BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|222352147 RIIa domain-containing protein [Homo sapiens] (92 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|222352147 RIIa domain-containing protein [Homo sapiens] 187 2e-48 gi|38348396 hypothetical protein LOC375307 [Homo sapiens] 41 2e-04 gi|8394343 sperm autoantigenic protein 17 [Homo sapiens] 31 0.25 gi|88196790 coiled-coil domain containing 88 [Homo sapiens] 29 0.72 gi|4758958 cAMP-dependent protein kinase, regulatory subunit alp... 29 0.93 gi|133778961 testis expressed 15 [Homo sapiens] 27 3.5 gi|51243032 oxysterol-binding protein-like protein 8 isoform b [... 27 3.5 gi|18079218 oxysterol-binding protein-like protein 8 isoform a [... 27 3.5 gi|47132585 cAMP-dependent protein kinase, regulatory subunit be... 27 3.5 gi|110347400 odz, odd Oz/ten-m homolog 1 isoform 3 [Homo sapiens] 27 4.6 gi|253970446 odz, odd Oz/ten-m homolog 1 isoform 2 [Homo sapiens] 27 4.6 gi|253970444 odz, odd Oz/ten-m homolog 1 isoform 1 [Homo sapiens] 27 4.6 gi|24797118 calcium-binding tyrosine phosphorylation-regulated p... 26 6.1 gi|24797116 calcium-binding tyrosine phosphorylation-regulated p... 26 6.1 gi|24797114 calcium-binding tyrosine phosphorylation-regulated p... 26 6.1 gi|24797108 calcium-binding tyrosine phosphorylation-regulated p... 26 6.1 gi|24797112 calcium-binding tyrosine phosphorylation-regulated p... 26 6.1 gi|4885583 Rho-associated, coiled-coil containing protein kinase... 26 7.9 gi|197313654 TBCC domain containing 1 [Homo sapiens] 26 7.9 gi|8922517 TBCC domain containing 1 [Homo sapiens] 26 7.9 gi|119372317 xin actin-binding repeat containing 2 isoform 1 [Ho... 26 7.9 gi|32469509 zinc finger and BTB domain containing 12 [Homo sapiens] 26 7.9 >gi|222352147 RIIa domain-containing protein [Homo sapiens] Length = 92 Score = 187 bits (475), Expect = 2e-48 Identities = 92/92 (100%), Positives = 92/92 (100%) Query: 1 METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKR 60 METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKR Sbjct: 1 METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKR 60 Query: 61 PDNILEFAADYFTDPRLPNKIHMQLIKDKKAA 92 PDNILEFAADYFTDPRLPNKIHMQLIKDKKAA Sbjct: 61 PDNILEFAADYFTDPRLPNKIHMQLIKDKKAA 92 >gi|38348396 hypothetical protein LOC375307 [Homo sapiens] Length = 387 Score = 40.8 bits (94), Expect = 2e-04 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 2/54 (3%) Query: 28 KIQTRIANEKYLRTHKEVEWLISGFFREIFLKRPDNILEFAADYF--TDPRLPN 79 K + R+ + YLR H E LIS F + L++P++++ FAA++F DP P+ Sbjct: 307 KEELRLGHASYLRQHPEAHALISDFLLFLLLRQPEDVVTFAAEFFGPFDPWRPS 360 >gi|8394343 sperm autoantigenic protein 17 [Homo sapiens] Length = 151 Score = 30.8 bits (68), Expect = 0.25 Identities = 14/25 (56%), Positives = 17/25 (68%) Query: 48 LISGFFREIFLKRPDNILEFAADYF 72 L+ G REI ++PDNI FAA YF Sbjct: 19 LLEGLTREILREQPDNIPAFAAAYF 43 >gi|88196790 coiled-coil domain containing 88 [Homo sapiens] Length = 1476 Score = 29.3 bits (64), Expect = 0.72 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 5/57 (8%) Query: 8 LQRPDPGALSAAQLEQLRKFKIQT--RIANEKYLRTHKEVEWLISGFFREIFLKRPD 62 L PDPG L+ A+LE L + + T ++A E+ L + E L+ RE RP+ Sbjct: 189 LSGPDPGELAPAELEMLSRSLMGTLSKLARERDLGAQRLAELLLE---REPLCLRPE 242 >gi|4758958 cAMP-dependent protein kinase, regulatory subunit alpha 2 [Homo sapiens] Length = 404 Score = 28.9 bits (63), Expect = 0.93 Identities = 10/26 (38%), Positives = 19/26 (73%) Query: 48 LISGFFREIFLKRPDNILEFAADYFT 73 L+ G+ E+ ++P +++EFA +YFT Sbjct: 13 LLQGYTVEVLRQQPPDLVEFAVEYFT 38 >gi|133778961 testis expressed 15 [Homo sapiens] Length = 2789 Score = 26.9 bits (58), Expect = 3.5 Identities = 14/60 (23%), Positives = 26/60 (43%) Query: 22 EQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKRPDNILEFAADYFTDPRLPNKI 81 ++L K T +K H +EW I+ F + K P + +E+ + T + K+ Sbjct: 303 QELEITKSSTSTIKDKDELDHLALEWQITPSFESLSQKHPQHSVEYEGNIHTSLAIAQKL 362 >gi|51243032 oxysterol-binding protein-like protein 8 isoform b [Homo sapiens] Length = 847 Score = 26.9 bits (58), Expect = 3.5 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 27 FKIQTRIANEKYLRTHKEVEWLISGFFRE-IFLKRPDN 63 F + + Y R K V+W +SGF+++ LK+P N Sbjct: 406 FLSEAALEENPYFRLKKVVKWYLSGFYKKPKGLKKPYN 443 >gi|18079218 oxysterol-binding protein-like protein 8 isoform a [Homo sapiens] Length = 889 Score = 26.9 bits (58), Expect = 3.5 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 27 FKIQTRIANEKYLRTHKEVEWLISGFFRE-IFLKRPDN 63 F + + Y R K V+W +SGF+++ LK+P N Sbjct: 448 FLSEAALEENPYFRLKKVVKWYLSGFYKKPKGLKKPYN 485 >gi|47132585 cAMP-dependent protein kinase, regulatory subunit beta 2 [Homo sapiens] Length = 418 Score = 26.9 bits (58), Expect = 3.5 Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 48 LISGFFREIFLKRPDNILEFAADYFT 73 L+ GF E+ +P ++LEFA +FT Sbjct: 12 LLQGFTVEVLRHQPADLLEFALQHFT 37 >gi|110347400 odz, odd Oz/ten-m homolog 1 isoform 3 [Homo sapiens] Length = 2725 Score = 26.6 bits (57), Expect = 4.6 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 42 HKEVEWLISGFFREIFLKRPDNILEFAADYFTDPRLPNKIHM 83 H L G++R I+ PD+ F DY D RL +H+ Sbjct: 1922 HSLQTMLSVGYYRNIYTP-PDSSTSFIQDYSRDGRLLQTLHL 1962 >gi|253970446 odz, odd Oz/ten-m homolog 1 isoform 2 [Homo sapiens] Length = 2731 Score = 26.6 bits (57), Expect = 4.6 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 42 HKEVEWLISGFFREIFLKRPDNILEFAADYFTDPRLPNKIHM 83 H L G++R I+ PD+ F DY D RL +H+ Sbjct: 1928 HSLQTMLSVGYYRNIYTP-PDSSTSFIQDYSRDGRLLQTLHL 1968 >gi|253970444 odz, odd Oz/ten-m homolog 1 isoform 1 [Homo sapiens] Length = 2732 Score = 26.6 bits (57), Expect = 4.6 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 42 HKEVEWLISGFFREIFLKRPDNILEFAADYFTDPRLPNKIHM 83 H L G++R I+ PD+ F DY D RL +H+ Sbjct: 1929 HSLQTMLSVGYYRNIYTP-PDSSTSFIQDYSRDGRLLQTLHL 1969 >gi|24797118 calcium-binding tyrosine phosphorylation-regulated protein isoform e [Homo sapiens] Length = 221 Score = 26.2 bits (56), Expect = 6.1 Identities = 11/27 (40%), Positives = 15/27 (55%) Query: 48 LISGFFREIFLKRPDNILEFAADYFTD 74 L+ G R + P NI +FAA YF + Sbjct: 17 LLEGISRAVLKTNPSNINQFAAAYFQE 43 >gi|24797116 calcium-binding tyrosine phosphorylation-regulated protein isoform c [Homo sapiens] Length = 379 Score = 26.2 bits (56), Expect = 6.1 Identities = 11/27 (40%), Positives = 15/27 (55%) Query: 48 LISGFFREIFLKRPDNILEFAADYFTD 74 L+ G R + P NI +FAA YF + Sbjct: 17 LLEGISRAVLKTNPSNINQFAAAYFQE 43 >gi|24797114 calcium-binding tyrosine phosphorylation-regulated protein isoform b [Homo sapiens] Length = 475 Score = 26.2 bits (56), Expect = 6.1 Identities = 11/27 (40%), Positives = 15/27 (55%) Query: 48 LISGFFREIFLKRPDNILEFAADYFTD 74 L+ G R + P NI +FAA YF + Sbjct: 17 LLEGISRAVLKTNPSNINQFAAAYFQE 43 >gi|24797108 calcium-binding tyrosine phosphorylation-regulated protein isoform a [Homo sapiens] Length = 493 Score = 26.2 bits (56), Expect = 6.1 Identities = 11/27 (40%), Positives = 15/27 (55%) Query: 48 LISGFFREIFLKRPDNILEFAADYFTD 74 L+ G R + P NI +FAA YF + Sbjct: 17 LLEGISRAVLKTNPSNINQFAAAYFQE 43 >gi|24797112 calcium-binding tyrosine phosphorylation-regulated protein isoform c [Homo sapiens] Length = 379 Score = 26.2 bits (56), Expect = 6.1 Identities = 11/27 (40%), Positives = 15/27 (55%) Query: 48 LISGFFREIFLKRPDNILEFAADYFTD 74 L+ G R + P NI +FAA YF + Sbjct: 17 LLEGISRAVLKTNPSNINQFAAAYFQE 43 >gi|4885583 Rho-associated, coiled-coil containing protein kinase 1 [Homo sapiens] Length = 1354 Score = 25.8 bits (55), Expect = 7.9 Identities = 11/27 (40%), Positives = 18/27 (66%) Query: 20 QLEQLRKFKIQTRIANEKYLRTHKEVE 46 QLE L+K +++ANEK + K++E Sbjct: 522 QLEDLKKVSQNSQLANEKLSQLQKQLE 548 >gi|197313654 TBCC domain containing 1 [Homo sapiens] Length = 557 Score = 25.8 bits (55), Expect = 7.9 Identities = 19/78 (24%), Positives = 31/78 (39%), Gaps = 16/78 (20%) Query: 6 GLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTH---------------KEVEWLIS 50 G LQ P P S L ++ + +Q R Y R + K++ WL Sbjct: 18 GALQVPPPSKFSLHYLRKISTY-VQIRATEGAYPRLYWSTWRHIACGKLQLAKDLAWLYF 76 Query: 51 GFFREIFLKRPDNILEFA 68 F + +K P+ LE++ Sbjct: 77 EIFDSLSMKTPEERLEWS 94 >gi|8922517 TBCC domain containing 1 [Homo sapiens] Length = 557 Score = 25.8 bits (55), Expect = 7.9 Identities = 19/78 (24%), Positives = 31/78 (39%), Gaps = 16/78 (20%) Query: 6 GLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTH---------------KEVEWLIS 50 G LQ P P S L ++ + +Q R Y R + K++ WL Sbjct: 18 GALQVPPPSKFSLHYLRKISTY-VQIRATEGAYPRLYWSTWRHIACGKLQLAKDLAWLYF 76 Query: 51 GFFREIFLKRPDNILEFA 68 F + +K P+ LE++ Sbjct: 77 EIFDSLSMKTPEERLEWS 94 >gi|119372317 xin actin-binding repeat containing 2 isoform 1 [Homo sapiens] Length = 3549 Score = 25.8 bits (55), Expect = 7.9 Identities = 11/23 (47%), Positives = 15/23 (65%) Query: 24 LRKFKIQTRIANEKYLRTHKEVE 46 +RKFK IA EKY + +E+E Sbjct: 2537 MRKFKTPLMIAEEKYRQQKEEIE 2559 >gi|32469509 zinc finger and BTB domain containing 12 [Homo sapiens] Length = 459 Score = 25.8 bits (55), Expect = 7.9 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 3/61 (4%) Query: 9 QRPDPGALSAAQLEQLR---KFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKRPDNIL 65 Q P A + + QLR +F T +A+ R HK + S F R+ FL P + L Sbjct: 11 QLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRDQFLLNPSSEL 70 Query: 66 E 66 + Sbjct: 71 Q 71 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.323 0.139 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,598,887 Number of Sequences: 37866 Number of extensions: 122102 Number of successful extensions: 290 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 275 Number of HSP's gapped (non-prelim): 22 length of query: 92 length of database: 18,247,518 effective HSP length: 63 effective length of query: 29 effective length of database: 15,861,960 effective search space: 459996840 effective search space used: 459996840 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.