  V  S+V           +   P KP G +    + 
Sbjct: 24372 IENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIV---IE 24428

Query: 913   DSSNSSISLAWREPAE--GDPPSGYILEM-RAEDTKEWSKCTKIPISGTCYTVGGLIERQ 969
                 +S  ++W+ PA+  G   + Y++E   A++  EW   +      TC  V  L E  
Sbjct: 24429 ALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVN-LTENA 24487

Query: 970   KYFFRIRAVNEAGVGEPVELDKGVRAMPP---PAAP-KFDLSARLKSHMVVRAGTALCIH 1025
              Y+FR+ A N  G+ +P+E+   V    P   P AP K  ++A  K   VV    A    
Sbjct: 24488 GYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVV----AWKPP 24543

Query: 1026  AAFSGSPPPDVIWQK-DGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEA 1084
             A+  G+   +   +K +    K     T+    + F + +        +R+  +N  GE+
Sbjct: 24544 ASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGES 24603

Query: 1085  RYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYT 1144
              +     +++   P +++ +  + P+      N +   Q +      +         WY 
Sbjct: 24604 EWS---EISEPITPKSDVPI--QAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYR 24658

Query: 1145  AAERVFSN--KYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLK 1202
               + + ++  KY +     G  Y+  ++A     D+     R T   N+      +A L+
Sbjct: 24659 QGKEIIADGLKYRIQEFKGG--YHQLIIASVTDDDATVYQVRAT---NQGGSVSGTASLE 24713

Query: 1203  PYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYN 1262
               E     H P+ +  +     LRG+  ++   F G P P +T  KG   I  N  +   
Sbjct: 24714 -VEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVI 24772

Query: 1263  STSGVCTLVIPT-CTLKDSGDYSVLVENELGKDRSSCTLTVYDKDD 1307
              T    +LV P     KD+G Y V  +N  G D+ +  L V D  D
Sbjct: 24773 VTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPD 24818



 Score = 62.8 bits (151), Expect = 2e-09
 Identities = 36/115 (31%), Positives = 56/115 (48%), Gaps = 1/115 (0%)

Query: 1213 PRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVI 1272
            P  V+ LK  TV+ G+  T+ C   G P PTVT Y+ D  I ++  F     SG+  L+I
Sbjct: 897  PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMI 956

Query: 1273 PTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDD-KSVVASITESLQKKSKHLM 1326
                 +DSG ++    NE G   +SC L V   ++ +    ++TE    + K  +
Sbjct: 957  REAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFV 1011



 Score = 62.8 bits (151), Expect = 2e-09
 Identities = 127/605 (20%), Positives = 241/605 (39%), Gaps = 84/605 (13%)

Query: 67    PEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLK 126
             P   ++ + VT   G+ A    ++ G   P I W R  G  + +S K    S  + H L 
Sbjct: 24228 PGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYR-FGKELIQSRKYKMSSDGRTHTLT 24286

Query: 127   LEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPKKKQKKVA 186
             +     +D   Y CIA+N+  + + T S L+ +   +      LK++   A     +   
Sbjct: 24287 VMTEEQEDEGVYTCIATNEVGE-VETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLR--- 24342

Query: 187   NEKEMLEILSKVPK----------KDFEKVCME----YGFTDFRGLLRKLKEMKKKVE-- 230
                 ++ I   VP           ++ E + +E    Y     + + RK    K KV+  
Sbjct: 24343 --LHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLS 24400

Query: 231   -----VEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTE---PLRIQYSLG 282
                  V+AI  ++ ++DK  K    +V + +++    +  + W    +        Y + 
Sbjct: 24401 NVFGTVDAILDVE-IQDKPDKPTGPIVIEALLK---NSAVISWKPPADDGGSWITNYVVE 24456

Query: 283   KYDVKQMGTKYMLVISNVNMNDAGIYSLSVGDK---RMSAELTV-LDEPLKFLGEMKPVK 338
             K + K+ G ++ LV S +++    I +L+       R+SA+ T  + +PL+    +    
Sbjct: 24457 KCEAKE-GAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKS 24515

Query: 339   VTERQTAVFE---IRLSKKEPNFVWK--------------FNGKELKRDDKYEITVSE-- 379
               E+  A  +     ++K      WK                 +E K++    +T  E  
Sbjct: 24516 PFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIR 24575

Query: 380   ----------DGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPIKFVSNLKNVR 429
                       +GL +  ++K   L    E+S  +  +  K+ + I      F   L+N+ 
Sbjct: 24576 ETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQ--APHFKEELRNLN 24633

Query: 430   VKERSRACLECELTSKDVTL-RWKKDG-QLLMHGTKYSMNH-EGKRAELIIEDAQLSDGG 486
             V+ +S A L C++T     + +W + G +++  G KY +   +G   +LII      D  
Sbjct: 24634 VRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDAT 24693

Query: 487   EYTVVAMQDGDPTEYYSTAIVTVEERLATVKS--GMSDVHAATGSPAELCVVLNDEKVEG 544
              Y V A   G      ++  V V  ++   K+  GM  VHA  G    + +  + +    
Sbjct: 24694 VYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPV 24753

Query: 545   VWLKDGKEITDLPG-MQIVKQGAVHKLIFPSMGPEHE--GKYTFRAKG----TESEASVF 597
             +  + G+++ D  G  Q++   +   L+FP+ G E +  G Y   AK      +    + 
Sbjct: 24754 ITWQKGQDLIDNNGHYQVIVTRSFTSLVFPN-GVERKDAGFYVVCAKNRFGIDQKTVELD 24812

Query: 598   IADPP 602
             +AD P
Sbjct: 24813 VADVP 24817



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 70/309 (22%), Positives = 126/309 (40%), Gaps = 28/309 (9%)

Query: 1001  APKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTK--GRETITKSKNHS 1058
             AP F    R ++   +  G  +      SG P P++ W K+ +P       +I++S+N  
Sbjct: 26828 APAFISQPRSQN---INEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVY 26884

Query: 1059  QFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNH 1118
                I +   SDSG Y I  +N  G+      + V         L L EE    V L  + 
Sbjct: 26885 SLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV---------LPLVEEPSREVVLRTSG 26935

Query: 1119  SPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDS 1178
                +Q    +  + M      A++ +     FS+  + + +   +       + + + +S
Sbjct: 26936 DTSLQGSFSSQSVQMSASKQEASFSS-----FSSS-SASSMTEMKFASMSAQSMSSMQES 26989

Query: 1179  --EPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPH-TVLRGQDCTMTCA 1235
               E   S    + N  Q++  ++K+    K   R  P  +  L    ++  G+  T+ CA
Sbjct: 26990 FVEMSSSSFMGISNMTQLESSTSKML---KAGIRGIPPKIEALPSDISIDEGKVLTVACA 27046

Query: 1236  FLGNPRPTVTLYKGDVNITANS--KFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGK 1293
             F G P P VT   G   I +    +F   +T  + TL+I     +D G Y++ + NE G 
Sbjct: 27047 FTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGS 27106

Query: 1294  DRSSCTLTV 1302
             D ++  + +
Sbjct: 27107 DSATVNIHI 27115



 Score = 57.4 bits (137), Expect = 9e-08
 Identities = 77/307 (25%), Positives = 121/307 (39%), Gaps = 34/307 (11%)

Query: 1001  APKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETI--TKSKNHS 1058
             AP+  L  R++SH V   G            P  +V W  +GV  +    I  T +    
Sbjct: 26068 APRITL--RMRSHRVP-CGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVL 26124

Query: 1059  QFLINSTKRSDSGVYRILLQNEFGEAR--YDIHVRVADFPRPPTNLRLFEEVPNTVTLTW 1116
                I      DSG YR +  N  GEA     + V   D+    +  R  EEVP +V    
Sbjct: 26125 TLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRR-DEEVPRSVF--- 26180

Query: 1117  NHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIG 1176
                P++    EA+ +   +  S     ++   V S        L   ++      ++   
Sbjct: 26181 ---PELTRT-EAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAAL 26236

Query: 1177  DSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAF 1236
             + + L+ + T           + K+K         A R +T  +  TV  G+    +C  
Sbjct: 26237 EEKSLEEKST-----------TRKIKT------TLAARILTKPRSMTVYEGESARFSCDT 26279

Query: 1237  LGNPRPTVT-LYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDR 1295
              G P PTVT L KG V ++ +++    +T    T  I +    D G+YSV+VEN  GK  
Sbjct: 26280 DGEPVPTVTWLRKGQV-LSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQE 26338

Query: 1296  SSCTLTV 1302
             +  TLT+
Sbjct: 26339 AEFTLTI 26345



 Score = 55.8 bits (133), Expect = 3e-07
 Identities = 99/494 (20%), Positives = 176/494 (35%), Gaps = 85/494 (17%)

Query: 316  RMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSK-KEPNFVWKFNGKELKRDDKYE 374
            R+ A + +   P   +  +K V V E ++   E  +S    P   W     +++    ++
Sbjct: 885  RVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQ 944

Query: 375  ITVSEDGLTHTLKIKDARLSDSGEFSA----EAGNLVQKAQLTID----------RIPIK 420
            IT  + G+   L I++A   DSG F+     EAG +     L +            +  K
Sbjct: 945  ITF-QSGIAR-LMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEK 1002

Query: 421  FVSNLKNVRVKERSRACLECELTSKDVT-------------------------------- 448
            F +  K   V+ R     +  LT +                                   
Sbjct: 1003 FTTEEKRF-VESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGG 1061

Query: 449  -----LRWKKDGQLLMHGTKYSMNHEGKRAE--LIIEDAQLSDGGEYTVVAMQDGDPTEY 501
                 + WKK G  L  G +Y +++  +  E  L+I      D GEYT+V       T  
Sbjct: 1062 NPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETS- 1120

Query: 502  YSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQI 561
             ++A +  E     +     ++   T   A +      E   G    + ++  +     I
Sbjct: 1121 -ASASLLEEADYELLMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALI 1179

Query: 562  VKQGAVHKLIFPSMGPEHE-----------GKYTFRAKGT----------ESEASVFIAD 600
             K+ A   ++  +   + E            +  +R   T          E + +V I++
Sbjct: 1180 RKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISE 1239

Query: 601  PPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGE 660
               ++      +  + I   +G T H K+   G PLPK+ WYKDG  +   ER  M+  +
Sbjct: 1240 SEAVESGFDSRIKNYRILEGMGVTFHCKMS--GYPLPKIAWYKDGKRIKHGERYQMDFLQ 1297

Query: 661  D-QALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVH 719
            D +A L I   + ED G+      N  G+A  +  L V   P  P G   ++        
Sbjct: 1298 DGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYV--EPAAPLGAPTYIPTLEPVSR 1355

Query: 720  MKWKAPKDNGGRPV 733
            ++  +P+     P+
Sbjct: 1356 IRSLSPRSVSRSPI 1369



 Score = 54.3 bits (129), Expect = 8e-07
 Identities = 33/96 (34%), Positives = 41/96 (42%)

Query: 1211  HAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTL 1270
             HAPR    ++ H V  GQ+          P   V  Y   V +  +SK  Y +TSGV TL
Sbjct: 26067 HAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTL 26126

Query: 1271  VIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKD 1306
              I  C   DSG Y  +  N  G+     TL V   D
Sbjct: 26127 EILDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGD 26162



 Score = 52.8 bits (125), Expect = 2e-06
 Identities = 66/296 (22%), Positives = 108/296 (36%), Gaps = 50/296 (16%)

Query: 251   VVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSL 310
             V + C +E  D + ++ W  G   L    +  KY++       +L + ++   D G Y  
Sbjct: 25280 VKYVCKIENYDQSTQVTWYFGVRQLE---NSEKYEITYEDGVAILYVKDITKLDDGTYRC 25336

Query: 311   SVGD-------------------------------KRMSAELTVLDEPLKFLGEMKPVKV 339
              V +                               KR +  + +L+ P +F   +     
Sbjct: 25337 KVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTA 25396

Query: 340   TERQTAVFEIRLS-KKEPNFVWKFNGKELKR-DDKYEITVSEDGLTHTLKIKDARLSDSG 397
                +   F + ++   EP+  W  +G+++K  D+  + T   D   + L I      D  
Sbjct: 25397 YVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDA 25456

Query: 398   EFSAEAGNLVQ----KAQLTIDRIPIKFVSNLK--------NVRVKERSRACLECELTS- 444
             E++  A N       KA+LT+   P    S L+        N   +E    C E  ++  
Sbjct: 25457 EYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGI 25516

Query: 445   KDVTLRWKKDGQLLMHGTKYSMNHEG-KRAELIIEDAQLSDGGEYTVVAMQDGDPT 499
                TL+W+KDGQ L  G    + HEG     L I D    D G Y V A      T
Sbjct: 25517 PPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGST 25572



 Score = 52.4 bits (124), Expect = 3e-06
 Identities = 70/313 (22%), Positives = 120/313 (38%), Gaps = 39/313 (12%)

Query: 999  PAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVP-TKG---RETITKS 1054
            PAAP F ++  +   +V   G ++       G+P P V W+K GVP T G   + +  K 
Sbjct: 1033 PAAPYF-ITKPVVQKLV--EGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQ 1089

Query: 1055 KNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTL 1114
                + +I+ T   D+G Y I+++N+ GE                 +  L EE    + +
Sbjct: 1090 TGECKLVISMTFADDAGEYTIVVRNKHGET--------------SASASLLEEADYELLM 1135

Query: 1115 TWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKY-YFRVVARN 1173
                    Q    A ++   +   TA  +  +E  +  +Y     L  +K     VV R 
Sbjct: 1136 KSQQEMLYQTQVTA-FVQEPKVGETAPGFVYSE--YEKEYEKEQALIRKKMAKDTVVVRT 1192

Query: 1174 EIGDSE-PLDSRDTWLINKDQIQDLSAKLKPYEKKDWRH------------APRFVTPLK 1220
             + D E  + S +  LI + + + +   L+   ++D                  F + +K
Sbjct: 1193 YVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIK 1252

Query: 1221 PHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYN-STSGVCTLVIPTCTLKD 1279
             + +L G   T  C   G P P +  YK    I    ++  +    G  +L IP    +D
Sbjct: 1253 NYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPED 1312

Query: 1280 SGDYSVLVENELG 1292
             G Y+    N  G
Sbjct: 1313 EGIYTAFASNIKG 1325



 Score = 52.4 bits (124), Expect = 3e-06
 Identities = 29/91 (31%), Positives = 46/91 (50%), Gaps = 2/91 (2%)

Query: 1212 APRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFW--YNSTSGVCT 1269
            AP F+T      ++ G      C   GNP+P V   K  V +T   ++   YN  +G C 
Sbjct: 1035 APYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECK 1094

Query: 1270 LVIPTCTLKDSGDYSVLVENELGKDRSSCTL 1300
            LVI      D+G+Y+++V N+ G+  +S +L
Sbjct: 1095 LVISMTFADDAGEYTIVVRNKHGETSASASL 1125



 Score = 51.2 bits (121), Expect = 6e-06
 Identities = 33/109 (30%), Positives = 51/109 (46%), Gaps = 13/109 (11%)

Query: 989   LDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDG----VP 1044
             L  G+R +PP           L S + +  G  L +  AF+G P P+V W   G      
Sbjct: 27015 LKAGIRGIPPKIEA-------LPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQ 27067

Query: 1045  TKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFG--EARYDIHVR 1091
              +GR  I  + + +  +I   ++ D G+Y + L NEFG   A  +IH+R
Sbjct: 27068 EQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIR 27116



 Score = 50.8 bits (120), Expect = 8e-06
 Identities = 46/197 (23%), Positives = 84/197 (42%), Gaps = 8/197 (4%)

Query: 330 FLGEMKPVKVTERQTAVFEIRLSK-KEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKI 388
           F   ++ V V E  TA FE  +S    P   W  +G+ +       + +S       L I
Sbjct: 8   FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTI 67

Query: 389 KDARLSDSGEFSAEA----GNLVQKAQLTI--DRIPIKFVSNLKNVRVKERSRACLECEL 442
                ++SG +S +A    G     A+L +  +  P  FV  L+++ V++ S+  L+  +
Sbjct: 68  PAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRV 127

Query: 443 TSKDV-TLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEY 501
           T      +++ +DG  +     + ++ EG    L+I +A   D G Y+V A         
Sbjct: 128 TGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATS 187

Query: 502 YSTAIVTVEERLATVKS 518
            +  +V  EE +   K+
Sbjct: 188 TAELLVQGEEEVPAKKT 204



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 25/96 (26%), Positives = 49/96 (51%)

Query: 1207  KDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSG 1266
             K+   AP F++  +   +  GQ+   TC   G P P +  +K ++ I+ +S    + +  
Sbjct: 26823 KELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRN 26882

Query: 1267  VCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTV 1302
             V +L I   ++ DSG Y++  +N  G+  ++ +L V
Sbjct: 26883 VYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV 26918



 Score = 50.1 bits (118), Expect = 1e-05
 Identities = 29/91 (31%), Positives = 45/91 (49%), Gaps = 2/91 (2%)

Query: 616 AITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEE--ERVSMERGEDQALLTISNCVRE 673
           ++ V  G TA  +    G P+P+V+W++DG  ++      V +   + +A LTI    + 
Sbjct: 14  SVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKA 73

Query: 674 DSGLILLKLKNDHGSATATLHLSVLDRPKPP 704
           +SG   LK  N  G AT+T  L V     PP
Sbjct: 74  NSGRYSLKATNGSGQATSTAELLVKAETAPP 104



 Score = 50.1 bits (118), Expect = 1e-05
 Identities = 84/364 (23%), Positives = 140/364 (38%), Gaps = 55/364 (15%)

Query: 384   HTLKIKD-------ARLSDSGEFSAEAGNLVQKAQLTIDRIPIKFVSN-LKNVRVKERSR 435
             HTL  KD       AR+S  G   ++ G  V  A++ +  I I  VS  + +   +E   
Sbjct: 25222 HTLIKKDLNMVVSAARISCGGAIRSQKG--VSVAKVKVASIEIGPVSGQIMHAVGEEGGH 25279

Query: 436   ACLECELTSKDVTLR--WKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAM 493
                 C++ + D + +  W    + L +  KY + +E   A L ++D    D G Y    +
Sbjct: 25280 VKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVV 25339

Query: 494   QD-GDPTEYYSTAIVTVEE-------RLATVKSGMSDVHAATGSPAELCVVLNDEKV--- 542
              D G+ + Y    +  V E       R        +D       P E  + L ++     
Sbjct: 25340 NDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVG 25399

Query: 543   EGV---------------WLKDGKEITDLPGMQIVK-----QGAVHKLIFPSMGPEHEGK 582
             E V               W K G++I   PG    K        +++L   S+  + + +
Sbjct: 25400 ENVRFGVTITVHPEPHVTWYKSGQKIK--PGDNDKKYTFESDKGLYQLTINSVTTDDDAE 25457

Query: 583   YTFRAKGTESEAS------VFIADPPTIDP--SVLEALAAHAITVKVGHTAHIKVPFRGK 634
             YT  A+    E S      V +  PPT      + + L A+A   + G +   ++   G 
Sbjct: 25458 YTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANA-ECQEGQSVCFEIRVSGI 25516

Query: 635   PLPKVTWYKDGMEVTEEERVSM-ERGEDQALLTISNCVREDSGLILLKLKNDHGSATATL 693
             P P + W KDG  ++    + +   G D   L I + + ED+G   +   N  GS +   
Sbjct: 25517 PPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQA 25576

Query: 694   HLSV 697
             HL V
Sbjct: 25577 HLQV 25580



 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 8/117 (6%)

Query: 1213 PRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVI 1272
            P FV  L+  TV +G    +     G P P V  Y+    I ++  F  +    + +L+I
Sbjct: 104  PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLI 163

Query: 1273 PTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDD------KSVV--ASITESLQKK 1321
                 +DSG YSV   N +G+  S+  L V  +++      K++V  A I+ES Q +
Sbjct: 164  AEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTR 220



 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 28/99 (28%), Positives = 44/99 (44%), Gaps = 3/99 (3%)

Query: 997   PPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTK---GRETITK 1053
             PP  +    +  RL ++   + G ++C     SG PPP + W+KDG P       E I +
Sbjct: 25482 PPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHE 25541

Query: 1054  SKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRV 1092
               ++    I  T   D+G YR+   N  G      H++V
Sbjct: 25542 GLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 25580



 Score = 47.8 bits (112), Expect = 7e-05
 Identities = 78/309 (25%), Positives = 120/309 (38%), Gaps = 29/309 (9%)

Query: 354  KEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSD-SGEFSAEA----GNLVQ 408
            KE N  W F  K +  D+K++    +D  T+TL I      D  GE+  EA    G    
Sbjct: 4462 KEVN--WYFENKLVPSDEKFKCL--QDQNTYTLVIDKVNTEDHQGEYVCEALNDSGKTAT 4517

Query: 409  KAQLTIDRIPIKFVSN-LKNVRVKERSRACLECELTSK-DVTLRWKKDGQLLMHGTKYSM 466
             A+LT+ +     +   ++ + V     A   CE+ S  +V  +W K G+ +    K S+
Sbjct: 4518 SAKLTVVKRAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSI 4577

Query: 467  NHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAA 526
                  + L I   Q+ D GEYT  A  +       +T  VTV      V+  + +    
Sbjct: 4578 RSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTVPGGEKKVRKLLPERKPE 4637

Query: 527  TGSPAELCVVL------NDEKVEGVWLKDGKE--ITDLPGMQIVKQGAV-------HKLI 571
                  L  VL       + KVE   L+  K+  + + P  + V++  V        K+ 
Sbjct: 4638 PKEEVVLKSVLRKRPEEEEPKVEPKKLEKVKKPAVPEPPPPKPVEEVEVPTVTKRERKIP 4697

Query: 572  FPSMGPEHEGKYTFRA--KGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKV 629
             P+  PE +      A     + EA V    PP ++P      A   + V VG  A  K 
Sbjct: 4698 EPTKVPEIKPAIPLPAPEPKPKPEAEVKTIKPPPVEPEPTPIAAPVTVPV-VGKKAEAKA 4756

Query: 630  PFRGKPLPK 638
            P      PK
Sbjct: 4757 PKEEAAKPK 4765



 Score = 47.8 bits (112), Expect = 7e-05
 Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 3/93 (3%)

Query: 1213  PRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITA---NSKFWYNSTSGVCT 1269
             P F  PL   T   G++         +P P VT YK    I     + K+ + S  G+  
Sbjct: 25385 PEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQ 25444

Query: 1270  LVIPTCTLKDSGDYSVLVENELGKDRSSCTLTV 1302
             L I + T  D  +Y+V+  N+ G+D     LTV
Sbjct: 25445 LTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 25477



 Score = 47.4 bits (111), Expect = 9e-05
 Identities = 33/109 (30%), Positives = 46/109 (42%), Gaps = 5/109 (4%)

Query: 1212 APRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSK-FWYNSTSGVCTL 1270
            AP+    ++  TV +G D       +G P P    YK  V I  + + +WY     VC L
Sbjct: 2031 APKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCEL 2090

Query: 1271 VIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASITESLQ 1319
            VI   T +DS    V   N  G+  S   L V  K     + + T+ LQ
Sbjct: 2091 VIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQ----LITFTQELQ 2135



 Score = 47.4 bits (111), Expect = 9e-05
 Identities = 55/226 (24%), Positives = 100/226 (44%), Gaps = 30/226 (13%)

Query: 220   RKLKEMKKKVEVEAIRILK-------PLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGT 272
             R +K++K++ +   +R+L+       PL +K   V   V F   + +  P   + W K  
Sbjct: 25366 RTMKKIKRRTDT--MRLLERPPEFTLPLYNKTAYVGENVRFGVTITVH-PEPHVTWYKSG 25422

Query: 273   EPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSL----SVGDKRMSAELTVLDEPL 328
             + ++   +  KY  +     Y L I++V  +D   Y++      G+    A+LTV   P 
Sbjct: 25423 QKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPP 25482

Query: 329   KFLGEMKPV--------KVTERQTAVFEIRLSK-KEPNFVWKFNGKELKRDDKYEITVSE 379
                  ++P+        +  E Q+  FEIR+S    P   W+ +G+ L      EI    
Sbjct: 25483 PTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEII--H 25540

Query: 380   DGLT-HTLKIKDARLSDSGEF----SAEAGNLVQKAQLTIDRIPIK 420
             +GL  + L I+D    D+G +    +  AG+   +A L ++R+  K
Sbjct: 25541 EGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYK 25586



 Score = 45.4 bits (106), Expect = 4e-04
 Identities = 69/296 (23%), Positives = 111/296 (37%), Gaps = 39/296 (13%)

Query: 1032 PPPDVIWQK--DGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIH 1089
            P  +VIW K  + +   GR  I         +I +    D+G Y   L +   + +  +H
Sbjct: 6184 PGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVH 6243

Query: 1090 VRVADFPRPPTNLRLFE-EVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAER 1148
               A+F   P NL + E E    V      S  VQ          KRD  T         
Sbjct: 6244 ELAAEFISKPQNLEILEGEKAEFVCSISKESFPVQ---------WKRDDKTLE------- 6287

Query: 1149 VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKD 1208
               +KY V  +  G+K       R  +     L    T+++     +  +A L   EK  
Sbjct: 6288 -SGDKYDV--IADGKK-------RVLVVKDATLQDMGTYVVMVGAAR-AAAHLTVIEKL- 6335

Query: 1209 WRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVC 1268
                 R V PLK   V   Q+    C  +         ++ +  I  +SK+       V 
Sbjct: 6336 -----RIVVPLKDTRVKEQQEVVFNCE-VNTEGAKAKWFRNEEAIFDSSKYIILQKDLVY 6389

Query: 1269 TLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASI--TESLQKKS 1322
            TL I    L D  +Y+V + N  G++  S    + +++D  +V  +   E+++KKS
Sbjct: 6390 TLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKS 6445



 Score = 45.4 bits (106), Expect = 4e-04
 Identities = 74/329 (22%), Positives = 131/329 (39%), Gaps = 40/329 (12%)

Query: 369   RDDKYEITVSEDGLTHTLKIKDARLSDSG--EFSAEAGNLVQKAQLTIDRIPIKFVSNLK 426
             R+ K ++T + + L+       A +  +   E S E  +  +K + T+     + ++  +
Sbjct: 26207 REVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTL---AARILTKPR 26263

Query: 427   NVRVKERSRACLECELTSKDV-TLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDG 485
             ++ V E   A   C+   + V T+ W + GQ+L    ++ +     ++   I   Q SD 
Sbjct: 26264 SMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDE 26323

Query: 486   GEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDEKVEGV 545
             G Y+VV        E   T  +T+++   T K+  S     +  P     V + E V   
Sbjct: 26324 GNYSVVVENSEGKQEAEFT--LTIQKARVTEKAVTSPPRVKSPEPR----VKSPEAV--- 26374

Query: 546   WLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTID 605
               K  K +          + +  K + P+     E K T     TE    + ++ PP I 
Sbjct: 26375 --KSPKRVKS-------PEPSHPKAVSPT-----ETKPT----PTEKVQHLPVSAPPKI- 26415

Query: 606   PSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQAL- 664
                L+A A+  I  K+       V  R K   +VTWYKDG ++ E          D    
Sbjct: 26416 TQFLKAEASKEI-AKLTCVVESSV-LRAK---EVTWYKDGKKLKENGHFQFHYSADGTYE 26470

Query: 665   LTISNCVREDSGLILLKLKNDHGSATATL 693
             L I+N    D G  + ++  + G++   L
Sbjct: 26471 LKINNLTESDQGEYVCEISGEGGTSKTNL 26499



 Score = 45.1 bits (105), Expect = 5e-04
 Identities = 32/106 (30%), Positives = 42/106 (39%)

Query: 1197  LSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITAN 1256
             ++ K +P   +     P  VT L+  TV             G PRPT    K    IT  
Sbjct: 26531 VTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQG 26590

Query: 1257  SKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTV 1302
              K+  +   G   L I      DSG Y+  V+N  G   SSC LT+
Sbjct: 26591 GKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTI 26636



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 40/196 (20%), Positives = 77/196 (39%), Gaps = 14/196 (7%)

Query: 509  VEERLATVKSGMSDVHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVH 568
            ++E    + + + D  +  G    L   + + K E  W  + K +      + ++    +
Sbjct: 4430 IKEDGPMIHTPLVDTVSEEGDIVHLTTSITNAK-EVNWYFENKLVPSDEKFKCLQDQNTY 4488

Query: 569  KLIFPSMGPE-HEGKYTFRA------KGTESEASVFIADPPTIDPSVLEALAAHAITVKV 621
             L+   +  E H+G+Y   A        T ++ +V     P I   +        + V +
Sbjct: 4489 TLVIDKVNTEDHQGEYVCEALNDSGKTATSAKLTVVKRAAPVIKRKI------EPLEVAL 4542

Query: 622  GHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLK 681
            GH A      +  P  +  W+K G E+ E ++ S+   +  + L I      D G    K
Sbjct: 4543 GHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCK 4602

Query: 682  LKNDHGSATATLHLSV 697
              N++GS + T  L+V
Sbjct: 4603 ASNEYGSVSCTATLTV 4618



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 46/213 (21%), Positives = 81/213 (38%), Gaps = 6/213 (2%)

Query: 489 TVVAMQDGDPTEYYSTAIVTVEERLATVKSGMS---DVHAATGSPAELCVVLNDEKVEGV 545
           +V   + G       +AI T+++ L+   S       V A T  P+E  V      +   
Sbjct: 776 SVPKTEHGYEASIAGSAIATLQKELSATSSAQKITKSVKAPTVKPSETRVRAEPTPLPQF 835

Query: 546 WLKDGKEI-TDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTI 604
              D  +      G+++ K+  V            E  +   AK TE+       + P  
Sbjct: 836 PFADTPDTYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVT 895

Query: 605 DPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQAL 664
            P+++  L    +TV  G +  ++    G P P VTWY++  ++       +      A 
Sbjct: 896 PPTLVSGLKN--VTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIAR 953

Query: 665 LTISNCVREDSGLILLKLKNDHGSATATLHLSV 697
           L I     EDSG       N+ G+ + + +L+V
Sbjct: 954 LMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 986



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 73/336 (21%), Positives = 119/336 (35%), Gaps = 70/336 (20%)

Query: 1030 GSPPPDVIWQKDG---VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARY 1086
            G P P+  W  DG   V     + + K       +I     SDSG + ++ QN  G +  
Sbjct: 1436 GRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSI 1495

Query: 1087 DI--HVRVADFPRPP--------TNLRLFEEVPNTVTLTWNHSPDVQ------------- 1123
             +   V   +    P         N++    +   V  T N +PD+              
Sbjct: 1496 SVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKY 1555

Query: 1124 -------EDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTG-----------------L 1159
                     GEA   I    +  + WYTA     + + T                    +
Sbjct: 1556 PKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLI 1615

Query: 1160 LPGRKYYFRVVARNEIGDSEPLDSR---DTWLINKDQIQDLSAKLKPYEKKDWRHAPRFV 1216
            +P   Y  + +A  E+   EPL  R   + W   +  + D   + KP+ KK        +
Sbjct: 1616 IPRGTYRAKEIAAPEL---EPLHLRYGQEQW--EEGDLYDKEKQQKPFFKKK-------L 1663

Query: 1217 TPLKPHTVLRGQ-DCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTC 1275
            T L+         +C +T   +G+P   V        + A ++    +  G C+L     
Sbjct: 1664 TSLRLKRFGPAHFECRLTP--IGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVA 1721

Query: 1276 TLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVV 1311
              +DSG  +    N+ G D +S TL V  KD+KS+V
Sbjct: 1722 YSRDSGIITCRATNKYGTDHTSATLIV--KDEKSLV 1755



 Score = 42.7 bits (99), Expect = 0.002
 Identities = 57/273 (20%), Positives = 106/273 (38%), Gaps = 30/273 (10%)

Query: 1032 PPPDVIWQKDG--VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIH 1089
            P   V W KD   +    R  I K K   + LI ST+ SD+G Y ++       A+  + 
Sbjct: 3038 PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVE 3097

Query: 1090 VRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERV 1149
             R          +++ E+    V    N     ++D +AH+    +D      +   ER 
Sbjct: 3098 GRDVRIRSIKKEVQVIEKQRAVVEFEVN-----EDDVDAHWY---KDGIEIN-FQVQER- 3147

Query: 1150 FSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDW 1209
              +KY V           R + R  I ++   D+ +   +       ++  +   E    
Sbjct: 3148 --HKYVVE----------RRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPE---- 3191

Query: 1210 RHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCT 1269
               P+ +  L+P TV  G+         G P+P ++ YK +  ++   K  +       T
Sbjct: 3192 --PPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYT 3249

Query: 1270 LVIPTCTLKDSGDYSVLVENELGKDRSSCTLTV 1302
            L++     +D+  Y+   +N+ G   +S +L+V
Sbjct: 3250 LLLIEAFPEDAAVYTCEAKNDYGVATTSASLSV 3282



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 25/112 (22%), Positives = 52/112 (46%), Gaps = 4/112 (3%)

Query: 1213 PRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVI 1272
            P F+  +    +  G   T++   +G P+P +  +   V +T ++ + +       +L+I
Sbjct: 3649 PIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLII 3708

Query: 1273 PTCTLKDSGDYSVLVENELGKDRSSCTLTVYDK----DDKSVVASITESLQK 1320
                L+D G+Y+ +  N+ GK   S  L +  K     D    +++ +SL+K
Sbjct: 3709 LFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEK 3760



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 31/110 (28%), Positives = 48/110 (43%), Gaps = 1/110 (0%)

Query: 1198 SAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANS 1257
            SA  K  EK      P F+  LKP    +G         +G P PTVT +K +  +  + 
Sbjct: 3752 SAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSV 3811

Query: 1258 KFW-YNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKD 1306
             +   ++ +G  T ++     +DSG Y    EN LG+   +  L V  +D
Sbjct: 3812 YYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLLED 3861



 Score = 42.0 bits (97), Expect = 0.004
 Identities = 29/111 (26%), Positives = 47/111 (42%), Gaps = 2/111 (1%)

Query: 588   KGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGME 647
             K +E +  V    P T+D +    L   +  V  G      +  + KP  +V WY +G+E
Sbjct: 26049 KTSERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVE 26108

Query: 648   VTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSAT--ATLHLS 696
             + E  ++          L I +C  +DSG       N  G A+  ATL ++
Sbjct: 26109 LQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVT 26159



 Score = 40.0 bits (92), Expect = 0.015
 Identities = 33/111 (29%), Positives = 45/111 (40%), Gaps = 15/111 (13%)

Query: 1002  PKFDLSARLKSHMV---VRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRE-----TITK 1053
             P+F L    K+  V   VR G  + +H      P P V W K G   K  +     T   
Sbjct: 25385 PEFTLPLYNKTAYVGENVRFGVTITVH------PEPHVTWYKSGQKIKPGDNDKKYTFES 25438

Query: 1054  SKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRL 1104
              K   Q  INS    D   Y ++ +N++GE      + V   P PPT+  L
Sbjct: 25439 DKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHP-PPTDSTL 25488



 Score = 39.7 bits (91), Expect = 0.019
 Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 2/93 (2%)

Query: 1212 APRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANS--KFWYNSTSGVCT 1269
            AP F  PL+   VL G   T      G P P V+ ++    I+ ++      + + G   
Sbjct: 5    APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK 64

Query: 1270 LVIPTCTLKDSGDYSVLVENELGKDRSSCTLTV 1302
            L IP  T  +SG YS+   N  G+  S+  L V
Sbjct: 65   LTIPAVTKANSGRYSLKATNGSGQATSTAELLV 97



 Score = 39.7 bits (91), Expect = 0.019
 Identities = 62/301 (20%), Positives = 101/301 (33%), Gaps = 54/301 (17%)

Query: 1008 ARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKS---KNHSQFLINS 1064
            +R+K++ ++  G  +  H   SG P P + W KDG   K  E           +   I  
Sbjct: 1249 SRIKNYRILE-GMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPV 1307

Query: 1065 TKRSDSGVYRILLQNEFGEARYD--IHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDV 1122
                D G+Y     N  G A     ++V  A     PT +   E V    +L+       
Sbjct: 1308 VLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLS------- 1360

Query: 1123 QEDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLD 1182
                        R  S +    +  R+   + +   + P R           +     L+
Sbjct: 1361 -----------PRSVSRSPIRMSPARMSPARMSPARMSPAR-----------MSPGRRLE 1398

Query: 1183 SRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRP 1242
              D     + Q++ L             + P FV        L GQ        +G P P
Sbjct: 1399 ETD-----ESQLERL-------------YKPVFVLKPVSFKCLEGQTARFDLKVVGRPMP 1440

Query: 1243 -TVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLT 1301
             T   + G   +   +        G  +L+I   T  DSG+++V+ +N  G+   S  LT
Sbjct: 1441 ETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILT 1500

Query: 1302 V 1302
            V
Sbjct: 1501 V 1501



 Score = 39.7 bits (91), Expect = 0.019
 Identities = 42/183 (22%), Positives = 70/183 (38%), Gaps = 14/183 (7%)

Query: 9    MLQEHVSMEFSSSTTHVQTFSQTTKIVGEEVVRRKSSSIVEFFSLVTRSSNIPAG----- 63
            +L E +  E         +   + +  G      + S I E   L++ S   P       
Sbjct: 3585 ILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYPTKFDSEK 3644

Query: 64   -DSVPEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKE 122
              + P F+++        GD A     V G  KP I W   +G+ +  SA   +     +
Sbjct: 3645 EGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFF-NGVLLTPSADYKFVFDGDD 3703

Query: 123  HVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLV-TEGQEKMDFK------KMLKKRAP 175
            H L +     +D   Y C+ASND+   I +  L + ++G+   D +      K L+K   
Sbjct: 3704 HSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGG 3763

Query: 176  PAP 178
            P P
Sbjct: 3764 PCP 3766



 Score = 39.7 bits (91), Expect = 0.019
 Identities = 32/131 (24%), Positives = 52/131 (39%), Gaps = 6/131 (4%)

Query: 52   SLVTRSSNIPAGDSVPEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKES 111
            S V +S     G   P F+++ +P+   +G  A+F   V G   P ++W +E+    +  
Sbjct: 3752 SAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENK---QLC 3808

Query: 112  AKIFYDSI---NKEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKK 168
              ++Y  I   N      +     +DS  Y C A N   ++     LLV      M    
Sbjct: 3809 TSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLLEDTDMTDTP 3868

Query: 169  MLKKRAPPAPK 179
               K  P AP+
Sbjct: 3869 CKAKSTPEAPE 3879



 Score = 39.7 bits (91), Expect = 0.019
 Identities = 49/220 (22%), Positives = 90/220 (40%), Gaps = 24/220 (10%)

Query: 80    EGDKAVFRARVQGNAKPHISWKRE-SGIPIKESAKIFYDSINKEHVLKLEPLTSDDSDNY 138
             EG    F  RV G   P + W+++   + +  + +I ++ ++  + L +     +D+  Y
Sbjct: 25503 EGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLD-YYALHIRDTLPEDTGYY 25561

Query: 139   KCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPKKKQKKVANEKEMLEILS-- 196
             +  A+N          L V    E++ +KK   K      +  QK++     M EILS  
Sbjct: 25562 RVTATNTAGSTSCQAHLQV----ERLRYKKQEFKSKEEHERHVQKQIDKTLRMAEILSGT 25617

Query: 197   ------KVPKKDFEKVCMEY----GFTDFRGLLRKLKEMKKKVEVEAIRILKPLEDKETK 246
                   +V K+   +  + Y         +G  R   E+++K E   +R+   + +    
Sbjct: 25618 ESVPLTQVAKEALREAAVLYKPAVSTKTVKGEFR--LEIEEKKEERKLRMPYDVPEPRKY 25675

Query: 247   VDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSL-GKYD 285
               TT+  D  ++   P   M W K    +R QY + GK D
Sbjct: 25676 KQTTIEEDQRIKQFVPMSDMKWYK---KIRDQYEMPGKLD 25712



 Score = 39.3 bits (90), Expect = 0.025
 Identities = 23/89 (25%), Positives = 38/89 (42%), Gaps = 3/89 (3%)

Query: 618   TVKVGHTAHIKVPFRGKPLPKVTWYKDGMEV---TEEERVSMERGEDQALLTISNCVRED 674
             T  VG      V     P P VTWYK G ++     +++ + E  +    LTI++   +D
Sbjct: 25395 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDD 25454

Query: 675   SGLILLKLKNDHGSATATLHLSVLDRPKP 703
                  +  +N +G  +    L+V   P P
Sbjct: 25455 DAEYTVVARNKYGEDSCKAKLTVTLHPPP 25483



 Score = 38.5 bits (88), Expect = 0.043
 Identities = 28/106 (26%), Positives = 42/106 (39%), Gaps = 1/106 (0%)

Query: 67  PEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHV-L 125
           P F +  Q V   EG  A F A + G   P +SW R+  +    +      S +     L
Sbjct: 6   PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65

Query: 126 KLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLK 171
            +  +T  +S  Y   A+N    A  T  LLV       +F + L+
Sbjct: 66  TIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQ 111



 Score = 38.5 bits (88), Expect = 0.043
 Identities = 32/145 (22%), Positives = 60/145 (41%), Gaps = 10/145 (6%)

Query: 17    EFSSSTTHVQTFSQTTKIVGEEVVRRKSSSIVEFFSLVTRSSNIPAGDSVPEFVEKPQPV 76
             ++   +++ + F +  + V +   RR    I        R+  +   +  PEF       
Sbjct: 25341 DYGEDSSYAELFVKGVREVYDYYCRRTMKKIKR------RTDTMRLLERPPEFTLPLYNK 25394

Query: 77    TAPEGDKAVFRARVQGNAKPHISWKRESGIPIK---ESAKIFYDSINKEHVLKLEPLTSD 133
             TA  G+   F   +  + +PH++W + SG  IK      K  ++S    + L +  +T+D
Sbjct: 25395 TAYVGENVRFGVTITVHPEPHVTWYK-SGQKIKPGDNDKKYTFESDKGLYQLTINSVTTD 25453

Query: 134   DSDNYKCIASNDHADAIYTVSLLVT 158
             D   Y  +A N + +      L VT
Sbjct: 25454 DDAEYTVVARNKYGEDSCKAKLTVT 25478



 Score = 37.7 bits (86), Expect = 0.074
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 81    GDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKLEPLTSDDSDNYKC 140
             G+       V G  +P+ISW ++ G P+K++ ++  +      VL ++    DD   Y  
Sbjct: 18021 GEDLKIEIPVIGRPRPNISWVKD-GEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTV 18079

Query: 141   IASNDHADAIYTVSLLVTE 159
              A+N    A   +S++V E
Sbjct: 18080 TATNSAGTATENLSVIVLE 18098



 Score = 37.4 bits (85), Expect = 0.096
 Identities = 26/98 (26%), Positives = 38/98 (38%), Gaps = 1/98 (1%)

Query: 1210 RHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCT 1269
            +  P  V   +P  VL G+     C   G P+P V  Y     I  + +F      G+  
Sbjct: 1792 KQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRY-DGIHY 1850

Query: 1270 LVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDD 1307
            L I  C   D+G+  V  EN  G       L +  ++D
Sbjct: 1851 LDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQRED 1888



 Score = 37.0 bits (84), Expect = 0.13
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 1029  SGSPPPDVIWQKDG--VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFG 1082
             +G P P  IW KDG  +   G+  +++ K      I+ T  SDSG+Y   ++N  G
Sbjct: 26571 TGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAG 26626



 Score = 35.8 bits (81), Expect = 0.28
 Identities = 25/93 (26%), Positives = 36/93 (38%)

Query: 1210 RHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCT 1269
            R AP     ++P  V  G     TC     P      +K    I  + K    S+  + +
Sbjct: 4526 RAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISS 4585

Query: 1270 LVIPTCTLKDSGDYSVLVENELGKDRSSCTLTV 1302
            L I    + D G+Y+    NE G    + TLTV
Sbjct: 4586 LEILRTQVVDCGEYTCKASNEYGSVSCTATLTV 4618



 Score = 35.4 bits (80), Expect = 0.37
 Identities = 25/90 (27%), Positives = 39/90 (43%), Gaps = 4/90 (4%)

Query: 1014 MVVRAGTALCIHAAFSGSPPPDVIWQKDG----VPTKGRETITKSKNHSQFLINSTKRSD 1069
            +VV  G+     A  SG P P+V W +DG      T     I+ S   ++  I +  +++
Sbjct: 15   VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKAN 74

Query: 1070 SGVYRILLQNEFGEARYDIHVRVADFPRPP 1099
            SG Y +   N  G+A     + V     PP
Sbjct: 75   SGRYSLKATNGSGQATSTAELLVKAETAPP 104



 Score = 35.4 bits (80), Expect = 0.37
 Identities = 31/119 (26%), Positives = 50/119 (42%), Gaps = 4/119 (3%)

Query: 54    VTRSSNIPAGDSVPEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAK 113
             +T  S++P     P F E+ + +       A    +V G+ KP + W R+    I +  K
Sbjct: 24612 ITPKSDVPI--QAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLK 24669

Query: 114   I-FYDSINKEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLK 171
                 +     H L +  +T DD+  Y+  A+N       T SL V E   K+   K L+
Sbjct: 24670 YRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEV-EVPAKIHLPKTLE 24727



 Score = 35.0 bits (79), Expect = 0.48
 Identities = 29/101 (28%), Positives = 41/101 (40%), Gaps = 7/101 (6%)

Query: 1030 GSPPPDVIWQKDG--VPTKGRETITKSKNHS-QFLINSTKRSDSGVYRILLQNEFGEARY 1086
            G P P V W K+   + T    TI  + N S  F++N  +R DSG+Y    +N  GE+  
Sbjct: 3792 GEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTC 3851

Query: 1087 DIHVRV----ADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQ 1123
               + V     D    P   +   E P     T    P V+
Sbjct: 3852 AAELLVLLEDTDMTDTPCKAKSTPEAPEDFPQTPLKGPAVE 3892



 Score = 34.3 bits (77), Expect = 0.82
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 7/95 (7%)

Query: 1016 VRAGTALCIHAAFSGSPPPDVIWQKDG---VPTK-GRETITKSKNHSQFLINSTKRSDSG 1071
            ++ G+ L +    +G+P PD++W K+    VP K  +  I  +K  +   I+ST   DS 
Sbjct: 1521 IKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSA 1580

Query: 1072 VYRILLQNEFGE--ARYDIHVRVADFPRPPTNLRL 1104
             Y     N+ G    R  ++V V +F  P    +L
Sbjct: 1581 WYTATAINKAGRDTTRCKVNVEV-EFAEPEPERKL 1614



 Score = 33.9 bits (76), Expect = 1.1
 Identities = 30/134 (22%), Positives = 62/134 (46%), Gaps = 12/134 (8%)

Query: 296   VISNVNMNDAGIYSLSVGDKR-----MSAELTVLDEPLKFLGEMKPV----KVTERQTAV 346
             VI+N+   +  ++ +   +++      S  + ++ + L    ++KP      V   Q   
Sbjct: 16884 VITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLK 16943

Query: 347   FEIRLS-KKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGN 405
              E+ +S + +P   W  +G  LK+  +  +T S D LT TL IK+    D G++     N
Sbjct: 16944 IEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLD-LT-TLSIKETHKDDGGQYGITVAN 17001

Query: 406   LVQKAQLTIDRIPI 419
             +V +   +I+ + +
Sbjct: 17002 VVGQKTASIEIVTL 17015



 Score = 33.5 bits (75), Expect = 1.4
 Identities = 36/161 (22%), Positives = 65/161 (40%), Gaps = 12/161 (7%)

Query: 973  FRIRAVNEAGVG-EPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGS 1031
            + ++A N +G      EL       PP      +   RL+S M VR G+ + +    +G 
Sbjct: 78   YSLKATNGSGQATSTAELLVKAETAPP------NFVQRLQS-MTVRQGSQVRLQVRVTGI 130

Query: 1032 PPPDVIWQKDGVPTKGR--ETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIH 1089
            P P V + +DG   +      I++  +    LI      DSG Y +   N  G A     
Sbjct: 131  PTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAE 190

Query: 1090 VRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHY 1130
            + V      P   +  + + +T  ++ +    +++  EAH+
Sbjct: 191  LLVQGEEEVPA--KKTKTIVSTAQISESRQTRIEKKIEAHF 229



 Score = 33.1 bits (74), Expect = 1.8
 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 1/69 (1%)

Query: 76    VTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKLEPLTSDDS 135
             V A  GD       V G  KP ++WK+   I +K++ ++ +++     +L +      DS
Sbjct: 14770 VIAKAGDNIKVEIPVLGRPKPTVTWKKGDQI-LKQTQRVNFETTATSTILNINECVRSDS 14828

Query: 136   DNYKCIASN 144
               Y   A N
Sbjct: 14829 GPYPLTARN 14837



 Score = 33.1 bits (74), Expect = 1.8
 Identities = 33/135 (24%), Positives = 53/135 (39%), Gaps = 17/135 (12%)

Query: 26    QTFSQT--TKIVGEEVVRRKSSSIVEFFSLVTR----SSNIPAGD-SVPEFVEKPQ---- 74
             QT+S    +K    EV + K  S++EF          S  +  G  +V E +  P+    
Sbjct: 21202 QTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLS 21261

Query: 75    -----PVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKLEP 129
                   VT   G         +G  KP ISW ++ G+P+KES  + +     +  L ++ 
Sbjct: 21262 DIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKD-GLPLKESEFVRFSKTENKITLSIKN 21320

Query: 130   LTSDDSDNYKCIASN 144
                +    Y  I  N
Sbjct: 21321 AKKEHGGKYTVILDN 21335



 Score = 33.1 bits (74), Expect = 1.8
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 2/44 (4%)

Query: 356   PNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEF 399
             P   WK     LK  D+  IT ++D    TL +KD+   DSG +
Sbjct: 22372 PKVTWKLEEMRLKETDRVSITTTKD--RTTLTVKDSMRGDSGRY 22413



 Score = 32.7 bits (73), Expect = 2.4
 Identities = 64/277 (23%), Positives = 104/277 (37%), Gaps = 48/277 (17%)

Query: 1036 VIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEF---GEARYDIHVRV 1092
            V W KDG   K      K K +             G  RIL+ N+     EA Y   VR 
Sbjct: 6099 VKWFKDGAEIK------KGKKYDII--------SKGAVRILVINKCLLDDEAEYSCEVRT 6144

Query: 1093 ADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYII-MKRDASTATWYTAAERVF- 1150
            A      T L   EE   T  L    + +V E      +  + +  +   WY   E +  
Sbjct: 6145 ARTSGMLTVLE--EEAVFTKNLA---NIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIE 6199

Query: 1151 SNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSR--DTWLINKDQIQDLSAKLKPYEKKD 1208
            + +Y +  L  GRK    V+    + D+   + R   +    K ++ +L+A+        
Sbjct: 6200 TGRYEI--LTEGRKRIL-VIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAE-------- 6248

Query: 1209 WRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVC 1268
                  F++  +   +L G+     C+      P V   + D  + +  K+   +     
Sbjct: 6249 ------FISKPQNLEILEGEKAEFVCSISKESFP-VQWKRDDKTLESGDKYDVIADGKKR 6301

Query: 1269 TLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDK 1305
             LV+   TL+D G Y V+V    G  R++  LTV +K
Sbjct: 6302 VLVVKDATLQDMGTYVVMV----GAARAAAHLTVIEK 6334



 Score = 32.3 bits (72), Expect = 3.1
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 280   SLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSV----GDKRMSAELTVLDEPLKFLGEMK 335
             SL K  ++   +  +L++ NVN  D+G Y L+V    G K     + VLD P    G  +
Sbjct: 15596 SLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTP----GPPQ 15651

Query: 336   PVKVTE 341
              +KV E
Sbjct: 15652 DLKVKE 15657



 Score = 32.0 bits (71), Expect = 4.0
 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 1247 YKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTL 1300
            Y  DV + +N K+   S  G   L +   T +D G+YS +++ +    +++C L
Sbjct: 2254 YHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGK----KTTCKL 2303



 Score = 32.0 bits (71), Expect = 4.0
 Identities = 57/243 (23%), Positives = 90/243 (37%), Gaps = 27/243 (11%)

Query: 1067 RSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDG 1126
            RS+  V+ + L++   E   ++ +   DF    T+  LF + P  V  T        E+G
Sbjct: 5939 RSEGKVHTLTLRDVKLEDAGEVQLTAKDFK---THANLFVKEP-PVEFTKPLEDQTVEEG 5994

Query: 1127 EAHYII--MKRDASTATWY-TAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
                +   + R+ +   W+    E + S KY +     GR      V +  I D  P D 
Sbjct: 5995 ATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVA--DGR------VRKLVIHDCTPEDI 6046

Query: 1184 RDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPT 1243
            +      KD     +  + P   +       F+ PL    V   +     C  L      
Sbjct: 6047 KTYTCDAKDFKTSCNLNVVPPHVE-------FLRPLTDLQVREKEMARFECE-LSRENAK 6098

Query: 1244 VTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVY 1303
            V  +K    I    K+   S   V  LVI  C L D  +YS     E+   R+S  LTV 
Sbjct: 6099 VKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSC----EVRTARTSGMLTVL 6154

Query: 1304 DKD 1306
            +++
Sbjct: 6155 EEE 6157



 Score = 32.0 bits (71), Expect = 4.0
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 11/70 (15%)

Query: 262   PNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAEL 321
             PNV  +W K    LR +  +   D     ++  L I N N ND+G Y+L++ +   +A L
Sbjct: 19911 PNV--LWSKPDTDLRTRAYVDTTD-----SRTSLTIENANRNDSGKYTLTIQNVLSAASL 19963

Query: 322   T----VLDEP 327
             T    VLD P
Sbjct: 19964 TLVVKVLDTP 19973



 Score = 32.0 bits (71), Expect = 4.0
 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 9/70 (12%)

Query: 262   PNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSV----GDKRM 317
             P    +W K    L +     + D+    +   L + N N NDAG Y+L+V    G K +
Sbjct: 22080 PTPTAVWSKPDSNLSL-----RADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSI 22134

Query: 318   SAELTVLDEP 327
             +  + VLD P
Sbjct: 22135 TFTVKVLDTP 22144



 Score = 31.6 bits (70), Expect = 5.3
 Identities = 33/129 (25%), Positives = 54/129 (41%), Gaps = 11/129 (8%)

Query: 224   EMKKKVEVEAIRI-LKPLEDKETKVDTTVVFDCIME-LKDPNVKMIWIKGTEPLRIQYSL 281
             E ++K+   ++ + +K +E    K  TTV F  I+  +  P  K  W      ++     
Sbjct: 11195 ECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAK--WTTDGSEIKTDEH- 11251

Query: 282   GKYDVKQMGTKYMLVISNVNMNDAGIYSLSV----GDKRMSAELTVLDEPLKFLGEMKPV 337
               Y V+      +L I N    D G Y ++V    G K ++  LTVLD P    G +  +
Sbjct: 11252 --YTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINIL 11309

Query: 338   KVTERQTAV 346
              VT     +
Sbjct: 11310 DVTPEHMTI 11318



 Score = 31.2 bits (69), Expect = 6.9
 Identities = 19/84 (22%), Positives = 37/84 (44%), Gaps = 4/84 (4%)

Query: 1012 SHMVVRAGTALCIHAAFSGSPPPDVIWQKDGV---PTKGRETITKSKNHSQFLINSTKRS 1068
            S+  +  G    +     G P P + W  +GV   P+   + +    +HS  +I  TK  
Sbjct: 3656 SNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHS-LIILFTKLE 3714

Query: 1069 DSGVYRILLQNEFGEARYDIHVRV 1092
            D G Y  +  N++G+     ++++
Sbjct: 3715 DEGEYTCMASNDYGKTICSAYLKI 3738



 Score = 30.8 bits (68), Expect = 9.0
 Identities = 26/82 (31%), Positives = 39/82 (47%), Gaps = 5/82 (6%)

Query: 277 IQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSL----SVGDKRMSAELTVLDEPLKFLG 332
           IQ SL  + + Q G  Y L+I+     D+G YS+    SVG    +AEL V  E      
Sbjct: 144 IQSSLD-FQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAK 202

Query: 333 EMKPVKVTERQTAVFEIRLSKK 354
           + K +  T + +   + R+ KK
Sbjct: 203 KTKTIVSTAQISESRQTRIEKK 224


>gi|110349713 titin isoform novex-1 [Homo sapiens]
          Length = 27051

 Score =  423 bits (1087), Expect = e-118
 Identities = 299/1086 (27%), Positives = 497/1086 (45%), Gaps = 54/1086 (4%)

Query: 121  KEHVLKLEPLTSDDSDNYKCIASNDHADAIYTV------------SLLVTEGQEKMDFKK 168
            ++ +L ++    +D+ NY C   +   D    V            +L + EG EK +F  
Sbjct: 6143 RKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEG-EKAEFVC 6201

Query: 169  MLKKRAPPAPKKKQKKVANEKEMLEILSKVPKKDF---EKVCMEYG-FTDFRGLLRKLKE 224
             + K + P   K+  K     +  ++++   K+     +    + G +    G  R    
Sbjct: 6202 SISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAH 6261

Query: 225  MKKKVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKY 284
            +     +E +RI+ PL+D   K    VVF+C  E+     K  W +  E +   +   KY
Sbjct: 6262 L---TVIEKLRIVVPLKDTRVKEQQEVVFNC--EVNTEGAKAKWFRNEEAI---FDSSKY 6313

Query: 285  DVKQMGTKYMLVISNVNMNDAGIYSLSVGDKR-----MSAELTVLDEPLKFLGEMKPVKV 339
             + Q    Y L I + +++D   Y++S+ + R      +A L V +E L+ +  +K ++ 
Sbjct: 6314 IILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIET 6373

Query: 340  TERQTAVFEIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEF 399
             E+++  F  ++++      W  NG+E+  D++    V  D   H L IKD    D GE+
Sbjct: 6374 MEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRV--DKYKHMLTIKDCGFPDEGEY 6431

Query: 400  SAEAGNLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLM 459
               AG     A+L I   P +FV +L++  V E   A   C+L+ +   ++W ++G+ + 
Sbjct: 6432 IVTAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIK 6491

Query: 460  HGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSG 519
             G KY    +G    LII+D +L D  EY    ++D       S A + VEE    +   
Sbjct: 6492 EGKKYKFEKDGSIHRLIIKDCRLDDECEYAC-GVEDRK-----SRARLFVEEIPVEIIRP 6545

Query: 520  MSDVHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEH 579
              D+  A G+       LN +KVE  WL++   +      Q++ +G +H+L    + P  
Sbjct: 6546 PQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRD 6605

Query: 580  EGKYTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKV 639
            +G+Y F AK  E+ A + +A  P I        A   + V VG    + VP+   P  + 
Sbjct: 6606 QGEYRFIAKDKEARAKLELAAAPKIKT------ADQDLVVDVGKPLTMVVPYDAYPKAEA 6659

Query: 640  TWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLD 699
             W+K+   ++ +   +++   +Q    I    + D G   + L+N HG A   ++L V+D
Sbjct: 6660 EWFKENEPLSTK---TIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVID 6716

Query: 700  RPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVT 759
             P P +  +E  E     V + W+ P  +GG  +  ++VERR + +K+W+   +      
Sbjct: 6717 VPGPVRN-LEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDRAESCE 6775

Query: 760  NFSTNKVEEGKAYQFRILAVNSEGVSDPLETEE-VFAGNPIEPPGFASQPQVTDVTKEAV 818
               T   + G  Y FR+ A N  G  +P+ET+  V A +  + PG      +TDV +  V
Sbjct: 6776 FTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGV 6835

Query: 819  TITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIA 878
            ++TW  P  DGGA +  Y++E R K S  W        +    TV  ++E  EY FRV A
Sbjct: 6836 SLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRA 6895

Query: 879  VNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYI 936
             N+ G G+PS  +  V   DP++ P    +L  SD + SS+ L W  P +  G P  GYI
Sbjct: 6896 QNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYI 6955

Query: 937  LEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAM 996
            +E   E    W +C    +    Y V GL +  KY +R+ A N+AGV +P E+   + A 
Sbjct: 6956 IERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTAD 7015

Query: 997  PPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIW--QKDGVPTKGRETITKS 1054
                 P  DLSA  K  + V     + I    +G P P   W      + T  R  +   
Sbjct: 7016 DAFVEPTMDLSA-FKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTL 7074

Query: 1055 KNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTL 1114
              +++ +I+ ++RSD G+Y + L+N       +I V V   P  P  L+  +   ++V L
Sbjct: 7075 SAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHL 7134

Query: 1115 TWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNE 1174
            TW    D        Y++ KR+ S  TW    + V   ++TV  L+ G++Y F+V ARN+
Sbjct: 7135 TWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNK 7194

Query: 1175 IGDSEP 1180
             G  EP
Sbjct: 7195 CGPGEP 7200



 Score =  380 bits (977), Expect = e-105
 Identities = 300/1056 (28%), Positives = 483/1056 (45%), Gaps = 93/1056 (8%)

Query: 288   QMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVF 347
             +MG KY   ++ VN+     YS S+ +      + + D  L+   ++K   VT R  A  
Sbjct: 23036 KMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPD--LELADDLKKT-VTIRAGASL 23092

Query: 348   EIRLS---KKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKD-ARLSDSGEFSAEA 403
              + +S   +  P   W   G +L      + T S     ++L I D     D+G+++ EA
Sbjct: 23093 RLMVSVSGRPPPVITWSKQGIDLASRAIIDTTES-----YSLLIVDKVNRYDAGKYTIEA 23147

Query: 404   GNLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWK---KDGQLLMH 460
              N   K   T+            +V+VKE SR           VT+ W+    DG   ++
Sbjct: 23148 ENQSGKKSATVLVKVYDTPGPCPSVKVKEVSR---------DSVTITWEIPTIDGGAPVN 23198

Query: 461   GTKYSMNHEGKRA---------ELIIEDAQLSDGGEYTVVAMQD-----GDPTEYYSTAI 506
                        RA         + +   + L +G  Y    + +     G+P E  S A+
Sbjct: 23199 NYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCE-TSDAV 23257

Query: 507   VTVEERLATVKSGMSDVHAATGSPA-ELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQG 565
             +  E  L   K  + DV  +T + A E  +     ++ G  L+  K  T+     +  + 
Sbjct: 23258 LVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKP 23317

Query: 566   AVHKLIFPSMGPEHEGKYTFRAKG-------TESEASVFIAD---PPTIDPSVLEALAAH 615
              V +    S+    +  +  RA+         E+  +V + D    PTID S +     H
Sbjct: 23318 TVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLRVLPTIDLSTMPQKTIH 23377

Query: 616   AITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDS 675
                V  G    + +P  G+P P  +W+  G ++ E ERV++E     A LTI      D+
Sbjct: 23378 ---VPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDT 23434

Query: 676   GLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQ 735
             G   L+LKN  G+ + T+ + +LD+P PP G ++  E+  + + + W+ P+ +GG P++ 
Sbjct: 23435 GEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPELDGGAPLSG 23494

Query: 736   FIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFA 795
             ++VE+R   +  W+ + E   + T F   ++ EG  Y FR+ A N  G+   L++E +  
Sbjct: 23495 YVVEQRDAHRPGWLPVSESVTRST-FKFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIEC 23553

Query: 796   GNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDP 855
              + I  PG     Q+ DV+++ +T+TW  P  DGG+ V GYIVER++  ++ WV VNK P
Sbjct: 23554 RSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVP 23613

Query: 856   IQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSS 915
             +  T+    GL E  EYE RV A+N  G G+PS PS  +VA DP+ PPG  Q+  V+D++
Sbjct: 23614 VTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTT 23673

Query: 916   NSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFF 973
              +S+SLAW  P +  G   +GY++EM+  D  EW+KC   P     YT+  L +  +Y F
Sbjct: 23674 RTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREYTLTHLPQGAEYRF 23733

Query: 974   RIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPP 1033
             R+ A N  G GEP E+   V+       P ++L  R +  + VR G  + +     G P 
Sbjct: 23734 RVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPF 23793

Query: 1034  PDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVA 1093
             P   W K+G     R  I  S+ H++ +I    R DSG Y ++L+N+ G+    I VRV 
Sbjct: 23794 PICKWTKEGQDISKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVI 23853

Query: 1094  DFPRPPTNLRLFEEVP-NTVTLTWNHSPDVQEDGEAH---YIIMKRDASTATWYTAAERV 1149
               P  P     ++++   +V ++W    D   DG A    YI+ +R+   A WYT   RV
Sbjct: 23854 GSPNSPEGPLEYDDIQVRSVRVSWRPPAD---DGGADILGYILERREVPKAAWYTIDSRV 23910

Query: 1150  FSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDW 1209
                   V GL    +Y+FRV A N+ G S+PL S +                 P   K  
Sbjct: 23911 RGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEE-----------------PVTPKTP 23953

Query: 1210  RHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRP------TVTLYKGDVNITANSKFWYNS 1263
              + P    P  P  VL   D T +   L   RP       VT Y  +   T+  K+  ++
Sbjct: 23954 LNPPE--PPSNPPEVL---DVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHN 24008

Query: 1264  TSGVCTLVIPTCTLKDSGDYS--VLVENELGKDRSS 1297
              + + T +     L    +Y   ++ +N++G   +S
Sbjct: 24009 KTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETS 24044



 Score =  377 bits (967), Expect = e-104
 Identities = 245/766 (31%), Positives = 380/766 (49%), Gaps = 52/766 (6%)

Query: 448   TLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIV 507
             +L W K    L+  T+Y      +  E       L+  G     +     PTEY      
Sbjct: 12763 SLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAG-----SSPPSKPTEY------ 12811

Query: 508   TVEERLATVKSGMSDVHAATGSPAELCVVL----NDEKVEGVWLKDGKEITDLPGMQIVK 563
              V  R+     G  +V   T S   L           K+ G ++    E   LPG + V+
Sbjct: 12812 -VTARMPVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFV----EACKLPGDKWVR 12866

Query: 564   -QGAVHKLI---FPSMGPEHEGKYTFRA----------KGTESEASVFIAD--PPTIDPS 607
                A H++    + + G E + +Y FRA              S+    +A+  PP ID S
Sbjct: 12867 CNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLS 12926

Query: 608   VLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTI 667
             V        +TVK G    +     GKP+P V+W KDG  +   E + M    +   L +
Sbjct: 12927 VA---MKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLEL 12983

Query: 668   SNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKD 727
              +  R+DSG   +  +N  GS +AT+ L VLD+P PP   V+  ++      + W+ P +
Sbjct: 12984 FSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPAS-VKINKMYSDRAMLSWEPPLE 13042

Query: 728   NGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDP 787
             +GG  +T +IV++R   + +W ++      +T+ S  K+ EG  YQFRI A N  GV DP
Sbjct: 13043 DGGSEITNYIVDKRETSRPNWAQVSATV-PITSCSVEKLIEGHEYQFRICAENKYGVGDP 13101

Query: 788   LETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNL 847
             + TE   A NP +PPG    P ++++TK+ +T++W  P  DGG+P+ GY++E+R+  +  
Sbjct: 13102 VFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVN 13161

Query: 848   WVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQ 907
             W  VN+ PI        GL E TEYEFRV A+NKAGPG+PS  S +  A+DP  PPG   
Sbjct: 13162 WTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGPPA 13221

Query: 908   DLHVSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIP--ISGTCYTVG 963
                V D++ SS+SL+W +PA   G P  GY++E++  D+  W +C  +P  +  T + V 
Sbjct: 13222 FPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRC-NLPQNLQKTRFEVT 13280

Query: 964   GLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALC 1023
             GL+E  +Y FR+ AVN+ G  +P ++            P+ +L A L+  +++RAG  + 
Sbjct: 13281 GLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTMR 13340

Query: 1024  IHAAFSGSPPPDVIWQKDGVPTKGRETI-TKSKNHSQFL-INSTKRSDSGVYRILLQNEF 1081
             ++    G PPP + W K  V  + R  +  KS +   FL   +  + D+G Y + L+N  
Sbjct: 13341 LYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSC 13400

Query: 1082  GEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDAST 1139
             G+  Y I V+V D P PP N+ + E   ++  +TW   P + + G    +Y++ KRDA  
Sbjct: 13401 GKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTW--EPPIIDGGSPIINYVVQKRDAER 13458

Query: 1140  ATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRD 1185
              +W T         + V  L  G+ Y+FRV A NE G  +P ++RD
Sbjct: 13459 KSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGETRD 13504



 Score =  372 bits (954), Expect = e-102
 Identities = 280/973 (28%), Positives = 457/973 (46%), Gaps = 72/973 (7%)

Query: 262   PNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSL----SVGDKRM 317
             P   + W+K  EPL+      + +V++  T  +L I   N +D G Y++    S G    
Sbjct: 17967 PRPNISWVKDGEPLK---QTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATE 18023

Query: 318   SAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVW--KFNGKELKRDDKYEI 375
             +  + VL++P   +G   PV+  E  +A F + +S + P +    + +   +++ D    
Sbjct: 18024 NLSVIVLEKPGPPVG---PVRFDE-VSADFVV-ISWEPPAYTGGCQISNYIVEKRDTTTT 18078

Query: 376   T---VSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKA-----QLTIDRIPIK------- 420
             T   VS      T+KI   +     +F   A N   K+     +  I + P K       
Sbjct: 18079 TWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGT 18138

Query: 421   -FVSNLKNVR--------VKERSRACLECELTSKDV-TLRWKKDGQLLMHGTKYSMN--H 468
              FV+++   +        V +     +   L  K+  ++ W K  +  +  TK+      
Sbjct: 18139 PFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLD 18198

Query: 469   EGKRAELIIEDAQLSDGGEYT-----VVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDV 523
             EG   E  +    +   G+ +      VA    DP       ++T        K    D 
Sbjct: 18199 EGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKKPAYD- 18257

Query: 524   HAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVH--KLIFPSMGPEHEG 581
                 GS     +V   +  +G W+K     T++   +    G V   +  F  +     G
Sbjct: 18258 ---GGSKITGYIVEKKDLPDGRWMK--ASFTNVLETEFTVSGLVEDQRYEFRVIARNAAG 18312

Query: 582   KYTFRAKGTESEASVFIADPP--TIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKV 639
              ++  +  + +  +    D P  ++DP   + +  HA     G T  ++   RGKP+P V
Sbjct: 18313 NFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHA-----GETFVLEADIRGKPIPDV 18367

Query: 640   TWYKDGMEVTEEE-RVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVL 698
              W KDG E+ E   R+ ++    +  L + +C+R D G  +LKL N  G+ +  + + VL
Sbjct: 18368 VWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVL 18427

Query: 699   DRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKV 758
             DRP PP+G ++   ++    ++ W  P  +GG  ++ +I+E+R   + SW ++   + + 
Sbjct: 18428 DRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVS-TEVQA 18486

Query: 759   TNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAV 818
              N+   K+  G  Y FR++AVN  G+ +PLE+  V A NP +PPG  S P+V+ +TK+++
Sbjct: 18487 LNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSM 18546

Query: 819   TITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIA 878
              +TW  P  DGG  + GYI+E+R K    W   NK  +   +  V GL E   YEFRV A
Sbjct: 18547 VVTWARPVDDGGTEIEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAA 18606

Query: 879   VNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDPPSGYI 936
              N AG G+PS PS    A D + PPG   +  V+D+S SS+SLAW +P    G P  GY+
Sbjct: 18607 ENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYV 18666

Query: 937   LEMRAEDTKEWSKCT-KIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRA 995
             +E++     EW+ CT    + G  +TV  L E  +Y FRI A+N  GVGEP  L   V A
Sbjct: 18667 VEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVA 18726

Query: 996   MPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQK-DGVPTKGRETITKS 1054
                   P+ +L A L+  +V+RA   L +     G P P+V W+K +G+ T  R  I  +
Sbjct: 18727 QERIEPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT-DRAQIEVT 18785

Query: 1055  KNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTL 1114
              + +  +I++  R DSG Y + L+N  G     ++VRV D P  P NL + E   ++VTL
Sbjct: 18786 SSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTL 18845

Query: 1115  TWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVAR 1172
             +W   P + + G    +YI+ KR+ +   + T         + +  L  G  YYFRV+A 
Sbjct: 18846 SW--EPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKTTFRIENLQEGCSYYFRVLAS 18903

Query: 1173  NEIGDSEPLDSRD 1185
             NE G   P ++ +
Sbjct: 18904 NEYGIGLPAETTE 18916



 Score =  369 bits (946), Expect = e-101
 Identities = 203/577 (35%), Positives = 321/577 (55%), Gaps = 11/577 (1%)

Query: 617   ITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSG 676
             +  + G +  ++    GKP P + WYKD  E+     V +E   D A + I +  R +SG
Sbjct: 20510 VKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSG 20569

Query: 677   LILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQF 736
                LKL+N  GSA+AT+ + +LD+P PP G +EF  ++   + + W+ P D+GG  +T +
Sbjct: 20570 CYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHY 20629

Query: 737   IVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAG 796
             IVE+R   +  W  + E   +    +T K+ +G  Y FR+ AVN  G+ +PLE++ V A 
Sbjct: 20630 IVEKRETSRVVWSMVSEHLEECI-ITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAK 20688

Query: 797   NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
             N    PG    P+VT +TK ++T+ W+ P  DGG+ + GY +E+R K S  W  V K+ I
Sbjct: 20689 NAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETI 20748

Query: 857   QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
             + T+  V GL E+++Y++RV AVN AG G  S PS    A DP+ PPG    + ++DS+ 
Sbjct: 20749 RDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTK 20808

Query: 917   SSISLAWREPA--EGDPPSGYILEMRAEDTKEWSK-CTKIPISGTCYTVGGLIERQKYFF 973
             SSI+L W +P    G   +GY++E+R  + +EW+   TK  +  T Y V  L     Y+F
Sbjct: 20809 SSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYF 20868

Query: 974   RIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPP 1033
             R+ AVN AG GEP+E+++ V+A     AP+ DL   L++ ++ +AG  + +   F G PP
Sbjct: 20869 RVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPP 20928

Query: 1034  PDVIWQKD--GVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYD-IHV 1090
             P V W+KD   + +  R +I  + + S   I    R+D+G Y + ++N  GE +   + V
Sbjct: 20929 PTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSV 20988

Query: 1091  RVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAER 1148
             +V D P     L++      TVTL W+  P + + G    +Y+I KRDA+  TW   + +
Sbjct: 20989 KVLDTPAACQKLQVKHVSRGTVTLLWD--PPLIDGGSPIINYVIEKRDATKRTWSVVSHK 21046

Query: 1149  VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRD 1185
               S  + +  L     ++FRV+A NEIG  EP ++ +
Sbjct: 21047 CSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTE 21083



 Score =  361 bits (927), Expect = 2e-99
 Identities = 200/602 (33%), Positives = 315/602 (52%), Gaps = 12/602 (1%)

Query: 590   TESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVT 649
             +ES   + + D       +++      I VK G    I     G+PLP ++W KDG+E+ 
Sbjct: 19400 SESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIE 19459

Query: 650   EEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVE 709
             E  R  +   ++  LLT+ +C+R D+G  +L LKN  G+ +  ++  VLD+P PP G +E
Sbjct: 19460 ERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLE 19519

Query: 710   FLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEG 769
                L+     + W  P+++GG  +  +IVE+R     +W  I E + ++T+    K+ +G
Sbjct: 19520 INGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWT-ICEGELQMTSCKVTKLLKG 19578

Query: 770   KAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDG 829
               Y FR+  VN  GV +PLE+  + A +P   P   +  ++T VTKE++T+ W+ P  DG
Sbjct: 19579 NEYIFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDG 19638

Query: 830   GAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSV 889
             G+ + GYI+ERR+K S  WV VNK P+   +    GL E  EYE+RV A N AG   PS 
Sbjct: 19639 GSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSE 19698

Query: 890   PSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEW 947
              S  + A+DPV  P       + DS  ++I++AW +P    G P +GY +E +  D  +W
Sbjct: 19699 TSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDW 19758

Query: 948   SKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLS 1007
              K +   + GT YT+ GL    +Y FR+++VN+ G  +P +      A      P FD+ 
Sbjct: 19759 -KTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDID 19817

Query: 1008  ARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKR 1067
             + ++  ++V+AG +  +   F G P P+V+W K     + R  +  + + +   I +  R
Sbjct: 19818 SEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRTSLTIENANR 19877

Query: 1068  SDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQE-DG 1126
             +DSG Y + +QN    A   + V+V D P PPTN+ + +    +  L+W    DV E DG
Sbjct: 19878 NDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSW----DVPENDG 19933

Query: 1127  EA---HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
              A   +Y I KR+AS   W +         Y VT L  G  YYFRV   NE G   P ++
Sbjct: 19934 GAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAET 19993

Query: 1184  RD 1185
             ++
Sbjct: 19994 KE 19995



 Score =  358 bits (918), Expect = 2e-98
 Identities = 222/650 (34%), Positives = 334/650 (51%), Gaps = 19/650 (2%)

Query: 552   EITDLPGMQIVKQGAVH--KLIFPSMGPEHEGKYTFR--AKGT--------ESEASVFIA 599
             E  DLP    +K   V+  +  F        GKY FR  AK T        ES  ++   
Sbjct: 13939 EKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICK 13998

Query: 600   DPPTIDPSVLEALAAHAITVKVGHTAHIK-VPFRGKPLPKVTWYKDGMEVTEEERVSMER 658
             D       VL+      +T+K G T  +  +   GKPLPK +W K G ++   +   +  
Sbjct: 13999 DEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITS 14058

Query: 659   GEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCV 718
                 ++LTI    R+D+G   +   N  G+    + ++VLD P PP G VE   +S    
Sbjct: 14059 TPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPP-GPVEISNVSAEKA 14117

Query: 719   HMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILA 778
              + W  P ++GG P+  +I+E+R   +  W  + E D +       K+ +G  Y FR+ A
Sbjct: 14118 TLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSE-DIQSCRHVATKLIQGNEYIFRVSA 14176

Query: 779   VNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIV 838
             VN  G  +P+++E V   +   PPG   +P+V++VTK   T++W  P  DGG+ + GY V
Sbjct: 14177 VNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHV 14236

Query: 839   ERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKD 898
             ERR+K S  WV   K P+   +C V GL E + YEFRV A N+AG G PS  S SV+ KD
Sbjct: 14237 ERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKD 14296

Query: 899   PVKPPGLVQDLHVSDSSNSSISLAWREP--AEGDPPSGYILEMRAEDTKEWSK-CTKIPI 955
                PPG   + HV+D++  S SLAW +P    G   +GY++E +    + W K  T   +
Sbjct: 14297 AAYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTAL 14356

Query: 956   SGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMV 1015
               T + V  L  ++KY FRI A+N+AGVGEP  +   V  +    AP F+L A L+  +V
Sbjct: 14357 RITQFVVPDLQTKEKYNFRISAINDAGVGEPAVI-PDVEIVEREMAPDFELDAELRRTLV 14415

Query: 1016  VRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRI 1075
             VRAG ++ I     G P P+V W KD +  K R  I  +++ +  +I    R D+G + +
Sbjct: 14416 VRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESFTLLIIPECNRYDTGKFVM 14475

Query: 1076  LLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKR 1135
              ++N  G+    ++VRV D P P  NLR  +   ++VTL W+           +YI+ KR
Sbjct: 14476 TIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKR 14535

Query: 1136  DASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRD 1185
             +A+  ++ TA  +     Y VTGL  G +Y+FRV+A NE G  EP ++ +
Sbjct: 14536 EATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTE 14585



 Score =  355 bits (910), Expect = 2e-97
 Identities = 278/985 (28%), Positives = 444/985 (45%), Gaps = 97/985 (9%)

Query: 262   PNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSV----GDKRM 317
             P   + W K   PL+    +   D   + T   L I   + +D G Y ++V    G K  
Sbjct: 16885 PKPTITWTKDGLPLKQTTRINVTDSLDLTT---LSIKETHKDDGGQYGITVANVVGQKTA 16941

Query: 318   SAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVWKF---NGKELKRDDKYE 374
             S E+  LD+P    G   PVK  +   +   I LS   P +       N    KRD    
Sbjct: 16942 SIEIVTLDKPDPPKG---PVKFDD--VSAESITLSWNPPLYTGGCQITNYIVQKRDTTTT 16996

Query: 375   I--TVSEDGLTHTLKIKDARLSDSGEFSAEAGNLV-QKAQLTIDRIPIKF---------- 421
             +   VS      TLK+   +     +F   A N   Q   L  D I  ++          
Sbjct: 16997 VWDVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGT 17056

Query: 422   -----VSNLKNV-----RVKERSRACLECELTSKDV-TLRWKKDGQLLMHGTKYSMNHEG 470
                  +S    V      V       +   L  K+  ++ W K  + ++H T++   +  
Sbjct: 17057 PFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQN-- 17114

Query: 471   KRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMS-DVHAATGS 529
                        L +G EY             Y+  IV V +     +  ++ D     G+
Sbjct: 17115 -----------LEEGIEYEF---------RVYAENIVGVGKASKNSECYVARDPCDPPGT 17154

Query: 530   PAELCVVLNDEKVEGVWLKD----GKEIT-------DLPGMQIVKQGAVHKLI--FPSMG 576
             P  + V  N+  ++  W K     G  IT       DLP  + +K    + +   F   G
Sbjct: 17155 PEPIMVKRNEITLQ--WTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSG 17212

Query: 577   PEHEGKYTFR----------AKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAH 626
                + +Y FR          +K ++S   +   D   +    ++      I V  G T  
Sbjct: 17213 LTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFR 17272

Query: 627   IKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDH 686
             ++    GKPLP + W +   E+ E  R  ++  + +ALL + + +R D G  +L+  N  
Sbjct: 17273 LEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVA 17332

Query: 687   GSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKK 746
             GS +  +++ VLDRP PP+G V+   ++     + W  P  +GG  ++ ++VE+R   + 
Sbjct: 17333 GSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRL 17392

Query: 747   SWIKIGEVDGKVTN-FSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFA 805
             +W  +      VTN     K+ EG  Y FRI+AVN  GV +PLE+  V   NP   PG  
Sbjct: 17393 AWTVVASE--VVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPP 17450

Query: 806   SQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDG 865
                +VT++ K+++T+ WN P  DGG+ ++GYIVE+R +    W+  NK  I   +  V G
Sbjct: 17451 KSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTG 17510

Query: 866   LLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWRE 925
             L ED EYEFRV A N AG G+PS  +    A DPV  PG   + H+ D++ +SI+LAW +
Sbjct: 17511 LTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGK 17570

Query: 926   PA--EGDPPSGYILEMRAEDTKEWSKCT-KIPISGTCYTVGGLIERQKYFFRIRAVNEAG 982
             P    G    GY++E+   D +EW   T +  +  T + +  L E Q+Y  R+ A+N+ G
Sbjct: 17571 PIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVG 17630

Query: 983   VGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDG 1042
             +GE   +   V+      AP+ DL + L+  +VVRAG +  IH  F G P P++ W ++ 
Sbjct: 17631 LGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREE 17690

Query: 1043  VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNL 1102
                  +  I K  N++Q  I++  R+D+G Y + L+N  G     + V+V D P PP NL
Sbjct: 17691 GEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNL 17750

Query: 1103  RLFEEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLL 1160
              + E   ++  L W   P + + G    +Y+I KR+++   +   + +     + V  L 
Sbjct: 17751 AVKEVRKDSAFLVW--EPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKTSFKVENLT 17808

Query: 1161  PGRKYYFRVVARNEIGDSEPLDSRD 1185
              G  YYFRV+A NE G   P+++ D
Sbjct: 17809 EGAIYYFRVMAENEFGVGVPVETVD 17833



 Score =  352 bits (902), Expect = 2e-96
 Identities = 208/628 (33%), Positives = 317/628 (50%), Gaps = 22/628 (3%)

Query: 580   EGK-YTFRA-------KGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPF 631
             EGK YTFR        +GT SE +V   D        L+ L       K      +K+P 
Sbjct: 13575 EGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPI 13634

Query: 632   RGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATA 691
             +GKP P V+W K    +  + RVS+E       L + +C + D+G   + LKN  G+   
Sbjct: 13635 KGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEG 13694

Query: 692   TLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKI 751
             T+ + V+ +P  P G ++F E++   + +KW  PKD+GG  +T +I+E+R      W+  
Sbjct: 13695 TISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTC 13754

Query: 752   GEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVT 811
                  K T F   ++ EG  Y FR+ A N  GV + L++E + A +P + P     P + 
Sbjct: 13755 ASAVQKTT-FRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIV 13813

Query: 812   DVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTE 871
             DV  ++V++TW  P + GG+P+ GY +E +++ S LW   NK PI+     V GL E  E
Sbjct: 13814 DVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLE 13873

Query: 872   YEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EG 929
             YEFRV+A+N AG G+PS+PS  VVA DP+ PPG  + +++   + +S++L W EP    G
Sbjct: 13874 YEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINI---TRNSVTLIWTEPKYDGG 13930

Query: 930   DPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAG-VGEPVE 988
                +GYI+E R   +K W K   + +    +TV  L+E  KY FRIRA N AG +  P E
Sbjct: 13931 HKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSE 13990

Query: 989   LDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHA-AFSGSPPPDVIWQKDGVPTKG 1047
               + +       AP   L   +K  + ++AG  + ++A +  G P P   W K G   + 
Sbjct: 13991 STETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRP 14050

Query: 1048  RE--TITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLF 1105
              +   IT +   S   I    R D+G Y I   N FG     + V V D P PP  + + 
Sbjct: 14051 SDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPPGPVEIS 14110

Query: 1106  EEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGR 1163
                    TLTW  +P +++ G     YI+ KR+ S   W   +E + S ++  T L+ G 
Sbjct: 14111 NVSAEKATLTW--TPPLEDGGSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKLIQGN 14168

Query: 1164  KYYFRVVARNEIGDSEPLDSRDTWLINK 1191
             +Y FRV A N  G  EP+ S    ++++
Sbjct: 14169 EYIFRVSAVNHYGKGEPVQSEPVKMVDR 14196



 Score =  352 bits (902), Expect = 2e-96
 Identities = 217/667 (32%), Positives = 334/667 (50%), Gaps = 19/667 (2%)

Query: 528   GSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAV--HKLIFPSMGPEHEGKYTF 585
             GS     +V   E  EG W+K     T++        G V  H+  F  +     G ++ 
Sbjct: 16095 GSKITGYIVEKKELPEGRWMK--ASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSE 16152

Query: 586   RAKGTESEASVFIADPPTI--DPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYK 643
              ++ T +  +    DPP I  DP   + +  HA     G +  +     GKP+P + W K
Sbjct: 16153 PSESTGAITARDEVDPPRISMDPKYKDTIVVHA-----GESFKVDADIYGKPIPTIQWIK 16207

Query: 644   DGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKP 703
                E++   R+ ++  +    L++ + VR DSG  +LK KN  G  + T+++ VLDRP P
Sbjct: 16208 GDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGP 16267

Query: 704   PQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFST 763
             P+G V    ++     + WK P  +GG  +  +IVERR   +  W  + + + +  +   
Sbjct: 16268 PEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVV-DANVQTLSCKV 16326

Query: 764   NKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWN 823
              K+ EG  Y FRI+AVN  GV +PLE+E V A NP   P     P+VT VTK+++ + W 
Sbjct: 16327 TKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWE 16386

Query: 824   APTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAG 883
              P  DGG+ +LGY++E+R K    W   +K  I   +  V GL+E+ +YEFRV A N AG
Sbjct: 16387 RPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAG 16446

Query: 884   PGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDPPSGYILEMRA 941
               +PS PS+   A DP+  PG   +  V D + SS+ L+W +P    G    GYI+E   
Sbjct: 16447 LSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCD 16506

Query: 942   EDTKEWSKCT-KIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPA 1000
                 EW+ CT    I+ T   V  L+E+ +Y FRI A+N+AGVGE  ++   +       
Sbjct: 16507 VSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLE 16566

Query: 1001  APKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQF 1060
             AP  DL   L+  + +RAG +L +     G P P+V W K     +    I  + + +  
Sbjct: 16567 APDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTSL 16626

Query: 1061  LINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSP 1120
             ++++  R DSG Y + L+N  G     + VRV D P PP NL++ E   ++V++TW   P
Sbjct: 16627 VLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITW--EP 16684

Query: 1121  DVQEDGE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDS 1178
              + + G    +YI+ KR+A+  ++         N + +  L  G  YYFRV A NE G  
Sbjct: 16685 PLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIG 16744

Query: 1179  EPLDSRD 1185
              P  + D
Sbjct: 16745 LPAQTAD 16751



 Score =  351 bits (901), Expect = 2e-96
 Identities = 205/589 (34%), Positives = 309/589 (52%), Gaps = 19/589 (3%)

Query: 608   VLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKD--GMEVTEEERVSMERGEDQALL 665
             VL+   +  +TVK G T  ++   RGKP P+V W KD    ++T   RV ++   D +  
Sbjct: 11830 VLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKF 11889

Query: 666   TISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAP 725
             +++   R D G  ++   N  GS  A   ++VLD+P P +  ++ +++S     + W  P
Sbjct: 11890 SLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRN-LKIVDVSSDRCTVCWDPP 11948

Query: 726   KDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVS 785
             +D+GG  +  +I+E+    +  W             +  ++ EG  Y FR+ A N  G  
Sbjct: 11949 EDDGGCEIQNYILEKCETKRMVWSTYSATV-LTPGTTVTRLIEGNEYIFRVRAENKIGTG 12007

Query: 786   DPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGS 845
              P E++ V A    + PG    P+VT V+KE +T+ WN P  DGG  + GY +E+++K S
Sbjct: 12008 PPTESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHS 12067

Query: 846   NLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGL 905
               WVPVNK  I   +  V  LL D EY+FRV A N+ G G+PS+PS  VVAKDP++PPG 
Sbjct: 12068 TRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGP 12127

Query: 906   VQDLHVSDSSNSSISLAWREPA--EGDPPSGYILEMR-----AEDTKEWSKC-TKIPISG 957
               +  V D++  SI+L W +P    G P  GY++EMR     A   + W +C     +  
Sbjct: 12128 PTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVR 12187

Query: 958   TCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVR 1017
               +TV  L E Q+Y FR+ A N+ G+G P EL + ++       P+ DL A ++  ++VR
Sbjct: 12188 KEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVIVR 12247

Query: 1018  AGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLI--NSTKRSDSGVYRI 1075
             AG  + + A   G P P V W+K G+    R+      +   FL+  NST R DSG Y +
Sbjct: 12248 AGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNST-RDDSGKYSL 12306

Query: 1076  LLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGE--AHYIIM 1133
              L N  GE    ++VRV D P P ++L++ +    +  ++W  +P   + G    HYI+ 
Sbjct: 12307 TLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSW--APPENDGGSQVTHYIVE 12364

Query: 1134  KRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLD 1182
             KR+A   TW T    V    + VT L+PG +YYFRV A NE G   P D
Sbjct: 12365 KREADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTD 12413



 Score =  348 bits (892), Expect = 3e-95
 Identities = 218/651 (33%), Positives = 325/651 (49%), Gaps = 40/651 (6%)

Query: 581   GKYTFRAKGTES------EASVFIAD------PPTIDPSVLEALAAHAITVKVGHTAHIK 628
             G+Y FR K   +       A+V   D      PP+ID           + V+ G   +I 
Sbjct: 9713  GEYEFRVKAVNAAGVSKPSATVGPCDCQRPDMPPSID-------LKEFMEVEEGTNVNIV 9765

Query: 629   VPFRGKPLPKVTWYK------DGME-VTEEERVSMERGEDQALLTISNCVREDSGLILLK 681
                +G P P +TW+K      D  E V  +  V+    +D   L I    R D+GL  + 
Sbjct: 9766  AKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTIT 9825

Query: 682   LKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERR 741
               N+ G+A+  + L+VL RP PP G ++F  +S   + + W  PKD+GG  +T +++E+R
Sbjct: 9826  AVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEKR 9885

Query: 742   AVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEP 801
                +K+W+ +   + K   ++  K+ EG  Y FRI+A N  G+ +PL++E   A N    
Sbjct: 9886  EANRKTWVHVSS-EPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFSV 9944

Query: 802   PGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQ---- 857
             PG   +P V+ VT+ ++T+ W  P  DGG+PV GY +E +   S  W  VN+DPI+    
Sbjct: 9945  PGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTL 10004

Query: 858   GTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNS 917
             G    V GL+E ++Y+FRV A+N AG G  S+PS    A+DP+ PPG      V+D + S
Sbjct: 10005 GVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPGPPFP-KVTDWTKS 10063

Query: 918   SISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRI 975
             S  L W  P +  G   +GYI+E + E  +EW K     + GT   V GL E   Y FR+
Sbjct: 10064 SADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRV 10123

Query: 976   RAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPD 1035
             RAVN AG+GEP E+   +       +P   L A ++  +VV AG  + I A  SG PPP 
Sbjct: 10124 RAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPT 10183

Query: 1036  VIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADF 1095
             V W  +        TI  +   S  +I + +RS  GVY +L +NE GE +  I V V D 
Sbjct: 10184 VTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDV 10243

Query: 1096  PRPPTNLRLFEEVPN-TVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKY 1154
             P P     L   + N +  LTW    D       +Y+I KR++    W      V     
Sbjct: 10244 PGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNA 10303

Query: 1155  TVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINK-----DQIQDLSAK 1200
             TV GL+ G+ Y+FR+ A N IG    +++ +  +I +     ++ +DL  K
Sbjct: 10304 TVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPERPEDLEVK 10354



 Score =  348 bits (892), Expect = 3e-95
 Identities = 210/595 (35%), Positives = 309/595 (51%), Gaps = 17/595 (2%)

Query: 598   IADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSME 657
             IA   TI PS+   L  +  +++ G    I++P  G+P P ++W KDG  + +  RV++E
Sbjct: 17932 IAKDLTIQPSL--KLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVE 17989

Query: 658   RGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSC 717
                   +L I    ++D G   +   N  G+AT  L + VL++P PP G V F E+S   
Sbjct: 17990 ETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVSADF 18049

Query: 718   VHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRIL 777
             V + W+ P   GG  ++ +IVE+R     +W  +     + T     K++ G  YQFRI 
Sbjct: 18050 VVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTT-IKITKLKTGTEYQFRIF 18108

Query: 778   AVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYI 837
             A N  G S PL+++ V    P + PG    P VT ++K+ + + W+ P  DGG  ++GY 
Sbjct: 18109 AENRYGKSAPLDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYH 18168

Query: 838   VERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAK 897
             +E+++K S LWV +NK PIQ TK    GL E  EYEF+V A N  G G+PS  S   VA+
Sbjct: 18169 LEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVAR 18228

Query: 898   DPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIPI 955
             DP  PPG  + + +   + ++++L W++PA   G   +GYI+E +      W K +   +
Sbjct: 18229 DPCDPPGRPEAIVI---TRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNV 18285

Query: 956   SGTCYTVGGLIERQKYFFRIRAVNEAG-VGEPVELDKGVRAMPPPAAPKFDLSARLKSHM 1014
               T +TV GL+E Q+Y FR+ A N AG   EP +    + A     AP   L  + K  +
Sbjct: 18286 LETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVI 18345

Query: 1015  VVRAGTALCIHAAFSGSPPPDVIWQKDG---VPTKGRETITKSKNHSQFLINSTKRSDSG 1071
             VV AG    + A   G P PDV+W KDG     T  R  I  +   +  ++    R+D G
Sbjct: 18346 VVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGG 18405

Query: 1072  VYRILLQNEFGEARYDIHVRVADFPRPPTN-LRLFEEVPNTVTLTWNHSPDVQEDGE--A 1128
              Y + L N  G     I V+V D P PP   L++         L WN  P +Q+ G   +
Sbjct: 18406 QYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWN--PPLQDGGANIS 18463

Query: 1129  HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
             HYII KR+ S  +W   +  V +  Y VT LLPG +Y FRV+A N+ G  EPL+S
Sbjct: 18464 HYIIEKRETSRLSWTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLES 18518



 Score =  345 bits (885), Expect = 2e-94
 Identities = 290/986 (29%), Positives = 433/986 (43%), Gaps = 117/986 (11%)

Query: 268   WIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEP 327
             WIK T    ++ +       Q   KY   IS +N  DAG     VG+  +  ++ +++  
Sbjct: 14347 WIKDTTGTALRITQFVVPDLQTKEKYNFRISAIN--DAG-----VGEPAVIPDVEIVER- 14398

Query: 328   LKFLGEMKP---VKVTERQTAVFEIRLS---------KKEPNFVWKFNGKELKRDDKYEI 375
                  EM P   +    R+T V    LS         +  P   W  +   LK     E 
Sbjct: 14399 -----EMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIEN 14453

Query: 376   TVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPIKFVSNLKNVRVKERSR 435
             T S       L I +    D+G+F            +TI+  P    S   NVRV +   
Sbjct: 14454 TESFT----LLIIPECNRYDTGKFV-----------MTIEN-PAGKKSGFVNVRVLDTPG 14497

Query: 436   ACLEC---ELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRA--------------ELIIE 478
               L     ++T   VTL W  D  L+  G++ +     KR               +   +
Sbjct: 14498 PVLNLRPTDITKDSVTLHW--DLPLIDGGSRITNYIVEKREATRKSYSTATTKCHKCTYK 14555

Query: 479   DAQLSDGGEYTVVAMQD-----GDPTEYYSTAIVTVEERLATVKS-GMSDVHAAT----- 527
                LS+G EY    M +     G+PTE  +T  V   E  +   S  + D+  +T     
Sbjct: 14556 VTGLSEGCEYFFRVMAENEYGIGEPTE--TTEPVKASEAPSPPDSLNIMDITKSTVSLAW 14613

Query: 528   -------GSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHE 580
                    GS     V+    K    W      IT + G++ V +           G E  
Sbjct: 14614 PKPKHDGGSKITGYVIEAQRKGSDQWT----HITTVKGLECVVRNLTE-------GEE-- 14660

Query: 581   GKYTFRAKGTES-------EASVFIADPPTIDPSV-LEALAAHAITVKVGHTAHIKVPFR 632
               YTF+     S       E+   I    T+ P + L  +    +  K G    +++P  
Sbjct: 14661 --YTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVL 14718

Query: 633   GKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATAT 692
             G+P P VTW K    + + +RV+ E      +L I+ CVR DSG   L  +N  G     
Sbjct: 14719 GRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEVGDV 14778

Query: 693   LHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIG 752
             + + V D P PP G ++F E+S   V   W  P+++GG P++ ++VE R     +W+++ 
Sbjct: 14779 ITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELA 14838

Query: 753   EVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTD 812
                 + T +   ++  G  YQFR+ A N  GV   + +  + A  P + PG    PQVT 
Sbjct: 14839 TTVIRTT-YKATRLTTGLEYQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTPQVTA 14897

Query: 813   VTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEY 872
             VTK+++TI+W+ P  DGG+P+LGY VER+++   LW  V+K  + G      GL +   Y
Sbjct: 14898 VTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAY 14957

Query: 873   EFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREP--AEGD 930
             EFRVIA N AG  +PS PS  ++A DP+ PPG    L++   +  +++L W +P    G 
Sbjct: 14958 EFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNI---TRHTVTLKWAKPEYTGGF 15014

Query: 931   PPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAG-VGEPVEL 989
               + YI+E R      W K     I    +TV GL E   Y FR+ A N AG +  P E 
Sbjct: 15015 KITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEP 15074

Query: 990   DKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRE 1049
                +       APK  +  + K  ++++AG A  + A  SG PPP + W KDG   +G  
Sbjct: 15075 SDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTA 15134

Query: 1050  TI-TKSKNHSQFLIN-STKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTN-LRLFE 1106
              +  K  + S  L+N  + R DSG Y +   N  G A++  +V+V D P PP   L + E
Sbjct: 15135 KLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTE 15194

Query: 1107  EVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRK 1164
                    L+W   P + + G    HYI+ KR+ S   W   A  V   K  VT LL G +
Sbjct: 15195 VTSEKCVLSW--FPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNE 15252

Query: 1165  YYFRVVARNEIGDSEPLDSRDTWLIN 1190
             Y FRV+A N+ G  EPL+S     +N
Sbjct: 15253 YIFRVMAVNKYGVGEPLESEPVLAVN 15278



 Score =  341 bits (874), Expect = 3e-93
 Identities = 190/575 (33%), Positives = 298/575 (51%), Gaps = 8/575 (1%)

Query: 617   ITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSG 676
             + +K G    ++    G+P P + W KDG E+    ++ ++  +    L   +  R DSG
Sbjct: 15099 VILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSG 15158

Query: 677   LILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQF 736
                L   N  G A    ++ VLDRP PP+G +   E++     + W  P D+GG  +  +
Sbjct: 15159 AYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHY 15218

Query: 737   IVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAG 796
             IV++R   + +W  +   + +VT     K+ +G  Y FR++AVN  GV +PLE+E V A 
Sbjct: 15219 IVQKRETSRLAWTNVAS-EVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLESEPVLAV 15277

Query: 797   NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
             NP  PP     P+VT +TK+++ + W  P  DGG+ ++ YIVERR K    W+  NK  +
Sbjct: 15278 NPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTL 15337

Query: 857   QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
                +  V GL E  EYEFR++A N AG   PS  S    A D V  PG   +  V D+S 
Sbjct: 15338 TDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFKPGPPGNPRVLDTSR 15397

Query: 917   SSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCT-KIPISGTCYTVGGLIERQKYFF 973
             SSIS+AW +P    G   +GY++E+   +  EW   T    +  T YT+ GL E Q+Y  
Sbjct: 15398 SSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKI 15457

Query: 974   RIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPP 1033
             RI A+N  G+GEP  +    +A      P+ +L A L+  + +RA   L +     G P 
Sbjct: 15458 RIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPA 15517

Query: 1034  PDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVA 1093
             P+V W +D   +  + +I  + +++  ++ +  R DSG Y + ++N  G     ++VRV 
Sbjct: 15518 PEVKWARDHGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVL 15577

Query: 1094  DFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFS 1151
             D P PP +L++ E    +VTLTW+  P + + G    +YI+ KR+++   + T A     
Sbjct: 15578 DTPGPPQDLKVKEVTKTSVTLTWD--PPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHK 15635

Query: 1152  NKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDT 1186
               + V  L  G  YYFRV+A NE G   P ++ ++
Sbjct: 15636 TSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAES 15670



 Score =  340 bits (872), Expect = 5e-93
 Identities = 197/589 (33%), Positives = 296/589 (50%), Gaps = 11/589 (1%)

Query: 601   PPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGE 660
             PP+++   L+      + VK G T       RG P+P   W  DG E+  +E  ++E   
Sbjct: 11135 PPSVE---LDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDN 11191

Query: 661   DQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHM 720
               ++LTI NC+R D+G   + + N  GS T  +HL+VLD P PP G +  L+++   + +
Sbjct: 11192 FSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTI 11251

Query: 721   KWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVN 780
              W+ PKD+GG PV  +IVE++   K +W  +     K T      +++G  Y FR+ A N
Sbjct: 11252 SWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSK-TKLKIPHLQKGCEYVFRVRAEN 11310

Query: 781   SEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVER 840
               GV  PL++    A +   PP    +P VTD+T+ A T++W  P  DGG+P+ GY +ER
Sbjct: 11311 KIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMER 11370

Query: 841   RKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPV 900
             R+  +  WV VNK PI   K  V GL E   YEFRV A N AG  +PS  S  + A  P+
Sbjct: 11371 REV-TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPI 11429

Query: 901   KPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGT 958
             KPPG   +  + D S  +  L W +P    G P  GY++E +   T +W++  K  +   
Sbjct: 11430 KPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQ 11489

Query: 959   C-YTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVR 1017
             C + V GLIE  +Y FRI+A N  G GEP EL + V A      P+ +L    +  + VR
Sbjct: 11490 CAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVR 11549

Query: 1018  AGTALCIHAAFSGSPPPDVIWQKDG--VPTKGRETITKSKNHSQFLINSTKRSDSGVYRI 1075
              G  + I A   G P PD+ W K+G  +  + R  + +     +  I    R+D G Y I
Sbjct: 11550 VGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYII 11609

Query: 1076  LLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKR 1135
               +N  G A+    V V D P P  NL++        T++W +  D       ++I+  R
Sbjct: 11610 SAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYR 11669

Query: 1136  DASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSR 1184
               +   W   A  V + +     LL   +YYFRV A N++G    ++++
Sbjct: 11670 KPNQKGWSIVASDV-TKRLIKANLLANNEYYFRVCAENKVGVGPTIETK 11717



 Score =  335 bits (859), Expect = 2e-91
 Identities = 196/574 (34%), Positives = 306/574 (53%), Gaps = 14/574 (2%)

Query: 617   ITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGE--DQALLTISNCVRED 674
             + +K G +  IK   +G+P+P+VTW+KDG+E+  E+R++ME  +      L + +  R+ 
Sbjct: 21596 LIIKSGESLRIKALVQGRPVPRVTWFKDGVEI--EKRMNMEITDVLGSTSLFVRDATRDH 21653

Query: 675   SGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVT 734
              G+  ++ KN  GSA A + + V D P    G + F  ++G  + + W AP ++G  P+T
Sbjct: 21654 RGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPIT 21713

Query: 735   QFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVF 794
              +I+E+R   + +W  I E   +  +++  K+  G  YQFR+ AVN  GV  PL+++ V 
Sbjct: 21714 HYIIEKRETSRLAWALI-EDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVV 21772

Query: 795   AGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPV-NK 853
             A      P     P+ +++T  ++T+TW  P  DGG+ +  YI+ERR+K S  WV V +K
Sbjct: 21773 AQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISK 21832

Query: 854   DPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSD 913
              PI  T+  V GL E  EYEF V+A N AG G  S  S  +  ++PV PPG    + V+D
Sbjct: 21833 RPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTD 21892

Query: 914   SSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKY 971
             +S +++SL W +P    G    GYI+EM   D  +W K        T YTV  L   ++Y
Sbjct: 21893 TSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEY 21952

Query: 972   FFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGS 1031
              FR+ A+N AG G+  E+   ++A+    AP+ D+ A  K   VVRAG ++ +  A+ G 
Sbjct: 21953 KFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGR 22012

Query: 1032  PPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVR 1091
             P P  +W K       R  I  + + S   + +  R+D+G Y + ++N  G       V+
Sbjct: 22013 PTPTAVWSKPDSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVK 22072

Query: 1092  VADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA---HYIIMKRDASTATWYTAAER 1148
             V D P PP  +   +    + TL W+ +P +  DG A   HY++ KR+AS  +W   +E+
Sbjct: 22073 VLDTPGPPGPITFKDVTRGSATLMWD-APLL--DGGARIHHYVVEKREASRRSWQVISEK 22129

Query: 1149  VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLD 1182
                  + V  L  G  YYFRV A NE G  EP +
Sbjct: 22130 CTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYE 22163



 Score =  331 bits (849), Expect = 2e-90
 Identities = 210/619 (33%), Positives = 310/619 (50%), Gaps = 26/619 (4%)

Query: 582   KYTFRAKGTESEASVFIADPPTIDPSVLEA---------LAAHAITVKVGHTAHIKVPFR 632
             +Y+FR      +    I+DP  +   V+           L  +  TV  G    + VPF 
Sbjct: 15744 EYSFRVSAQNEKG---ISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFI 15800

Query: 633   GKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATAT 692
             G+P P VTW+KD + + +  RV+ E  E+ +LLTI +  RED G  ++KL N  G A  T
Sbjct: 15801 GRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIET 15860

Query: 693   LHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIG 752
             L++ VLD+P PP G V+  E++   + + W  PK +GG  +  +IVE+R     +W  + 
Sbjct: 15861 LNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVS 15920

Query: 753   EVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTD 812
                 + T     +++ G  YQFRI A N  G S  L +E   A  P + PG    P VT 
Sbjct: 15921 ATVARTT-IKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTL 15979

Query: 813   VTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEY 872
              +++++ + WN P  DGG+ V+GY +ER+++ S LWV +NK PI  TK    GL E  EY
Sbjct: 15980 SSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEY 16039

Query: 873   EFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGD 930
             EFRV A N  G G+PS  S   VA+DP  PPG  + + V   + +S++L W++P    G 
Sbjct: 16040 EFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIV---TRNSVTLQWKKPTYDGGS 16096

Query: 931   PPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGV-GEPVEL 989
               +GYI+E +      W K +   I  T + V GL+E  +Y FR+ A N AGV  EP E 
Sbjct: 16097 KITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSES 16156

Query: 990   DKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQK--DGVPTKG 1047
                + A      P+  +  + K  +VV AG +  + A   G P P + W K    +    
Sbjct: 16157 TGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTA 16216

Query: 1048  RETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEE 1107
             R  I  +   +   +    R DSG Y +  +N  GE    ++V+V D P PP    +   
Sbjct: 16217 RLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISG 16276

Query: 1108  V-PNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRK 1164
             V     TL W   P +Q+ G    +YI+ +R+ S   W      V +    VT LL G +
Sbjct: 16277 VTAEKCTLAW--KPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNE 16334

Query: 1165  YYFRVVARNEIGDSEPLDS 1183
             Y FR++A N+ G  EPL+S
Sbjct: 16335 YTFRIMAVNKYGVGEPLES 16353



 Score =  331 bits (848), Expect = 3e-90
 Identities = 261/933 (27%), Positives = 421/933 (45%), Gaps = 67/933 (7%)

Query: 290   GTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEI 349
             G +Y+  + +VN   A   S S  D +++ E    +EPL  +       +  +  A F +
Sbjct: 19778 GAEYVFRVKSVNKVGASDPSDS-SDPQIAKERE--EEPLFDIDSEMRKTLIVKAGASFTM 19834

Query: 350   RL---SKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNL 406
              +    +  PN +W     +L+     + T S   LT    I++A  +DSG+++    N+
Sbjct: 19835 TVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRTSLT----IENANRNDSGKYTLTIQNV 19890

Query: 407   VQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRW---KKDGQLLMHGTK 463
             +  A LT+    +       N+ V++         +T +   L W   + DG   +    
Sbjct: 19891 LSAASLTLVVKVLDTPGPPTNITVQD---------VTKESAVLSWDVPENDGGAPVKNYH 19941

Query: 464   YSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERL---ATVKSGM 520
                    K+A + + +    +   Y V  +Q+G    YY       E  +   A  K G+
Sbjct: 19942 IEKREASKKAWVSVTNN--CNRLSYKVTNLQEG--AIYYFRVSGENEFGVGIPAETKEGV 19997

Query: 521   SDVHAATGSPAELCVV-LNDEKVEGVWLK---DGK--------EITDLPGMQIVKQGAVH 568
               +      P +L V  ++ + V   WLK   DG         E  +      VK     
Sbjct: 19998 K-ITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKCAVAK 20056

Query: 569   KLIFPSMGPEHEGKYTFRA-----KGTESEASVFIA-------DPPTIDPSVLEALAAHA 616
                    G     +Y FR       G      + +        +PP ID   ++   +H 
Sbjct: 20057 STHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEID---MKNFPSHT 20113

Query: 617   ITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSG 676
             + V+ G    + +P  GKPLPKVT  +DG+ +    R + E   +   + +   V  D+G
Sbjct: 20114 VYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAG 20173

Query: 677   LILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQF 736
                +   N  G+  A +++ VLDRP PP G V   +++   V +KW+ PK +GG  VT +
Sbjct: 20174 RYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNY 20233

Query: 737   IVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAG 796
             I+ +R      W ++     + T     K+  G+ YQFRI A N  G+SD +++  V   
Sbjct: 20234 ILLKRETSTAVWTEVSATVAR-TMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVK 20292

Query: 797   NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
              P   PG  S P VT+VT+E++T+ W+ P  +GG+ V+GY +E + + S LW   NK  I
Sbjct: 20293 LPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVI 20352

Query: 857   QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
             + T   V  +     YEFRV A N AG G+PS PS  V+A D  +PP   +++ ++D S 
Sbjct: 20353 RTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPP---RNVRITDISK 20409

Query: 917   SSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFR 974
             +S+SL+W++PA   G   +GYI+E R      W+K +   ++ T + + GL +  +Y FR
Sbjct: 20410 NSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFR 20469

Query: 975   IRAVNEAG-VGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPP 1033
             + A N  G +  P E+   +  +     P  DL       +  RAGT++ + A  SG P 
Sbjct: 20470 VFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPA 20529

Query: 1034  PDVIWQKDG--VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVR 1091
             P + W KD   + T     +  + + +  LI    R +SG Y + L+N  G A   I V+
Sbjct: 20530 PTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQ 20589

Query: 1092  VADFPRPPTNLRLFEEV-PNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVF 1150
             + D P PP     F+ V    +TL W    D       HYI+ KR+ S   W   +E + 
Sbjct: 20590 ILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLE 20649

Query: 1151  SNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
                 T T ++ G +Y FRV A N+ G  EPL+S
Sbjct: 20650 ECIITTTKIIKGNEYIFRVRAVNKYGIGEPLES 20682



 Score =  330 bits (846), Expect = 6e-90
 Identities = 206/622 (33%), Positives = 309/622 (49%), Gaps = 19/622 (3%)

Query: 562   VKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKV 621
             +K+G  ++    ++    +GK +F  K    +  +    PPT+     + L     T++V
Sbjct: 10409 LKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELA---PPTLHLDFRDKL-----TIRV 10460

Query: 622   GHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLK 681
             G    +   + GKP PKV+W+KD  +V E++R  ++       L      R DSG   + 
Sbjct: 10461 GEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVV 10520

Query: 682   LKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERR 741
             ++N  GS      ++V+DRP PP G V F E++   + + WK P D+GG  +T +I+E++
Sbjct: 10521 VENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKK 10580

Query: 742   AVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEP 801
              VGK  W+ +     K T    +K+ EGK Y FRI A N  G+SDPL ++ + A +    
Sbjct: 10581 EVGKDVWMPVTSASAKTT-CKVSKLLEGKDYIFRIHAENLYGISDPLVSDSMKAKDRFRV 10639

Query: 802   PGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQG-TK 860
             P    QP VT+VTK++  +TWN P  DGG P+  YI+E+R+  S  W  V KDPI   TK
Sbjct: 10640 PDAPDQPIVTEVTKDSALVTWNKP-HDGGKPITNYILEKRETMSKRWARVTKDPIHPYTK 10698

Query: 861   CTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSIS 920
               V  LLE  +YEFRV A N+ G G PS PS  V AKDP+  P    +    D++ +S+ 
Sbjct: 10699 FRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVD 10758

Query: 921   LAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPIS--GTCYTVGGLIERQKYFFRIR 976
             L W+ P    G    GYI+E +    +EW +    P S   T Y V GL + Q Y FR+ 
Sbjct: 10759 LTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVL 10818

Query: 977   AVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDV 1036
             AVN AG  +P  + + V        P+  L A +     ++ G  L + A   G P P V
Sbjct: 10819 AVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKV 10878

Query: 1037  IWQKD--GVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVAD 1094
              W+K+    PTK R  +T     S+  I +    D G+Y + ++N  G     + V V D
Sbjct: 10879 TWKKEDRDAPTKARIDVTPV--GSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLD 10936

Query: 1095  FPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKY 1154
              P PP +L + E   ++  LTW    D       +Y++ +RD ++A W   +       +
Sbjct: 10937 KPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSH 10996

Query: 1155  TVTGLLPGRKYYFRVVARNEIG 1176
                 L  G +Y FRV A N+ G
Sbjct: 10997 FAKHLNEGNQYLFRVAAENQYG 11018



 Score =  326 bits (836), Expect = 8e-89
 Identities = 262/890 (29%), Positives = 401/890 (45%), Gaps = 86/890 (9%)

Query: 356  PNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEA----GNLVQKAQ 411
            P  VW     EL   DK  + +   G    L IKDA   D G +   A    G+    A+
Sbjct: 8762 PTKVWTKEEGEL---DKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAAR 8818

Query: 412  LTIDRIPIKFVSNLKNVRVKERSRACLECELTSKD----VT--LRWKKDGQLLMHGTKYS 465
            + +  +P   V +LK V V  R    L       D    +T  +  +KD +  MH  +  
Sbjct: 8819 VEVFDVPGP-VLDLKPV-VTNRKMCLLNWSDPEDDGGSEITGFIIERKDAK--MHTWRQP 8874

Query: 466  MNHEGKRAELIIEDAQLSDGGEYT--VVAMQD---GDPTEYYSTAIV------TVEERLA 514
            +  E  + ++      L +G EY   V+A      G P E      V      T  ERL 
Sbjct: 8875 IETERSKCDI----TGLLEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLT 8930

Query: 515  TVKSGMSDVHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPS 574
              +   S +      P           ++G  ++  K   D P  + V +       F  
Sbjct: 8931 YTERTKSTITLDWKEPRSN----GGSPIQGYIIE--KRRHDKPDFERVNKRLCPTTSFLV 8984

Query: 575  MGPEHEGKYTFRAKGT----ESEAS----VFIAD---PPTIDPSVLEALAAHAITVKVGH 623
               +    Y FR K      ESE S    V I D   PPTI   +  ++    I VK G 
Sbjct: 8985 ENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRL--SVRGDTIKVKAGE 9042

Query: 624  TAHIKVPFRGKPLPKVTWYK---------DGMEVTEEERVSMERGEDQALLTISNCVRED 674
              HI     G P+PK+ W K         D +++T+EE   + R E +  L+I   VRED
Sbjct: 9043 PVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEE---VSRSEAKTELSIPKAVRED 9099

Query: 675  SGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVT 734
             G   +   N  GS    +H+ V DRP PP+  +   ++     ++ W AP DNGG  +T
Sbjct: 9100 KGTYTVTASNRLGSVFRNVHVEVYDRPSPPRN-LAVTDIKAESCYLTWDAPLDNGGSEIT 9158

Query: 735  QFIVERRAVGKKS--WIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEE 792
             +++++R   +K   W ++     +   +   K+     Y+FR+ AVN  G+SD  ++++
Sbjct: 9159 HYVIDKRDASRKKAEWEEVTNTAVE-KRYGIWKLIPNGQYEFRVRAVNKYGISDECKSDK 9217

Query: 793  VFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLW---- 848
            V   +P   PG   +P+V   TK ++ ++W  P  +GG+P+ GY +E+R++GS  W    
Sbjct: 9218 VVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVS 9277

Query: 849  -VPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQ 907
              P+ K  ++G +  V  LLE  +Y+FR +A+N AG G PS PS   VA DP+ PPG   
Sbjct: 9278 RAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPPGPPS 9337

Query: 908  DLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTK-IPISGTC-YTVG 963
               V D + SSISL W+ PA+  G P  GYI+EM+ E T +W +  +   +  TC   V 
Sbjct: 9338 CPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCECVVP 9397

Query: 964  GLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALC 1023
             L E +KY FR++AVNEAG  EP +    + A      P+  +    +  +V +AG+ + 
Sbjct: 9398 NLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIR 9457

Query: 1024 IHAAFSGSPPPDVIWQKDGVPTKGRE----------TITKSKNHSQFLINSTKRSDSGVY 1073
            I A   G P P   W+ DG   K  +           +  ++N S  +I   KRS +G Y
Sbjct: 9458 IPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHTGKY 9517

Query: 1074 RILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIM 1133
             I  +N+ G+   +  V+V D P PP +L++ +    +  L+W    D   D    Y+I 
Sbjct: 9518 SITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIE 9577

Query: 1134 KRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
            KR      W        S  + V  LL  ++Y+FRV A N  G   P+++
Sbjct: 9578 KRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVET 9627



 Score =  326 bits (836), Expect = 8e-89
 Identities = 217/659 (32%), Positives = 323/659 (49%), Gaps = 43/659 (6%)

Query: 562   VKQGAVHKLIFPSMGPEHEGKYTFRAKGT---------ESEASVFIADPPTIDPSVLEAL 612
             V+ G   +L F       + +Y FR K           E+ +SV I +P     + L  +
Sbjct: 22221 VEAGHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGI 22280

Query: 613   AAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVR 672
                 IT K G    I VP  G+P PKVTW  + M + E +RVS+   +D+  LT+ + +R
Sbjct: 22281 TNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMR 22340

Query: 673   EDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRP 732
              DSG   L L+N  G  T ++ + V+ RP P  G +E   +S     + W  PKD GG  
Sbjct: 22341 GDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGGGTE 22400

Query: 733   VTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEE 792
             +T +IVE+R  G  +W  +     K T      + +   Y FR+ + N  GVS PLE+  
Sbjct: 22401 ITNYIVEKRESGTTAWQLVNS-SVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESAP 22459

Query: 793   VFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVN 852
             + A +P  PP   ++P+V  V+  A++I W  P  DGG+ ++GY VE++++ + LWV  N
Sbjct: 22460 IIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKEN 22519

Query: 853   KDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVS 912
             K P       V GL+E  EY+FR  A+N AG  + S  S  ++A++PV  PG  +   V+
Sbjct: 22520 KVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRPE---VT 22576

Query: 913   DSSNSSISLAWREPA--EGDPPSGYILEMRAED---TKEWSKCTKIPISGTCYTVGGLIE 967
             D + S++SL W  PA   G    GYI+E +         W KC    +S   +TV  L E
Sbjct: 22577 DVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSE 22636

Query: 968   RQKYFFRIRAVNEAGVGEPVELDKGVRAMPPP------AAPKFDLSARLKSHMV-VRAGT 1020
                Y FR+ A N AGV     + KG  +  P       A PK +L ARL   +V +RAG+
Sbjct: 22637 GDTYEFRVLAKNAAGV-----ISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGS 22691

Query: 1021  ALCIHAAFSGSPPPDVIWQKDG--VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQ 1078
              L + AA  G P P +IW K    +    + ++  +   +  +I    RSDSG Y + ++
Sbjct: 22692 DLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVK 22751

Query: 1079  NEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA---HYIIMKR 1135
             N  G     + V+V D P P   L +        TL W+     QEDG A   HYI+ +R
Sbjct: 22752 NASGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLP---QEDGGAEITHYIVERR 22808

Query: 1136  DASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIG-----DSEPLDSRDTWLI 1189
             + S   W        +  Y VT L+   +Y FRV A N+ G     +SEP+ +R+++ I
Sbjct: 22809 ETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTI 22867



 Score =  325 bits (833), Expect = 2e-88
 Identities = 227/759 (29%), Positives = 365/759 (48%), Gaps = 54/759 (7%)

Query: 587   AKGTESEASVFIADPPTIDPSVLEA-LAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDG 645
             +KG+ES   V   D      + L+A L    +T++ G    +     GKP PK+ W K  
Sbjct: 22654 SKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGD 22713

Query: 646   MEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQ 705
              E+   E+VS++    +A   I  C R DSG   L +KN  G+   ++ + VLD P P  
Sbjct: 22714 KELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPC- 22772

Query: 706   GRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNK 765
             G++    ++     + W  P+++GG  +T +IVERR   + +W+ I E +    ++   +
Sbjct: 22773 GKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWV-IVEGECPTLSYVVTR 22831

Query: 766   VEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAP 825
             + +   Y FR+ AVN  G   P+E+E + A N    P     P+     KE + I W  P
Sbjct: 22832 LIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKP 22891

Query: 826   TQDGGAPVLGYIVERRKKGSNLWVPVNKD-PIQGTKCTVDGLLEDTEYEFRVIAVNKAGP 884
               DGG  +  Y+V++R+K S  W  VNKD  +  T+  V  L+E  +Y+FRV AVN AG 
Sbjct: 22892 ESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGN 22951

Query: 885   GQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAE 942
              +PS  S+ +  ++P   PG      V D++  SISLAW +P    G    GY+LEM+ +
Sbjct: 22952 SEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEK 23011

Query: 943   DTKEWSKC-TKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAA 1001
             DT +W +  T   I  T +TV  L   QKY FR+ AVN  G+ E  E    +  +     
Sbjct: 23012 DTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEI 23071

Query: 1002  PKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFL 1061
             P  +L+  LK  + +RAG +L +  + SG PPP + W K G+    R  I  ++++S  +
Sbjct: 23072 PDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSLLI 23131

Query: 1062  INSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPD 1121
             ++   R D+G Y I  +N+ G+    + V+V D P P  ++++ E   ++VT+TW   P 
Sbjct: 23132 VDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITW-EIPT 23190

Query: 1122  VQEDGEA---HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDS 1178
             +  DG A   +YI+ KR+A+   + T   +     Y ++GL+ G  YYFRV+  N  G  
Sbjct: 23191 I--DGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIG 23248

Query: 1179  EPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLG 1238
             EP ++ D  L+++                          PL P   L   D T +   L 
Sbjct: 23249 EPCETSDAVLVSE-------------------------VPLVP-AKLEVVDVTKSTVTLA 23282

Query: 1239  NPRPTVTLYKGDVNIT--------ANSKFWYNSTSGVCTLVIPTCTLKDSGD---YSVLV 1287
               +P   LY G   +T        A ++ W    +   T++  T T  + G+   + +  
Sbjct: 23283 WEKP---LYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRA 23339

Query: 1288  ENELGKDRSSCTLTVYDKDDKSVVASI-TESLQKKSKHL 1325
             +NE G      T+T     D  V+ +I   ++ +K+ H+
Sbjct: 23340 QNEKGVSEPRETVTAVTVQDLRVLPTIDLSTMPQKTIHV 23378



 Score =  325 bits (832), Expect = 2e-88
 Identities = 195/607 (32%), Positives = 305/607 (50%), Gaps = 16/607 (2%)

Query: 592   SEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEE 651
             S A   +A    I+P V  A ++++  V+VG    I+VP  G+P P +TW KDG+ + + 
Sbjct: 16844 SLAVPIVAKDLVIEPDVKPAFSSYS--VQVGQDLKIEVPISGRPKPTITWTKDGLPLKQT 16901

Query: 652   ERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFL 711
              R+++    D   L+I    ++D G   + + N  G  TA++ +  LD+P PP+G V+F 
Sbjct: 16902 TRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFD 16961

Query: 712   ELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKA 771
             ++S   + + W  P   GG  +T +IV++R      W  +     + T     K++ G  
Sbjct: 16962 DVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTT-LKVTKLKTGTE 17020

Query: 772   YQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGA 831
             YQFRI A N  G S  LE++ + A  P + PG    P  T ++K+++ I W+ P  +GG+
Sbjct: 17021 YQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGS 17080

Query: 832   PVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPS 891
             PV+GY +ER+++ S LW  VNK  I  T+     L E  EYEFRV A N  G G+ S  S
Sbjct: 17081 PVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNS 17140

Query: 892   SSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSK 949
                VA+DP  PPG  + + V     + I+L W +P    G   +GYI+E R      W K
Sbjct: 17141 ECYVARDPCDPPGTPEPIMV---KRNEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMK 17197

Query: 950   CTKIPISGTCYTVGGLIERQKYFFRIRAVNEAG-VGEPVELDKGVRAMPPPAAPKFDLSA 1008
              +   +  T +TV GL E Q+Y FR+ A N AG + +P +    + A      P+  +  
Sbjct: 17198 ASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDP 17257

Query: 1009  RLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDG--VPTKGRETITKSKNHSQFLINSTK 1066
             + +  +VV AG    + A   G P P + W +    +    R  I  +   +  ++    
Sbjct: 17258 KFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAI 17317

Query: 1067  RSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTN-LRLFEEVPNTVTLTWNHSPDVQED 1125
             R D G Y +   N  G   + ++V+V D P PP   +++        +LTW  SP +Q+ 
Sbjct: 17318 RIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTW--SPPLQDG 17375

Query: 1126  GE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
             G   +HY++ KR+ S   W   A  V +N   VT LL G +Y FR++A N+ G  EPL+S
Sbjct: 17376 GSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPLES 17435

Query: 1184  RDTWLIN 1190
                 + N
Sbjct: 17436 APVLMKN 17442



 Score =  318 bits (816), Expect = 2e-86
 Identities = 196/641 (30%), Positives = 304/641 (47%), Gaps = 25/641 (3%)

Query: 557   PGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEA--------SVFIADPPTIDPSV 608
             P  +  +   V  L     G +   KY FR     +           V+ A    + P +
Sbjct: 12471 PADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKI 12530

Query: 609   LEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTIS 668
             L       IT+K G    I+    GKP P   W K   EV     +++ + +  ++L I 
Sbjct: 12531 L---MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIK 12587

Query: 669   NCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDN 728
             +  R+DSG   L  +N  G+ T  + + V+D P PPQ   +  ++      + W  P ++
Sbjct: 12588 DVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHIPLED 12647

Query: 729   GGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPL 788
             GG  +T +IVE+  V +  W+       K T+    K+  G+ Y FR+ A N  G+S+PL
Sbjct: 12648 GGSNITNYIVEKCDVSRGDWVTALASVTK-TSCRVGKLIPGQEYIFRVRAENRFGISEPL 12706

Query: 789   ETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLW 848
              + ++ A  P   P      +VT V K+ + + W+ P  DGG+P++GY++ER+++ S LW
Sbjct: 12707 TSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLW 12766

Query: 849   VPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQD 908
             V  N   ++ T+    GL+E  EY FR+ A+NKAG   PS P+  V A+ PV PPG  + 
Sbjct: 12767 VKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKPE- 12825

Query: 909   LHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIP--ISGTCYTVGG 964
               V D + S++SL W  P    G    GY +E       +W +C   P  I    YT  G
Sbjct: 12826 --VIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATG 12883

Query: 965   LIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCI 1024
             L E+ +Y FR  A     +  P E    V  +     P+ DLS  +KS + V+AGT +C+
Sbjct: 12884 LEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCL 12943

Query: 1025  HAAFSGSPPPDVIWQKDGVPTKGRETI--TKSKNHSQFLINSTKRSDSGVYRILLQNEFG 1082
              A   G P P V W+KDG   K  E I     +N     + S  R DSG Y I  +N  G
Sbjct: 12944 DATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSG 13003

Query: 1083  EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGE--AHYIIMKRDASTA 1140
                  I ++V D P PP ++++ +   +   L+W   P +++ G    +YI+ KR+ S  
Sbjct: 13004 SKSATIKLKVLDKPGPPASVKINKMYSDRAMLSW--EPPLEDGGSEITNYIVDKRETSRP 13061

Query: 1141  TWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPL 1181
              W   +  V     +V  L+ G +Y FR+ A N+ G  +P+
Sbjct: 13062 NWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPV 13102



 Score =  317 bits (812), Expect = 5e-86
 Identities = 193/605 (31%), Positives = 291/605 (48%), Gaps = 26/605 (4%)

Query: 598   IADPPTIDPSVLEALA-----------AHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGM 646
             ++DP TI P  ++ L               +TV++GH  H+++P++GKP P ++W KDG+
Sbjct: 21171 LSDPVTIGPITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGL 21230

Query: 647   EVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQG 706
              + E E V   + E++  L+I N  +E  G   + L N        + +  L  P  P+G
Sbjct: 21231 PLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKG 21290

Query: 707   RVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKV 766
              + F E+    V + W  P+DNGG  +T + +E+R   + +W  +     + T    N V
Sbjct: 21291 PIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCSSVARTTFKVPNLV 21350

Query: 767   EEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPT 826
             ++ + YQFR+ A N  GVS PL +  + A +    PG   +P + +VT + +++TW+AP 
Sbjct: 21351 KDAE-YQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPV 21409

Query: 827   QDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQ 886
              DGG+ V G+ VE++++ S LW  VN  PI G +    GL+E  +Y+FRV A N AG   
Sbjct: 21410 YDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGLSS 21469

Query: 887   PSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDT 944
             PS PS   +A  PV PPG    +   D +  +I+L W  P    G    GY +E R +  
Sbjct: 21470 PSDPSKFTLAVSPVDPPGTPDYI---DVTRETITLKWNPPLRDGGSKIVGYSIEKR-QGN 21525

Query: 945   KEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKG-VRAMPPPAAPK 1003
             + W +C    +S   YTV GL    +Y FRI A N  G   P     G +        P 
Sbjct: 21526 ERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPI 21585

Query: 1004  FDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRET--ITKSKNHSQFL 1061
              +        +++++G +L I A   G P P V W KDGV  + R    IT     +   
Sbjct: 21586 VEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLF 21645

Query: 1062  INSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPD 1121
             +    R   GVY +  +N  G A+ +I V+V D P        F  +       W  +P 
Sbjct: 21646 VRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAP- 21704

Query: 1122  VQEDGEA---HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDS 1178
                DG A   HYII KR+ S   W    ++  +  YT   L+ G +Y FRV A N+ G  
Sbjct: 21705 -LNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVG 21763

Query: 1179  EPLDS 1183
              PLDS
Sbjct: 21764 RPLDS 21768



 Score =  313 bits (801), Expect = 9e-85
 Identities = 262/892 (29%), Positives = 399/892 (44%), Gaps = 90/892 (10%)

Query: 356  PNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTID 415
            P   W  +GKE+K  D+  +T+  D ++  L++  +  +D+G ++    N +  A  +I+
Sbjct: 8044 PTVSWHKDGKEVKASDR--LTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASIN 8101

Query: 416  RIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRAEL 475
               I      K+++  + +++   C+LT +        DG   +          G+R  +
Sbjct: 8102 VKVIGLPGPCKDIKASDITKS--SCKLTWEPPEF----DGGTPILHYVLERREAGRRTYI 8155

Query: 476  IIEDAQ---------LSDGGEY--TVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVH 524
             +   +         L   GEY   V A+      EY       + +          DV 
Sbjct: 8156 PVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVE 8215

Query: 525  AATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVK---------QGAVHKLIFPSM 575
                +   + +       +G     G +I      +I K         +  V  L + + 
Sbjct: 8216 VHNPTAEAMTITWKPPLYDG-----GSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAK 8270

Query: 576  GPEHEGKYTFRAKGTESEASVFI---ADPPT--IDP-SVLEALAAHAITVKVGHTAHIKV 629
            G E   +Y FR +  E+ A +     A PPT  +DP    + +   ++ VK G    +  
Sbjct: 8271 GLEEGKEYQFRVRA-ENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDA 8329

Query: 630  PFRGKPLPKVTWYKDGM--------------------EVTEEE--------RVSME---R 658
               G P P +TW KD                      EV EEE        R+S++   +
Sbjct: 8330 SISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKK 8389

Query: 659  GEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCV 718
            GE Q  L + + +R D GL ++K++NDHG A A   +SVLD P PP   V F ++  + V
Sbjct: 8390 GESQ--LRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFV-FEDIRKTSV 8446

Query: 719  HMKWKAPKDNGGRPVTQFIVERRAVGK--KSWIKIGEVDGKVTNFSTNKVEEGKAYQFRI 776
              KW+ P D+GG  +  + +E++   K    WI +     +   +S  K+ EGK Y FR+
Sbjct: 8447 LCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTL-RHCKYSVTKLIEGKEYLFRV 8505

Query: 777  LAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGY 836
             A N  G   P  ++ + A +P  PP    +P V DVT  ++ + WN P +D G+P+LGY
Sbjct: 8506 RAENRFGPGPPCVSKPLVAKDPFGPPDAPDKPIVEDVTSNSMLVKWNEP-KDNGSPILGY 8564

Query: 837  IVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVA 896
             +E+R+  S  W  VNK  +   K  VDGLLE   Y FRV A N AGPG+ S PS    A
Sbjct: 8565 WLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTA 8624

Query: 897  KDPVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIP 954
             DP+ PPG      V+D+S+++I L W  PA   G    GY ++ +   T EWS+CT+  
Sbjct: 8625 HDPISPPG-PPIPRVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKM 8683

Query: 955  ISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHM 1014
            I    YTV  + E   Y  R+ AVN AG G P E  + V    P   P  +L   +K  +
Sbjct: 8684 IKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGE-TQPVTVAEPQEPPAVELDVSVKGGI 8742

Query: 1015 VVRAGTALCIHAAFSGSPPPDVIWQK-DGVPTKGRETITKSKNHSQFLINSTKRSDSGVY 1073
             + AG  L I A  +G P P  +W K +G   K R  I      S+ +I    R D G Y
Sbjct: 8743 QIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSELIIKDALRKDHGRY 8802

Query: 1074 RILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH---Y 1130
             I   N  G       V V D P P  +L+          L W+   D ++DG +    +
Sbjct: 8803 VITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWS---DPEDDGGSEITGF 8859

Query: 1131 IIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLD 1182
            II ++DA   TW    E   S K  +TGLL G++Y FRV+A+N+ G   P++
Sbjct: 8860 IIERKDAKMHTWRQPIETERS-KCDITGLLEGQEYKFRVIAKNKFGCGPPVE 8910



 Score =  308 bits (790), Expect = 2e-83
 Identities = 202/595 (33%), Positives = 288/595 (48%), Gaps = 19/595 (3%)

Query: 598   IADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSME 657
             IA    I PSV   L  H   VK      I VPF+G+P   V W KDG  + E  RV++ 
Sbjct: 19015 IARDIEIKPSV--ELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVS 19072

Query: 658   RGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSC 717
               +    L+I    +ED G   L + N  GS T  + + VLDRP PP G +   E+S   
Sbjct: 19073 SSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPP-GPIRIDEVSCDS 19131

Query: 718   VHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRIL 777
             + + W  P+ +GG  ++ +IVE++     +W  + +   + T+    ++  G  YQFR+ 
Sbjct: 19132 ITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVAR-TSIKIVRLTTGSEYQFRVC 19190

Query: 778   AVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYI 837
             A N  G S   E+  V A  P  PPG    P+V   TK  + +TW  P  DGG+ V+GY 
Sbjct: 19191 AENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYH 19250

Query: 838   VERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAK 897
             +E +++ S LW   NK  I  T+  V GL E   YE+RV A N AG G+ S     V A+
Sbjct: 19251 LEYKERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPAR 19310

Query: 898   DPVKPPGLVQDLHVSDSSNSSISLAWREP--AEGDPPSGYILEMRAEDTKEWSKCTKIPI 955
             DP  PPG  +   V++ +  S+SL W +P    G   +GYI+E R      W KC    I
Sbjct: 19311 DPCDPPGQPE---VTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNI 19367

Query: 956   SGTCYTVGGLIERQKYFFRIRAVNEA-GVGEPVELDKGVRAMPPPAAPKFDLSARLKSHM 1014
               T + V  L E Q+Y FR+ A N A  V EP E    +        P+  +  + +  +
Sbjct: 19368 QETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVI 19427

Query: 1015  VVRAGTALCIHAAFSGSPPPDVIWQKDG--VPTKGRETITKSKNHSQFLINSTKRSDSGV 1072
             VV+AG  L I+A  +G P P + W KDG  +  + R  I  + NH+   +    R D+G 
Sbjct: 19428 VVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQ 19487

Query: 1073  YRILLQNEFGEARYDIHVRVADFPRPPTN-LRLFEEVPNTVTLTWNHSPDVQEDGEA--- 1128
             Y + L+N  G     ++ +V D P PP   L +        +L+W      QEDG A   
Sbjct: 19488 YVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRP---QEDGGADID 19544

Query: 1129  HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
             +YI+ KR+ S   W      +      VT LL G +Y FRV   N+ G  EPL+S
Sbjct: 19545 YYIVEKRETSHLAWTICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLES 19599



 Score =  293 bits (751), Expect = 6e-79
 Identities = 187/608 (30%), Positives = 301/608 (49%), Gaps = 25/608 (4%)

Query: 587  AKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGM 646
            ++ TE   +V   + P I    L+      +TVK G    +     GKP PK+TW K  M
Sbjct: 7301 SRPTEEIQAVDTQEAPEI---FLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADM 7357

Query: 647  EVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQG 706
             + +++R+++E    ++ +TI +  R D+G  +++  N  G ATA + ++VLD+P PP  
Sbjct: 7358 ILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAA 7417

Query: 707  RVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKV 766
              +  +++     + W  P+D+GG  +T ++VERRA   + W K+     K TNF   K+
Sbjct: 7418 -FDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTV-KDTNFKATKL 7475

Query: 767  EEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPT 826
               K Y FR+ A N  GV +P++   + A    +PPG  ++ + +D+TK+AVT+TW  P 
Sbjct: 7476 IPNKEYIFRVAAENMYGVGEPVQASPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPD 7535

Query: 827  QDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQ 886
             DGG+P+ GY VER    ++ WV  NK P++ T   V GL    +Y FRV+A N AGPG+
Sbjct: 7536 DDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGK 7595

Query: 887  PSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDT 944
            PS  +  ++ KDP+ PP       V D   +S+ L W +P    G     Y++EM    T
Sbjct: 7596 PSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGT 7655

Query: 945  KEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGV---RAMPPPAA 1001
             EW +  +  +  T + + GL+E Q+Y FR+RAVN+AG  EP E    V     + PP+ 
Sbjct: 7656 DEWVRVAE-GVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSP 7714

Query: 1002 PKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFL 1061
            P++     +  +    A     +     GSP  + I +K  V  KG +T+  +   ++  
Sbjct: 7715 PRWLEVINITKN---TADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCT 7771

Query: 1062 INSTKRSDSGVYRILLQNEFGEARY---DIHVRVAD---FPRPPTNLRLFEEVPNTVTLT 1115
            +         V+R+  +N  G++ Y   +  V   D    P PP  L + +     V L 
Sbjct: 7772 VTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLK 7831

Query: 1116 WNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFSN-KYTVTGLLPGRKYYFRVVAR 1172
            W   P   + G     Y+I K++     W  A +    +  + VT ++ G +  F+V A 
Sbjct: 7832 W--EPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAE 7889

Query: 1173 NEIGDSEP 1180
            NE G   P
Sbjct: 7890 NEAGVGHP 7897



 Score =  285 bits (729), Expect = 2e-76
 Identities = 315/1307 (24%), Positives = 527/1307 (40%), Gaps = 123/1307 (9%)

Query: 68   EFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKL 127
            EF+ KPQ +   EG+KA F   +   + P + WKR+    ++   K    +  K+ VL +
Sbjct: 6181 EFISKPQNLEILEGEKAEFVCSISKESFP-VQWKRDDKT-LESGDKYDVIADGKKRVLVV 6238

Query: 128  EPLTSDDSDNYKCIASNDHADAIYTV-----------SLLVTEGQEKM-------DFKKM 169
            +  T  D   Y  +     A A  TV              V E QE +       +  K 
Sbjct: 6239 KDATLQDMGTYVVMVGAARAAAHLTVIEKLRIVVPLKDTRVKEQQEVVFNCEVNTEGAKA 6298

Query: 170  LKKRAPPAPKKKQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKV 229
               R   A     K +  +K+++  L        ++       T+ RG   K       V
Sbjct: 6299 KWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVK-SAANLIV 6357

Query: 230  EVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPL----RIQYSLGKYD 285
            E E +RI++PL+D ET    +V F C  ++   NV + W K  E +    R+ Y + KY 
Sbjct: 6358 EEEDLRIVEPLKDIETMEKKSVTFWC--KVNRLNVTLKWTKNGEEVPFDNRVSYRVDKY- 6414

Query: 286  VKQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTA 345
                  K+ML I +    D G Y ++ G  +  AEL +++ P +F+  ++   VTE   A
Sbjct: 6415 ------KHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDA 6468

Query: 346  VFEIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGN 405
            VF  +LS+++ N  W  NG+E+K   KY+    +DG  H L IKD RL D  E++    +
Sbjct: 6469 VFSCQLSREKANVKWYRNGREIKEGKKYKF--EKDGSIHRLIIKDCRLDDECEYACGVED 6526

Query: 406  LVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYS 465
               +A+L ++ IP++ +   +++     +      EL    V ++W ++  +++ G K+ 
Sbjct: 6527 RKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQ 6586

Query: 466  MNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHA 525
            M  EGK   L I D +  D GEY  +A +D +       A          +K+   D+  
Sbjct: 6587 MMSEGKIHRLQICDIKPRDQGEYRFIA-KDKEARAKLELAAAP------KIKTADQDLVV 6639

Query: 526  ATGSPAELCVVLND-EKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYT 584
              G P  + V  +   K E  W K+ + ++    +    +    +++    G +   K  
Sbjct: 6640 DVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKT-IDTTAEQTSFRILEAKKGDKGRYKIV 6698

Query: 585  FRAKGTESEA----SVFIADPPTIDPSVLEAL-----AAHAITVKVGHTAHIKVPFRGKP 635
             + K  ++E      V     P  +  V E        A    +  G +  I      + 
Sbjct: 6699 LQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRD 6758

Query: 636  LPKVTWY--KDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATL 693
            + + TW    D  E  E     +++G  + L  +S   R  +G     ++ D+     + 
Sbjct: 6759 IKRKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGE---PVETDNPVEARSK 6815

Query: 694  HLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGE 753
            +    D P PP   V   +++   V + W+ P+ +GG  +T +++E R      W     
Sbjct: 6816 Y----DVPGPPLN-VTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMT 6870

Query: 754  VDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDP-LETEEVFAGNPIEPPGFASQPQVTD 812
            V  +  + +   V EG+ Y FR+ A N  GV  P   T  V   +PIE P        +D
Sbjct: 6871 VRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSD 6930

Query: 813  VTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEY 872
             T+ +V + W  P +DGG+P+LGYI+ER ++G + W+  N   +      V GL +  +Y
Sbjct: 6931 QTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKY 6990

Query: 873  EFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPP 932
             +RV A NKAG   PS     + A D    P +  DL    +    + +    P     P
Sbjct: 6991 LYRVSAENKAGVSDPSEILGPLTADDAFVEPTM--DL---SAFKDGLEVIVPNPITILVP 7045

Query: 933  S-GYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDK 991
            S GY        T  W    K+  +G         +R K    + A  E  +      DK
Sbjct: 7046 STGY-----PRPTATWCFGDKVLETG---------DRVK-MKTLSAYAELVISPSERSDK 7090

Query: 992  GVRAMPPPAAPKFDLSARLKSHMVVRAG----------TALCIHAAFS------GSPPPD 1035
            G+  +      K  +S  +  +++ R            T   +H  +       GSP   
Sbjct: 7091 GIYTLKLENRVK-TISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTG 7149

Query: 1036 VIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGE---ARYDIHVRV 1092
             + +K  V  K    +       +F +    +    ++++  +N+ G    A  D  V +
Sbjct: 7150 YVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNM 7209

Query: 1093 ---ADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERV 1149
               A  P PP N++  +   N++ LTW+   +        YI+ +    +  W    E V
Sbjct: 7210 STPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGEPV 7269

Query: 1150 FSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDW 1209
               K  VTGL  G+ Y +RV A N  G S+P  SR T     ++IQ +  +  P    D 
Sbjct: 7270 AETKMEVTGLEEGKWYAYRVKALNRQGASKP--SRPT-----EEIQAVDTQEAPEIFLD- 7321

Query: 1210 RHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCT 1269
                  V  L   TV  G    +     G P P +T  K D+ +  + +    +     T
Sbjct: 7322 ------VKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKST 7375

Query: 1270 LVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASITE 1316
            + I      D+G Y +   N  G+  +   + V DK        IT+
Sbjct: 7376 VTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITD 7422



 Score =  273 bits (699), Expect = 6e-73
 Identities = 160/493 (32%), Positives = 252/493 (51%), Gaps = 15/493 (3%)

Query: 701  PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTN 760
            P PP+  +E + ++ +   +KW  P+ +GG P+T +IVE+R V +K W  + +   K T 
Sbjct: 7712 PSPPRW-LEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTV-DTTVKDTK 7769

Query: 761  FSTNKVEEGKAYQFRILAVNSEGVSDPLETEE-VFAGNPIEPPGFASQPQVTDVTKEAVT 819
             +   + EG  Y FR+ A N+ G SD  E E+ V A +    PG      V DVTK  V 
Sbjct: 7770 CTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVD 7829

Query: 820  ITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAV 879
            + W  P  DGG P+  Y++E++++    WV   K         V  ++E TE +F+V A 
Sbjct: 7830 LKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAE 7889

Query: 880  NKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYIL 937
            N+AG G PS P+  +  +DP  PP    DLHV+D+    I++AW+ P +  G P  GY +
Sbjct: 7890 NEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHV 7949

Query: 938  EMRAEDTKEWSKCTKIPISGTCYTV-GGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAM 996
            EM    T++W +    PI    + V  G++  ++Y  R+RAVN  GV EP E+ + V A 
Sbjct: 7950 EMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAK 8009

Query: 997  PPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKN 1056
             P   P  DL       ++V  G  L I   F   P P V W KDG   K  + +T   +
Sbjct: 8010 DPDCKPTIDLETH---DIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKND 8066

Query: 1057 H--SQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTL 1114
            H  +   +  + R+D+G+Y I L+N+ G A   I+V+V   P P  +++  +   ++  L
Sbjct: 8067 HISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKL 8126

Query: 1115 TWNHSPDVQEDGE--AHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVAR 1172
            TW   P   + G    HY++ +R+A   T+           +TV  L+P  +Y+FRV A 
Sbjct: 8127 TW--EPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAV 8184

Query: 1173 NEIGDSEPLDSRD 1185
            N++G  E ++ ++
Sbjct: 8185 NKVGGGEYIELKN 8197



 Score =  255 bits (652), Expect = 2e-67
 Identities = 168/569 (29%), Positives = 270/569 (47%), Gaps = 36/569 (6%)

Query: 617   ITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSG 676
             I V+ G    + +P +GKP P   W K+G ++++  R  +   E    L I    R DSG
Sbjct: 23774 IFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISK--RAMIATSETHTELVIKEADRGDSG 23831

Query: 677   LILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQF 736
                L L+N  G     + + V+  P  P+G +E+ ++    V + W+ P D+GG  +  +
Sbjct: 23832 TYDLVLENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGY 23891

Query: 737   IVERRAVGKKSWIKIGEVDGKV--TNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVF 794
             I+ERR V K +W  I   D +V  T+     ++E   Y FR+ A N  G+S PL++EE  
Sbjct: 23892 ILERREVPKAAWYTI---DSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPV 23948

Query: 795   AG----NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVP 850
                   NP EPP  ++ P+V DVTK +V+++W+ P  DGG+ V GY +ER++  ++ WV 
Sbjct: 23949 TPKTPLNPPEPP--SNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVR 24006

Query: 851   VNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLH 910
              NK  I  T  TV GL+ D EY+FR+IA N  G  + S  S  VV KDP   P    +L 
Sbjct: 24007 HNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELE 24066

Query: 911   VSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIER 968
             +   S  S++L W +P    G    GY +E R      W K  K  I    +T+GGL+E 
Sbjct: 24067 ILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEA 24126

Query: 969   QKYFFRIRAVNEAGVGEPVELDKGVRA-MPPPAAPKFDLSARLKSHMVVRAGTALCIHAA 1027
              +Y FR+ A NE G+  P      ++  +    AP   +   +K  +  + G A  +   
Sbjct: 24127 TEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAP--GIRKEMKD-VTTKLGEAAQLSCQ 24183

Query: 1028  FSGSPPPDVIWQKDG---VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEA 1084
               G P PD+ W + G   + ++  +  +  + H+   + + ++ D GVY  +  NE GE 
Sbjct: 24184 IVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHT-LTVMTEEQEDEGVYTCIATNEVGEV 24242

Query: 1085  RYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYT 1144
                  + +   P+      L E+    V  T             H + + R     TW+ 
Sbjct: 24243 ETSSKLLLQATPQFHPGYPLKEKYYGAVGSTL----------RLHVMYIGRPVPAMTWF- 24291

Query: 1145  AAERVFSNKYTVTGLLPGRKYYFRVVARN 1173
               +++  N   +T  +   ++Y  +V +N
Sbjct: 24292 HGQKLLQNSENIT--IENTEHYTHLVMKN 24318



 Score =  252 bits (643), Expect = 2e-66
 Identities = 205/799 (25%), Positives = 359/799 (44%), Gaps = 50/799 (6%)

Query: 438   LECELTSKD-VTLRWKK---DG--QLLMHGTKYSMNHEG---KRAELIIEDAQLSDGG-- 486
             LE    SKD VTL+W+K   DG  ++L +  +Y  + +    K  +  I+D Q + GG  
Sbjct: 24065 LEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLL 24124

Query: 487   -----EYTVVAMQDGDPTEYYSTAIVTVEERLAT-----VKSGMSDVHAATGSPAEL-CV 535
                  E+ V A  +   +    TA+ +++ +L +     ++  M DV    G  A+L C 
Sbjct: 24125 EATEYEFRVFAENETGLSRPRRTAM-SIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQ 24183

Query: 536   VLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKG----TE 591
             ++     +  W + GKE+      ++   G  H L   +   E EG YT  A       E
Sbjct: 24184 IVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVE 24243

Query: 592   SEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEE 651
             + + + +   P   P        +     VG T  + V + G+P+P +TW+     +   
Sbjct: 24244 TSSKLLLQATPQFHPGYPLKEKYYGA---VGSTLRLHVMYIGRPVPAMTWFHGQKLLQNS 24300

Query: 652   ERVSMERGEDQALLTISNCVRED-SGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEF 710
             E +++E  E    L + N  R+  +G   ++L N  G+  A L + + D+P  P G +  
Sbjct: 24301 ENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVI 24360

Query: 711   LELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGK 770
               L  +   + WK P D+GG  +T ++VE+    + +  ++      VT      + E  
Sbjct: 24361 EALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENA 24420

Query: 771   AYQFRILAVNSEGVSDPLETEEV-FAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDG 829
              Y FR+ A N+ G+SDPLE   V    +P E PG   +P +T VTK++  + W  P  DG
Sbjct: 24421 GYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDG 24480

Query: 830   GAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSV 889
             GA +  Y +E+R+K  N W+ V  + I+ T  +V  L+E  EYEFRV   N  G  + S 
Sbjct: 24481 GAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSE 24540

Query: 890   PSSSVVAKD--PVKPPGLVQDL-HVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKE 946
              S  +  K   P++ P   ++L +++    S+ +L  +      P   +  + + E   +
Sbjct: 24541 ISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGK-EIIAD 24599

Query: 947   WSKCTKIPISGTCY--TVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKF 1004
               K       G  +   +  + +     +++RA N+ G         G  ++      K 
Sbjct: 24600 GLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGG------SVSGTASLEVEVPAKI 24653

Query: 1005  DLSARLKSHMVVRA--GTALCIHAAFSGSPPPDVIWQK--DGVPTKGRETITKSKNHSQF 1060
              L   L+    V A  G  + I   FSG P P + WQK  D +   G   +  +++ +  
Sbjct: 24654 HLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSL 24713

Query: 1061  LI-NSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHS 1119
             +  N  +R D+G Y +  +N FG  +  + + VAD P PP  +++ +   ++V LTW   
Sbjct: 24714 VFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEP 24773

Query: 1120  PDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSE 1179
                      +YI+ ++ A+TA  +    +    +YTV  L     Y FRV+A N+ G S+
Sbjct: 24774 ASDGGSKITNYIV-EKCATTAERWLRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSK 24832

Query: 1180  PLDSRDTWLINKDQIQDLS 1198
             P +  +  +  +D+ + ++
Sbjct: 24833 PSEPSEPTITKEDKTRAMN 24851



 Score =  243 bits (621), Expect = 7e-64
 Identities = 306/1277 (23%), Positives = 500/1277 (39%), Gaps = 142/1277 (11%)

Query: 68   EFVEKPQPVTAPEGDKAVFRARV-QGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLK 126
            EF +  +  T  EG  AV    V + NAK  + W + +G  I +S K    +  +   L 
Sbjct: 5914 EFTKPLEDQTVEEGATAVLECEVSRENAK--VKWFK-NGTEILKSKKYEIVADGRVRKLV 5970

Query: 127  LEPLTSDDSDNYKCIASN-----------DHADAIYTVSLLVTEGQEKMDFK-------- 167
            +   T +D   Y C A +            H + +  ++ L    +E   F+        
Sbjct: 5971 IHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFECELSRENA 6030

Query: 168  --KMLKKRAPPAPKKKQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEM 225
              K  K  A     KK   ++     + +++K    D  +   E       G+L  L+E 
Sbjct: 6031 KVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEE- 6089

Query: 226  KKKVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYD 285
                  EA+   K L + E     T+   C  E+  P  ++IW KG E +      G+Y+
Sbjct: 6090 ------EAV-FTKNLANIEVSETDTIKLVC--EVSKPGAEVIWYKGDEEI---IETGRYE 6137

Query: 286  VKQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTA 345
            +   G K +LVI N ++ DAG Y+  +   R   ++ V +   +F+ + + +++ E + A
Sbjct: 6138 ILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKA 6197

Query: 346  VFEIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGN 405
             F   +SK+     WK + K L+  DKY++    DG    L +KDA L D G +    G 
Sbjct: 6198 EFVCSISKESFPVQWKRDDKTLESGDKYDVIA--DGKKRVLVVKDATLQDMGTYVVMVGA 6255

Query: 406  LVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYS 465
                A LT+    ++ V  LK+ RVKE+      CE+ ++    +W ++ + +   +KY 
Sbjct: 6256 ARAAAHLTVIE-KLRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYI 6314

Query: 466  MNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHA 525
            +  +     L I DA L D   Y V ++ +       S A + VEE    +   + D+  
Sbjct: 6315 ILQKDLVYTLRIRDAHLDDQANYNV-SLTNHRGENVKSAANLIVEEEDLRIVEPLKDIET 6373

Query: 526  ATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTF 585
                       +N   V   W K+G+E+     +        H L     G   EG+Y  
Sbjct: 6374 MEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIV 6433

Query: 586  RAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDG 645
             A   +S A + I + PT     +E L    +T         ++    +    V WY++G
Sbjct: 6434 TAGQDKSVAELLIIEAPT---EFVEHLEDQTVTEFDDAVFSCQL---SREKANVKWYRNG 6487

Query: 646  MEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQ 705
             E+ E ++   E+      L I +C  +D       +++    A   +    ++  +PPQ
Sbjct: 6488 REIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQ 6547

Query: 706  GRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAV--GKKSWIKIGEVDGKVTNFST 763
               + LE  G+ V    +  KD   +   Q++     V  G K  +     +GK+     
Sbjct: 6548 ---DILEAPGADVVFLAELNKD---KVEVQWLRNNMVVVQGDKHQMMS---EGKIHRLQI 6598

Query: 764  NKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWN 823
              ++     ++R +A + E  +      E+ A   I+    A Q  V DV K    +   
Sbjct: 6599 CDIKPRDQGEYRFIAKDKEARAKL----ELAAAPKIKT---ADQDLVVDVGKPLTMVV-- 6649

Query: 824  APTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAG 883
                    P   Y      K    W   N +P+  TK T+D   E T   FR++   K  
Sbjct: 6650 --------PYDAY-----PKAEAEWFKEN-EPLS-TK-TIDTTAEQTS--FRILEAKKGD 6691

Query: 884  PGQPSV-------PSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSG 934
             G+  +        +   +    +  PG V++L V+++ +  +SLAW EP    G    G
Sbjct: 6692 KGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIG 6751

Query: 935  YILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQ-KYFFRIRAVNEAGVGEPVELDKGV 993
            Y++E R    K W   T    S   +TV GL +   +Y FR+ A N  G GEPVE D  V
Sbjct: 6752 YVVERRDIKRKTWVLATDRAESCE-FTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPV 6810

Query: 994  RAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPD----------VIWQKDGV 1043
             A      P   L+  +    V R G +L          PP+          VI  +D  
Sbjct: 6811 EARSKYDVPGPPLNVTITD--VNRFGVSLTWE-------PPEYDGGAEITNYVIELRDKT 6861

Query: 1044 PTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDI---HVRVAD---FPR 1097
              +    +T         +          +R+  QN  G  +       V+VAD    P 
Sbjct: 6862 SIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPS 6921

Query: 1098 PPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTAAERVFSN-KY 1154
            PP NL   ++  ++V L W   P +++ G     YII + +     W     ++     Y
Sbjct: 6922 PPVNLTSSDQTQSSVQLKWE--PPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTY 6979

Query: 1155 TVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPR 1214
             VTGL  G KY +RV A N+ G S+P +     L   D   + +  L  ++       P 
Sbjct: 6980 KVTGLEKGNKYLYRVSAENKAGVSDPSEILGP-LTADDAFVEPTMDLSAFKDGLEVIVPN 7038

Query: 1215 FVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPT 1274
             +T L P T              G PRPT T   GD  +    +    + S    LVI  
Sbjct: 7039 PITILVPST--------------GYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISP 7084

Query: 1275 CTLKDSGDYSVLVENEL 1291
                D G Y++ +EN +
Sbjct: 7085 SERSDKGIYTLKLENRV 7101



 Score =  208 bits (529), Expect = 3e-53
 Identities = 167/633 (26%), Positives = 273/633 (43%), Gaps = 66/633 (10%)

Query: 699  DRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKV 758
            D P PP  R+E  +++   V + W  P D+GG P+T + VER       W++  ++  K 
Sbjct: 7509 DPPGPPT-RLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKD 7567

Query: 759  TNFSTNKVEEGKAYQFRILAVNSEGVSDPLE-TEEVFAGNPIEPPGFASQPQVTDVTKEA 817
            T +    +   K Y+FR+LA N  G   P + TE +   +PI+PP    +P V DV K +
Sbjct: 7568 TTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTS 7627

Query: 818  VTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVI 877
            V + W  P  DGGA +  Y++E  K G++ WV V  + +  T+  + GL+E  EY FRV 
Sbjct: 7628 VRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRV-AEGVPTTQHLLPGLMEGQEYSFRVR 7686

Query: 878  AVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGY 935
            AVNKAG  +PS PS  V+ ++ + PP   + L V + + ++  L W  P +  G P + Y
Sbjct: 7687 AVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNY 7746

Query: 936  ILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRA 995
            I+E R    K W +     +  T  TV  L E   Y FR+ A N  G  +  E++  V A
Sbjct: 7747 IVEKRDVRRKGW-QTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLA 7805

Query: 996  M-------PPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPD---------VIWQ 1039
                    PP A    D++ R               H      PP +         VI +
Sbjct: 7806 KDTFTTPGPPYALAVVDVTKR---------------HVDLKWEPPKNDGGRPIQRYVIEK 7850

Query: 1040 KDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADF---- 1095
            K+ + T+  +    +     F +          +++  +NE G         +       
Sbjct: 7851 KERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPT 7910

Query: 1096 --PRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTAAERVFS 1151
              P PP +L + +     + + W   P  +  G     Y +      T  W     R   
Sbjct: 7911 SPPSPPLDLHVTDAGRKHIAIAWK--PPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIK 7968

Query: 1152 N-KYTVT-GLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDW 1209
            + K+ V  G++P ++Y  RV A N IG SEP +  +  ++ KD     +  L+ ++    
Sbjct: 7969 DLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISEN-VVAKDPDCKPTIDLETHDI--- 8024

Query: 1210 RHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCT 1269
                          V+ G+  ++   F   P PTV+ +K    + A+ +    +      
Sbjct: 8025 -------------IVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAH 8071

Query: 1270 LVIPTCTLKDSGDYSVLVENELGKDRSSCTLTV 1302
            L +P     D+G Y++ +EN+LG   +S  + V
Sbjct: 8072 LEVPKSVRADAGIYTITLENKLGSATASINVKV 8104



 Score =  208 bits (529), Expect = 3e-53
 Identities = 143/432 (33%), Positives = 213/432 (49%), Gaps = 26/432 (6%)

Query: 762   STNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTIT 821
             + N+ + GK   + +   NS G         V     ++ PG     +V +VTK +VT+T
Sbjct: 15548 NVNRFDSGK---YILTVENSSGSKSAFVNVRV-----LDTPGPPQDLKVKEVTKTSVTLT 15599

Query: 822   WNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNK 881
             W+ P  DGG+ +  YIVE+R+     +  V  +    T   VD L E   Y FRV+A N+
Sbjct: 15600 WDPPLLDGGSKIKNYIVEKRESTRKAYSTVATN-CHKTSWKVDQLQEGCSYYFRVLAENE 15658

Query: 882   AGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEM 939
              G G P+  + SV A +   PPG +    + D + +S+SL+W +P    G    GYI+EM
Sbjct: 15659 YGIGLPAETAESVKASERPLPPGKIT---LMDVTRNSVSLSWEKPEHDGGSRILGYIVEM 15715

Query: 940   RAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPP 999
             + + + +W+ C  + ++    T+ GLI+ ++Y FR+ A NE G+ +P +L   V A    
Sbjct: 15716 QTKGSDKWATCATVKVTEA--TITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLV 15773

Query: 1000  AAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKG--RETITKSKNH 1057
               P F L   L +   V AG  L +   F G P P V W KD VP K   R     ++N+
Sbjct: 15774 IPPAFKL---LFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENN 15830

Query: 1058  SQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTN-LRLFEEVPNTVTLTW 1116
             S   I    R D G Y + L N  GEA   ++V V D P PPT  +++ E   +++TL+W
Sbjct: 15831 SLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTADSITLSW 15890

Query: 1117  NHSPDVQEDGEA--HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNE 1174
                P   + G +  +YI+ KRD ST TW   +  V         L  G +Y FR+ A N 
Sbjct: 15891 G--PPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFRIAAENR 15948

Query: 1175  IGDSEPLDSRDT 1186
              G S  L+S  T
Sbjct: 15949 YGKSTYLNSEPT 15960



 Score =  204 bits (518), Expect = 6e-52
 Identities = 122/391 (31%), Positives = 190/391 (48%), Gaps = 6/391 (1%)

Query: 797  NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
            N I  P    + +  D+TK++V +TW  P  DGG+P+ GY+VE+R+     W  V  D +
Sbjct: 7111 NVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV-MDFV 7169

Query: 857  QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
               + TV  L++  EY F+V A NK GPG+P+     V    P   P   +++   D + 
Sbjct: 7170 TDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWRDRTA 7229

Query: 917  SSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFR 974
            +SI L W  P    G    GYI+E     + +W  C + P++ T   V GL E + Y +R
Sbjct: 7230 NSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGE-PVAETKMEVTGLEEGKWYAYR 7288

Query: 975  IRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPP 1034
            ++A+N  G  +P    + ++A+    AP+  L  +L + + V+AGT + + A  +G P P
Sbjct: 7289 VKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEP 7348

Query: 1035 DVIWQKDGVPTKG--RETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRV 1092
             + W K  +  K   R TI      S   I  +KRSD+G Y I   N  G A   + V V
Sbjct: 7349 KITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 7408

Query: 1093 ADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSN 1152
             D P PP    + +    +  LTWN   D       +Y++ +R   +  W+  +  V   
Sbjct: 7409 LDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKDT 7468

Query: 1153 KYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
             +  T L+P ++Y FRV A N  G  EP+ +
Sbjct: 7469 NFKATKLIPNKEYIFRVAAENMYGVGEPVQA 7499



 Score =  201 bits (512), Expect = 3e-51
 Identities = 144/532 (27%), Positives = 249/532 (46%), Gaps = 31/532 (5%)

Query: 168  KMLKKRAPPAPKKKQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKK 227
            K   K     P  K + V+  K    +L  +   D  +      +T   G L    E K 
Sbjct: 2780 KWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGE------YTAVVGQL----ECKA 2829

Query: 228  KVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVK 287
            K+ VE + I K +++ E     T  F+C  E+   NV  +W+K    + +     K+ + 
Sbjct: 2830 KLFVETLHITKTMKNIEVPETKTASFEC--EVSHFNVPSMWLKNGVEIEMSE---KFKIV 2884

Query: 288  QMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVF 347
              G  + L+I N +  D+  Y+   G+ ++SA LTV   P+     +K +   E+ T  F
Sbjct: 2885 VQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVT--PIMITSMLKDINAEEKDTITF 2942

Query: 348  EIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLV 407
            E+ ++ +  ++ W  NG E+K  DK ++   +  LTH+L I++    D+ +++  AG   
Sbjct: 2943 EVTVNYEGISYKWLKNGVEIKSTDKCQMRTKK--LTHSLNIRNVHFGDAADYTFVAGKAT 3000

Query: 408  QKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMN 467
              A L ++   I+F  ++K+++V E+ RA  ECE++  D+T++W KD Q L    +  + 
Sbjct: 3001 STATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQ 3060

Query: 468  HEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAAT 527
             E     L+I   ++SD G+YTVVA  +       STA + VE R   ++S   +V    
Sbjct: 3061 KEKYVHRLLIPSTRMSDAGKYTVVAGGN------VSTAKLFVEGRDVRIRSIKKEVQVIE 3114

Query: 528  GSPAELCVVLNDEKVEGVWLKDGKEIT--DLPGMQIVKQGAVHKLIFPSMGPEHEGKYTF 585
               A +   +N++ V+  W KDG EI        + V +  +H++          G+YTF
Sbjct: 3115 KQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTF 3174

Query: 586  RAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDG 645
             A    S  ++++  P    P VL+ L    +TV+ G  A       G+P PK++WYK+ 
Sbjct: 3175 VAGRNRSSVTLYVNAPE--PPQVLQEL--QPVTVQSGKPARFCAVISGRPQPKISWYKEE 3230

Query: 646  MEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSV 697
              ++   +        +  L +     ED+ +   + KND+G AT +  LSV
Sbjct: 3231 QLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSV 3282



 Score =  201 bits (512), Expect = 3e-51
 Identities = 137/438 (31%), Positives = 208/438 (47%), Gaps = 44/438 (10%)

Query: 802  PGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKC 861
            PG     + +D+TK +  +TW  P  DGG P+L Y++ERR+ G   ++PV     +    
Sbjct: 8108 PGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENK-LSW 8166

Query: 862  TVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISL 921
            TV  L+ + EY FRV AVNK G G+     + V+A+DP +PP    D+ V + +  ++++
Sbjct: 8167 TVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTI 8226

Query: 922  AWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVN 979
             W+ P    G    GYI+E  A+  + W +C +  +    YT  GL E ++Y FR+RA N
Sbjct: 8227 TWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAEN 8286

Query: 980  EAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQ 1039
             AG+ EP       +A+ P  APK      L++ + V+ G  + + A+ SGSP P + W 
Sbjct: 8287 AAGISEPSRATPPTKAVDPIDAPK----VILRTSLEVKRGDEIALDASISGSPYPTITWI 8342

Query: 1040 KDG------------------------------VPTKGRETITKS-KNHSQFLINSTKRS 1068
            KD                               +P   R +I  S K  SQ  +  + R 
Sbjct: 8343 KDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRP 8402

Query: 1069 DSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNT-VTLTWNHSPDVQEDGE 1127
            D G+Y I ++N+ G A+    V V D P PP N  +FE++  T V   W    D      
Sbjct: 8403 DHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINF-VFEDIRKTSVLCKWEPPLDDGGSEI 8461

Query: 1128 AHYIIMKRDAS--TATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRD 1185
             +Y + K+D +   + W      +   KY+VT L+ G++Y FRV A N  G   P  S+ 
Sbjct: 8462 INYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKP 8521

Query: 1186 TWLINKDQIQDLSAKLKP 1203
              L+ KD      A  KP
Sbjct: 8522 --LVAKDPFGPPDAPDKP 8537



 Score =  201 bits (510), Expect = 5e-51
 Identities = 167/595 (28%), Positives = 274/595 (46%), Gaps = 38/595 (6%)

Query: 600   DPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERG 659
             + P +D   L++     I V+ G +A I +PF+G+P P++TW ++  E T+  +V +E+G
Sbjct: 17648 EAPELD---LDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTD--KVQIEKG 17702

Query: 660   EDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVH 719
              +   L+I NC R D+G  +LKL+N  GS +A + + VLD P PPQ  +   E+      
Sbjct: 17703 VNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQN-LAVKEVRKDSAF 17761

Query: 720   MKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAV 779
             + W+ P  +GG  V  +++++R   +K++  +     K T+F    + EG  Y FR++A 
Sbjct: 17762 LVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSK-TSFKVENLTEGAIYYFRVMAE 17820

Query: 780   NSEGVSDPLET-EEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIV 838
             N  GV  P+ET + V A  P  PPG  +   +TDV++ + ++ W  P  DGG+ VLGY+V
Sbjct: 17821 NEFGVGVPVETVDAVKAAEPPSPPGKVT---LTDVSQTSASLMWEKPEHDGGSRVLGYVV 17877

Query: 839   ERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKD 898
             E + KG+  W  V +  +      V GL    EY+FRV A N+ G   P V    V+AKD
Sbjct: 17878 EMQPKGTEKWSIVAESKV--CNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKD 17935

Query: 899   PVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGT 958
                 P L    + + S  +   L    P  G P          E  K+    T++ +  T
Sbjct: 17936 LTIQPSLKLPFN-TYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQ---TTRVNVEET 17991

Query: 959   C-YTVGGLIERQKYFF---RIRAVNEAGVG-EPVELDKGVRAMPPPAAPKFDLSARLKSH 1013
                TV  + E  K  F    + A N AG   E + +    +  PP    +FD    + + 
Sbjct: 17992 ATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFD---EVSAD 18048

Query: 1014  MVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVY 1073
              VV +       A   G    + I +K    T     ++ +   +   I   K      +
Sbjct: 18049 FVVISWEP---PAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQF 18105

Query: 1074  RILLQNEFGE-ARYDIHVRVADF----PRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGE- 1127
             RI  +N +G+ A  D    +  +    P PP    +     + + + W H P V + G  
Sbjct: 18106 RIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQW-HEP-VNDGGTK 18163

Query: 1128  -AHYIIMKRDASTATWYTAAER-VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEP 1180
                Y + +++ ++  W    +  +   K+  TGL  G +Y F+V A N +G  +P
Sbjct: 18164 IIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKP 18218



 Score =  200 bits (509), Expect = 7e-51
 Identities = 157/596 (26%), Positives = 262/596 (43%), Gaps = 26/596 (4%)

Query: 600   DPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERG 659
             +PP +   +L+A  A    +KVG T  +    +G P PKVTW K+  +   + R+ +   
Sbjct: 10842 EPPEL---ILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPV 10898

Query: 660   EDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVH 719
               +  L I N   ED G+  L ++N  GS T ++ + VLD+P PP+  +E  E+     +
Sbjct: 10899 GSK--LEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRD-LEVSEIRKDSCY 10955

Query: 720   MKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAV 779
             + WK P D+GG  +T ++VERR V    W  +     K ++F+ + + EG  Y FR+ A 
Sbjct: 10956 LTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHFAKH-LNEGNQYLFRVAAE 11014

Query: 780   NSEGVSDPLETEE-VFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIV 838
             N  G    +ET + + A +P+ PPG        DV K  V++ WN P +DGG+P+ GY+V
Sbjct: 11015 NQYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLV 11074

Query: 839   ERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKD 898
             E +++G+  W+      +   +C V GL +   Y FRV A N  G G P   +  +  ++
Sbjct: 11075 EYQEEGTQDWIKFK--TVTNLECVVTGLQQGKTYRFRVKAENIVGLGLPDT-TIPIECQE 11131

Query: 899   PVKPPGLVQDLHVSDSSNSSISLAWREPA--EGDP-PSGYILEMRAEDTKEWSKCTKIPI 955
              + PP +  D+ + +          R PA   G P P+       +E   +     +   
Sbjct: 11132 KLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDN 11191

Query: 956   SGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMV 1015
               +  T+   + R    ++I   N AG  + V +   V  +P P     ++      HM 
Sbjct: 11192 FSSVLTIKNCLRRDTGEYQITVSNAAG-SKTVAVHLTVLDVPGPPTGPINILDVTPEHMT 11250

Query: 1016  VRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRI 1075
             +             GSP  + I +K          ++   + ++  I   ++    V+R+
Sbjct: 11251 ISWQPP----KDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRV 11306

Query: 1076  LLQNEFG-----EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHY 1130
               +N+ G     ++   +       P PP    + +   N  T++W   P          
Sbjct: 11307 RAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWT-LPKSDGGSPITG 11365

Query: 1131  IIMKRDASTATWYTAAERVFSN-KYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRD 1185
               M+R   T  W    +   ++ K+ VTGL  G  Y FRV A N  G S+P  S D
Sbjct: 11366 YYMERREVTGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSD 11421



 Score =  196 bits (497), Expect = 2e-49
 Identities = 174/653 (26%), Positives = 280/653 (42%), Gaps = 42/653 (6%)

Query: 567  VHKLIFPSMGPEHEGKYTFRAKGTESEASV---------FIADPPTIDPSVLEALAAHAI 617
            V +L +   G E   KY +R    E++A V           AD   ++P++  +     +
Sbjct: 6974 VPELTYKVTGLEKGNKYLYRVSA-ENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGL 7032

Query: 618  TVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGL 677
             V V +   I VP  G P P  TW      +   +RV M+     A L IS   R D G+
Sbjct: 7033 EVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGI 7092

Query: 678  ILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFI 737
              LKL+N   + +  + ++V+ RP  P+  ++F +++   VH+ W+ P D+GG P+T ++
Sbjct: 7093 YTLKLENRVKTISGEIDVNVIARPSAPK-ELKFGDITKDSVHLTWEPPDDDGGSPLTGYV 7151

Query: 738  VERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEE-VFAG 796
            VE+R V +K+W K+ +    +  F+   + +GK Y F++ A N  G  +P   +E V   
Sbjct: 7152 VEKREVSRKTWTKVMDFVTDL-EFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMS 7210

Query: 797  NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
             P   P      +  D T  ++ +TW+ P  DGG+ + GYIVER  +GS+ WV    +P+
Sbjct: 7211 TPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACG-EPV 7269

Query: 857  QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
              TK  V GL E   Y +RV A+N+ G  +PS P+  + A D  + P +  D+ +     
Sbjct: 7270 AETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLT 7329

Query: 917  SSISLAWREPAE-GDPPSGYILEMRAEDTKEWSK---CTKIPISGTCYTVGGLIERQKYF 972
                     PA     P   I   +A+   +  K      +P   T  T+          
Sbjct: 7330 VKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKST-VTIVDSKRSDTGT 7388

Query: 973  FRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSP 1032
            + I AVN  G    V     +    PPAA  FD++       ++             GS 
Sbjct: 7389 YIIEAVNVCGRATAVVEVNVLDKPGPPAA--FDITDVTNESCLLTWNPP----RDDGGSK 7442

Query: 1033 PPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFG---------- 1082
              + + ++    ++    ++ +   + F       +   ++R+  +N +G          
Sbjct: 7443 ITNYVVERRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQASPI 7502

Query: 1083 EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATW 1142
             A+Y       D P PPT L   +   + VTLTW    D        Y + + D  T  W
Sbjct: 7503 TAKYQF-----DPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKW 7557

Query: 1143 YTAAER-VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQI 1194
                +  V    Y V GL   +KY FRV+A N  G  +P  S +  LI KD I
Sbjct: 7558 VRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILI-KDPI 7609



 Score =  196 bits (497), Expect = 2e-49
 Identities = 143/520 (27%), Positives = 238/520 (45%), Gaps = 28/520 (5%)

Query: 698   LDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGK 757
             L+ P+PP    E L+++ S V + W  PKD+GG  VT + +ER+      W++  +    
Sbjct: 23954 LNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQIT 24013

Query: 758   VTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEE-VFAGNPIEPPGFASQPQVTDVTKE 816
              T ++   +     YQFRI+A N  G+S+     E V   +P + P    + ++  ++K+
Sbjct: 24014 TTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKD 24073

Query: 817   AVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRV 876
             +VT+ W  P  DGG  +LGY VE R+ G + W   NK+ I+  + T+ GLLE TEYEFRV
Sbjct: 24074 SVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRV 24133

Query: 877   IAVNKAGPGQPSVPSSSVVAK-DPVKPPGLVQDLH-----VSDSSNSSISLAWREPAEGD 930
              A N+ G  +P   + S+  K    + PG+ +++      + +++  S  +  R      
Sbjct: 24134 FAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGR------ 24187

Query: 931   PPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKY--FFRIRAVNEAGVGEPVE 988
              P   I   R       S+  K+   G  +T+  + E Q+    +   A NE G     E
Sbjct: 24188 -PLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVG-----E 24241

Query: 989   LDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGR 1048
             ++   + +   A P+F     LK       G+ L +H  + G P P + W       +  
Sbjct: 24242 VETSSKLLLQ-ATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNS 24300

Query: 1049  ETIT-KSKNHSQFLI--NSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLF 1105
             E IT ++  H   L+  N  +++ +G Y++ L N FG     + V + D P  PT   + 
Sbjct: 24301 ENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVI 24360

Query: 1106  EEV-PNTVTLTWNHSPDVQEDGEAHYIIMKRDAST-ATWYTAAERVFSNKYTVTGLLPGR 1163
             E +  N+  ++W    D       +Y++ K +A   A W   +  +      +  L    
Sbjct: 24361 EALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENA 24420

Query: 1164  KYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKP 1203
              YYFRV A+N  G S+PL+     +I K   +   A  KP
Sbjct: 24421 GYYFRVSAQNTFGISDPLEVSSVVII-KSPFEKPGAPGKP 24459



 Score =  195 bits (496), Expect = 2e-49
 Identities = 163/617 (26%), Positives = 271/617 (43%), Gaps = 43/617 (6%)

Query: 701   PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTN 760
             P PP+   E   ++   + + W  P  +GG  +  +IVERR    + WIK  +       
Sbjct: 15283 PDPPKNP-EVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLR 15341

Query: 761   FSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVF-AGNPIEPPGFASQPQVTDVTKEAVT 819
             +  + + EG  Y+FRI+A N+ G+S P  T   + A + +  PG    P+V D ++ +++
Sbjct: 15342 YKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFKPGPPGNPRVLDTSRSSIS 15401

Query: 820   ITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDP-IQGTKCTVDGLLEDTEYEFRVIA 878
             I WN P  DGG+ + GY+VE      + W  V     ++ T  T+ GL E+ EY+ R+ A
Sbjct: 15402 IAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYA 15461

Query: 879   VNKAGPGQPSVPSSSVVAKDPVKPPG--LVQDLHVSDSSNSSISLAWREPAEGDPPSGYI 936
             +N  G G+P++   +  A+D + PP   L  DL    +  +  +L    P +G P     
Sbjct: 15462 MNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPE-- 15519

Query: 937   LEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAM 996
             ++   +  +   K +    S     + G + R      I  V  +   +   ++  VR +
Sbjct: 15520 VKWARDHGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVN--VRVL 15577

Query: 997   PPPAAPKFDLSARLKSHMVVRAGTALCIHAAF--SGSPPPDVIWQKDGVPTKGRETITKS 1054
               P  P+      LK   V +    L         GS   + I +K     K   T+  +
Sbjct: 15578 DTPGPPQ-----DLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATN 15632

Query: 1055  KNHSQFLINSTKRSDSGVYRILLQNEFG---EARYDIHVRVADFPRPPTNLRLFEEVPNT 1111
              + + + ++  +   S  +R+L +NE+G    A     V+ ++ P PP  + L +   N+
Sbjct: 15633 CHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITLMDVTRNS 15692

Query: 1112  VTLTWNHSPDVQEDGEAH---YIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFR 1168
             V+L+W      + DG +    YI+  +   +  W T A  V   + T+TGL+ G +Y FR
Sbjct: 15693 VSLSWEKP---EHDGGSRILGYIVEMQTKGSDKWATCAT-VKVTEATITGLIQGEEYSFR 15748

Query: 1169  VVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQ 1228
             V A+NE G S+P              + LS    P   KD    P F       TVL G+
Sbjct: 15749 VSAQNEKGISDP--------------RQLSV---PVIAKDLVIPPAFKLLFNTFTVLAGE 15791

Query: 1229  DCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVE 1288
             D  +   F+G P P VT +K +V +   ++    ST     L I     +D G Y V + 
Sbjct: 15792 DLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLT 15851

Query: 1289  NELGKDRSSCTLTVYDK 1305
             N  G+   +  + V DK
Sbjct: 15852 NSAGEAIETLNVIVLDK 15868



 Score =  193 bits (491), Expect = 8e-49
 Identities = 124/393 (31%), Positives = 189/393 (48%), Gaps = 9/393 (2%)

Query: 799   IEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQG 858
             ++ PG     +V+++ K++  +TW  P  DGG+ +  Y+VERR   S  W P++    + 
Sbjct: 10935 LDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKK 10994

Query: 859   TKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSS 918
             +      L E  +Y FRV A N+ G G        + A DP+ PPG  +DLH  D   + 
Sbjct: 10995 SHFAKH-LNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTE 11053

Query: 919   ISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIR 976
             +SL W +P    G P +GY++E + E T++W K   +  +     V GL + + Y FR++
Sbjct: 11054 VSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKTV--TNLECVVTGLQQGKTYRFRVK 11111

Query: 977   AVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDV 1036
             A N  G+G P +    +        P  +L  +L   +VV+AGT +   A   G P P  
Sbjct: 11112 AENIVGLGLP-DTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTA 11170

Query: 1037  IWQKDGVPTKGRETIT-KSKNHSQFL-INSTKRSDSGVYRILLQNEFGEARYDIHVRVAD 1094
              W  DG   K  E  T ++ N S  L I +  R D+G Y+I + N  G     +H+ V D
Sbjct: 11171 KWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLD 11230

Query: 1095  FPRPPTN-LRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNK 1153
              P PPT  + + +  P  +T++W    D       +YI+ K+D    TW   +      K
Sbjct: 11231 VPGPPTGPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTK 11290

Query: 1154  YTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDT 1186
               +  L  G +Y FRV A N+IG   PLDS  T
Sbjct: 11291 LKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPT 11323



 Score =  193 bits (491), Expect = 8e-49
 Identities = 194/806 (24%), Positives = 335/806 (41%), Gaps = 105/806 (13%)

Query: 546   WLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTID 605
             W KDG  +    G+++  Q  +  L   S+  +  G YT  A+ +    S       TI 
Sbjct: 12957 WKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSA------TIK 13010

Query: 606   PSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKD----GMEVT-----EEERVSM 656
               VL+         K G  A +K+         ++W       G E+T     + E    
Sbjct: 13011 LKVLD---------KPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRP 13061

Query: 657   ERGEDQALLTISNC-----VREDSGLILLKLKNDHGSATATL-HLSVLDRPKPPQGRVE- 709
                +  A + I++C     +        +  +N +G         ++   P  P GR + 
Sbjct: 13062 NWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDP 13121

Query: 710   --FLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVE 767
                  ++   + + WK P D+GG P+T +++E+R     +W K+              ++
Sbjct: 13122 PVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQ 13181

Query: 768   EGKAYQFRILAVNSEGVSDPLETEEV-FAGNPIEPPGFASQPQVTDVTKEAVTITWNAPT 826
             EG  Y+FR+ A+N  G   P +  +  +A +P  PPG  + P+V D T+ +V+++W  P 
Sbjct: 13182 EGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGPPAFPKVYDTTRSSVSLSWGKPA 13241

Query: 827   QDGGAPVLGYIVERRKKGSNLWVPVN-KDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPG 885
              DGG+P++GY+VE ++  S+ WV  N    +Q T+  V GL+EDT+Y+FRV AVNK G  
Sbjct: 13242 YDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLMEDTQYQFRVYAVNKIGYS 13301

Query: 886   QPSVPSSSVVAKDPVKPPG--LVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRAED 943
              PS        KD + PP   L  DL  +    + +++    P +G PP           
Sbjct: 13302 DPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTMRLYVPVKGRPPPKIT------- 13354

Query: 944   TKEWSKCTKIPISGTCYTVGGLIERQKY--FFRIRAVNEAGVGEPV----------ELDK 991
                WSK    P       +G  I+   +  F R   VN+   G+ +          E   
Sbjct: 13355 ---WSK----PNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTI 13407

Query: 992   GVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETI 1051
              V+ +  P  P   ++  +K      A           GSP  + + QK     K   T+
Sbjct: 13408 VVKVLDTPGPP---VNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTV 13464

Query: 1052  TKSKNHSQFLINSTKRSDSGVYRILLQNEFG-----EARYDIHVRVADFPRPPTNLRLFE 1106
             T   + + F + + +   S  +R+  +NE+G     E R    V+ +  P P  +L++  
Sbjct: 13465 TTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGETRDA--VKASQTPGPVVDLKVRS 13522

Query: 1107  EVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTAT--WYTAAERVFSNKYTVTGLLPGRK 1164
                ++ ++ W        DG +  I    D  T    W    + + S +Y+   L  G++
Sbjct: 13523 VSKSSCSIGWKKP---HSDGGSRIIGYVVDFLTEENKWQRVMKSL-SLQYSAKDLTEGKE 13578

Query: 1165  YYFRVVARNEIGDSEPLDSRDTWLINKDQI--QDLSAKLKP---YEKKDWRHAPRFVTPL 1219
             Y FRV A NE G+  P    +  ++ +D +   DL  K  P   Y  K+  +  R   P+
Sbjct: 13579 YTFRVSAENENGEGTP---SEITVVARDDVVAPDLDLKGLPDLCYLAKENSNF-RLKIPI 13634

Query: 1220  KPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKD 1279
             K                 G P P+V+  KG+  +  +++    S++   TL++  C   D
Sbjct: 13635 K-----------------GKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSD 13677

Query: 1280  SGDYSVLVENELGKDRSSCTLTVYDK 1305
             +G Y++ ++N  G    + ++ V  K
Sbjct: 13678 AGKYTITLKNVAGTKEGTISIKVVGK 13703



 Score =  193 bits (490), Expect = 1e-48
 Identities = 138/458 (30%), Positives = 214/458 (46%), Gaps = 43/458 (9%)

Query: 749   IKIGEVDGKV------------TNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAG 796
             +K G+VDG++            T+   + V    + ++ +   NS G      T  V   
Sbjct: 16602 VKWGKVDGEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRV--- 16658

Query: 797   NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
               ++ P      +VT++TK++V+ITW  P  DGG+ +  YIVE+R+     +  V  +  
Sbjct: 16659 --LDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTN-C 16715

Query: 857   QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
                   +D L E   Y FRV A N+ G G P+  +  +   +  +PPG +    V D + 
Sbjct: 16716 HKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKIT---VDDVTR 16772

Query: 917   SSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFR 974
             +S+SL+W +P    G     YI+EM+A+ +++WS+C ++       T   L + ++Y FR
Sbjct: 16773 NSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVIT--NLTQGEEYLFR 16830

Query: 975   IRAVNEAGVGEPVELDKGVRA----MPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSG 1030
             + AVNE G  +P  L   + A    + P   P F       S   V+ G  L I    SG
Sbjct: 16831 VVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAF-------SSYSVQVGQDLKIEVPISG 16883

Query: 1031  SPPPDVIWQKDGVPTK--GRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDI 1088
              P P + W KDG+P K   R  +T S + +   I  T + D G Y I + N  G+    I
Sbjct: 16884 RPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASI 16943

Query: 1089  HVRVADFPRPPTNLRLFEEV-PNTVTLTWNHSPDVQEDG--EAHYIIMKRDASTATWYTA 1145
              +   D P PP     F++V   ++TL+WN  P +   G    +YI+ KRD +T  W   
Sbjct: 16944 EIVTLDKPDPPKGPVKFDDVSAESITLSWN--PPLYTGGCQITNYIVQKRDTTTTVWDVV 17001

Query: 1146  AERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
             +  V      VT L  G +Y FR+ A N  G S  L+S
Sbjct: 17002 SATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALES 17039



 Score =  191 bits (486), Expect = 3e-48
 Identities = 152/474 (32%), Positives = 218/474 (45%), Gaps = 34/474 (7%)

Query: 730   GRPVTQF-IVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVS--- 785
             G P+  F IV  R   K +W K+G +D  V     + V+      F ++  ++   S   
Sbjct: 12249 GCPIRLFAIVRGRPAPKVTWRKVG-IDNVVRKGQVDLVD---TMAFLVIPNSTRDDSGKY 12304

Query: 786   -----DPLETEEVFAG-NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVE 839
                  +P   + VF     ++ PG  S  +V+DVTK +  ++W  P  DGG+ V  YIVE
Sbjct: 12305 SLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVE 12364

Query: 840   RRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDP 899
             +R+     W  V  + ++ T   V  L+   EY FRV AVN+ GPG P+     V+A DP
Sbjct: 12365 KREADRKTWSTVTPE-VKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDP 12423

Query: 900   VKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAED--TKEWSKCTKIPI 955
             +  P   + L V++ + +S +LAW  P    G    GYI   R E+     W++ +   +
Sbjct: 12424 LSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYS--VV 12481

Query: 956   SGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMV 1015
                   V GL E +KY FR+ A N  GV  P E +    A      PK      +   + 
Sbjct: 12482 KDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKI----LMPEQIT 12537

Query: 1016  VRAGTALCIHAAFSGSPPPDVIWQK--DGVPTKGRETITKSKNHSQFLINSTKRSDSGVY 1073
             ++AG  L I A   G P P   W+K  D V T     + K+ + S  +I    R DSG Y
Sbjct: 12538 IKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYY 12597

Query: 1074  RILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEV-PNTVTLTWNHSPDVQEDGEA---H 1129
              +  +N  G     I V V D P PP       ++  +  +L+W H P   EDG +   +
Sbjct: 12598 SLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSW-HIP--LEDGGSNITN 12654

Query: 1130  YIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
             YI+ K D S   W TA   V      V  L+PG++Y FRV A N  G SEPL S
Sbjct: 12655 YIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPLTS 12708



 Score =  191 bits (485), Expect = 4e-48
 Identities = 165/599 (27%), Positives = 252/599 (42%), Gaps = 54/599 (9%)

Query: 609   LEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTIS 668
             L+A     I V  G    I     GKP P VTW  +  E T  +  ++E     + + I 
Sbjct: 10154 LDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMN--ERTLPQEATIETTAISSSMVIK 10211

Query: 669   NCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDN 728
             NC R   G+  L  KN+ G    T+ + VLD P P         L+     + W +P+D+
Sbjct: 10212 NCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDD 10271

Query: 729   GGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPL 788
             GG P+T +++E+R   +++W  +     +  N +   + +GKAY FRI A NS G+   +
Sbjct: 10272 GGSPITNYVIEKRESDRRAWTPVTYTVTR-QNATVQGLIQGKAYFFRIAAENSIGMGPFV 10330

Query: 789   ETEEVFA-GNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNL 847
             ET E      PI  P      +V +VTK  VT+TWN P  DGG+ ++ Y++E R  G+  
Sbjct: 10331 ETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEK 10390

Query: 848   WVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQ 907
             +  V  D +   K TV GL E   YE+RV AVN  G G+PS  +  +  KD + PP L  
Sbjct: 10391 FHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHL 10450

Query: 908   DLH--VSDSSNSSISLAWREPAEGDPPSGYILEMR--AEDTKEWSKCTKIPI-------- 955
             D    ++     + +L  R   +  P   +  +     ED +   K T   +        
Sbjct: 10451 DFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAK 10510

Query: 956   ---SGT-CYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLK 1011
                SG  C  V      +K F ++  V+  G              PP     FD     K
Sbjct: 10511 RSDSGKYCVVVENSTGSRKGFCQVNVVDRPG--------------PPVGPVSFD--EVTK 10554

Query: 1012  SHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSG 1071
              +MV+     L       GS   + I +K  V       +T +   +   ++        
Sbjct: 10555 DYMVISWKPPL----DDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDY 10610

Query: 1072  VYRILLQNEFG--------EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQ 1123
             ++RI  +N +G          +     RV D P  P    + E   ++  +TWN   D  
Sbjct: 10611 IFRIHAENLYGISDPLVSDSMKAKDRFRVPDAPDQPI---VTEVTKDSALVTWNKPHDGG 10667

Query: 1124  EDGEAHYIIMKRDASTATWYTAAERVFS--NKYTVTGLLPGRKYYFRVVARNEIGDSEP 1180
             +    +YI+ KR+  +  W    +       K+ V  LL G +Y FRV A NEIG  +P
Sbjct: 10668 KP-ITNYILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDP 10725



 Score =  191 bits (484), Expect = 5e-48
 Identities = 126/394 (31%), Positives = 187/394 (47%), Gaps = 11/394 (2%)

Query: 797   NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
             N ++ PG     +VT+VTKE  TI+W  P  +GG+ +  +IVE RK     W  V  D  
Sbjct: 11625 NVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVT 11684

Query: 857   QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN 916
             +  +     LL + EY FRV A NK G G      + ++A +P+  PG  ++LH++D   
Sbjct: 11685 K--RLIKANLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGK 11742

Query: 917   SSISLAWREP--AEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFR 974
             + + L WR P    G P   Y +E R + + +W +  K  I  T Y V   +E Q Y FR
Sbjct: 11743 TFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFR 11802

Query: 975   IRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPP 1034
             ++  NE G  + V+ ++ V        P  DL  +L   + V+AG  + + A   G P P
Sbjct: 11803 VQTKNEGGESDWVKTEE-VVVKEDLQKPVLDL--KLSGVLTVKAGDTIRLEAGVRGKPFP 11859

Query: 1035  DVIWQKDGVPT----KGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHV 1090
             +V W KD   T      R  I    + S+F +   KRSD G Y +   N  G       V
Sbjct: 11860 EVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATV 11919

Query: 1091  RVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVF 1150
              V D P P  NL++ +   +  T+ W+   D       +YI+ K +     W T +  V 
Sbjct: 11920 NVLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVL 11979

Query: 1151  SNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSR 1184
             +   TVT L+ G +Y FRV A N+IG   P +S+
Sbjct: 11980 TPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESK 12013



 Score =  189 bits (481), Expect = 1e-47
 Identities = 158/580 (27%), Positives = 258/580 (44%), Gaps = 42/580 (7%)

Query: 619   VKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLI 678
             V+ G +  + + ++G+P P   W K    ++   R  +   +  + LT+ NC R D+G  
Sbjct: 21997 VRAGASIRLFIAYQGRPTPTAVWSKPDSNLSL--RADIHTTDSFSTLTVENCNRNDAGKY 22054

Query: 679   LLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIV 738
              L ++N+ GS + T  + VLD P PP G + F +++     + W AP  +GG  +  ++V
Sbjct: 22055 TLTVENNSGSKSITFTVKVLDTPGPP-GPITFKDVTRGSATLMWDAPLLDGGARIHHYVV 22113

Query: 739   ERRAVGKKSWIKIGEVDGKVTN--FSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAG 796
             E+R   ++SW  I E   K T   F  N + EG  Y FR+ AVN  GV +P E  E    
Sbjct: 22114 EKREASRRSWQVISE---KCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVA 22170

Query: 797   NPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPI 856
                E P    +  V D +K +  + W  P  DGG+ + GY++E R+KGS+ WV       
Sbjct: 22171 T--EQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGH--T 22226

Query: 857   QGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPP-----GLVQDLHV 911
             +    TV+ L+E TEYEFRV A N AG  +P    SSV+ K+P   P     G+   L +
Sbjct: 22227 KQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQL-I 22285

Query: 912   SDSSNSSISLAWREPAEGDPP---SGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIER 968
             +  + S  ++    P  G P    +  + EMR ++T   S  T      T  TV   +  
Sbjct: 22286 TCKAGSPFTI--DVPISGRPAPKVTWKLEEMRLKETDRVSITT--TKDRTTLTVKDSMRG 22341

Query: 969   QKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAF 1028
                 + +   N AGV +   +   V   P P     ++S+      V+  G         
Sbjct: 22342 DSGRYFLTLENTAGV-KTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEP----KDG 22396

Query: 1029  SGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEAR-YD 1087
              G+   + I +K    T   + +  S   +Q  +    +     +R+  +N FG ++  +
Sbjct: 22397 GGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE 22456

Query: 1088  IHVRVADF----PRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH---YIIMKRDASTA 1140
                 +A+     P  PT   ++    N +++ W    +   DG +    Y + K++ +T 
Sbjct: 22457 SAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWE---EPYHDGGSKIIGYWVEKKERNTI 22513

Query: 1141  TWYTAAE-RVFSNKYTVTGLLPGRKYYFRVVARNEIGDSE 1179
              W    +       Y VTGL+ G +Y FR  A N  G S+
Sbjct: 22514 LWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSK 22553



 Score =  189 bits (480), Expect = 2e-47
 Identities = 192/770 (24%), Positives = 305/770 (39%), Gaps = 73/770 (9%)

Query: 570   LIFPSMGPEHEGKYTFRAKGTESEAS------VFIADPPTIDPSVLEALAAHAITVKVGH 623
             L+ P       G YT  A      AS      V     P + P   E+++A  +T+    
Sbjct: 9809  LVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSW-- 9866

Query: 624   TAHIKVPFRGKPLPKVTWYK-DGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKL 682
                   P +     K+T Y  +  E   +  V +     +   TI   +     +  +  
Sbjct: 9867  -----FPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMA 9921

Query: 683   KNDHGSA--------TATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVT 734
             +N +G          TA    SV   P  P        ++ + + + W+ P+ +GG PVT
Sbjct: 9922  QNKYGIGEPLDSEPETARNLFSVPGAPDKPT----VSSVTRNSMTVNWEEPEYDGGSPVT 9977

Query: 735   QFIVERRAVGKKSWIKIGEVDGKV----TNFSTNKVEEGKAYQFRILAVNSEGVSDP-LE 789
              + +E +    K W ++     K      ++    + EG  YQFR+ A+N+ GV    L 
Sbjct: 9978  GYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLP 10037

Query: 790   TEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWV 849
             ++   A +PI PPG    P+VTD TK +  + W+ P +DGG+ V GYIVE +++G   W 
Sbjct: 10038 SDPATARDPIAPPG-PPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWE 10096

Query: 850   PVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDL 909
                   ++GTK  V GL E   Y+FRV AVN AG G+P   +  +  KD +  P L  D 
Sbjct: 10097 KGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDA 10156

Query: 910   HVSDSSNSSISLAWREPA--EGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIE 967
              V D          R  A   G PP      M      + +      IS +   +     
Sbjct: 10157 SVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSSM-VIKNCQR 10215

Query: 968   RQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAA 1027
               +  + + A NEAG  +   +   V  +P P    F       +H +      L   + 
Sbjct: 10216 SHQGVYSLLAKNEAGERKKTII-VDVLDVPGPVGTPF------LAHNLTNESCKLTWFSP 10268

Query: 1028  FS--GSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFG--- 1082
                 GSP  + + +K     +    +T +       +    +  +  +RI  +N  G   
Sbjct: 10269 EDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGP 10328

Query: 1083  --EARYDIHVRVA-DFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDA 1137
               E    + +R     P  P +L + E   NTVTLTWN  P   + G    +Y++  R  
Sbjct: 10329 FVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWN--PPKYDGGSEIINYVLESRLI 10386

Query: 1138  STATWYTAA-ERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQD 1196
              T  ++    + + S KYTV GL  G  Y +RV A N +G  +P                
Sbjct: 10387 GTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKP---------------- 10430

Query: 1197  LSAKLKPYEKKDWRHAPRFVTPLKPHTVLR-GQDCTMTCAFLGNPRPTVTLYKGDVNITA 1255
              S   KP   KD    P      +    +R G+   +T  + G P+P V+ +K + ++  
Sbjct: 10431 -SFCTKPITCKDELAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLE 10489

Query: 1256  NSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDK 1305
             + +    +T     L        DSG Y V+VEN  G  +  C + V D+
Sbjct: 10490 DDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDR 10539



 Score =  188 bits (477), Expect = 3e-47
 Identities = 110/321 (34%), Positives = 176/321 (54%), Gaps = 12/321 (3%)

Query: 590  TESEASVFIADP---PTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGM 646
            +E   +V   DP   PTID      L  H I V  G    I VPFR  P+P V+W+KDG 
Sbjct: 8000 SEISENVVAKDPDCKPTID------LETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGK 8053

Query: 647  EVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQG 706
            EV   +R++M+     A L +   VR D+G+  + L+N  GSATA++++ V+  P P + 
Sbjct: 8054 EVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKD 8113

Query: 707  RVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKV 766
             ++  +++ S   + W+ P+ +GG P+  +++ERR  G++++I +   + K++    + +
Sbjct: 8114 -IKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLI 8172

Query: 767  EEGKAYQFRILAVNSEGVSDPLETEE-VFAGNPIEPPGFASQPQVTDVTKEAVTITWNAP 825
              G+ Y FR+ AVN  G  + +E +  V A +P +PP      +V + T EA+TITW  P
Sbjct: 8173 PNGE-YFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPP 8231

Query: 826  TQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPG 885
              DGG+ ++GYI+E+  KG   W   N+  +     T  GL E  EY+FRV A N AG  
Sbjct: 8232 LYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGIS 8291

Query: 886  QPSVPSSSVVAKDPVKPPGLV 906
            +PS  +    A DP+  P ++
Sbjct: 8292 EPSRATPPTKAVDPIDAPKVI 8312



 Score =  187 bits (475), Expect = 6e-47
 Identities = 164/601 (27%), Positives = 274/601 (45%), Gaps = 52/601 (8%)

Query: 601   PPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGE 660
             PP I+   L+A     +T++   T  + VP +G+P P+V W +D  E    ++ S+E   
Sbjct: 15485 PPEIE---LDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGE--SLDKASIESTS 15539

Query: 661   DQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHM 720
                LL + N  R DSG  +L ++N  GS +A +++ VLD P PPQ  ++  E++ + V +
Sbjct: 15540 SYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQD-LKVKEVTKTSVTL 15598

Query: 721   KWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVN 780
              W  P  +GG  +  +IVE+R   +K++  +     K T++  ++++EG +Y FR+LA N
Sbjct: 15599 TWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHK-TSWKVDQLQEGCSYYFRVLAEN 15657

Query: 781   SEGVSDPLET-EEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVE 839
               G+  P ET E V A     PPG   +  + DVT+ +V+++W  P  DGG+ +LGYIVE
Sbjct: 15658 EYGIGLPAETAESVKASERPLPPG---KITLMDVTRNSVSLSWEKPEHDGGSRILGYIVE 15714

Query: 840   RRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDP 899
              + KGS+ W       ++ T+ T+ GL++  EY FRV A N+ G   P   S  V+AKD 
Sbjct: 15715 MQTKGSDKWATC--ATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDL 15772

Query: 900   VKPPGLV-----------QDLHVSDS--SNSSISLAWREPAEGDPPSGYILEMRAEDTKE 946
             V PP              +DL V        + ++ W    + + P      + AE T+ 
Sbjct: 15773 VIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWH---KDNVPLKQTTRVNAESTEN 15829

Query: 947   WSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVE-LDKGVRAMPPPAAPKFD 1005
              S  T   I   C    G        + ++  N A  GE +E L+  V   P P      
Sbjct: 15830 NSLLT---IKDACREDVG-------HYVVKLTNSA--GEAIETLNVIVLDKPGPPTGPVK 15877

Query: 1006  LSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINST 1065
             +       + +  G          GS   + I +K    T   + ++ +   +       
Sbjct: 15878 MDEVTADSITLSWGPP----KYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRL 15933

Query: 1066  KRSDSGVYRILLQNEFGEARY-DIHVRVADF----PRPPTNLRLFEEVPNTVTLTWNHSP 1120
             K      +RI  +N +G++ Y +    VA +    P PP    +     +++ + WN   
Sbjct: 15934 KTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPI 15993

Query: 1121  DVQEDGEAHYIIMKRDASTATWYTAAER-VFSNKYTVTGLLPGRKYYFRVVARNEIGDSE 1179
                      Y + +++ ++  W    +  +   K+  TGL  G +Y FRV A N +G  +
Sbjct: 15994 SDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGK 16053

Query: 1180  P 1180
             P
Sbjct: 16054 P 16054



 Score =  187 bits (474), Expect = 8e-47
 Identities = 184/687 (26%), Positives = 294/687 (42%), Gaps = 94/687 (13%)

Query: 560   QIVKQGAVHKLIFPSMGPEHEGKYTFRAKGT------------ESEASVFIADPPTIDPS 607
             +I K   + +  F   G     +Y FR K              ES  +  I  PP ++  
Sbjct: 11480 RINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVE-- 11537

Query: 608   VLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTI 667
              L+      ITV+VG T  I    +G+P P +TW K+G  +  E+RV + +   +  L I
Sbjct: 11538 -LDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQI 11596

Query: 668   SNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKD 727
                VR D G  ++  KN  G A  +  ++VLDRP P Q          +C  + W+ P D
Sbjct: 11597 KEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCT-ISWENPLD 11655

Query: 728   NGGRPVTQFIVERRAVGKKSW-IKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSD 786
             NGG  +T FIVE R   +K W I   +V  ++   +     E   Y FR+ A N  GV  
Sbjct: 11656 NGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIKANLLANNE---YYFRVCAENKVGVGP 11712

Query: 787   PLETEE-VFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGS 845
              +ET+  + A NPI+ PG      + D  K  V + W  P  DGG+P L Y VERR KGS
Sbjct: 11713 TIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGS 11772

Query: 846   NLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGL 905
             + W  V+K  I+ T   VD  +E+  YEFRV   N+ G     V +  VV K+ ++ P  
Sbjct: 11773 DDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESD-WVKTEEVVVKEDLQKP-- 11829

Query: 906   VQDLHVSD----SSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYT 961
             V DL +S      +  +I L   E      P   +   + +D  + ++  ++ I     +
Sbjct: 11830 VLDLKLSGVLTVKAGDTIRL---EAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADS 11886

Query: 962   VGGLIERQKYF----FRIRAVNEAG----------VGEP----------VELDKGVRAMP 997
                 + + K      + + A N AG          + +P          V  D+      
Sbjct: 11887 SKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDRCTVCWD 11946

Query: 998   PPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNH 1057
             P   P+ D    ++++++ +  T   + + +S +           V T G  T+T+    
Sbjct: 11947 P---PEDDGGCEIQNYILEKCETKRMVWSTYSAT-----------VLTPG-TTVTRLIEG 11991

Query: 1058  SQFLINSTKRSDSGVYRILLQNEFG-----EARYDIHVRVADFPRPPTNLRLFEEVPNTV 1112
             +++           ++R+  +N+ G     E++  I     D P  P    + +     +
Sbjct: 11992 NEY-----------IFRVRAENKIGTGPPTESKPVIAKTKYDKPGRPDPPEVTKVSKEEM 12040

Query: 1113  TLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTAAERVF-SNKYTVTGLLPGRKYYFRV 1169
             T+ WN  P   + G++   Y + K++  +  W    +      +  V  LLP  +Y FRV
Sbjct: 12041 TVVWN--PPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRV 12098

Query: 1170  VARNEIGDSEP-LDSRDTWLINKDQIQ 1195
              A NEIG  EP L SR   ++ KD I+
Sbjct: 12099 KAENEIGIGEPSLPSRP--VVAKDPIE 12123



 Score =  185 bits (470), Expect = 2e-46
 Identities = 136/460 (29%), Positives = 206/460 (44%), Gaps = 20/460 (4%)

Query: 730   GRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLE 789
             GRP  +    R        ++I E     T  S +  +   A ++ +   NS G      
Sbjct: 17678 GRPTPEITWSREEGEFTDKVQI-EKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFV 17736

Query: 790   TEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWV 849
             T +V     ++ PG      V +V K++  + W  P  DGGA V  Y++++R+     + 
Sbjct: 17737 TVKV-----LDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYA 17791

Query: 850   PVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDL 909
              V+      T   V+ L E   Y FRV+A N+ G G P     +V A +P  PPG V   
Sbjct: 17792 NVSSK-CSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVT-- 17848

Query: 910   HVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIE 967
              ++D S +S SL W +P    G    GY++EM+ + T++WS   +  +     T  GL  
Sbjct: 17849 -LTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVT--GLSS 17905

Query: 968   RQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAA 1027
              Q+Y FR++A NE G  +P  L   V A      P   L     S   ++AG  L I   
Sbjct: 17906 GQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYS---IQAGEDLKIEIP 17962

Query: 1028  FSGSPPPDVIWQKDGVPTKG--RETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEAR 1085
               G P P++ W KDG P K   R  + ++   +   I    + D G Y +   N  G A 
Sbjct: 17963 VIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTAT 18022

Query: 1086  YDIHVRVADFPRPPTNLRLFEEVP-NTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYT 1144
              ++ V V + P PP     F+EV  + V ++W           ++YI+ KRD +T TW+ 
Sbjct: 18023 ENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHM 18082

Query: 1145  AAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSR 1184
              +  V      +T L  G +Y FR+ A N  G S PLDS+
Sbjct: 18083 VSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSK 18122



 Score =  184 bits (467), Expect = 5e-46
 Identities = 129/458 (28%), Positives = 206/458 (44%), Gaps = 17/458 (3%)

Query: 732   PVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETE 791
             P   + +  R + +++ I+   +   +   +  +  +G    + +LA N  G     E +
Sbjct: 10182 PTVTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGV---YSLLAKNEAG-----ERK 10233

Query: 792   EVFAGNPIEPPGFASQPQVT-DVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVP 850
             +    + ++ PG    P +  ++T E+  +TW +P  DGG+P+  Y++E+R+     W P
Sbjct: 10234 KTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTP 10293

Query: 851   VNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLH 910
             V    +     TV GL++   Y FR+ A N  G G     S ++V ++P+  P   +DL 
Sbjct: 10294 VTYT-VTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPERPEDLE 10352

Query: 911   VSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIER 968
             V + + ++++L W  P    G     Y+LE R   T+++ K T   +    YTV GL E 
Sbjct: 10353 VKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEG 10412

Query: 969   QKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAF 1028
               Y +R+ AVN  G G+P    K +      A P   L  R K  + +R G A  +   +
Sbjct: 10413 DTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDK--LTIRVGEAFALTGRY 10470

Query: 1029  SGSPPPDVIWQKD--GVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARY 1086
             SG P P V W KD   V    R  I  +           KRSDSG Y ++++N  G  + 
Sbjct: 10471 SGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKG 10530

Query: 1087  DIHVRVADFPRPPTNLRLFEEVPNT-VTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTA 1145
                V V D P PP     F+EV    + ++W    D       +YII K++     W   
Sbjct: 10531 FCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPV 10590

Query: 1146  AERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
                       V+ LL G+ Y FR+ A N  G S+PL S
Sbjct: 10591 TSASAKTTCKVSKLLEGKDYIFRIHAENLYGISDPLVS 10628



 Score =  183 bits (465), Expect = 8e-46
 Identities = 173/660 (26%), Positives = 266/660 (40%), Gaps = 74/660 (11%)

Query: 582   KYTFRAKGT----ESEASVFIADPPTID----PSVLEALAAH-AITVKVGHTAHIKVPFR 632
             KY FR K      ESE S    + P  D    P V   + A   +  K G    I    +
Sbjct: 9404  KYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIK 9463

Query: 633   GKPLPKVTW---------YKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLK 683
             G+P PK +W          KDG+    E+   +E  E+ +++ I  C R  +G   +  K
Sbjct: 9464  GRPTPKSSWEFDGKAKKAMKDGVHDIPED-AQLETAENSSVIIIPECKRSHTGKYSITAK 9522

Query: 684   NDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAV 743
             N  G  TA   + V+D P PP+         GSC  + WK P D+GG  +  +++E+R +
Sbjct: 9523  NKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSC-RLSWKMPDDDGGDRIKGYVIEKRTI 9581

Query: 744   GKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLET-EEVFAGNPIEPP 802
               K+W K+    G  T    + + E + Y FR+ A N  G+  P+ET +   A +PI PP
Sbjct: 9582  DGKAWTKVNPDCGSTTFVVPDLLSE-QQYFFRVRAENRFGIGPPVETIQRTTARDPIYPP 9640

Query: 803   GFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVE-------RRKKGSNLWVPVNKDP 855
                 + ++  +TK  V ++W  P  DGG+PV  YIVE         KK +  W   NK  
Sbjct: 9641  DPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEA--WRQCNKRD 9698

Query: 856   IQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPG--LVQDLHVSD 913
             ++  + TV+ L+E  EYEFRV AVN AG  +PS        + P  PP   L + + V +
Sbjct: 9699  VEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQRPDMPPSIDLKEFMEVEE 9758

Query: 914   SSNSSI----------SLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVG 963
              +N +I          +L W +     P +        E     +   K+ +  TC  V 
Sbjct: 9759  GTNVNIVAKIKGVPFPTLTWFKAPPKKPDN-------KEPVLYDTHVNKLVVDDTCTLVI 9811

Query: 964   GLIERQKY-FFRIRAVNEAGVGEPVELDKGVRAMP-PPAAPKFDLSARLKSHMVVRAGTA 1021
                 R     + I AVN  G     E+   V   P PP  P      + +S    +   +
Sbjct: 9812  PQSRRSDTGLYTITAVNNLGTASK-EMRLNVLGRPGPPVGP-----IKFESVSADQMTLS 9865

Query: 1022  LCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEF 1081
                     GS   + + +K     K    ++       + I         V+RI+ QN++
Sbjct: 9866  WFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKY 9925

Query: 1082  G-----EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRD 1136
             G     ++  +    +   P  P    +     N++T+ W             Y +  +D
Sbjct: 9926  GIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKD 9985

Query: 1137  ASTATWYTA-----AERVFSNKYTVTGLLPGRKYYFRVVARNEIG------DSEPLDSRD 1185
              ++  W                Y VTGL+ G  Y FRV A N  G       S+P  +RD
Sbjct: 9986  TTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARD 10045



 Score =  182 bits (463), Expect = 1e-45
 Identities = 168/649 (25%), Positives = 276/649 (42%), Gaps = 83/649 (12%)

Query: 582   KYTFRAKGTESEASVFIADPPTIDPSV------------LEALAAHAITVKVGHTAHIKV 629
             +Y FR     SE    + +P T+  SV            L+A     + ++   T  + V
Sbjct: 18701 EYNFRICAINSEG---VGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFV 18757

Query: 630   PFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSA 689
               +G+P P+V W K    +T+  R  +E      +L I N  R DSG   L L+N+ GS 
Sbjct: 18758 TIKGRPEPEVKWEKAEGILTD--RAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSK 18815

Query: 690   TATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWI 749
             TA +++ VLD P  P   +   E+    V + W+ P  +GG  +T +IVE+R   +K++ 
Sbjct: 18816 TAFVNVRVLDSPSAPVN-LTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYA 18874

Query: 750   KIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEE-VFAGNPIEPPGFASQP 808
              I     K T F    ++EG +Y FR+LA N  G+  P ET E V    P  PPG  +  
Sbjct: 18875 TITNNCTKTT-FRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVT-- 18931

Query: 809   QVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLE 868
              + DVT+   TI W  P  DGG+ + GY+VE + KGS  W    +  ++  + T+ GL  
Sbjct: 18932 -LVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQ--VKTLEATISGLTA 18988

Query: 869   DTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE 928
               EY FRV AVN+ G   P      V+A+D    P +    H       + ++  RE  +
Sbjct: 18989 GEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFH-------TFNVKAREQLK 19041

Query: 929   GDPPSGYILEMRAEDTKEWSK-------CTKIPISG----TCYTVGGLIERQKYFFRIRA 977
              D P     + R + T  W K        T++ +S     T  ++    +     + +  
Sbjct: 19042 IDVP----FKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCV 19097

Query: 978   VNEAG-VGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPP--- 1033
              N AG +  P+ +   V   P P  P             +R     C     S +PP   
Sbjct: 19098 SNSAGSITVPITII--VLDRPGPPGP-------------IRIDEVSCDSITISWNPPEYD 19142

Query: 1034  -----PDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARY-D 1087
                   + I +K    +     ++++   +   I          +R+  +N +G++ Y +
Sbjct: 19143 GGCQISNYIVEKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSE 19202

Query: 1088  IHVRVADF----PRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWY 1143
                 VA++    P PP   ++     +T+ +TW    +        Y +  ++ S+  W 
Sbjct: 19203 SSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWS 19262

Query: 1144  TAAERVFSN-KYTVTGLLPGRKYYFRVVARNEIG------DSEPLDSRD 1185
              A + + ++ +  V+GL  G  Y +RV A N  G        EP+ +RD
Sbjct: 19263 KANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARD 19311



 Score =  176 bits (447), Expect = 1e-43
 Identities = 152/630 (24%), Positives = 264/630 (41%), Gaps = 70/630 (11%)

Query: 701   PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTN 760
             P PP+ + E   ++ +   + WK P D+GG  +T + VERR      W++  +       
Sbjct: 14200 PGPPE-KPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDLR 14258

Query: 761   FSTNKVEEGKAYQFRILAVNSEGVSDPLE-TEEVFAGNPIEPPGFASQPQVTDVTKEAVT 819
                  ++EG  Y+FR+ A N  G+  P E ++ V   +   PPG  S P VTD TK++ +
Sbjct: 14259 CKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSAS 14318

Query: 820   ITWNAPTQDGGAPVLGYIVERRKKGSNLWVP-VNKDPIQGTKCTVDGLLEDTEYEFRVIA 878
             + W  P  DGG  + GY+VE +K G   W+       ++ T+  V  L    +Y FR+ A
Sbjct: 14319 LAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQFVVPDLQTKEKYNFRISA 14378

Query: 879   VNKAGPGQPSV-PSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPP----- 932
             +N AG G+P+V P   +V ++      L  +L  +    + +S+    P +G P      
Sbjct: 14379 INDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTW 14438

Query: 933   --SGYILEMRA--EDTKEWS-----KCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGV 983
                   L+ RA  E+T+ ++     +C +        T+     ++  F  +R ++  G 
Sbjct: 14439 TKDNINLKNRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGP 14498

Query: 984   G---EPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQK 1040
                  P ++ K    +     P  D  +R+ +++V                       +K
Sbjct: 14499 VLNLRPTDITKDSVTLHWDL-PLIDGGSRITNYIV-----------------------EK 14534

Query: 1041  DGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFG---EARYDIHVRVADFPR 1097
                  K   T T   +   + +          +R++ +NE+G          V+ ++ P 
Sbjct: 14535 REATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASEAPS 14594

Query: 1098  PPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH---YIIMKRDASTATWYTAAERVFSNKY 1154
             PP +L + +   +TV+L W   P  + DG +    Y+I  +   +  W T    V   + 
Sbjct: 14595 PPDSLNIMDITKSTVSLAW---PKPKHDGGSKITGYVIEAQRKGSDQW-THITTVKGLEC 14650

Query: 1155  TVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPR 1214
              V  L  G +Y F+V+A N  G S P +SR   +  +  + +L  +   Y+K     A  
Sbjct: 14651 VVRNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLR-GIYQKLVIAKA-- 14707

Query: 1215  FVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPT 1274
                         G +  +    LG P+PTVT  KGD  +    +  + +T+    L I  
Sbjct: 14708 ------------GDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINE 14755

Query: 1275  CTLKDSGDYSVLVENELGKDRSSCTLTVYD 1304
             C   DSG Y +   N +G+     T+ V+D
Sbjct: 14756 CVRSDSGPYPLTARNIVGEVGDVITIQVHD 14785



 Score =  174 bits (442), Expect = 4e-43
 Identities = 163/600 (27%), Positives = 259/600 (43%), Gaps = 61/600 (10%)

Query: 609   LEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTIS 668
             L+A     + ++ G T  + VP +G+P PK+TW K  + + +   + ++  +    L   
Sbjct: 13323 LDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCE 13382

Query: 669   NCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDN 728
             N  + D+G  +L L+N  G    T+ + VLD P PP   V   E+S    ++ W+ P  +
Sbjct: 13383 NVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVN-VTVKEISKDSAYVTWEPPIID 13441

Query: 729   GGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPL 788
             GG P+  ++V++R   +KSW  +     K T+F    +EEGK+Y FR+ A N  G+ DP 
Sbjct: 13442 GGSPIINYVVQKRDAERKSWSTVTTECSK-TSFRVANLEEGKSYFFRVFAENEYGIGDPG 13500

Query: 789   ETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLW 848
             ET +    +  + PG     +V  V+K + +I W  P  DGG+ ++GY+V+   +  N W
Sbjct: 13501 ETRDAVKAS--QTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTE-ENKW 13557

Query: 849   VPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGL--- 905
               V K      + +   L E  EY FRV A N+ G G PS    +VVA+D V  P L   
Sbjct: 13558 QRVMKS--LSLQYSAKDLTEGKEYTFRVSAENENGEGTPS--EITVVARDDVVAPDLDLK 13613

Query: 906   -VQDLHVSDSSNSSISLAWREPAEGDP-PSGYILEMRAEDTKEWSKCTKIPIS--GTCYT 961
              + DL      NS+  L  + P +G P PS  +   + ED         +  S   T   
Sbjct: 13614 GLPDLCYLAKENSNFRL--KIPIKGKPAPS--VSWKKGEDPLATDTRVSVESSAVNTTLI 13669

Query: 962   VGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAP-KFDLSARLKSHMVVRAGT 1020
             V    +     + I   N AG  E     K V     P  P KFD        +   A T
Sbjct: 13670 VYDCQKSDAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFD-------EVTAEAMT 13722

Query: 1021  ALCIHAAFSGSPPPD---------VIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSG 1071
                       +PP D         ++ ++D V  K   T   +   + F +         
Sbjct: 13723 -------LKWAPPKDDGGSEITNYILEKRDSVNNKW-VTCASAVQKTTFRVTRLHEGMEY 13774

Query: 1072  VYRILLQNEFG----------EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPD 1121
              +R+  +N++G           AR+     V D P PP    + +   ++V+LTW     
Sbjct: 13775 TFRVSAENKYGVGEGLKSEPIVARHPFD--VPDAPPPP---NIVDVRHDSVSLTWTDPKK 13829

Query: 1122  VQEDGEAHYIIMKRDASTATWYTAAER-VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEP 1180
                     Y +  ++ ++  W  A +  +    + VTGL  G +Y FRV+A N  G  +P
Sbjct: 13830 TGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKP 13889



 Score =  174 bits (440), Expect = 7e-43
 Identities = 143/479 (29%), Positives = 208/479 (43%), Gaps = 77/479 (16%)

Query: 743  VGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPP 802
            V KKS + I  VD K ++  T  +E          AVN  G         V   N ++ P
Sbjct: 7370 VPKKSTVTI--VDSKRSDTGTYIIE----------AVNVCG-----RATAVVEVNVLDKP 7412

Query: 803  GFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCT 862
            G  +   +TDVT E+  +TWN P  DGG+ +  Y+VERR   S +W  ++   ++ T   
Sbjct: 7413 GPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSST-VKDTNFK 7471

Query: 863  VDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLA 922
               L+ + EY FRV A N  G G+P V +S + AK    PPG    L  SD +  +++L 
Sbjct: 7472 ATKLIPNKEYIFRVAAENMYGVGEP-VQASPITAKYQFDPPGPPTRLEPSDITKDAVTLT 7530

Query: 923  WREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNE 980
            W EP +  G P +GY +E    DT +W +C K+P+  T Y V GL  ++KY FR+ A N 
Sbjct: 7531 WCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENL 7590

Query: 981  AGVG------EPVELDKGVRAMPPPAAP-----------------KFDLSARLKSHMV-- 1015
            AG G      EP+ +   +    PP  P                 + D  A+++S+++  
Sbjct: 7591 AGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEM 7650

Query: 1016 VRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRI 1075
            ++ GT   +  A             +GVPT            +Q L+          +R+
Sbjct: 7651 LKTGTDEWVRVA-------------EGVPT------------TQHLLPGLMEGQEYSFRV 7685

Query: 1076 LLQNEFGEARYD-----IHVRVADFP-RPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH 1129
               N+ GE+        +  R   +P  PP  L +     NT  L W            +
Sbjct: 7686 RAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITN 7745

Query: 1130 YIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWL 1188
            YI+ KRD     W T    V   K TVT L  G  Y FRV A N IG S+  +  D+ L
Sbjct: 7746 YIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVL 7804



 Score =  174 bits (440), Expect = 7e-43
 Identities = 141/466 (30%), Positives = 208/466 (44%), Gaps = 32/466 (6%)

Query: 730   GRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFST-------NKVEEGKAYQFRILAVNSE 782
             GRP  +    +  V  +   +IG +D K T+F T       NK + GK   + +   NS 
Sbjct: 13347 GRPPPKITWSKPNVNLRD--RIG-LDIKSTDFDTFLRCENVNKYDAGK---YILTLENSC 13400

Query: 783   GVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRK 842
             G     + E       ++ PG      V +++K++  +TW  P  DGG+P++ Y+V++R 
Sbjct: 13401 G-----KKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRD 13455

Query: 843   KGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKP 902
                  W  V  +    T   V  L E   Y FRV A N+ G G P     +V A    + 
Sbjct: 13456 AERKSWSTVTTE-CSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGETRDAVKAS---QT 13511

Query: 903   PGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCY 960
             PG V DL V   S SS S+ W++P    G    GY+++   E+ K W +  K       Y
Sbjct: 13512 PGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTEENK-WQRVMKS--LSLQY 13568

Query: 961   TVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGT 1020
             +   L E ++Y FR+ A NE G G P E+   V A     AP  DL        + +  +
Sbjct: 13569 SAKDLTEGKEYTFRVSAENENGEGTPSEIT--VVARDDVVAPDLDLKGLPDLCYLAKENS 13626

Query: 1021  ALCIHAAFSGSPPPDVIWQK--DGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQ 1078
                +     G P P V W+K  D + T  R ++  S  ++  ++   ++SD+G Y I L+
Sbjct: 13627 NFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLK 13686

Query: 1079  NEFGEARYDIHVRVADFPRPPTNLRLFEEV-PNTVTLTWNHSPDVQEDGEAHYIIMKRDA 1137
             N  G     I ++V   P  PT    F+EV    +TL W    D       +YI+ KRD+
Sbjct: 13687 NVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDS 13746

Query: 1138  STATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDS 1183
                 W T A  V    + VT L  G +Y FRV A N+ G  E L S
Sbjct: 13747 VNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKS 13792



 Score =  172 bits (437), Expect = 1e-42
 Identities = 175/656 (26%), Positives = 265/656 (40%), Gaps = 95/656 (14%)

Query: 701  PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIG-----EVD 755
            P PP G+ + L  +   + + W  P DNGG P+T + +E+R  G   W ++      +V 
Sbjct: 9227 PGPP-GKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVG 9285

Query: 756  GKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLE-TEEVFAGNPIEPPGFASQPQVTDVT 814
             K   F+  ++ EG  YQFR +A+N+ G+  P E ++   AG+PI PPG  S P+V D T
Sbjct: 9286 LKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPPGPPSCPEVKDKT 9345

Query: 815  KEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDP--IQGTKCTVDGLLEDTEY 872
            K ++++ W  P +DGG+P+ GYIVE +++G+  W  VN+    I   +C V  L E  +Y
Sbjct: 9346 KSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCECVVPNLKELRKY 9405

Query: 873  EFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA----E 928
             FRV AVN+AG  +PS  +  + A D  + P +  D+   D          R PA     
Sbjct: 9406 RFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGR 9465

Query: 929  GDPPSGYILEMRAE----------------DTKEWSKCTKIPISGTCYTVGGLIERQKYF 972
              P S +  + +A+                +T E S    IP     +T        KY 
Sbjct: 9466 PTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHT-------GKY- 9517

Query: 973  FRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALC--IHAAFSG 1030
              I A N+AG       +  V+ M  P  PK      LK   + R    L   +     G
Sbjct: 9518 -SITAKNKAG---QKTANCRVKVMDVPGPPK-----DLKVSDITRGSCRLSWKMPDDDGG 9568

Query: 1031 SPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFG-------- 1082
                  + +K  +  K    +      + F++          +R+  +N FG        
Sbjct: 9569 DRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETI 9628

Query: 1083 ---EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIM-----K 1134
                AR  I+      P PP  L++     NTV L+W    +       HYI+       
Sbjct: 9629 QRTTARDPIYP-----PDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDP 9683

Query: 1135 RDASTATWYTAAER-VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQ 1193
                   W    +R V   ++TV  L+ G +Y FRV A N  G S+P             
Sbjct: 9684 TGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKP------------- 9730

Query: 1194 IQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNI 1253
                SA + P + +     P  +   +   V  G +  +     G P PT+T +K     
Sbjct: 9731 ----SATVGPCDCQR-PDMPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKK 9785

Query: 1254 TANSKFWYNST-------SGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTV 1302
              N +     T          CTLVIP     D+G Y++   N LG       L V
Sbjct: 9786 PDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNV 9841



 Score =  172 bits (437), Expect = 1e-42
 Identities = 178/792 (22%), Positives = 321/792 (40%), Gaps = 74/792 (9%)

Query: 546   WLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFI------A 599
             W+K  +E+++   ++I        L          G Y  +AK    E SV +       
Sbjct: 16205 WIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDR 16264

Query: 600   DPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERG 659
               P   P V+  + A   T+        K P +      + +  +  E +      ++  
Sbjct: 16265 PGPPEGPVVISGVTAEKCTLAW------KPPLQDGGSDIINYIVERRETSRLVWTVVDAN 16318

Query: 660   EDQALLTISNCVREDSGLILLKLKNDHG--------SATATLHLSVLDRPKPPQGRVEFL 711
                    ++  +  +     +   N +G           A     V D PK P    E  
Sbjct: 16319 VQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAP----EVT 16374

Query: 712   ELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIK-----IGEVDGKVTNFSTNKV 766
              ++   + + W+ P  +GG  +  +++E+R      W +     IGE+  +VT    N  
Sbjct: 16375 TVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENH- 16433

Query: 767   EEGKAYQFRILAVNSEGVSDPLETEEVF-AGNPIEPPGFASQPQVTDVTKEAVTITWNAP 825
                  Y+FR+ A N+ G+S+P        A +PI  PG  + P+V D+T+ +V ++W+ P
Sbjct: 16434 ----DYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKP 16489

Query: 826   TQDGGAPVLGYIVERRKKGSNLWVPVNKDP-IQGTKCTVDGLLEDTEYEFRVIAVNKAGP 884
               DGG  + GYIVE+       W        I  T   V+ LLE  EY FR+ A+NKAG 
Sbjct: 16490 IYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGV 16549

Query: 885   GQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSN--SSISLAWREPAEGDPPSGYILEMRAE 942
             G+ +     ++ ++ ++ P +  DL +    N  +  SL    P +G P +  +   + +
Sbjct: 16550 GEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRP-TPEVKWGKVD 16608

Query: 943   DTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAP 1002
                  +    +  S T   +  +       + +   N +G          VR +  P+ P
Sbjct: 16609 GEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVT---VRVLDTPSPP 16665

Query: 1003  KFDLSARLKSHMVVRAGTALCIHAAF--SGSPPPDVIWQKDGVPTKGRETITKSKNHSQF 1060
                    LK   + +   ++         GS   + I +K     K    +  + + + +
Sbjct: 16666 -----VNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSW 16720

Query: 1061  LINSTKRSDSGVYRILLQNEFG---EARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWN 1117
              I+  +   S  +R+  +NE+G    A+    ++VA+ P+PP  + + +   N+V+L+W 
Sbjct: 16721 KIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKITVDDVTRNSVSLSWT 16780

Query: 1118  HSPDVQEDGEAHYI--IMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEI 1175
                  + DG +  I  I++  A  +  ++   RV S +  +T L  G +Y FRVVA NE 
Sbjct: 16781 KP---EHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVITNLTQGEEYLFRVVAVNEK 16837

Query: 1176  GDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCA 1235
             G S+P  S    ++ KD + +   K            P F +    ++V  GQD  +   
Sbjct: 16838 GRSDPR-SLAVPIVAKDLVIEPDVK------------PAFSS----YSVQVGQDLKIEVP 16880

Query: 1236  FLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDR 1295
               G P+PT+T  K  + +   ++     +  + TL I      D G Y + V N +G+  
Sbjct: 16881 ISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKT 16940

Query: 1296  SSCTLTVYDKDD 1307
             +S  +   DK D
Sbjct: 16941 ASIEIVTLDKPD 16952



 Score =  171 bits (432), Expect = 6e-42
 Identities = 170/661 (25%), Positives = 275/661 (41%), Gaps = 101/661 (15%)

Query: 701  PKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTN 760
            P PP   +  ++++   V +KW+ PK++GGRP+ ++++E++      W+K G+  G   N
Sbjct: 7812 PGPPYA-LAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCN 7870

Query: 761  FSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFA-GNPIEPPGFASQPQVTDVTKEAVT 819
            F    V EG   QF++ A N  GV  P E  E+ +  +P  PP       VTD  ++ + 
Sbjct: 7871 FRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIA 7930

Query: 820  ITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVD-GLLEDTEYEFRVIA 878
            I W  P ++GG+P++GY VE    G+  W+ VN  PI+  K  V+ G++ D EY  RV A
Sbjct: 7931 IAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRA 7990

Query: 879  VNKAGPGQPSVPSSSVVAKDPVKPPGL---VQDLHVSDSSNSSISLAWREPAEGDPPSGY 935
            VN  G  +PS  S +VVAKDP   P +     D+ V +    SI + +R  A   P   +
Sbjct: 7991 VNAIGVSEPSEISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFR--AVPVPTVSW 8048

Query: 936  ILEMRAEDTKEWSKCTKIPISGTCYT----VGGLIERQKYFFRIRAVNEAGVGEPVELDK 991
                  +D KE     ++ +     +    V   +      + I   N+ G      ++ 
Sbjct: 8049 -----HKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLG-SATASINV 8102

Query: 992  GVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAA-FSGSPP--PDVIWQKDGVPTKGR 1048
             V  +P P          +K+  + ++   L      F G  P    V+ +++     GR
Sbjct: 8103 KVIGLPGPCKD-------IKASDITKSSCKLTWEPPEFDGGTPILHYVLERREA----GR 8151

Query: 1049 ET---ITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVR---VADFPR----P 1098
             T   +   +N   + +     +    +R+   N+ G   Y I ++   +A  P+    P
Sbjct: 8152 RTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEY-IELKNPVIAQDPKQPPDP 8210

Query: 1099 PTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTAAERVFSN-KYT 1155
            P ++ +       +T+TW   P + + G     YII K       W    E +     YT
Sbjct: 8211 PVDVEVHNPTAEAMTITWK--PPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYT 8268

Query: 1156 VTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRF 1215
              GL  G++Y FRV A N  G SEP                 S    P +  D   AP+ 
Sbjct: 8269 AKGLEEGKEYQFRVRAENAAGISEP-----------------SRATPPTKAVDPIDAPKV 8311

Query: 1216 V--TPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWY------------ 1261
            +  T L+   V RG +  +  +  G+P PT+T  K D N+    +               
Sbjct: 8312 ILRTSLE---VKRGDEIALDASISGSPYPTITWIK-DENVIVPEEIKKRAAPLVRRRKGE 8367

Query: 1262 ------------------NSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVY 1303
                              NS  G   L +      D G Y + VEN+ G  ++ CT++V 
Sbjct: 8368 VQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVL 8427

Query: 1304 D 1304
            D
Sbjct: 8428 D 8428



 Score =  169 bits (427), Expect = 2e-41
 Identities = 217/939 (23%), Positives = 367/939 (39%), Gaps = 112/939 (11%)

Query: 430   VKERSRACLECELTSK-DVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEY 488
             VK R +  ++     +   T+ W+KDGQ L   T+ +++       L I++A   D G Y
Sbjct: 19034 VKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTY 19093

Query: 489   TVVAMQDGDPTEYYSTAIVTVEERLA---TVKSGMSDVHAATGSPAEL---CVVLNDEKV 542
              +             T IV           +     D    + +P E    C + N    
Sbjct: 19094 ELCVSNSAGSITVPITIIVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQISN---- 19149

Query: 543   EGVWLKDGKEITDLPGMQIVKQGAVH---KLIFPSMGPEHEGKYTFR---AKGTESEASV 596
                ++ + KE T      IV Q       K++  + G E++ +        K + SE+S 
Sbjct: 19150 ---YIVEKKETTSTT-WHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSA 19205

Query: 597   FIADPPTIDPS------VLEA-----LAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDG 645
              +A+ P   P       V+ A     L    + V  G +  I      K    + W K  
Sbjct: 19206 VVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKAN 19265

Query: 646   MEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQ 705
               +  + ++ +  G D+ L+       E+   I        G  + +        P  P 
Sbjct: 19266 KILIADTQMKVS-GLDEGLMYEYRVYAENIAGI--------GKCSKSCEPVPARDPCDPP 19316

Query: 706   GRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNK 765
             G+ E   ++   V +KW  P  +GG  +T +IVERR +    W+K    + + T F   +
Sbjct: 19317 GQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQETYFEVTE 19376

Query: 766   VEEGKAYQFRILAVNS-EGVSDPLE-TEEVFAGNPIEPPGFASQPQVTDV--TKEAVTIT 821
             + E + Y+FR+ A N+ + VS+P E T  +   + +EPP      +  DV   K    + 
Sbjct: 19377 LTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLK 19436

Query: 822   WNAPTQDGGAPVLGYI---VERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIA 878
              NA       PV+ +    +E  ++     +  +   +   K   D +  DT    + + 
Sbjct: 19437 INADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVK---DCIRRDTG---QYVL 19490

Query: 879   VNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYI 936
               K   G  SV  +  V   P  P G    L ++  +    SL+W  P E  G     YI
Sbjct: 19491 TLKNVAGTRSVAVNCKVLDKPGPPAG---PLEINGLTAEKCSLSWGRPQEDGGADIDYYI 19547

Query: 937   LEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAM 996
             +E R      W+ C    +  T   V  L++  +Y FR+  VN+ GVGEP+E    ++A+
Sbjct: 19548 VEKRETSHLAWTICEG-ELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLE-SVAIKAL 19605

Query: 997   PPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETIT---- 1052
              P   P    S  + S  V +    LC        P  D   +  G   + RE  +    
Sbjct: 19606 DPFTVPSPPTSLEITS--VTKESMTLCW-----SRPESDGGSEISGYIIERREKNSLRWV 19658

Query: 1053  --KSKNHSQFLINST--KRSDSGVYRILLQNEFG---EARYDIHVRVAD---FPRPPTNL 1102
                 K      + ST  +      YR+  +N  G    +     +R  D    P PP+  
Sbjct: 19659 RVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKP 19718

Query: 1103  RLFEEVPNTVTLTWNHSPDVQEDGEAH---YIIMKRDASTATWYTAAERVFSNKYTVTGL 1159
             ++ +    T+T+ W        DG A    Y +  + +    W T+ + +   +YT++GL
Sbjct: 19719 KIVDSGKTTITIAWVKP---LFDGGAPITGYTVEYKKSDDTDWKTSIQSLRGTEYTISGL 19775

Query: 1160  LPGRKYYFRVVARNEIGDSEPLDSRDTWLI---NKDQIQDLSAKLKPYEKKDWRHAPRFV 1216
               G +Y FRV + N++G S+P DS D  +     ++ + D+ ++++              
Sbjct: 19776 TTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMR-------------- 19821

Query: 1217  TPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCT 1276
                K   V  G   TMT  F G P P V   K D ++   ++ + ++T    +L I    
Sbjct: 19822 ---KTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDL--RTRAYVDTTDSRTSLTIENAN 19876

Query: 1277  LKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSVVASIT 1315
               DSG Y++ ++N L    +S TL V   D      +IT
Sbjct: 19877 RNDSGKYTLTIQNVL--SAASLTLVVKVLDTPGPPTNIT 19913



 Score =  167 bits (424), Expect = 5e-41
 Identities = 248/1114 (22%), Positives = 419/1114 (37%), Gaps = 162/1114 (14%)

Query: 262   PNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVNMNDAGIYSL----SVGDKRM 317
             P  K+ W K    LR +  L   D+K       L   NVN  DAG Y L    S G K  
Sbjct: 13349 PPPKITWSKPNVNLRDRIGL---DIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEY 13405

Query: 318   SAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEP---------NFVWKFNGKELK 368
             +  + VLD P        PV VT ++ +     ++ + P         N+V +    E K
Sbjct: 13406 TIVVKVLDTP------GPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERK 13459

Query: 369   R---------DDKYEITVSEDGLTHTLKI---KDARLSDSGEFSAEAGNLVQKAQLTIDR 416
                          + +   E+G ++  ++    +  + D GE + +A    Q     +D 
Sbjct: 13460 SWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGE-TRDAVKASQTPGPVVD- 13517

Query: 417   IPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKK---DGQLLMHGTKYSMNHEGKRA 473
                          +K RS +   C       ++ WKK   DG   + G       E  + 
Sbjct: 13518 -------------LKVRSVSKSSC-------SIGWKKPHSDGGSRIIGYVVDFLTEENKW 13557

Query: 474   ELIIEDAQL-------SDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKS----GMSD 522
             + +++   L       ++G EYT     + +  E   + I  V             G+ D
Sbjct: 13558 QRVMKSLSLQYSAKDLTEGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPD 13617

Query: 523   VH--AATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHK-LIFPSMGPEH 579
             +   A   S   L + +  +    V  K G++         V+  AV+  LI        
Sbjct: 13618 LCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSD 13677

Query: 580   EGKYTFRAKGT----ESEASVFIADPPTID--PSVLEALAAHAITVKVGHTAHIKVPFRG 633
              GKYT   K      E   S+ +   P I   P   + + A A+T+K         P + 
Sbjct: 13678 AGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWA-------PPKD 13730

Query: 634   KPLPKVTWY-KDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSA--- 689
                 ++T Y  +  +    + V+      +    ++           +  +N +G     
Sbjct: 13731 DGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGL 13790

Query: 690   -----TATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVG 744
                   A     V D P PP      +++    V + W  PK  GG P+T + +E +   
Sbjct: 13791 KSEPIVARHPFDVPDAPPPPN----IVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERN 13846

Query: 745   KKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDP-LETEEVFAGNPIEPPG 803
                W +  +   ++ +F    + EG  Y+FR++A+N  GV  P L +E V A +PI+PPG
Sbjct: 13847 SLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPG 13906

Query: 804   FASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTV 863
                +P+V ++T+ +VT+ W  P  DGG  + GYIVE+R   S  W+  N   +     TV
Sbjct: 13907 ---KPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTV 13963

Query: 864   DGLLEDTEYEFRVIAVNKAGP-GQPSVPSSSVVAKDPVKPPGLVQDLHVSD-----SSNS 917
               L+E  +YEFR+ A N AG    PS  + +++ KD  + P +V D  + D     + ++
Sbjct: 13964 TDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDT 14023

Query: 918   SISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRA 977
              +  A     +  P S +    +     + ++ T  P S +  T+     +    + I A
Sbjct: 14024 IVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTS-SMLTIKYATRKDAGEYTITA 14082

Query: 978   VNEAGVG-EPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDV 1036
              N  G   E V++   V  +P P  P       + +    +A           GSP    
Sbjct: 14083 TNPFGTKVEHVKVT--VLDVPGPPGP-----VEISNVSAEKATLTWTPPLEDGGSPIKSY 14135

Query: 1037  IWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEAR--YDIHVRVAD 1094
             I +K          +++     + +     + +  ++R+   N +G+        V++ D
Sbjct: 14136 ILEKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQSEPVKMVD 14195

Query: 1095  F---PRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFS 1151
                 P PP    +     NT T++W    D        Y + +R+  +  W  A +   S
Sbjct: 14196 RFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVS 14255

Query: 1152  N-KYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWR 1210
             + +  VTGL  G  Y FRV A N  G   P ++ D+ L+                 KD  
Sbjct: 14256 DLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLM-----------------KDAA 14298

Query: 1211  HAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNIT--------ANSKFWYN 1262
             + P    P  PH      D T   A L   +P    Y G + IT           + W  
Sbjct: 14299 YPPG--PPSNPHVT----DTTKKSASLAWGKPH---YDGGLEITGYVVEHQKVGDEAWIK 14349

Query: 1263  STSG----VCTLVIPTCTLKDSGDYSVLVENELG 1292
              T+G    +   V+P    K+  ++ +   N+ G
Sbjct: 14350 DTTGTALRITQFVVPDLQTKEKYNFRISAINDAG 14383



 Score =  167 bits (423), Expect = 6e-41
 Identities = 166/658 (25%), Positives = 277/658 (42%), Gaps = 63/658 (9%)

Query: 562  VKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKV 621
            +++GA +KL   ++    EG        T +E      +PP ++   L+      I +  
Sbjct: 8694 IREGADYKLRVSAVNAAGEGPPGETQPVTVAEPQ----EPPAVE---LDVSVKGGIQIMA 8746

Query: 622  GHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLK 681
            G T  I     G+P+P   W K+  E+ +++RV ++    ++ L I + +R+D G  ++ 
Sbjct: 8747 GKTLRIPAVVTGRPVPTKVWTKEEGEL-DKDRVVIDNVGTKSELIIKDALRKDHGRYVIT 8805

Query: 682  LKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERR 741
              N  GS  A   + V D P P       +     C+ + W  P+D+GG  +T FI+ER+
Sbjct: 8806 ATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCL-LNWSDPEDDGGSEITGFIIERK 8864

Query: 742  AVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEP 801
                 +W +   ++ + +      + EG+ Y+FR++A N  G   P+E   + A +P+ P
Sbjct: 8865 DAKMHTWRQ--PIETERSKCDITGLLEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLGP 8922

Query: 802  PGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKC 861
            P    +   T+ TK  +T+ W  P  +GG+P+ GYI+E+R+     +  VNK     T  
Sbjct: 8923 PTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSF 8982

Query: 862  TVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISL 921
             V+ L E   YEFRV AVN+ G  +PS+P + V+  D V PP +   L V      +I +
Sbjct: 8983 LVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEV-PPTIKLRLSV---RGDTIKV 9038

Query: 922  AWREPAEGDPPSGYILEMRAEDTKEWSK-------------CTKIPIS----GTCYTVGG 964
               EP    P     L M      EWSK              TK  +S     T  ++  
Sbjct: 9039 KAGEPVH-IPADVTGLPM---PKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPK 9094

Query: 965  LIERQKYFFRIRAVNEAG-VGEPVELDKGVRAMPPPAAPKFDLSAR---LKSHMVVRAGT 1020
             +   K  + + A N  G V   V ++   R  PP      D+ A    L     +  G 
Sbjct: 9095 AVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGG 9154

Query: 1021 ALCIHAAFSGSPPPDVIWQKDGVPTKGR-ETITKSKNHSQFLINSTKRSDSGVYRILLQN 1079
            +   H          VI ++D    K   E +T +    ++ I     +    +R+   N
Sbjct: 9155 SEITHY---------VIDKRDASRKKAEWEEVTNTAVEKRYGIWKLIPNGQYEFRVRAVN 9205

Query: 1080 EFG---EARYDIHVRVAD---FPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIM 1133
            ++G   E + D  V + D    P PP   ++      ++ ++W    D        Y + 
Sbjct: 9206 KYGISDECKSD-KVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLE 9264

Query: 1134 KRDASTATWYTAAERVFSN------KYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRD 1185
            KR+  +  W   +    +       ++ V  LL G KY FR +A N  G   P +  D
Sbjct: 9265 KREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSD 9322



 Score =  165 bits (418), Expect = 2e-40
 Identities = 271/1160 (23%), Positives = 436/1160 (37%), Gaps = 188/1160 (16%)

Query: 228  KVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMI-WIKGTEPLRIQYSLGKYDV 286
            K++VEA++I K L++         VF   +EL  PNVK + WIK    L    S  KY +
Sbjct: 2655 KLKVEAVKIKKTLKNLTVTETQDAVFT--VELTHPNVKGVQWIKNGVVLE---SNEKYAI 2709

Query: 287  KQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAV 346
               GT Y L I N  + D  +Y   +G    SA L V  E +K + + K V   E  T  
Sbjct: 2710 SVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHV--ETVKIIKKPKDVTALENATVA 2767

Query: 347  FEIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNL 406
            FE+ +S       W     E+K  DK+ + VSE  + H L +++   SD+GE++A  G L
Sbjct: 2768 FEVSVSHDTVPVKWFHKSVEIKPSDKHRL-VSERKV-HKLMLQNISPSDAGEYTAVVGQL 2825

Query: 407  VQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSM 466
              KA+L ++ + I     +KN+ V E   A  ECE++  +V   W K+G  +    K+ +
Sbjct: 2826 ECKAKLFVETLHI--TKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKI 2883

Query: 467  NHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAA 526
              +GK  +LII +    D  EYT V   D        +A +TV   + T  S + D++A 
Sbjct: 2884 VVQGKLHQLIIMNTSTEDSAEYTFVCGND------QVSATLTVTPIMIT--SMLKDINAE 2935

Query: 527  TGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFR 586
                    V +N E +   WLK+G EI      Q+  +   H L   ++       YTF 
Sbjct: 2936 EKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFV 2995

Query: 587  AKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPL-------PKV 639
            A    S A++++              A H    K  H   IKV  + + +       P +
Sbjct: 2996 AGKATSTATLYVE-------------ARHIEFRK--HIKDIKVLEKKRAMFECEVSEPDI 3040

Query: 640  T--WYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSV 697
            T  W KD  E+   +R+ +++ +    L I +    D+G    K     G   +T  L V
Sbjct: 3041 TVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAG----KYTVVAGGNVSTAKLFV 3096

Query: 698  LDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGK 757
              R      R+  ++     +  +         R V +F V    V    W K    DG 
Sbjct: 3097 EGRDV----RIRSIKKEVQVIEKQ---------RAVVEFEVNEDDVDAH-WYK----DGI 3138

Query: 758  VTNFSTNKVEEGKAY----QFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDV 813
              NF   +V+E   Y    +   + ++    SD  E   V   N      + + P+   V
Sbjct: 3139 EINF---QVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQV 3195

Query: 814  TKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYE 873
             +E   +T     Q G       ++  R +    W    +    G KC    L +  EY 
Sbjct: 3196 LQELQPVT----VQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKF--LHDGQEYT 3249

Query: 874  FRVI-------------AVNKAGPGQPSVPSS----SVVAKD---PVKPPGLV---QDLH 910
              +I             A N  G    S   S     VV+ D   PV PP ++   QD  
Sbjct: 3250 LLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTV 3309

Query: 911  VSDS---------SNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYT 961
             S+          S + + ++W    +   PS +    + EDT +       P     YT
Sbjct: 3310 TSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYT 3369

Query: 962  ---------VGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKS 1012
                     V          F     N +     V L    +  P    P F    +  S
Sbjct: 3370 FVASNAVGQVSSTANLSLEGFSKFEENTSNSQWHVSLSVSFKKEPLGQKPSF---IQPLS 3426

Query: 1013 HMVVRAGTALCIHAAFSGSPPPDVIW---QKDGVPTKGRET-ITKSKNHSQFLINSTKRS 1068
             + V  G  +  HA  SG P P++ W   Q+  +PTK       +S   +  LI      
Sbjct: 3427 SLRVHNGETVRFHARVSGIPKPEIQWFHNQQLILPTKDVVFHFEESTGMALMLIVDAYSE 3486

Query: 1069 DSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA 1128
             +G Y     N  GEA     + V   P+ P ++ L E +   + +              
Sbjct: 3487 HAGQYSCKAANSAGEATCAATLTVT--PKAPESI-LHERIEQEIEME------------- 3530

Query: 1129 HYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWL 1188
                MK  +S+   + +AE                               E L S +  L
Sbjct: 3531 ----MKEFSSS---FLSAEE------------------------------EGLHSAELQL 3553

Query: 1189 INKDQIQDLSAKLKPYEKKDWRH----APRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTV 1244
               ++  +L ++   Y  K         P F+  +    +  G   T++   +G P+P +
Sbjct: 3554 SKINETLELLSESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKI 3613

Query: 1245 TLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYD 1304
              +   V +T ++ + +       +L+I    L+D G+Y+ +  N+ GK   S  L +  
Sbjct: 3614 QWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINS 3673

Query: 1305 K----DDKSVVASITESLQK 1320
            K     D    +++ +SL+K
Sbjct: 3674 KGEGHKDTETESAVAKSLEK 3693



 Score =  165 bits (417), Expect = 3e-40
 Identities = 163/635 (25%), Positives = 271/635 (42%), Gaps = 78/635 (12%)

Query: 698   LDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGK 757
             +D  +PP+  V   ++S + V + W+ P  +GG  +T +IVERR +    W K    +  
Sbjct: 20393 IDACEPPRN-VRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVT 20451

Query: 758   VTNFSTNKVEEGKAYQFRILAVNSEG-------VSDPLETEEVFAGNPIEPPGFASQPQV 810
              T F  + + +   Y+FR+ A N+ G       V  P+   + + G  I+ P      + 
Sbjct: 20452 ETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGPVIDLP-----LEY 20506

Query: 811   TDVTK--EAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLE 868
             T+V K     ++   A      AP + +  + ++  +N  V V     + T      L++
Sbjct: 20507 TEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCV-----ENTTDLASILIK 20561

Query: 869   DTE------YEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLA 922
             D +      YE ++   N  G    ++    V   D   PPG    +     +   I+L 
Sbjct: 20562 DADRLNSGCYELKLR--NAMGSASATI---RVQILDKPGPPG--GPIEFKTVTAEKITLL 20614

Query: 923   WREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNE 980
             WR PA+  G   + YI+E R      WS  ++  +     T   +I+  +Y FR+RAVN+
Sbjct: 20615 WRPPADDGGAKITHYIVEKRETSRVVWSMVSE-HLEECIITTTKIIKGNEYIFRVRAVNK 20673

Query: 981   AGVGEPVELDKGV--RAMPPPAAPKF-DLSARLKSHMVVRAGTALCIHAAFSGSPPPDVI 1037
              G+GEP+E D  V   A   P  P   +++   K+ M V     +    A  GS      
Sbjct: 20674 YGIGEPLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPI----ADGGSDISGYF 20729

Query: 1038  WQKDGVPTKGRETITKS--KNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRV--- 1092
              +K    + G   + K   ++  Q +   T+ SD   YR+   N  G+  +         
Sbjct: 20730 LEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQ-YRVCAVNAAGQGPFSEPSEFYKA 20788

Query: 1093  ---ADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEA--HYIIMKRDASTATWYTAAE 1147
                 D P PP  +R+ +   +++TL W  S  V + G A   Y++  R      W T + 
Sbjct: 20789 ADPIDPPGPPAKIRIADSTKSSITLGW--SKPVYDGGSAVTGYVVEIRQGEEEEWTTVST 20846

Query: 1148  R--VFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYE 1205
             +  V + +Y V+ L PG  YYFRV A N  G  EP++  +                 P +
Sbjct: 20847 KGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNE-----------------PVQ 20889

Query: 1206  KKDWRHAPRFVTPLKPHTVL---RGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYN 1262
              KD   AP     +   T +    G+D  +   F G P PTVT  K + N+ +++++   
Sbjct: 20890 AKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIE 20949

Query: 1263  STSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSS 1297
             +T     L IP  T  D+G Y + +EN +G+ +SS
Sbjct: 20950 NTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSS 20984



 Score =  165 bits (417), Expect = 3e-40
 Identities = 205/927 (22%), Positives = 345/927 (37%), Gaps = 119/927 (12%)

Query: 441   ELTSKDVTLRWK---KDGQLLMHGTKYSMN-HEGKRAELIIEDAQLSDGGEYTVVAMQDG 496
             ++T + +TL+W    +DG   + G  YS+   +G    +      +S+  +YTV  +  G
Sbjct: 21493 DVTRETITLKWNPPLRDGGSKIVG--YSIEKRQGNERWVRCNFTDVSEC-QYTVTGLSPG 21549

Query: 497   D----------------PTEYYSTAIVTVEERLATV----KSGMSDVHAATGSPAELCVV 536
             D                P    S  I+T +E +  +          +   +G    +  +
Sbjct: 21550 DRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKAL 21609

Query: 537   LNDEKVEGV-WLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGT----E 591
             +    V  V W KDG EI     M+I        L       +H G YT  AK      +
Sbjct: 21610 VQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAK 21669

Query: 592   SEASVFIADPP--TIDPSVLEALAAHAITV------KVGHTAHIKVPFRGKPLPKVTW-- 641
             +E  V + D P   + P     +    +T+        G           +   ++ W  
Sbjct: 21670 AEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWAL 21729

Query: 642   YKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRP 701
              +D  E      + +  G +     +S   +   G  L     D     A +  +V D P
Sbjct: 21730 IEDKCEAQSYTAIKLINGNEYQF-RVSAVNKFGVGRPL-----DSDPVVAQIQYTVPDAP 21783

Query: 702   KPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIK-IGEVDGKVTN 760
               P+       ++G+ + + W  P+ +GG  + Q+I+ERR      W+K I +     T 
Sbjct: 21784 GIPEPS----NITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETR 21839

Query: 761   FSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVF-AGNPIEPPGFASQPQVTDVTKEAVT 819
             F    + EG  Y+F ++A N+ GV        +     P+ PPG  +  +VTD +K  V+
Sbjct: 21840 FKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVS 21899

Query: 820   ITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAV 879
             + W+ P  DGG  ++GYI+E  K     W  VN +    T+ TV  L    EY+FRV A+
Sbjct: 21900 LEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAI 21959

Query: 880   NKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDS----SNSSISL------------AW 923
             N AG G     + ++ A D +  P L  D +   +    + +SI L             W
Sbjct: 21960 NGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVW 22019

Query: 924   REPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGV 983
              +P         I    +  T     C +        TV      +   F ++ ++  G 
Sbjct: 22020 SKPDSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGP 22079

Query: 984   GEPVELDKGVRAMPPPA--APKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKD 1041
               P+      R        AP  D  AR+  ++V                       +K 
Sbjct: 22080 PGPITFKDVTRGSATLMWDAPLLDGGARIHHYVV-----------------------EKR 22116

Query: 1042  GVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEAR-YDIH--VRVADFPRP 1098
                 +  + I++      F +N         +R+   NE+G    Y++   +   + P P
Sbjct: 22117 EASRRSWQVISEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPAP 22176

Query: 1099  PTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH---YIIMKRDASTATWYTAAERVFSNKYT 1155
             P  L + +   ++  L W   PD   DG +    Y++  R   +  W  A        +T
Sbjct: 22177 PRRLDVVDTSKSSAVLAWL-KPD--HDGGSRITGYLLEMRQKGSDFWVEAGHTK-QLTFT 22232

Query: 1156  VTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRF 1215
             V  L+   +Y FRV A+N+ G SEP ++  + +I + QI+  +A L              
Sbjct: 22233 VERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEP-TADLTGITN--------- 22282

Query: 1216  VTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTC 1275
                 +  T   G   T+     G P P VT    ++ +    +    +T    TL +   
Sbjct: 22283 ----QLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDS 22338

Query: 1276  TLKDSGDYSVLVENELGKDRSSCTLTV 1302
                DSG Y + +EN  G    S T+ V
Sbjct: 22339 MRGDSGRYFLTLENTAGVKTFSVTVVV 22365



 Score =  164 bits (416), Expect = 4e-40
 Identities = 230/1109 (20%), Positives = 416/1109 (37%), Gaps = 125/1109 (11%)

Query: 268   WIKGTEPLRIQYSLGKYDVKQMGT------KYMLVISNVNMNDAGIYSL----SVGDKRM 317
             ++ G  P  + +++ +  + Q  T         +VI N   +  G+YSL      G+++ 
Sbjct: 10175 YVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERKK 10234

Query: 318   SAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVWKFNGKELKRDDK----- 372
             +  + VLD P           +T     +          + +  +  ++ + D +     
Sbjct: 10235 TIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPV 10294

Query: 373   -YEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPIKFVSNLKNVRVK 431
              Y +T     +   ++ K      + E S   G  V+ ++  + R PI      +++ VK
Sbjct: 10295 TYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPERPEDLEVK 10354

Query: 432   ERSRACLECELTSKDVTLRWKKD----GQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGE 487
             E         +T   VTL W       G  +++    S     ++   +  D  LS   +
Sbjct: 10355 E---------VTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSR--K 10403

Query: 488   YTVVAMQDGDPTEYYSTAI--------------VTVEERLA------------TVKSGMS 521
             YTV  +++GD  EY  +A+              +T ++ LA            T++ G  
Sbjct: 10404 YTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIRVG-- 10461

Query: 522   DVHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEG 581
             +  A TG  +         K +  W KD  ++ +     I    A   L          G
Sbjct: 10462 EAFALTGRYS------GKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSG 10515

Query: 582   KYTFRAKGTES------EASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKP 635
             KY    + +        + +V     P + P   + +    + +        K P     
Sbjct: 10516 KYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISW------KPPLDDGG 10569

Query: 636   LPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLH- 694
                  +  +  EV ++  + +     +    +S  +     +  +  +N +G +   +  
Sbjct: 10570 SKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDYIFRIHAENLYGISDPLVSD 10629

Query: 695   -LSVLDRPKPPQGRVEFL--ELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKI 751
              +   DR + P    + +  E++     + W  P D GG+P+T +I+E+R    K W ++
Sbjct: 10630 SMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKPHD-GGKPITNYILEKRETMSKRWARV 10688

Query: 752   GEVD-GKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLE-TEEVFAGNPIEPPGFASQPQ 809
              +      T F    + EG  Y+FR+ A N  G+ DP   ++ VFA +PI  P     P+
Sbjct: 10689 TKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPE 10748

Query: 810   VTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDP--IQGTKCTVDGLL 867
               D T  +V +TW  P  DGG+ +LGYIVE +K G   W   N  P     TK  V GL 
Sbjct: 10749 AIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLR 10808

Query: 868   EDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPA 927
             +   Y+FRV+AVN AG   P+     V+ KD ++PP L+ D +++   +  +    R  A
Sbjct: 10809 DGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSA 10868

Query: 928   --EGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGE 985
               +G P      +    D    ++    P+ G+   +          + +   N AG   
Sbjct: 10869 IIKGVPFPKVTWKKEDRDAPTKARIDVTPV-GSKLEIRNAAHEDGGIYSLTVENPAG--- 10924

Query: 986   PVELDKGVRAMPPPAAPK-FDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVP 1044
                +   V  +  P  P+  ++S   K    +     L       GS   + + ++  V 
Sbjct: 10925 SKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPL----DDGGSVITNYVVERRDVA 10980

Query: 1045  TKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARY---DIHVRVADF---PRP 1098
             +     ++ +              +  ++R+  +N++G   +      ++  D    P P
Sbjct: 10981 SAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGP 11040

Query: 1099  PTNLRLFEEVPNTVTLTWNHSPDVQEDGEAH---YIIMKRDASTATWYTAAERVFSNKYT 1155
             P +L   +     V+L WN  PD   DG +    Y++  ++  T  W    + V + +  
Sbjct: 11041 PKDLHHVDVDKTEVSLVWN-KPD--RDGGSPITGYLVEYQEEGTQDWIKF-KTVTNLECV 11096

Query: 1156  VTGLLPGRKYYFRVVARNEIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRF 1215
             VTGL  G+ Y FRV A N +G   P               D +  ++  EK         
Sbjct: 11097 VTGLQQGKTYRFRVKAENIVGLGLP---------------DTTIPIECQEKLVPPSVELD 11141

Query: 1216  VTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTC 1275
             V  ++   V  G          G P PT         I  +  +   + +    L I  C
Sbjct: 11142 VKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNC 11201

Query: 1276  TLKDSGDYSVLVENELGKDRSSCTLTVYD 1304
               +D+G+Y + V N  G    +  LTV D
Sbjct: 11202 LRRDTGEYQITVSNAAGSKTVAVHLTVLD 11230



 Score =  163 bits (412), Expect = 1e-39
 Identities = 149/604 (24%), Positives = 259/604 (42%), Gaps = 43/604 (7%)

Query: 598   IADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSME 657
             I + P ID   L+     ++  K G    + +PF+G+P P VTW KD   +  + R S+E
Sbjct: 20893 ILEAPEID---LDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIE 20949

Query: 658   RGEDQALLTISNCVREDSGLILLKLKNDHGS-ATATLHLSVLDRPKPPQGRVEFLELSGS 716
               +  +LLTI    R D+G  +L ++N  G   ++T+ + VLD P   Q +++   +S  
Sbjct: 20950 NTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQ-KLQVKHVSRG 21008

Query: 717   CVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRI 776
              V + W  P  +GG P+  +++E+R   K++W  +       T+F    + E   + FR+
Sbjct: 21009 TVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSS-TSFKLIDLSEKTPFFFRV 21067

Query: 777   LAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGY 836
             LA N  G+ +P ET E       E P       + D TK +V ++W  P  DGG+ +  Y
Sbjct: 21068 LAENEIGIGEPCETTEPV--KAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEY 21125

Query: 837   IVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVA 896
             +VER+ KG   W        +  +  V  L E +  EFRV A N+ G   P V    +  
Sbjct: 21126 VVERKGKGEQTWSHAGIS--KTCEIEVSQLKEQSVLEFRVFAKNEKGLSDP-VTIGPITV 21182

Query: 897   KDPVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPIS 956
             K+ +  P    ++ +SD   + +++        + P     + + + +  W K   +P+ 
Sbjct: 21183 KELIITP----EVDLSDIPGAQVTVRIGHNVHLELP----YKGKPKPSISWLK-DGLPLK 21233

Query: 957   GTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGV--RAMP-------PPAAPKFDLS 1007
              + +      E +       A  E G    V LD  V   A+P       PP+ PK  + 
Sbjct: 21234 ESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKGPIR 21293

Query: 1008  -ARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTK 1066
                +K+  V+ +     +     G        +K        + +  S   + F + +  
Sbjct: 21294 FDEIKADSVILSWD---VPEDNGGGEITCYSIEKRETSQTNWKMVCSSVARTTFKVPNLV 21350

Query: 1067  RSDSGVYRILLQNEFGEAR---YDIHVRVADF--PRPPTNLRLFEEVPNTVTLTWNHSPD 1121
             +     +R+  +N +G ++     I V    F  P PP    ++    + ++LTW+    
Sbjct: 21351 KDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWD--AP 21408

Query: 1122  VQEDGE--AHYIIMKRDASTATWYTA-AERVFSNKYTVTGLLPGRKYYFRVVARNEIGDS 1178
             V + G     + + K++ ++  W       +   +Y  TGL+ G  Y FRV A N  G S
Sbjct: 21409 VYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGLS 21468

Query: 1179  EPLD 1182
              P D
Sbjct: 21469 SPSD 21472



 Score =  162 bits (409), Expect = 3e-39
 Identities = 153/668 (22%), Positives = 271/668 (40%), Gaps = 55/668 (8%)

Query: 68   EFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKL 127
            +F+   + VTA E + AVF   +  +    + W +     +  +  +      K H +  
Sbjct: 5558 KFLTPLKDVTAKEKESAVFTVELSHD-NIRVKWFKNDQ-RLHTTRSVSMQDEGKTHSITF 5615

Query: 128  EPLTSDDSDNYKCIASNDHADAIYTV---------SLLVTEGQEKMDF------------ 166
            + L+ DD+   +  A    ++A  TV          L    G EK +             
Sbjct: 5616 KDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAP 5675

Query: 167  KKMLKKRAPPAPKKKQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMK 226
             K  K      P K     A+ K+ + IL K  K D  +   + G     G        K
Sbjct: 5676 VKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSG--------K 5727

Query: 227  KKVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIW-IKGTEPLRIQYSLGKYD 285
              +E   I++++PL   E     T  F+   E+ + ++   W +KG   L+        +
Sbjct: 5728 LDIEDREIKLVRPLHSVEVMETETARFET--EISEDDIHANWKLKGEALLQTP----DCE 5781

Query: 286  VKQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTA 345
            +K+ G  + LV+ N  ++  G       + + SA L V    +  L  +K V VT  +TA
Sbjct: 5782 IKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETA 5841

Query: 346  VFEIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGN 405
             F+  LS ++    W   GK+L+  DK  +    +G  HTL ++D +L D+GE    A +
Sbjct: 5842 TFDCELSYEDIPVEWYLKGKKLEPSDK--VVPRSEGKVHTLTLRDVKLEDAGEVQLTAKD 5899

Query: 406  LVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYS 465
                A L +   P++F   L++  V+E + A LECE++ ++  ++W K+G  ++   KY 
Sbjct: 5900 FKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYE 5959

Query: 466  MNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHA 525
            +  +G+  +L+I D    D   YT       D  ++ ++  + V          ++D+  
Sbjct: 5960 IVADGRVRKLVIHDCTPEDIKTYTC------DAKDFKTSCNLNVVPPHVEFLRPLTDLQV 6013

Query: 526  ATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTF 585
                 A     L+ E  +  W KDG EI       I+ +GAV  L+      + E +Y+ 
Sbjct: 6014 REKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSC 6073

Query: 586  RAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFR-GKPLPKVTWYKD 644
              +   +   + + +   +          +   ++V  T  IK+     KP  +V WYK 
Sbjct: 6074 EVRTARTSGMLTVLEEEAV-------FTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKG 6126

Query: 645  GMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPP 704
              E+ E  R  +     + +L I N   ED+G    +L +        +H    +    P
Sbjct: 6127 DEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKP 6186

Query: 705  QGRVEFLE 712
            Q  +E LE
Sbjct: 6187 Q-NLEILE 6193



 Score =  160 bits (406), Expect = 6e-39
 Identities = 256/1157 (22%), Positives = 432/1157 (37%), Gaps = 180/1157 (15%)

Query: 242   DKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVN 301
             ++  KV  T+    I++   P  K+ W K     R   +  + DV  +G+K  L I N  
Sbjct: 10855 EQHIKVGDTLRLSAIIK-GVPFPKVTWKKED---RDAPTKARIDVTPVGSK--LEIRNAA 10908

Query: 302   MNDAGIYSLSV----GDKRMSAELTVLDEPLKFLGEMKPVKVTE-RQTAVFEIRLSKKEP 356
               D GIYSL+V    G K +S ++ VLD+P    G  + ++V+E R+ + +   L+ KEP
Sbjct: 10909 HEDGGIYSLTVENPAGSKTVSVKVLVLDKP----GPPRDLEVSEIRKDSCY---LTWKEP 10961

Query: 357   ---------NFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGE---FSAEAG 404
                      N+V       ++R D      S    T   K   A+  + G    F   A 
Sbjct: 10962 LDDGGSVITNYV-------VERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAE 11014

Query: 405   NLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKK---DGQLLMHG 461
             N   +        PIK +  L         +     ++   +V+L W K   DG   + G
Sbjct: 11015 NQYGRGPFVETPKPIKALDPL---HPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITG 11071

Query: 462   TKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYY-------------STAIVT 508
                    EG +  +  +        E  V  +Q G    +              +T  + 
Sbjct: 11072 YLVEYQEEGTQDWIKFKTV---TNLECVVTGLQQGKTYRFRVKAENIVGLGLPDTTIPIE 11128

Query: 509   VEERLATVKSGM-----SDVHAATGSPAELCVVLNDEKV-EGVWLKDGKEITDLPGMQIV 562
              +E+L      +       +    G+      ++    V    W  DG EI       + 
Sbjct: 11129 CQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVE 11188

Query: 563   KQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVF-------IADPPTIDPSVLEALAAH 615
                    L   +      G+Y           +V        +  PPT   ++L+    H
Sbjct: 11189 TDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEH 11248

Query: 616   AITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDS 675
                     T   + P      P + +  +  +  ++    +  G  +  L I +  +   
Sbjct: 11249 M-------TISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCE 11301

Query: 676   GLILLKLKNDHG-----SATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGG 730
              +  ++ +N  G      +T T+       P PP G+    +++ +   + W  PK +GG
Sbjct: 11302 YVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPP-GKPVVTDITENAATVSWTLPKSDGG 11360

Query: 731   RPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPL-E 789
              P+T + +ERR V  K W+++ +       F    + EG  Y+FR+ A N  G+S P   
Sbjct: 11361 SPITGYYMERREVTGK-WVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPS 11419

Query: 790   TEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWV 849
             ++ + A  PI+PPG    P++ D ++E   + W  P  DGG+P+LGY+VE +K G+  W 
Sbjct: 11420 SDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWN 11479

Query: 850   PVNKDP-IQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQD 908
              +NKD  I+     V GL+E  EY FR+ A N  G G+P   + SV+AKD + PP +  D
Sbjct: 11480 RINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELD 11539

Query: 909   LHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIER 968
             +   D     +    R  A         ++ R E    W+K             G ++ R
Sbjct: 11540 VTCRDVITVRVGQTIRILAR--------VKGRPEPDITWTK------------EGKVLVR 11579

Query: 969   QKYFFRIRAVN--EAGVGEPVELDKGVRAMPPPAAPKFDLSARLKS---------HMVVR 1017
             +K    I+ +   E  + E V  D G          K+ +SA+  S         +++ R
Sbjct: 11580 EKRVDLIQDLPRVELQIKEAVRADHG----------KYIISAKNSSGHAQGSAIVNVLDR 11629

Query: 1018  AGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETIT---------KSKNHSQFLINSTKR- 1067
              G    +           + W+       G   IT           K  S    + TKR 
Sbjct: 11630 PGPCQNLKVTNVTKENCTISWENP--LDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRL 11687

Query: 1068  -------SDSGVYRILLQNEFG-----EARYDI-HVRVADFPRPPTNLRLFEEVPNTVTL 1114
                    ++   +R+  +N+ G     E +  I  +   D P  P NL + ++    V L
Sbjct: 11688 IKANLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYL 11747

Query: 1115  TWNHSPDVQEDGEAHYIIMKRDASTATWYTAAE-RVFSNKYTVTGLLPGRKYYFRVVARN 1173
              W             Y + +R   +  W    +  +    Y V   +  + Y FRV  +N
Sbjct: 11748 KWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKN 11807

Query: 1174  EIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPH---TVLRGQDC 1230
             E G+S+ + + +  ++ K+ +Q      KP            V  LK     TV  G   
Sbjct: 11808 EGGESDWVKTEE--VVVKEDLQ------KP------------VLDLKLSGVLTVKAGDTI 11847

Query: 1231  TMTCAFLGNPRPTV--TLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVE 1288
              +     G P P V  T  K   ++T + +   ++ +      +      D G Y V   
Sbjct: 11848 RLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTAT 11907

Query: 1289  NELGKDRSSCTLTVYDK 1305
             N  G   +  T+ V DK
Sbjct: 11908 NTAGSFVAYATVNVLDK 11924



 Score =  160 bits (406), Expect = 6e-39
 Identities = 157/655 (23%), Positives = 275/655 (41%), Gaps = 61/655 (9%)

Query: 661   DQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDR-----PKPPQGRVEFLELSG 715
             ++ ++T +  ++ +  +  ++  N +G        SV+ +     P PP G  E  +++ 
Sbjct: 20649 EECIITTTKIIKGNEYIFRVRAVNKYGIG