Guide to the Human Genome
Home | Table of Contents | Search text | Search genes | Search sequences | Purchase | FAQ | Blog | Help

Search of human proteins with 148839296

BLASTP 2.2.11 [Jun-05-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|148839296 immunoglobulin-like and fibronectin type III
domain containing 1 [Homo sapiens]
         (868 letters)

Database: hs.faa 
           37,866 sequences; 18,247,518 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|148839296 immunoglobulin-like and fibronectin type III domain...  1780   0.0  
gi|253970427 immunoglobulin superfamily, member 22 [Homo sapiens]     579   e-165
gi|110349719 titin isoform N2-A [Homo sapiens]                        332   9e-91
gi|110349717 titin isoform novex-2 [Homo sapiens]                     332   9e-91
gi|110349713 titin isoform novex-1 [Homo sapiens]                     332   9e-91
gi|110349715 titin isoform N2-B [Homo sapiens]                        332   9e-91
gi|133908641 myosin binding protein C, fast type [Homo sapiens]       266   6e-71
gi|46049110 myosin binding protein C, slow type isoform 4 [Homo ...   249   1e-65
gi|46049125 myosin binding protein C, slow type isoform 2 [Homo ...   249   1e-65
gi|45976288 myosin binding protein C, slow type isoform 1 [Homo ...   249   1e-65
gi|46049119 myosin binding protein C, slow type isoform 3 [Homo ...   239   6e-63
gi|148596957 myosin binding protein C, cardiac [Homo sapiens]         238   2e-62
gi|55956914 myosin binding protein H [Homo sapiens]                   192   9e-49
gi|155969693 myomesin family, member 3 [Homo sapiens]                 160   5e-39
gi|156104903 myomesin 2 [Homo sapiens]                                154   4e-37
gi|140560917 myomesin 1 isoform b [Homo sapiens]                      139   1e-32
gi|194018539 myosin binding protein H-like [Homo sapiens]             134   3e-31
gi|140560919 myomesin 1 isoform a [Homo sapiens]                      132   2e-30
gi|58331253 obscurin, cytoskeletal calmodulin and titin-interact...   119   2e-26
gi|148833506 obscurin, cytoskeletal calmodulin and titin-interac...   119   2e-26
gi|116008194 myosin light chain kinase isoform 3A [Homo sapiens]      107   5e-23
gi|116008192 myosin light chain kinase isoform 1 [Homo sapiens]       107   5e-23
gi|116008190 myosin light chain kinase isoform 3B [Homo sapiens]      107   5e-23
gi|116008188 myosin light chain kinase isoform 2 [Homo sapiens]       107   5e-23
gi|222352127 sidekick 2 [Homo sapiens]                                100   6e-21
gi|119220552 sidekick 1 [Homo sapiens]                                 96   1e-19
gi|221316760 L1 cell adhesion molecule isoform 3 precursor [Homo...    93   9e-19
gi|13435353 L1 cell adhesion molecule isoform 2 precursor [Homo ...    93   9e-19
gi|4557707 L1 cell adhesion molecule isoform 1 precursor [Homo s...    93   9e-19
gi|157785645 SPEG complex locus [Homo sapiens]                         91   4e-18

>gi|148839296 immunoglobulin-like and fibronectin type III domain
           containing 1 [Homo sapiens]
          Length = 868

 Score = 1780 bits (4611), Expect = 0.0
 Identities = 868/868 (100%), Positives = 868/868 (100%)

Query: 1   MGWQPMGENWGCLEEMLNEDQSREPPGHLGSRRSGKDGRLDIYGERRDATRSSTSRYKPG 60
           MGWQPMGENWGCLEEMLNEDQSREPPGHLGSRRSGKDGRLDIYGERRDATRSSTSRYKPG
Sbjct: 1   MGWQPMGENWGCLEEMLNEDQSREPPGHLGSRRSGKDGRLDIYGERRDATRSSTSRYKPG 60

Query: 61  TGSFSKDAQGPMGHFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIF 120
           TGSFSKDAQGPMGHFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIF
Sbjct: 61  TGSFSKDAQGPMGHFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIF 120

Query: 121 KQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAG 180
           KQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAG
Sbjct: 121 KQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAG 180

Query: 181 KPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSV 240
           KPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSV
Sbjct: 181 KPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSV 240

Query: 241 TLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVER 300
           TLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVER
Sbjct: 241 TLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVER 300

Query: 301 RQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEAL 360
           RQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEAL
Sbjct: 301 RQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEAL 360

Query: 361 PKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRW 420
           PKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRW
Sbjct: 361 PKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRW 420

Query: 421 TVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITL 480
           TVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITL
Sbjct: 421 TVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITL 480

Query: 481 SWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVN 540
           SWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVN
Sbjct: 481 SWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVN 540

Query: 541 EGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWL 600
           EGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWL
Sbjct: 541 EGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWL 600

Query: 601 KDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQA 660
           KDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQA
Sbjct: 601 KDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQA 660

Query: 661 PGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLG 720
           PGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLG
Sbjct: 661 PGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLG 720

Query: 721 ILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGL 780
           ILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGL
Sbjct: 721 ILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGL 780

Query: 781 RSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKD 840
           RSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKD
Sbjct: 781 RSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKD 840

Query: 841 SGEYKAVAENTLGQAVSTATLIVIEPST 868
           SGEYKAVAENTLGQAVSTATLIVIEPST
Sbjct: 841 SGEYKAVAENTLGQAVSTATLIVIEPST 868


>gi|253970427 immunoglobulin superfamily, member 22 [Homo sapiens]
          Length = 1326

 Score =  579 bits (1492), Expect = e-165
 Identities = 301/791 (38%), Positives = 447/791 (56%), Gaps = 8/791 (1%)

Query: 78   GLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGT 137
            G++D+    G  A L   L  +   G W KDG ++T   G+   + G VH L    +   
Sbjct: 519  GMSDVHAATGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPE 578

Query: 138  QAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLR-EPLVVKAGKPVIVKIPFQSHLPIQ 196
              G+YTF A   +SEA++ + D PTI P V E L    + VK G    +K+PF+     +
Sbjct: 579  HEGKYTFRAKGTESEASVFIADPPTIDPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPK 638

Query: 197  AAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQ 256
              W KDG EV  + +    ++ G+    L + +  R+D G   + L+++ GS  A L L 
Sbjct: 639  VTWYKDGMEV--TEEERVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLS 696

Query: 257  VIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPA 316
            V+D+P PPQG +E  +   + V ++W+ P+DNGGR V  ++VERR  G+ +W+K+GE   
Sbjct: 697  VLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDG 756

Query: 317  DSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQ 375
              T F+   VE G+ Y FR+ AV SEG  + LE+EE+    P   P   S P +   + +
Sbjct: 757  KVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKE 816

Query: 376  GITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRV 435
             +T+TW AP   G A +LGY++ERRKKGSN W  VN  P+   + TV  + +  +YEFRV
Sbjct: 817  AVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRV 876

Query: 436  TAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQG 495
             AV  +GPG+P  PS +V A+DP++PPGLV++L V+D SN+SI+L+W  P   EGD   G
Sbjct: 877  IAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREP--AEGDPPSG 934

Query: 496  YVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQ 555
            Y++E+ + D+ +W  C    +  T YT  GL   + YF R+ AVNE G  +P  LD  V+
Sbjct: 935  YILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVR 994

Query: 556  AMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTK 615
            AMP    PKF + +  K  + V+ G  + +  +F   P P+V W KDG+P   R      
Sbjct: 995  AMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVPTKGRETITKS 1054

Query: 616  DGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVT 675
               +Q LI     SDSG+Y ++L+   G E  +   +RVA  P+ P  + L E VP TVT
Sbjct: 1055 KNHSQFLINSTKRSDSGVYRILLQNEFG-EARYDIHVRVADFPRPPTNLRLFEEVPNTVT 1113

Query: 676  AEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKN 735
              W  SPD  +D   HY +  R ++   W+ AA+R+ +N++T+ G+LPG +Y+FRVVA+N
Sbjct: 1114 LTWNHSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARN 1173

Query: 736  ELGASKPSDTSQPWCIPR-QRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMS 794
            E+G S+P D+   W I + Q    + K   Y + D    PRF+  L+ H + +G +C M+
Sbjct: 1174 EIGDSEPLDSRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMT 1233

Query: 795  CAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQ 854
            CA  G+PRP VT +K D ++  N   +     GVC+L IP+ + KDSG+Y  + EN LG+
Sbjct: 1234 CAFLGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGK 1293

Query: 855  AVSTATLIVIE 865
              S+ TL V +
Sbjct: 1294 DRSSCTLTVYD 1304



 Score =  137 bits (346), Expect = 3e-32
 Identities = 137/551 (24%), Positives = 214/551 (38%), Gaps = 50/551 (9%)

Query: 47  RDATRSSTSRYKPGTGSFSKDAQGPMGH----FSQGLADMEVQPGEAATLSCTLTSDLGP 102
           +DA  S +  +    G+  + AQ  +      F   L ++ V+    A L C LTS    
Sbjct: 389 KDARLSDSGEFSAEAGNLVQKAQLTIDRIPIKFVSNLKNVRVKERSRACLECELTSKDVT 448

Query: 103 GTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVA---GD---QQSEATLT 156
             W KDG  L          +G    L I   Q +  G YT VA   GD     S A +T
Sbjct: 449 LRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVT 508

Query: 157 VQDS-PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQ 215
           V++   T+   +++     +    G P  + +       ++  W KDG E+        Q
Sbjct: 509 VEERLATVKSGMSD-----VHAATGSPAELCVVLNDE-KVEGVWLKDGKEITDLPG--MQ 560

Query: 216 VDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHR 275
           +       +L  PS G +  G+Y  T R++G   ++E ++ + D P      +E    H 
Sbjct: 561 IVKQGAVHKLIFPSMGPEHEGKY--TFRAKG--TESEASVFIADPPTIDPSVLEALAAHA 616

Query: 276 AGVCLRWRPPRDNGGRTVECYVVER-RQAGRSTWLKVG-----------EAPADSTTFTD 323
             V +         G T    V  R +   + TW K G           E   D    T 
Sbjct: 617 ITVKV---------GHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTI 667

Query: 324 AHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPA-ILSASSQGITLTWT 382
           ++          ++     G+  A     +L      PK P      L  S   + + W 
Sbjct: 668 SNCVREDSGLILLKLKNDHGSATATLHLSVL----DRPKPPQGRVEFLELSGSCVHMKWK 723

Query: 383 APRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSG 442
           AP+  G   +  +++ERR  G  +W  + +       ++   V +G  Y+FR+ AV   G
Sbjct: 724 APKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEG 783

Query: 443 PGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCS 502
             +P   ++ VFA +P+ PPG     QVTD +  ++T++W  P    G    GY+VE   
Sbjct: 784 VSDP-LETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRK 842

Query: 503 SDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVC 562
             S  W+P +   +  T  T  GL     Y  RV AVN+ G  QPS   + V A      
Sbjct: 843 KGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKP 902

Query: 563 PKFLVDSSTKD 573
           P  + D    D
Sbjct: 903 PGLVQDLHVSD 913



 Score = 91.7 bits (226), Expect = 3e-18
 Identities = 164/784 (20%), Positives = 276/784 (35%), Gaps = 92/784 (11%)

Query: 105  WFKDGVKLTTQDG--VIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPT 162
            W  +G +L   D   +   +DGL H+L I   + + +G ++  AG+   +A LT+   P 
Sbjct: 360  WKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPI 419

Query: 163  IAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGY 222
                  + +R    VK      ++    S   +   W+KDG  ++  +  +  ++     
Sbjct: 420  KFVSNLKNVR----VKERSRACLECELTSK-DVTLRWKKDGQLLMHGT--KYSMNHEGKR 472

Query: 223  TRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRW 282
              L +  A   D G+Y+V    +G   +   T  V  +         + D H A      
Sbjct: 473  AELIIEDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAA------ 526

Query: 283  RPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPAD-------------STTFTDAHVEPG 329
                   G   E  VV   +     WLK G+   D                F     E  
Sbjct: 527  ------TGSPAELCVVLNDEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHE 580

Query: 330  RKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSA-SSQGITLTWTAPRGPG 388
             KYTFR +   S       E+   +  P  +      P++L A ++  IT+     +   
Sbjct: 581  GKYTFRAKGTES-------EASVFIADPPTID-----PSVLEALAAHAITV-----KVGH 623

Query: 389  SAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSG------ 442
            +AHI       +     TW     +   E R ++                  SG      
Sbjct: 624  TAHI-KVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQALLTISNCVREDSGLILLKL 682

Query: 443  PGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCS 502
              + G  +  +      RP      ++  + S + + + W  P    G     ++VE  +
Sbjct: 683  KNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKAPKDNGGRPVTQFIVERRA 742

Query: 503  SDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVC 562
                 W+        VT ++   +  G+ Y  R+ AVN  G S P   + +    P+   
Sbjct: 743  VGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGVSDPLETEEVFAGNPIEP- 801

Query: 563  PKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPE--VTWLKDGLPLPKRSVTVTKDGLTQ 620
            P F       D+    V  T   P      P+    V   K G  L    V V KD +  
Sbjct: 802  PGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNL---WVPVNKDPIQG 858

Query: 621  LLIPVAGLSDSGLY----TVVLRTLQGKEVAHSFRIRVAACPQAPG---PIHLQENVPGT 673
                V GL +   Y      V +   G+    S  +      + PG    +H+ ++   +
Sbjct: 859  TKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSS 918

Query: 674  VTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAAD-RIHTNRFTLLGILPGHEYHFRVV 732
            ++  W   P E  D P  Y +  R+     W +     I    +T+ G++   +Y FR+ 
Sbjct: 919  ISLAWR-EPAEG-DPPSGYILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIR 976

Query: 733  AKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQ-GCEC 791
            A NE G  +P        +   +    +  P   + DLS +      L+SH++ + G   
Sbjct: 977  AVNEAGVGEP--------VELDKGVRAMPPPAAPKFDLSAR------LKSHMVVRAGTAL 1022

Query: 792  CMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENT 851
            C+  A  GSP P V W K+    +G   +  T         I S    DSG Y+ + +N 
Sbjct: 1023 CIHAAFSGSPPPDVIWQKDGVPTKGRETI--TKSKNHSQFLINSTKRSDSGVYRILLQNE 1080

Query: 852  LGQA 855
             G+A
Sbjct: 1081 FGEA 1084



 Score = 40.8 bits (94), Expect = 0.005
 Identities = 22/93 (23%), Positives = 44/93 (47%), Gaps = 1/93 (1%)

Query: 774 PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDR-SLEGNPAVYSTDLLGVCSLT 832
           P F+   +    P+G +      VQG+ +PH++W +     ++ +  ++   +     L 
Sbjct: 67  PEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLK 126

Query: 833 IPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
           +  ++  DS  YK +A N    A+ T +L+V E
Sbjct: 127 LEPLTSDDSDNYKCIASNDHADAIYTVSLLVTE 159



 Score = 38.1 bits (87), Expect = 0.036
 Identities = 42/143 (29%), Positives = 65/143 (45%), Gaps = 17/143 (11%)

Query: 121 KQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLRE--PLVVK 178
           KQ G  + L I++V    AG Y+   GD++  A LTV D P       + L E  P+ V 
Sbjct: 287 KQMGTKYMLVISNVNMNDAGIYSLSVGDKRMSAELTVLDEP------LKFLGEMKPVKVT 340

Query: 179 AGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTR-LCLPSAGRKDCGQ 237
             +  + +I      P    W+ +G E+      E  V   DG T  L +  A   D G+
Sbjct: 341 ERQTAVFEIRLSKKEP-NFVWKFNGKELKRDDKYEITVS-EDGLTHTLKIKDARLSDSGE 398

Query: 238 YSVTLRSEGGSV--QAELTLQVI 258
           +S    +E G++  +A+LT+  I
Sbjct: 399 FS----AEAGNLVQKAQLTIDRI 417



 Score = 33.9 bits (76), Expect = 0.67
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 221  GYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPD 262
            G   L +P+   KD G YSV + +E G  ++  TL V DK D
Sbjct: 1266 GVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDD 1307


>gi|110349719 titin isoform N2-A [Homo sapiens]
          Length = 33423

 Score =  332 bits (851), Expect = 9e-91
 Identities = 188/609 (30%), Positives = 306/609 (50%), Gaps = 11/609 (1%)

Query: 145   VAGDQQSEATLTVQDS---PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRK 201
             V+  +++   +TVQD    PTI  D++   ++ + V AG+PV + IP     P  A+W  
Sbjct: 29717 VSEPRETVTAVTVQDLRVLPTI--DLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFF 29774

Query: 202   DGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKP 261
              G+++  S      V+      +L +     +D G+Y++ L++  G+    + + ++DKP
Sbjct: 29775 AGSKLRESE--RVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKP 29832

Query: 262   DPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTF 321
              PP GP+++ +     + + W PP  +GG  +  YVVE+R A R  WL V E+   ST F
Sbjct: 29833 GPPTGPIKIDEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRST-F 29891

Query: 322   TDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEA-LPKAPSAPAILSASSQGITLT 380
                 +  G +Y FRV A    G G  L+SE I       +P  P    I   S  G+TLT
Sbjct: 29892 KFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIECRSSIRIPGPPETLQIFDVSRDGMTLT 29951

Query: 381   WTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAP 440
             W  P   G + + GY++ER++  ++ W  VN  PV   R+    + +G +YE RVTA+  
Sbjct: 29952 WYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINA 30011

Query: 441   SGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVEL 500
              G G+P  PS  + A DP+ PPG  +N +VTD + TS++L+W+ P+ + G +  GY++E+
Sbjct: 30012 RGSGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEM 30071

Query: 501   CSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVT 560
                D  +W  C+     +  YT   L  G  Y  RV A N GG  +P+ +   V+   + 
Sbjct: 30072 QKVDQHEWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEML 30131

Query: 561   VCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQ 620
               P + +D   ++ + V+ G  +R+ +  +  P P   W K+G  + KR++  T +  T+
Sbjct: 30132 EYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTE 30191

Query: 621   LLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWE 679
             L+I  A   DSG Y +VL    GK+  +  ++RV   P +P GP+   +    +V   W 
Sbjct: 30192 LVIKEADRGDSGTYDLVLENKCGKKAVY-IKVRVIGSPNSPEGPLEYDDIQVRSVRVSWR 30250

Query: 680   PSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGA 739
             P  D+     L Y +  R      W+    R+      + G+    EYHFRV A+N+ G 
Sbjct: 30251 PPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGI 30310

Query: 740   SKPSDTSQP 748
             SKP  + +P
Sbjct: 30311 SKPLKSEEP 30319



 Score =  295 bits (755), Expect = 1e-79
 Identities = 176/588 (29%), Positives = 283/588 (48%), Gaps = 9/588 (1%)

Query: 166   DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
             D+  +  E +  +AG  V ++            W KD  E+   ++    V+       +
Sbjct: 26873 DLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKEL--QTNALVCVENTTDLASI 26930

Query: 226   CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPP 285
              +  A R + G Y + LR+  GS  A + +Q++DKP PP GP+E +      + L WRPP
Sbjct: 26931 LIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPP 26990

Query: 286   RDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAG 345
              D+GG  +  Y+VE+R+  R  W  V E   +    T   +  G +Y FRVRAV   G G
Sbjct: 26991 ADDGGAKITHYIVEKRETSRVVWSMVSEH-LEECIITTTKIIKGNEYIFRVRAVNKYGIG 27049

Query: 346   EALESEEILVAPEAL--PKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKG 403
             E LES+ + VA  A   P  P  P +   +   +T+ W+ P   G + I GY +E+R K 
Sbjct: 27050 EPLESDSV-VAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKK 27108

Query: 404   SNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPG 463
             S  W  V  + + + R  V  + +   Y++RV AV  +G G    PS+   A DP+ PPG
Sbjct: 27109 SLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPG 27168

Query: 464   LVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHV-GTVPVTTYT 522
                 +++ D + +SITL W+ P    G    GYVVE+   +  +W      G V  T Y 
Sbjct: 27169 PPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYV 27228

Query: 523   AKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDT 582
                L+PG  Y+ RV+AVN  GQ +P  ++  VQA  +   P+  +D + +  +  K G+ 
Sbjct: 27229 VSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGED 27288

Query: 583   VRVPVSFEAMPMPEVTWLKD--GLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRT 640
             V+V + F+  P P VTW KD   L    R      D  + L IP    +D+G Y + +  
Sbjct: 27289 VQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIEN 27348

Query: 641   LQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSA 700
               G+  + +  ++V   P A   + ++    GTVT  W+P   +     ++Y +  R + 
Sbjct: 27349 GVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDAT 27408

Query: 701   HGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
                W   + +  +  F L+ +     + FRV+A+NE+G  +P +T++P
Sbjct: 27409 KRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEP 27456



 Score =  286 bits (733), Expect = 4e-77
 Identities = 183/608 (30%), Positives = 287/608 (47%), Gaps = 13/608 (2%)

Query: 145   VAGDQQSEATLTVQDS---PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSH-LPIQAAWR 200
             V+   +S   + V+D    P +  DV  K R+ +VVKAG+ + +        LP+  +W 
Sbjct: 25768 VSEPSESTGPIIVKDDVEPPRVMMDV--KFRDVIVVKAGEVLKINADIAGRPLPV-ISWA 25824

Query: 201   KDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDK 260
             KDG E+        ++   D +T L +    R+D GQY +TL++  G+    +  +V+DK
Sbjct: 25825 KDGIEI--EERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDK 25882

Query: 261   PDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTT 320
             P PP GP+E+         L W  P+++GG  ++ Y+VE+R+     W  + E     T+
Sbjct: 25883 PGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWT-ICEGELQMTS 25941

Query: 321   FTDAHVEPGRKYTFRVRAVTSEGAGEALESEEI-LVAPEALPKAPSAPAILSASSQGITL 379
                  +  G +Y FRV  V   G GE LES  I  + P  +P  P++  I S + + +TL
Sbjct: 25942 CKVTKLLKGNEYIFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLEITSVTKESMTL 26001

Query: 380   TWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVA 439
              W+ P   G + I GY+IERR+K S  W  VN +PV + R     +R+GC+YE+RV A  
Sbjct: 26002 CWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAEN 26061

Query: 440   PSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVE 499
              +G   P   S  + A DP+  P      ++ D   T+IT++W  P    G    GY VE
Sbjct: 26062 AAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVE 26121

Query: 500   LCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPV 559
                SD   W    + ++  T YT  GL  G  Y  RV +VN+ G S PS       A   
Sbjct: 26122 YKKSDDTDW-KTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKER 26180

Query: 560   TVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLT 619
                P F +DS  +  L VK G +  + V F   P+P V W K    L  R+   T D  T
Sbjct: 26181 EEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRT 26240

Query: 620   QLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWE 679
              L I  A  +DSG YT+ ++ +     + +  ++V   P  P  I +Q+    +    W+
Sbjct: 26241 SLTIENANRNDSGKYTLTIQNVL-SAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWD 26299

Query: 680   PSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGA 739
                ++      +Y +  R ++   W    +  +   + +  +  G  Y+FRV  +NE G 
Sbjct: 26300 VPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGV 26359

Query: 740   SKPSDTSQ 747
               P++T +
Sbjct: 26360 GIPAETKE 26367



 Score =  284 bits (727), Expect = 2e-76
 Identities = 189/655 (28%), Positives = 304/655 (46%), Gaps = 13/655 (1%)

Query: 99    DLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITH--VQGTQAGRYTFVAGDQQSEATLT 156
             DL  G W K     T      F   GLV         +    AG ++  +    +     
Sbjct: 24643 DLPDGRWMK--ASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARD 24700

Query: 157   VQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQV 216
               D+P  + D   K ++ +VV AG+  +++   +        W KDG E+  ++ R  ++
Sbjct: 24701 EIDAPNASLD--PKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAAR-MEI 24757

Query: 217   DLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRA 276
                   T L +    R D GQY + L + GG+    +T++V+D+P PP+GP++V      
Sbjct: 24758 KSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAE 24817

Query: 277   GVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRV 336
                L W PP  +GG  +  Y++E+R+  R +W +V      +  +    + PG +Y FRV
Sbjct: 24818 KCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVS-TEVQALNYKVTKLLPGNEYIFRV 24876

Query: 337   RAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGY 395
              AV   G GE LES  +    P   P  PS P + + +   + +TW  P   G   I GY
Sbjct: 24877 MAVNKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGY 24936

Query: 396   LIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFA 455
             ++E+R K    WT  N + + + R  V  + +G  YEFRV A   +G GEP  PS    A
Sbjct: 24937 ILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRA 24996

Query: 456   RDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGT 515
              D + PPG   N +VTD S +S++L+W+ P    G   +GYVVE+  + + +W  C   T
Sbjct: 24997 CDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPT 25056

Query: 516   -VPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDL 574
              +    +T   L+    Y  R+ A+N  G  +P+ L   V A      P+  +D+  + +
Sbjct: 25057 GLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKV 25116

Query: 575   LTVKVGDTVRVPVSFEAMPMPEVTWLK-DGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGL 633
             + ++   T+R+ V+ +  P PEV W K +G+   +  + VT    T L+I      DSG 
Sbjct: 25117 VVLRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVT-SSFTMLVIDNVTRFDSGR 25175

Query: 634   YTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYA 693
             Y + L    G + A    +RV   P AP  + ++E    +VT  WEP   +      +Y 
Sbjct: 25176 YNLTLENNSGSKTAF-VNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYI 25234

Query: 694   VFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             V  R +    +    +      F +  +  G  Y+FRV+A NE G   P++T++P
Sbjct: 25235 VEKRETTRKAYATITNNCTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEP 25289



 Score =  284 bits (726), Expect = 3e-76
 Identities = 190/641 (29%), Positives = 304/641 (47%), Gaps = 26/641 (4%)

Query: 137   TQAGRYTF-VAGDQQ------SEATLTVQDSPTIAPDVTEKLREPL--VVKAGKPVIVKI 187
             T+   YTF V+ + +      SE T+  +D   +APD+  K    L  + K      +KI
Sbjct: 19946 TEGKEYTFRVSAENENGEGTPSEITVVARDD-VVAPDLDLKGLPDLCYLAKENSNFRLKI 20004

Query: 188   PFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGG 247
             P +       +W+K   E   ++D    V+     T L +    + D G+Y++TL++  G
Sbjct: 20005 PIKGKPAPSVSWKK--GEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAG 20062

Query: 248   SVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRST 307
             + +  ++++V+ KP  P GP++  +     + L+W PP+D+GG  +  Y++E+R +  + 
Sbjct: 20063 TKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNK 20122

Query: 308   WLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA-PEALPKAPSA 366
             W+    A    TTF    +  G +YTFRV A    G GE L+SE I+   P  +P AP  
Sbjct: 20123 WVTCASA-VQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPP 20181

Query: 367   PAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVR 426
             P I+      ++LTWT P+  G + I GY +E +++ S  W   N  P+  R + V  + 
Sbjct: 20182 PNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLT 20241

Query: 427   QGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPD 486
             +G +YEFRV A+  +G G+P  PS+ V A DP+ PPG    + +T     S+TL W  P 
Sbjct: 20242 EGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINIT---RNSVTLIWTEPK 20298

Query: 487   TQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ-S 545
                G +  GY+VE     S  W+  +   VP   +T   L  G  Y  R+ A N  G  S
Sbjct: 20299 YDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAIS 20358

Query: 546   QPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRV-PVSFEAMPMPEVTWLKDGL 604
              PS     +        P  ++D + KD LT+K GDT+ +  +S    P+P+ +W K G 
Sbjct: 20359 APSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGK 20418

Query: 605   PLPKRSVT-VTKDGLTQLL-IPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPG 662
              +    +T +T    + +L I  A   D+G YT+      G +V H  ++ V   P  PG
Sbjct: 20419 DIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEH-VKVTVLDVPGPPG 20477

Query: 663   PIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGIL 722
             P+ +        T  W P  ++       Y +  R ++   W   ++ I + R     ++
Sbjct: 20478 PVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKLI 20537

Query: 723   PGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAP 763
              G+EY FRV A N  G  +P   S+P    +  DRF    P
Sbjct: 20538 QGNEYIFRVSAVNHYGKGEPVQ-SEP---VKMVDRFGPPGP 20574



 Score =  284 bits (726), Expect = 3e-76
 Identities = 173/592 (29%), Positives = 290/592 (48%), Gaps = 10/592 (1%)

Query: 159   DSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDL 218
             ++P I  DV  K ++ +++KAG+   ++       P    W KDG E+ G++  E  + +
Sbjct: 21457 EAPKIKVDV--KFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLE--IKI 21512

Query: 219   GDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGV 278
              D  T L    + R+D G Y++T  + GG  +    ++V+D+P PP+GP+ V +      
Sbjct: 21513 ADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKC 21572

Query: 279   CLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRA 338
              L W PP D+GG  ++ Y+V++R+  R  W  V  +    T      +  G +Y FRV A
Sbjct: 21573 VLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVA-SEVQVTKLKVTKLLKGNEYIFRVMA 21631

Query: 339   VTSEGAGEALESEEIL-VAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLI 397
             V   G GE LESE +L V P   P  P  P + + +   + + W  P   G + I+ Y++
Sbjct: 21632 VNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIV 21691

Query: 398   ERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARD 457
             ERR K    W   N + + + R+ V+ + +G +YEFR+ A   +G   P P S    A D
Sbjct: 21692 ERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACD 21751

Query: 458   PMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQW-LPCHVGTV 516
              +  PG   N +V D S +SI+++W  P    G E  GY+VE+   +  +W +      +
Sbjct: 21752 TVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGL 21811

Query: 517   PVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLT 576
               T+YT  GL   + Y +R+ A+N  G  +P+ +    +A    + P+  +D+  + ++T
Sbjct: 21812 KATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVT 21871

Query: 577   VKVGDTVRVPVSFEAMPMPEVTWLKD-GLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYT 635
             ++   T+R+ V  +  P PEV W +D G  L K S+  T    T L++      DSG Y 
Sbjct: 21872 IRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIEST-SSYTLLIVGNVNRFDSGKYI 21930

Query: 636   VVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVF 695
             + +    G + A    +RV   P  P  + ++E    +VT  W+P   +      +Y V 
Sbjct: 21931 LTVENSSGSKSAF-VNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVE 21989

Query: 696   TRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQ 747
              R S    +   A   H   + +  +  G  Y+FRV+A+NE G   P++T++
Sbjct: 21990 KRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAE 22041



 Score =  281 bits (719), Expect = 2e-75
 Identities = 181/627 (28%), Positives = 302/627 (48%), Gaps = 24/627 (3%)

Query: 138   QAGRYTF----------VAGDQQSEATLTVQD---SPTIAPDVTEKLREPLVVKAGKPVI 184
             + G+Y F          ++   +S  T+  +D   +PTI  D T  +++ L +KAG  ++
Sbjct: 20340 EGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIVLDPT--IKDGLTIKAGDTIV 20397

Query: 185   VKIPFQSHLPI-QAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLR 243
             +        P+ +++W K G ++  S     Q+      + L +  A RKD G+Y++T  
Sbjct: 20398 LNAISILGKPLPKSSWSKAGKDIRPSDI--TQITSTPTSSMLTIKYATRKDAGEYTITAT 20455

Query: 244   SEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQA 303
             +  G+    + + V+D P PP GP+E+ +       L W PP ++GG  ++ Y++E+R+ 
Sbjct: 20456 NPFGTKVEHVKVTVLDVPGPP-GPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRET 20514

Query: 304   GRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEI-LVAPEALPK 362
              R  W  V E    S       +  G +Y FRV AV   G GE ++SE + +V     P 
Sbjct: 20515 SRLLWTVVSE-DIQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQSEPVKMVDRFGPPG 20573

Query: 363   APSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTV 422
              P  P + + +    T++W  P   G + I GY +ERR+K S  W      PV + R  V
Sbjct: 20574 PPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDLRCKV 20633

Query: 423   ADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSW 482
               +++G  YEFRV+A   +G G P   SD+V  +D   PPG   N  VTD +  S +L+W
Sbjct: 20634 TGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSASLAW 20693

Query: 483   AGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGT-VPVTTYTAKGLRPGEGYFVRVTAVNE 541
               P    G E  GYVVE        W+    GT + +T +    L+  E Y  R++A+N+
Sbjct: 20694 GKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAIND 20753

Query: 542   GGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLK 601
              G  +P+ +   V+ +   + P F +D+  +  L V+ G ++R+ V  +  P PEVTW K
Sbjct: 20754 AGVGEPAVIPD-VEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTK 20812

Query: 602   DGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP 661
             D + L  R+     +  T L+IP     D+G + + +    GK+ +    +RV   P   
Sbjct: 20813 DNINLKNRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKK-SGFVNVRVLDTPGPV 20871

Query: 662   GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGI 721
               +   +    +VT  W+    +      +Y V  R +    +  A  + H   + + G+
Sbjct: 20872 LNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTKCHKCTYKVTGL 20931

Query: 722   LPGHEYHFRVVAKNELGASKPSDTSQP 748
               G EY FRV+A+NE G  +P++T++P
Sbjct: 20932 SEGCEYFFRVMAENEYGIGEPTETTEP 20958



 Score =  279 bits (714), Expect = 7e-75
 Identities = 165/576 (28%), Positives = 281/576 (48%), Gaps = 6/576 (1%)

Query: 175   LVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKD 234
             L++K+G+ + +K   Q     +  W KDG E+    + E    LG   T L +  A R  
Sbjct: 27968 LIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGS--TSLFVRDATRDH 28025

Query: 235   CGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVE 294
              G Y+V  ++  GS +AE+ ++V D P    GP+   +     + L W  P ++G   + 
Sbjct: 28026 RGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPIT 28085

Query: 295   CYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEIL 354
              Y++E+R+  R  W  + E   ++ ++T   +  G +Y FRV AV   G G  L+S+ ++
Sbjct: 28086 HYIIEKRETSRLAWALI-EDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVV 28144

Query: 355   VAPE-ALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAV-ND 412
                +  +P AP  P   + +   ITLTW  P   G + I  Y++ERR+K S  W  V + 
Sbjct: 28145 AQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISK 28204

Query: 413   QPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTD 472
             +P+ E R+ V  + +G +YEF V A   +G G     S  +  R+P+ PPG    ++VTD
Sbjct: 28205 RPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTD 28264

Query: 473   RSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGY 532
              S T+++L W+ P    G E  GY++E+C +D   W   +      T YT   L+ GE Y
Sbjct: 28265 TSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEY 28324

Query: 533   FVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAM 592
               RV+A+N  G+     +   ++A+     P+  +D++ K    V+ G ++R+ ++++  
Sbjct: 28325 KFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGR 28384

Query: 593   PMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRI 652
             P P   W K    L  R+   T D  + L +     +D+G YT+ +    G + + +F +
Sbjct: 28385 PTPTAVWSKPDSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSK-SITFTV 28443

Query: 653   RVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIH 712
             +V   P  PGPI  ++   G+ T  W+    +      HY V  R ++   W   +++  
Sbjct: 28444 KVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISEKCT 28503

Query: 713   TNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
                F +  +  G  Y+FRV A NE G  +P +  +P
Sbjct: 28504 RQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEP 28539



 Score =  277 bits (708), Expect = 3e-74
 Identities = 194/673 (28%), Positives = 302/673 (44%), Gaps = 19/673 (2%)

Query: 81    DMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAG 140
             D+   PG        L  D     W ++ + +   D      +G +H L I  ++    G
Sbjct: 12920 DILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQG 12979

Query: 141   RYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWR 200
              Y F+A D+++ A L +  +P I     +   + LVV  GKP+ + +P+ ++   +A W 
Sbjct: 12980 EYRFIAKDKEARAKLELAAAPKI-----KTADQDLVVDVGKPLTMVVPYDAYPKAEAEWF 13034

Query: 201   KDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDK 260
             K+   +   +     +D     T   +  A + D G+Y + L+++ G  +  + L+VID 
Sbjct: 13035 KENEPLSTKT-----IDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDV 13089

Query: 261   PDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTT 320
             P P +  +EV +     V L W  P  +GG  +  YVVERR   R TW+   +  A+S  
Sbjct: 13090 PGPVRN-LEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDR-AESCE 13147

Query: 321   FTDAHVEPGR-KYTFRVRAVTSEGAGEALESEEILVAPEA--LPKAPSAPAILSASSQGI 377
             FT   ++ G  +Y FRV A    G GE +E++  + A     +P  P    I   +  G+
Sbjct: 13148 FTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGV 13207

Query: 378   TLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTA 437
             +LTW  P   G A I  Y+IE R K S  W         +   TV DV +G +Y FRV A
Sbjct: 13208 SLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRA 13267

Query: 438   VAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYV 497
                 G G+P   +  V   DP+  P    NL  +D++ +S+ L W  P    G    GY+
Sbjct: 13268 QNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYI 13327

Query: 498   VELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAM 557
             +E C      W+ C++  VP  TY   GL  G  Y  RV+A N+ G S PS +   + A 
Sbjct: 13328 IERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTAD 13387

Query: 558   PVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWL--KDGLPLPKRSVTVTK 615
                V P   + S+ KD L V V + + + V     P P  TW      L    R    T 
Sbjct: 13388 DAFVEPTMDL-SAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTL 13446

Query: 616   DGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVT 675
                 +L+I  +  SD G+YT+ L   + K ++    + V A P AP  +   +    +V 
Sbjct: 13447 SAYAELVISPSERSDKGIYTLKLEN-RVKTISGEIDVNVIARPSAPKELKFGDITKDSVH 13505

Query: 676   AEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKN 735
               WEP  D+       Y V  R  +   W +  D +    FT+  ++ G EY F+V A+N
Sbjct: 13506 LTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARN 13565

Query: 736   ELGASKPSDTSQP 748
             + G  +P+   +P
Sbjct: 13566 KCGPGEPAYVDEP 13578



 Score =  266 bits (679), Expect = 8e-71
 Identities = 174/592 (29%), Positives = 269/592 (45%), Gaps = 11/592 (1%)

Query: 165   PDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTR 224
             P +  KL   L VKAG  + ++   +     + AW KD      +     ++D     ++
Sbjct: 18201 PVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSK 18260

Query: 225   LCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRP 284
               L  A R D G+Y VT  +  GS  A  T+ V+DKP P +  +++ D       + W P
Sbjct: 18261 FSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRN-LKIVDVSSDRCTVCWDP 18319

Query: 285   PRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGA 344
             P D+GG  ++ Y++E+ +  R  W           T     +E G +Y FRVRA    G 
Sbjct: 18320 PEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIE-GNEYIFRVRAENKIGT 18378

Query: 345   GEALESEEILVAPEA-LPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKG 403
             G   ES+ ++   +   P  P  P +   S + +T+ W  P   G   I GY +E+++K 
Sbjct: 18379 GPPTESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKH 18438

Query: 404   SNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPG 463
             S  W  VN   +PERR  V ++    +Y+FRV A    G GEP  PS  V A+DP+ PPG
Sbjct: 18439 STRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPG 18498

Query: 464   LVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVEL-----CSSDSLQWLPCHVGTVPV 518
                N +V D +  SITL W  P    G    GYVVE+      +S    W  C+     V
Sbjct: 18499 PPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLV 18558

Query: 519   -TTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTV 577
                +T   L   + Y  RV A N+ G  +P+ L   ++   +   P+  +D+S + L+ V
Sbjct: 18559 RKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVIV 18618

Query: 578   KVGDTVRVPVSFEAMPMPEVTWLKDGLP-LPKRSVTVTKDGLTQLLIPVAGLSDSGLYTV 636
             + G  +R+       P P+VTW K G+  + ++      D +  L+IP +   DSG Y++
Sbjct: 18619 RAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSL 18678

Query: 637   VLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFT 696
              L    G E A    +RV   P     + + +    +    W P  ++      HY V  
Sbjct: 18679 TLVNPAG-EKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEK 18737

Query: 697   RSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             R +    W      +    F +  ++PG+EY+FRV A NE G   P+D  +P
Sbjct: 18738 READRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKP 18789



 Score =  266 bits (679), Expect = 8e-71
 Identities = 184/657 (28%), Positives = 293/657 (44%), Gaps = 18/657 (2%)

Query: 99    DLGPGTWFKDGVKLTTQDGVIFKQDGLV--HSLFITHVQGTQAGRYTFVAGDQQSEATLT 156
             +L  G W K     T      F+  GLV  H      +    AG ++      +S   +T
Sbjct: 22479 ELPEGRWMK--ASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFS---EPSESTGAIT 22533

Query: 157   VQDS---PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDRE 213
              +D    P I+ D   K ++ +VV AG+   V             W K   E+  S+   
Sbjct: 22534 ARDEVDPPRISMD--PKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL--SNTAR 22589

Query: 214   AQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDC 273
              ++   D  T L +  A R D G Y +  ++  G     + ++V+D+P PP+GP+ +   
Sbjct: 22590 LEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGV 22649

Query: 274   HRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYT 333
                   L W+PP  +GG  +  Y+VERR+  R  W  V +A   + +     +  G +YT
Sbjct: 22650 TAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVV-DANVQTLSCKVTKLLEGNEYT 22708

Query: 334   FRVRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHI 392
             FR+ AV   G GE LESE ++   P  +P AP AP + + +   + + W  P   G + I
Sbjct: 22709 FRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEI 22768

Query: 393   LGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDA 452
             LGY++E+R K    WT  + + + E R  V  + +   YEFRV+A   +G  EP PPS  
Sbjct: 22769 LGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAY 22828

Query: 453   VFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCH 512
               A DP+  PG   N +V D + +S+ LSW+ P    G E QGY+VE C     +W  C 
Sbjct: 22829 QKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCT 22888

Query: 513   VGT-VPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSST 571
               T +  T    + L     Y  R+ A+N+ G  + + +   +        P   +D   
Sbjct: 22889 PPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLEL 22948

Query: 572   KDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDS 631
             + ++ ++ G ++R+ V  +  P PEV W K    +   ++       T L++      DS
Sbjct: 22949 RKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTSLVLDNVNRYDS 23008

Query: 632   GLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLH 691
             G YT+ L    G + A    +RV   P  P  + + E    +V+  WEP   +      +
Sbjct: 23009 GKYTLTLENSSGTKSAF-VTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKN 23067

Query: 692   YAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             Y V  R +    +       H N + +  +  G  Y+FRV A+NE G   P+ T+ P
Sbjct: 23068 YIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADP 23124



 Score =  264 bits (674), Expect = 3e-70
 Identities = 169/584 (28%), Positives = 277/584 (47%), Gaps = 9/584 (1%)

Query: 166   DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
             D++  ++  L VKAG  V +            +W+KDG  +  +     ++ +      L
Sbjct: 19296 DLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEG--IKMAMQRNLCTL 19353

Query: 226   CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPP 285
              L S  RKD G Y++T  +  GS  A + L+V+DKP PP   +++   +     L W PP
Sbjct: 19354 ELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPAS-VKINKMYSDRAMLSWEPP 19412

Query: 286   RDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAG 345
              ++GG  +  Y+V++R+  R  W +V      ++   +  +E G +Y FR+ A    G G
Sbjct: 19413 LEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIE-GHEYQFRICAENKYGVG 19471

Query: 346   EALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGS 404
             + + +E  +   P   P     P I + +   +T++W  P   G + I GYL+E+R+  +
Sbjct: 19472 DPVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQA 19531

Query: 405   NTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGL 464
               WT VN +P+ ER      +++G +YEFRVTA+  +GPG+P   S A +ARDP  PPG 
Sbjct: 19532 VNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGP 19591

Query: 465   VRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHV-GTVPVTTYTA 523
                 +V D + +S++LSW  P    G    GY+VE+  +DS  W+ C++   +  T +  
Sbjct: 19592 PAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEV 19651

Query: 524   KGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTV 583
              GL     Y  RV AVN+ G S PS +        + + P+  +D+  +  L ++ G T+
Sbjct: 19652 TGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTM 19711

Query: 584   RVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTK--DGLTQLLIPVAGLSDSGLYTVVLRTL 641
             R+ V  +  P P++TW K  + L  R     K  D  T L        D+G Y + L   
Sbjct: 19712 RLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENS 19771

Query: 642   QGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAH 701
              GK+  ++  ++V   P  P  + ++E    +    WEP   +     ++Y V  R +  
Sbjct: 19772 CGKK-EYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAER 19830

Query: 702   GPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
               W           F +  +  G  Y FRV A+NE G   P +T
Sbjct: 19831 KSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGET 19874



 Score =  263 bits (673), Expect = 4e-70
 Identities = 167/589 (28%), Positives = 274/589 (46%), Gaps = 11/589 (1%)

Query: 165   PDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTR 224
             P +    R+ L ++ G+   +   +      + +W KD A+V+   D    +        
Sbjct: 16818 PTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVL--EDDRTHIKTTPATLA 16875

Query: 225   LCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRP 284
             L    A R D G+Y V + +  GS +    + V+D+P PP GP+   +  +  + + W+P
Sbjct: 16876 LEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKP 16935

Query: 285   PRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGA 344
             P D+GG  +  Y++E+++ G+  W+ V  A A +T      +E G+ Y FR+ A    G 
Sbjct: 16936 PLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLE-GKDYIFRIHAENLYGI 16994

Query: 345   GEALESEEILVAPE-ALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKG 403
              + L S+ +       +P AP  P +   +     +TW  P   G   I  Y++E+R+  
Sbjct: 16995 SDPLVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKPHDGGKP-ITNYILEKRETM 17053

Query: 404   SNTWTAVNDQPV-PERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP 462
             S  W  V   P+ P  ++ V D+ +GCQYEFRV+A    G G+P PPS  VFA+DP+  P
Sbjct: 17054 SKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKP 17113

Query: 463   GLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCH--VGTVPVTT 520
                 N +  D +  S+ L+W  P    G +  GY+VE       +W   +    + P T 
Sbjct: 17114 SPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETK 17173

Query: 521   YTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVG 580
             Y   GLR G+ Y  RV AVN  G+S P+ +   V        P+ ++D++      +KVG
Sbjct: 17174 YKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVG 17233

Query: 581   DTVRVPVSFEAMPMPEVTWLKDGLPLP-KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLR 639
             DT+R+    + +P P+VTW K+    P K  + VT  G ++L I  A   D G+Y++ + 
Sbjct: 17234 DTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVG-SKLEIRNAAHEDGGIYSLTVE 17292

Query: 640   TLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSS 699
                G +   S ++ V   P  P  + + E    +    W+   D+   V  +Y V  R  
Sbjct: 17293 NPAGSKTV-SVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDV 17351

Query: 700   AHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             A   W   +            +  G++Y FRV A+N+ G     +T +P
Sbjct: 17352 ASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKP 17400



 Score =  263 bits (672), Expect = 5e-70
 Identities = 187/652 (28%), Positives = 297/652 (45%), Gaps = 30/652 (4%)

Query: 114   TQDGVIFKQDGLVHSLFITHVQGTQAGR-YTF------VAGDQQSEATLTVQDSPTIAPD 166
             TQD + FK    +  +    V G Q G+ Y F      + G    + T+ ++    + P 
Sbjct: 17453 TQDWIKFKTVTNLECV----VTGLQQGKTYRFRVKAENIVGLGLPDTTIPIECQEKLVPP 17508

Query: 167   VTE---KLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYT 223
               E   KL E LVVKAG  V      +      A W  DG+E+   +D    V+  +  +
Sbjct: 17509 SVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEI--KTDEHYTVETDNFSS 17566

Query: 224   RLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWR 283
              L + +  R+D G+Y +T+ +  GS    + L V+D P PP GP+ + D     + + W+
Sbjct: 17567 VLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTISWQ 17626

Query: 284   PPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEG 343
             PP+D+GG  V  Y+VE++   + TW  V    +  T     H++ G +Y FRVRA    G
Sbjct: 17627 PPKDDGGSPVINYIVEKQDTRKDTWGVVSSG-SSKTKLKIPHLQKGCEYVFRVRAENKIG 17685

Query: 344   AGEALESEEILVAPE-ALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKK 402
              G  L+S   +   + + P  P  P +   +    T++WT P+  G + I GY +ERR+ 
Sbjct: 17686 VGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREV 17745

Query: 403   GSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP 462
              +  W  VN  P+ + ++ V  + +G  YEFRV A   +G  +P P SD + A  P++PP
Sbjct: 17746 -TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKPP 17804

Query: 463   GLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVG-TVPVTTY 521
             G   N ++ D+S  +  L W  P +  G    GYVVE     + QW   +    +    +
Sbjct: 17805 GPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAF 17864

Query: 522   TAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGD 581
                GL  G  Y  R+ A N  G+ +P  L   V A  +   P+  +D + +D++TV+VG 
Sbjct: 17865 RVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQ 17924

Query: 582   TVRVPVSFEAMPMPEVTWLKDG--LPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLR 639
             T+R+    +  P P++TW K+G  L   KR   +      +L I  A  +D G Y +  +
Sbjct: 17925 TIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAK 17984

Query: 640   TLQGKEVAHSFRIRVAACPQAPGP---IHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFT 696
                G    H+    +      PGP   + +        T  WE   D       ++ V  
Sbjct: 17985 NSSG----HAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEY 18040

Query: 697   RSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             R      W   A  + T R     +L  +EY+FRV A+N++G     +T  P
Sbjct: 18041 RKPNQKGWSIVASDV-TKRLIKANLLANNEYYFRVCAENKVGVGPTIETKTP 18091



 Score =  259 bits (661), Expect = 1e-68
 Identities = 166/575 (28%), Positives = 261/575 (45%), Gaps = 12/575 (2%)

Query: 173   EPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGR 232
             E + +KAGK + ++            W+K   EVV SS     V   D  + L +    R
Sbjct: 18906 EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSS--HLAVHKADSSSILIIKDVTR 18963

Query: 233   KDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRT 292
             KD G YS+T  +  G+   ++ + V+D P PPQ P ++ D       L W  P ++GG  
Sbjct: 18964 KDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHIPLEDGGSN 19023

Query: 293   VECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEE 352
             +  Y+VE+    R  W+    A    T+     + PG++Y FRVRA    G  E L S +
Sbjct: 19024 ITNYIVEKCDVSRGDWV-TALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPLTSPK 19082

Query: 353   ILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVN 411
             ++   P  +P  P    +   +   I + W  P   G + I+GYLIER+++ S  W   N
Sbjct: 19083 MVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVKAN 19142

Query: 412   DQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVT 471
             D  V    +  A + +G +Y FR+ A+  +G   P  P++ V AR P+ PPG     +V 
Sbjct: 19143 DTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPG---KPEVI 19199

Query: 472   DRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVG--TVPVTTYTAKGLRPG 529
             D + ++++L WA P    G +  GY VE C     +W+ C+     +P   YTA GL   
Sbjct: 19200 DVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEEK 19259

Query: 530   EGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSF 589
               Y  R  A      S PS     V  +   V P+  +  + K LLTVK G  V +  + 
Sbjct: 19260 AQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCLDATV 19319

Query: 590   EAMPMPEVTWLKDGLPL-PKRSVTVT-KDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVA 647
                PMP V+W KDG  L P   + +  +  L  L +      DSG YT+      G + A
Sbjct: 19320 FGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSA 19379

Query: 648   HSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEA 707
              + +++V   P  P  + + +         WEP  ++      +Y V  R ++   W + 
Sbjct: 19380 -TIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQV 19438

Query: 708   ADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKP 742
             +  +     ++  ++ GHEY FR+ A+N+ G   P
Sbjct: 19439 SATVPITSCSVEKLIEGHEYQFRICAENKYGVGDP 19473



 Score =  258 bits (658), Expect = 2e-68
 Identities = 170/617 (27%), Positives = 289/617 (46%), Gaps = 36/617 (5%)

Query: 173   EPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDR----EAQVDLGDGYTRLCLP 228
             + + VKAG+PV +          +  W K+   +   +D     + +V   +  T L +P
Sbjct: 15406 DTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIP 15465

Query: 229   SAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDN 288
              A R+D G Y+VT  +  GSV   + ++V D+P PP+  + V D       L W  P DN
Sbjct: 15466 KAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRN-LAVTDIKAESCYLTWDAPLDN 15524

Query: 289   GGRTVECYVVERRQAGR--STWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGE 346
             GG  +  YV+++R A R  + W +V     +   +    + P  +Y FRVRAV   G  +
Sbjct: 15525 GGSEITHYVIDKRDASRKKAEWEEVTNTAVEKR-YGIWKLIPNGQYEFRVRAVNKYGISD 15583

Query: 347   ALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSN 405
               +S+++++  P  LP  P  P +L+ +   + ++WT P   G + I GY +E+R++GS 
Sbjct: 15584 ECKSDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSP 15643

Query: 406   TWTAVNDQPVPER-----RWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMR 460
              W+ V+  P+ +       + V  + +G +Y+FR  A+  +G G P  PSD   A DP+ 
Sbjct: 15644 YWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIF 15703

Query: 461   PPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTT 520
             PPG     +V D++ +SI+L W  P    G   +GY+VE+    +  W   +     +TT
Sbjct: 15704 PPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITT 15763

Query: 521   --YTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVK 578
                    L+    Y  RV AVNE G+S+PS     + A  +   P+  +D   +D L  K
Sbjct: 15764 CECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCK 15823

Query: 579   VGDTVRVPVSFEAMPMPEVTW---------LKDGL-PLPKRSVTVTKDGLTQLLIPVAGL 628
              G  +R+P   +  P P+ +W         +KDG+  +P+ +   T +  + ++IP    
Sbjct: 15824 AGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKR 15883

Query: 629   SDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDV 688
             S +G Y++  +   G++ A+  R++V   P  P  + + +   G+    W+   D+  D 
Sbjct: 15884 SHTGKYSITAKNKAGQKTANC-RVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDR 15942

Query: 689   PLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
                Y +  R+     W +      +  F +  +L   +Y FRV A+N  G   P +T Q 
Sbjct: 15943 IKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQ- 16001

Query: 749   WCIPRQRDRFTVKAPCY 765
                     R T + P Y
Sbjct: 16002 --------RTTARDPIY 16010



 Score =  257 bits (656), Expect = 4e-68
 Identities = 167/606 (27%), Positives = 278/606 (45%), Gaps = 11/606 (1%)

Query: 145   VAGDQQSEATLTVQDS---PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRK 201
             ++    S   +T +D    P I+ D   K R+ +VV AG+   ++            W +
Sbjct: 23604 ISKPSDSTGPITAKDEVELPRISMD--PKFRDTIVVNAGETFRLEADVHGKPLPTIEWLR 23661

Query: 202   DGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKP 261
                E+  S+    ++   D    L +  A R D GQY +   +  GS    + ++V+D+P
Sbjct: 23662 GDKEIEESA--RCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRP 23719

Query: 262   DPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTF 321
              PP+GP++V         L W PP  +GG  +  YVVE+R+  R  W  V      ++  
Sbjct: 23720 GPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLK 23779

Query: 322   TDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLT 380
                 +E G +Y FR+ AV   G GE LES  +L+  P  LP  P +  + + +   +T+ 
Sbjct: 23780 VTKLLE-GNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVC 23838

Query: 381   WTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAP 440
             W  P   G + I+GY++E+R +    W   N + + + R  V  + +  +YEFRV+A   
Sbjct: 23839 WNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENA 23898

Query: 441   SGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVEL 500
             +G GEP P +    A DP+  PG   N  + D +  SITL+W  P    G E  GYVVE+
Sbjct: 23899 AGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEI 23958

Query: 501   CSSDSLQWLPCHVGT-VPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPV 559
             C +D  +W      T + VT +    L   + Y +RV A+N+ G  + +++   V+    
Sbjct: 23959 CKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDK 24018

Query: 560   TVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLT 619
                P+  +DS  +  + V+ G + R+ + F+  P PE+TW ++      +         T
Sbjct: 24019 LEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTDKVQIEKGVNYT 24078

Query: 620   QLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWE 679
             QL I     +D+G Y + L    G + A    ++V   P  P  + ++E    +    WE
Sbjct: 24079 QLSIDNCDRNDAGKYILKLENSSGSKSAF-VTVKVLDTPGPPQNLAVKEVRKDSAFLVWE 24137

Query: 680   PSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGA 739
             P   +      +Y +  R S    +   + +     F +  +  G  Y+FRV+A+NE G 
Sbjct: 24138 PPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGV 24197

Query: 740   SKPSDT 745
               P +T
Sbjct: 24198 GVPVET 24203



 Score =  256 bits (655), Expect = 5e-68
 Identities = 185/660 (28%), Positives = 300/660 (45%), Gaps = 39/660 (5%)

Query: 101   GPGTWFKDGVKLTTQDGV--IFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQ 158
             G  TW   G+  T +  V  + +Q  L   +F  + +G           D  +   +TV+
Sbjct: 27505 GEQTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLS---------DPVTIGPITVK 27555

Query: 159   DSPTIAP--DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDG-----AEVVGSSD 211
             +   I P  D+++     + V+ G  V +++P++       +W KDG     +E V  S 
Sbjct: 27556 EL-IITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSK 27614

Query: 212   REAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQ 271
              E ++ L        + +A ++  G+Y+V L +    +   +T+  +  P  P+GP+   
Sbjct: 27615 TENKITLS-------IKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKGPIRFD 27667

Query: 272   DCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRK 331
             +     V L W  P DNGG  + CY +E+R+  ++ W  V  + A  TTF   ++    +
Sbjct: 27668 EIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCSSVA-RTTFKVPNLVKDAE 27726

Query: 332   YTFRVRAVTSEGAGEALESEEILVAPE-ALPKAPSAPAILSASSQGITLTWTAPRGPGSA 390
             Y FRVRA    G  + L S  I+   +  +P  P  P I + +S G++LTW AP   G +
Sbjct: 27727 YQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGS 27786

Query: 391   HILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPS 450
              + G+ +E++++ S  W  VN  P+  R +    + +G  Y+FRV A   +G   P  PS
Sbjct: 27787 EVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGLSSPSDPS 27846

Query: 451   DAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLP 510
                 A  P+ PPG    + VT     +ITL W  P    G +  GY +E    +  +W+ 
Sbjct: 27847 KFTLAVSPVDPPGTPDYIDVT---RETITLKWNPPLRDGGSKIVGYSIEKRQGNE-RWVR 27902

Query: 511   CHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ-SQPSALDTLVQAMPVTVCPKFLVDS 569
             C+   V    YT  GL PG+ Y  R+ A N  G  S PS    ++      V P      
Sbjct: 27903 CNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGP 27962

Query: 570   STKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKD--GLTQLLIPVAG 627
                D L +K G+++R+    +  P+P VTW KDG+ + KR      D  G T L +  A 
Sbjct: 27963 EYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDAT 28022

Query: 628   LSDSGLYTVVLRTLQGKEVAHSFRIRVAACP-QAPGPIHLQENVPGTVTAEWEPSPDEAQ 686
                 G+YTV  +   G   A   +++V   P +  GPI    N+ G     W  +P    
Sbjct: 28023 RDHRGVYTVEAKNASGSAKA-EIKVKVQDTPGKVVGPIRF-TNITGEKMTLWWDAPLNDG 28080

Query: 687   DVPL-HYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
               P+ HY +  R ++   W    D+     +T + ++ G+EY FRV A N+ G  +P D+
Sbjct: 28081 CAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDS 28140



 Score =  254 bits (650), Expect = 2e-67
 Identities = 170/576 (29%), Positives = 260/576 (45%), Gaps = 12/576 (2%)

Query: 175   LVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKD 234
             ++ KAG  + V+IP          W+K G +++  + R    +     T L +    R D
Sbjct: 21075 VIAKAGDNIKVEIPVLGRPKPTVTWKK-GDQILKQTQR-VNFETTATSTILNINECVRSD 21132

Query: 235   CGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVE 294
              G Y +T R+  G V   +T+QV D P PP GP++  +     V   W PP ++GG  + 
Sbjct: 21133 SGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPIS 21192

Query: 295   CYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEIL 354
              YVVE RQ   +TW+++       TT+    +  G +Y FRV+A    G G  + S  I+
Sbjct: 21193 NYVVEMRQTDSTTWVELATTVI-RTTYKATRLTTGLEYQFRVKAQNRYGVGPGITSACIV 21251

Query: 355   VA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQ 413
                P  +P  P  P + + +   +T++W  P   G + ILGY +ER+++    W  V+  
Sbjct: 21252 ANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKA 21311

Query: 414   PVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDR 473
              VP   +  + +  G  YEFRV A   +G  +P  PS+ + A DP+ PPG    L +T  
Sbjct: 21312 LVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNIT-- 21369

Query: 474   SNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYF 533
                ++TL WA P+   G +   Y+VE     + +WL  +   +    +T  GL     Y 
Sbjct: 21370 -RHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYE 21428

Query: 534   VRVTAVNEGGQ-SQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAM 592
              RV A N  G  S PS     +        PK  VD   KD + +K G+  R+       
Sbjct: 21429 FRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGR 21488

Query: 593   PMPEVTWLKDGLPLPKRSVTVTK--DGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSF 650
             P P + W KDG  L   +    K  D  T L+   +   DSG YT+   T  G    H F
Sbjct: 21489 PPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLT-ATNPGGFAKHIF 21547

Query: 651   RIRVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAAD 709
              ++V   P  P GP+ + E         W P  D+      HY V  R ++   W   A 
Sbjct: 21548 NVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVAS 21607

Query: 710   RIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
              +   +  +  +L G+EY FRV+A N+ G  +P ++
Sbjct: 21608 EVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLES 21643



 Score =  254 bits (650), Expect = 2e-67
 Identities = 189/666 (28%), Positives = 307/666 (46%), Gaps = 37/666 (5%)

Query: 98    SDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTF------VAG--DQ 149
             S++G G W K    + + +             F T    ++   Y F       AG   +
Sbjct: 28981 SEVGDGRWLKCNYTIVSDN-------------FFTVTALSEGDTYEFRVLAKNAAGVISK 29027

Query: 150   QSEATLTVQDSPTIAPDVTE---KLREPLV-VKAGKPVIVKIPFQSHLPIQAAWRKDGAE 205
              SE+T  V      AP   E   +L   LV ++AG  +++          +  W K G +
Sbjct: 29028 GSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTK-GDK 29086

Query: 206   VVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQ 265
              +   ++ +    G   T + +    R D G+Y++T+++  G+    + ++V+D P P  
Sbjct: 29087 ELDLCEKVSLQYTGKRATAV-IKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPC- 29144

Query: 266   GPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKV-GEAPADSTTFTDA 324
             G + V    +    L W  P+++GG  +  Y+VERR+  R  W+ V GE P  S   T  
Sbjct: 29145 GKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYVVT-- 29202

Query: 325   HVEPGRKYTFRVRAVTSEGAGEALESEEILVAPE-ALPKAPSAPAILSASSQGITLTWTA 383
              +    +Y FRVRAV   G G  +ESE I+      +P  P  P  +    + I + WT 
Sbjct: 29203 RLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTK 29262

Query: 384   PRGPGSAHILGYLIERRKKGSNTWTAVN-DQPVPERRWTVADVRQGCQYEFRVTAVAPSG 442
             P   G   I  YL+++R+K S  WT VN D  V + R  V  + +GC Y+FRVTAV  +G
Sbjct: 29263 PESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAG 29322

Query: 443   PGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCS 502
               EP   S+ +  R+P   PG     +V D +  SI+L+W  P    G +  GYV+E+  
Sbjct: 29323 NSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQE 29382

Query: 503   SDSLQWLPCHV-GTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTV 561
              D+ QW   H   T+  T +T   L+ G+ Y  RV AVN  G S+ S     ++ +    
Sbjct: 29383 KDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIE 29442

Query: 562   CPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQL 621
              P   +    K  +T++ G ++R+ VS    P P +TW K G+ L  R++  T +  + L
Sbjct: 29443 IPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSLL 29502

Query: 622   LIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWE-P 680
             ++      D+G YT+      GK+ A +  ++V   P     + ++E    +VT  WE P
Sbjct: 29503 IVDKVNRYDAGKYTIEAENQSGKKSA-TVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIP 29561

Query: 681   SPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGAS 740
             + D    V  +Y V  R +A   +     +     + + G++ G  Y+FRV+ +N  G  
Sbjct: 29562 TIDGGAPVN-NYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIG 29620

Query: 741   KPSDTS 746
             +P +TS
Sbjct: 29621 EPCETS 29626



 Score =  251 bits (640), Expect = 3e-66
 Identities = 182/661 (27%), Positives = 289/661 (43%), Gaps = 30/661 (4%)

Query: 126   VHSLFITHVQGTQAGRYTF------VAGDQQSEATLTVQDS--PTIAPDVTEKLREPLVV 177
             V  L  T     + G Y F       AG  +  AT+   D   P + P +   L+E + V
Sbjct: 16071 VEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQRPDMPPSID--LKEFMEV 16128

Query: 178   KAGKPV-----IVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGR 232
             + G  V     I  +PF +    +A  +K   +     D      + D    L +P + R
Sbjct: 16129 EEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRR 16188

Query: 233   KDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRT 292
              D G Y++T  +  G+   E+ L V+ +P PP GP++ +      + L W PP+D+GG  
Sbjct: 16189 SDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSK 16248

Query: 293   VECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESE- 351
             +  YV+E+R+A R TW+ V   P +  T+T   +  G +Y FR+ A    G GE L+SE 
Sbjct: 16249 ITNYVIEKREANRKTWVHVSSEPKE-CTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEP 16307

Query: 352   EILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVN 411
             E      ++P AP  P + S +   +T+ W  P   G + + GY +E +   S  W  VN
Sbjct: 16308 ETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVN 16367

Query: 412   DQPVPER----RWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRN 467
               P+        + V  + +G  Y+FRV A+  +G G    PSD   ARDP+ PPG    
Sbjct: 16368 RDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPG-PPF 16426

Query: 468   LQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLR 527
              +VTD + +S  L W+ P    G +  GY+VE       +W       V  T     GL+
Sbjct: 16427 PKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTGLK 16486

Query: 528   PGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPV 587
              G  Y  RV AVN  G  +P  +  +++     V P   +D+S +D + V  G  +R+  
Sbjct: 16487 EGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRIIA 16546

Query: 588   SFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVA 647
                  P P VTW  +   LP+ +   T    + ++I     S  G+Y+++ +   G E  
Sbjct: 16547 YVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAG-ERK 16605

Query: 648   HSFRIRVAACPQAPGPIHLQENVPG-TVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHE 706
              +  + V   P   G   L  N+   +    W    D+      +Y +  R S    W  
Sbjct: 16606 KTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTP 16665

Query: 707   AADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS------QPWCIPRQRDRFTV 760
                 +     T+ G++ G  Y FR+ A+N +G     +TS      +P  +P + +   V
Sbjct: 16666 VTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPERPEDLEV 16725

Query: 761   K 761
             K
Sbjct: 16726 K 16726



 Score =  250 bits (639), Expect = 3e-66
 Identities = 163/600 (27%), Positives = 269/600 (44%), Gaps = 17/600 (2%)

Query: 163   IAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGY 222
             + P   + L     V AG+ + V +PF         W KD   +  ++   A+    +  
Sbjct: 22145 VIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAEST--ENN 22202

Query: 223   TRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRW 282
             + L +  A R+D G Y V L +  G     L + V+DKP PP GP+++ +     + L W
Sbjct: 22203 SLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTADSITLSW 22262

Query: 283   RPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSE 342
              PP+ +GG ++  Y+VE+R    +TW ++  A    TT     ++ G +Y FR+ A    
Sbjct: 22263 GPPKYDGGSSINNYIVEKRDTSTTTW-QIVSATVARTTIKACRLKTGCEYQFRIAAENRY 22321

Query: 343   GAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRK 401
             G    L SE  +   P  +P  P  P +  +S   + + W  P   G + ++GY +ER++
Sbjct: 22322 GKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKE 22381

Query: 402   KGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRP 461
             + S  W  +N  P+P+ ++    + +G +YEFRV+A    G G+P   S+   ARDP  P
Sbjct: 22382 RNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDP 22441

Query: 462   PGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTY 521
             PG    + VT     S+TL W  P    G +  GY+VE       +W+      +  T +
Sbjct: 22442 PGRPEAIIVT---RNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASFTNIIDTHF 22498

Query: 522   TAKGLRPGEGYFVRVTAVNEGGQ-SQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVG 580
                GL     Y  RV A N  G  S+PS     + A      P+  +D   KD + V  G
Sbjct: 22499 EVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVVHAG 22558

Query: 581   DTVRVPVSFEAMPMPEVTWLKDGLPLPK--RSVTVTKDGLTQLLIPVAGLSDSGLYTVVL 638
             ++ +V       P+P + W+K    L    R    + D  T L +  A   DSG Y +  
Sbjct: 22559 ESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKA 22618

Query: 639   RTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTR 697
             + + G E + +  ++V   P  P GP+ +        T  W+P   +     ++Y V  R
Sbjct: 22619 KNVAG-ERSVTVNVKVLDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERR 22677

Query: 698   SSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT-----SQPWCIP 752
              ++   W      + T    +  +L G+EY FR++A N+ G  +P ++       P+ +P
Sbjct: 22678 ETSRLVWTVVDANVQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVP 22737



 Score =  249 bits (635), Expect = 1e-65
 Identities = 176/633 (27%), Positives = 288/633 (45%), Gaps = 32/633 (5%)

Query: 131   ITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVT--EKLREPL---VVKAGKPVIV 185
             +T +   Q  ++   A +++ ++   V   P IA D+T    L+ P     ++AG+ + +
Sbjct: 24272 VTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKI 24331

Query: 186   KIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSE 245
             +IP         +W KDG  +  ++     V+     T L +    + D G+Y+VT  + 
Sbjct: 24332 EIPVIGRPRPNISWVKDGEPLKQTT--RVNVEETATSTVLHIKEGNKDDFGKYTVTATNS 24389

Query: 246   GGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGR 305
              G+    L++ V++KP PP GP+   +     V + W PP   GG  +  Y+VE+R    
Sbjct: 24390 AGTATENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTT 24449

Query: 306   STWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA-PEALPKAP 364
             +TW  V    A  TT     ++ G +Y FR+ A    G    L+S+ ++V  P   P  P
Sbjct: 24450 TTWHMVSATVA-RTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPGPP 24508

Query: 365   SAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVAD 424
               P + S S   + + W  P   G   I+GY +E+++K S  W  +N  P+ + ++    
Sbjct: 24509 GTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTG 24568

Query: 425   VRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAG 484
             + +G +YEF+V+A    G G+P   S+   ARDP  PPG    + +T     ++TL W  
Sbjct: 24569 LDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVIT---RNNVTLKWKK 24625

Query: 485   PDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ 544
             P    G +  GY+VE       +W+      V  T +T  GL   + Y  RV A N  G 
Sbjct: 24626 PAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGN 24685

Query: 545   -SQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDG 603
              S+PS     + A      P   +D   KD++ V  G+T  +       P+P+V W KDG
Sbjct: 24686 FSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDG 24745

Query: 604   LPLPKRSV------TVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAAC 657
               L + +       T+ K   T L++     +D G Y + L  + G +   S  I V   
Sbjct: 24746 KELEETAARMEIKSTIQK---TTLVVKDCIRTDGGQYILKLSNVGGTK---SIPITVKVL 24799

Query: 658   PQAPGPIHLQENVPGTVTAE-----WEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIH 712
              + PGP      V G VTAE     W P   +      HY +  R ++   W + +  + 
Sbjct: 24800 DR-PGPPEGPLKVTG-VTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQ 24857

Query: 713   TNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
                + +  +LPG+EY FRV+A N+ G  +P ++
Sbjct: 24858 ALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLES 24890



 Score =  246 bits (627), Expect = 9e-65
 Identities = 164/614 (26%), Positives = 286/614 (46%), Gaps = 24/614 (3%)

Query: 161   PTIAPDVTEKLREPLV-----VKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQ 215
             P IA D+  K    L      VKA + + + +PF+        WRKDG  +  ++     
Sbjct: 25385 PVIARDIEIKPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETT--RVN 25442

Query: 216   VDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHR 275
             V      T L +  A ++D G Y + + +  GS+   +T+ V+D+P PP GP+ + +   
Sbjct: 25443 VSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPP-GPIRIDEVSC 25501

Query: 276   AGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFR 335
               + + W PP  +GG  +  Y+VE+++   +TW  V +A A  T+     +  G +Y FR
Sbjct: 25502 DSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVA-RTSIKIVRLTTGSEYQFR 25560

Query: 336   VRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILG 394
             V A    G     ES  ++   P + P  P  P ++ A+   + +TW  P   G + ++G
Sbjct: 25561 VCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIG 25620

Query: 395   YLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVF 454
             Y +E +++ S  W+  N   + + +  V+ + +G  YE+RV A   +G G+     + V 
Sbjct: 25621 YHLEYKERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVP 25680

Query: 455   ARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVG 514
             ARDP  PPG     +VT+ +  S++L W+ P    G +  GY+VE       +WL C+  
Sbjct: 25681 ARDPCDPPG---QPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYT 25737

Query: 515   TVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ-SQPSALDTLVQAMPVTVCPKFLVDSSTKD 573
              +  T +    L   + Y  RV A N     S+PS     +        P+ ++D   +D
Sbjct: 25738 NIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRD 25797

Query: 574   LLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVT--VTKDGLTQLLIPVAGLSDS 631
             ++ VK G+ +++       P+P ++W KDG+ + +R+ T  ++ D  T L +      D+
Sbjct: 25798 VIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDT 25857

Query: 632   GLYTVVLRTLQG-KEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEW-EPSPDEAQDVP 689
             G Y + L+ + G + VA + ++     P A GP+ +        +  W  P  D   D+ 
Sbjct: 25858 GQYVLTLKNVAGTRSVAVNCKVLDKPGPPA-GPLEINGLTAEKCSLSWGRPQEDGGADID 25916

Query: 690   LHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPW 749
              +Y V  R ++H  W      +      +  +L G+EY FRV   N+ G  +P ++    
Sbjct: 25917 -YYIVEKRETSHLAWTICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLES---- 25971

Query: 750   CIPRQRDRFTVKAP 763
                +  D FTV +P
Sbjct: 25972 VAIKALDPFTVPSP 25985



 Score =  244 bits (624), Expect = 2e-64
 Identities = 172/644 (26%), Positives = 276/644 (42%), Gaps = 35/644 (5%)

Query: 148   DQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVV 207
             D +S A   V     I PDV         V+ G+ + +++P          W KDG  + 
Sbjct: 23213 DPRSLAVPIVAKDLVIEPDVKPAFSS-YSVQVGQDLKIEVPISGRPKPTITWTKDGLPL- 23270

Query: 208   GSSDREAQVDLGDGY--TRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQ 265
                 +  ++++ D    T L +    + D GQY +T+ +  G   A + +  +DKPDPP+
Sbjct: 23271 ---KQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPK 23327

Query: 266   GPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAH 325
             GP++  D     + L W PP   GG  +  Y+V++R    + W  V  A    TT     
Sbjct: 23328 GPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVW-DVVSATVARTTLKVTK 23386

Query: 326   VEPGRKYTFRVRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAP 384
             ++ G +Y FR+ A    G   ALES+ I+   P   P  P  P   + S   + + W  P
Sbjct: 23387 LKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEP 23446

Query: 385   RGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPG 444
                G + ++GY +ER+++ S  WT VN   + + ++   ++ +G +YEFRV A    G G
Sbjct: 23447 VNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVG 23506

Query: 445   EPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSD 504
             +    S+   ARDP  PPG    + V       ITL W  P    G    GY+VE     
Sbjct: 23507 KASKNSECYVARDPCDPPGTPEPIMV---KRNEITLQWTKPVYDGGSMITGYIVEKRDLP 23563

Query: 505   SLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ-SQPSALDTLVQAMPVTVCP 563
               +W+      V  T +T  GL   + Y  RV A N  G  S+PS     + A      P
Sbjct: 23564 DGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELP 23623

Query: 564   KFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPK--RSVTVTKDGLTQL 621
             +  +D   +D + V  G+T R+       P+P + WL+    + +  R      D    L
Sbjct: 23624 RISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALL 23683

Query: 622   LIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWEP 680
             ++  A   D G Y +    + G + +    ++V   P  P GP+ +        +  W P
Sbjct: 23684 IVKDAIRIDGGQYILRASNVAGSK-SFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSP 23742

Query: 681   SPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGAS 740
                +      HY V  R ++   W   A  + TN   +  +L G+EY FR++A N+ G  
Sbjct: 23743 PLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVG 23802

Query: 741   KPSDTS-----QPWCIPR----------QRDRFTVKAPCYREPD 769
             +P +++      P+ +P            +D  TV   C+  PD
Sbjct: 23803 EPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTV---CWNRPD 23843



 Score =  235 bits (600), Expect = 1e-61
 Identities = 155/574 (27%), Positives = 257/574 (44%), Gaps = 12/574 (2%)

Query: 177   VKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCG 236
             V+AG  + V IP       +    +DG  +  +     ++   +    + L  +   D G
Sbjct: 26488 VRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAEN--LTINLKESVTADAG 26545

Query: 237   QYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECY 296
             +Y +T  +  G+ +A + + V+D+P PP GP+ + D     V L+W PP+ +GG  V  Y
Sbjct: 26546 RYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNY 26605

Query: 297   VVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA 356
             ++ +R+   + W +V    A  T      +  G +Y FR++A    G  + ++S  + V 
Sbjct: 26606 ILLKRETSTAVWTEVSATVA-RTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVK 26664

Query: 357   -PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPV 415
              P   P  PS P + + + + IT+ W  P   G + ++GY +E + + S  W   N   +
Sbjct: 26665 LPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVI 26724

Query: 416   PERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSN 475
                 + V  +  G  YEFRV A   +G G+P  PS+ V A D   PP   RN+++TD S 
Sbjct: 26725 RTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPP---RNVRITDISK 26781

Query: 476   TSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVR 535
              S++LSW  P    G +  GY+VE       +W       V  T +   GL     Y  R
Sbjct: 26782 NSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFR 26841

Query: 536   VTAVNE-GGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPM 594
             V A N  G  S PS +   +  +     P   +     +++  + G +V++       P 
Sbjct: 26842 VFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPA 26901

Query: 595   PEVTWLKDGLPLPKRSVTVTKD--GLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRI 652
             P + W KD   L   ++   ++   L  +LI  A   +SG Y + LR   G   A + R+
Sbjct: 26902 PTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASA-TIRV 26960

Query: 653   RVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRI 711
             ++   P  P GPI  +      +T  W P  D+      HY V  R ++   W   ++ +
Sbjct: 26961 QILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHL 27020

Query: 712   HTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
                  T   I+ G+EY FRV A N+ G  +P ++
Sbjct: 27021 EECIITTTKIIKGNEYIFRVRAVNKYGIGEPLES 27054



 Score =  225 bits (574), Expect = 1e-58
 Identities = 172/598 (28%), Positives = 266/598 (44%), Gaps = 43/598 (7%)

Query: 157   VQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQV 216
             ++D   I P+  +K   PLV +    V  + PF   LP+      D ++           
Sbjct: 14714 IKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFV--LPLTQRLSIDNSK----------- 14760

Query: 217   DLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRA 276
                 G ++L +  + R D G Y + + ++ G  +A  T+ V+D P PP      +D  + 
Sbjct: 14761 ---KGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPIN-FVFEDIRKT 14816

Query: 277   GVCLRWRPPRDNGGRTVECYVVERRQAGR--STWLKVGEAPADSTTFTDAHVEPGRKYTF 334
              V  +W PP D+GG  +  Y +E++   +  S W+ V              +E G++Y F
Sbjct: 14817 SVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIE-GKEYLF 14875

Query: 335   RVRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHIL 393
             RVRA    G G    S+ ++   P   P AP  P +   +S  + + W  P+  GS  IL
Sbjct: 14876 RVRAENRFGPGPPCVSKPLVAKDPFGPPDAPDKPIVEDVTSNSMLVKWNEPKDNGSP-IL 14934

Query: 394   GYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAV 453
             GY +E+R+  S  W+ VN   +   +  V  + +G  Y FRV A   +GPG+  PPSD  
Sbjct: 14935 GYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPK 14994

Query: 454   FARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHV 513
              A DP+ PPG     +VTD S+T+I L W  P    G E  GY V+     + +W  C  
Sbjct: 14995 TAHDPISPPGPPIP-RVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTE 15053

Query: 514   GTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVC-----PKFLVD 568
               + V  YT K +R G  Y +RV+AVN  G+  P       +  PVTV      P   +D
Sbjct: 15054 KMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPG------ETQPVTVAEPQEPPAVELD 15107

Query: 569   SSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGL-TQLLIPVAG 627
              S K  + +  G T+R+P      P+P   W K+   L K  V +   G  ++L+I  A 
Sbjct: 15108 VSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSELIIKDAL 15167

Query: 628   LSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPI-HLQENVPG--TVTAEWEPSPDE 684
               D G Y +      G + A + R+ V      PGP+  L+  V         W    D+
Sbjct: 15168 RKDHGRYVITATNSCGSKFA-AARVEVF---DVPGPVLDLKPVVTNRKMCLLNWSDPEDD 15223

Query: 685   AQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKP 742
                    + +  + +    W +  +    ++  + G+L G EY FRV+AKN+ G   P
Sbjct: 15224 GGSEITGFIIERKDAKMHTWRQPIE-TERSKCDITGLLEGQEYKFRVIAKNKFGCGPP 15280



 Score =  219 bits (559), Expect = 7e-57
 Identities = 163/614 (26%), Positives = 274/614 (44%), Gaps = 23/614 (3%)

Query: 161   PTIAP--DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDL 218
             P I P  D+T    + +  KAG P  + +P       +  W+ +   +   +DR +    
Sbjct: 28641 PQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLK-ETDRVSITTT 28699

Query: 219   GDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGV 278
              D  T L +  + R D G+Y +TL +  G     +T+ VI +P P  GP+EV        
Sbjct: 28700 KDR-TTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESC 28758

Query: 279   CLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRA 338
              L W  P+D GG  +  Y+VE+R++G + W  V  +    T     H+    +Y+FRV +
Sbjct: 28759 VLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSS-VKRTQIKVTHLTKYMEYSFRVSS 28817

Query: 339   VTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLI 397
                 G  + LES  I+   P   P AP+ P +   S+  +++ W  P   G + I+GY +
Sbjct: 28818 ENRFGVSKPLESAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWV 28877

Query: 398   ERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARD 457
             E++++ +  W   N  P  E  + V  + +G +Y+FR  A+  +G  +    S  + A++
Sbjct: 28878 EKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQN 28937

Query: 458   PMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVE---LCSSDSLQWLPCHVG 514
             P+  PG     +VTD + ++++L W+ P    G +  GY++E   +      +WL C+  
Sbjct: 28938 PVDAPG---RPEVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYT 28994

Query: 515   TVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ-SQPSALDTLVQAMPVTVCPKFLVDSSTK- 572
              V    +T   L  G+ Y  RV A N  G  S+ S     V        PK  +D+    
Sbjct: 28995 IVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHG 29054

Query: 573   DLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPL---PKRSVTVTKDGLTQLLIPVAGLS 629
             DL+T++ G  + +  +    P P++ W K    L    K S+  T    T  +I     S
Sbjct: 29055 DLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRAT-AVIKFCDRS 29113

Query: 630   DSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVP 689
             DSG YT+ ++   G + A S  ++V   P   G + +        T  W    ++     
Sbjct: 29114 DSGKYTLTVKNASGTK-AVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEI 29172

Query: 690   LHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPW 749
              HY V  R ++   W        T  + +  ++  +EY FRV A N+ G   P + S+P 
Sbjct: 29173 THYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVE-SEPI 29231

Query: 750   CIPRQRDRFTVKAP 763
                  R+ FT+ +P
Sbjct: 29232 V---ARNSFTIPSP 29242



 Score =  213 bits (543), Expect = 5e-55
 Identities = 165/619 (26%), Positives = 276/619 (44%), Gaps = 48/619 (7%)

Query: 165   PDVTEKLREPLVVK--------AGKPVIVKIPFQSHLPIQAAWRK---DGAEVVGS---- 209
             P    K  EP+++K         GKP +  +   S   ++  W K   DG   + S    
Sbjct: 13965 PGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTS---VRLNWTKPEHDGGAKIESYVIE 14021

Query: 210   -----SDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAE--------LTLQ 256
                  +D   +V  G   T+  LP  G  +  +YS  +R+   + ++E        L  +
Sbjct: 14022 MLKTGTDEWVRVAEGVPTTQHLLP--GLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCRE 14079

Query: 257   VIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPA 316
              +  P PP+  +EV +  +    L+W  P  +GG  +  Y+VE+R   R  W  V     
Sbjct: 14080 KLYPPSPPRW-LEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVK 14138

Query: 317   DSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEAL--PKAPSAPAILSASS 374
             D T  T   +  G  Y FRV A  + G  +  E E+ ++A +    P  P A A++  + 
Sbjct: 14139 D-TKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTK 14197

Query: 375   QGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFR 434
             + + L W  P+  G   I  Y+IE++++    W        P+  + V DV +G + +F+
Sbjct: 14198 RHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQ 14257

Query: 435   VTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQ 494
             V A   +G G P  P++ +   DP  PP    +L VTD     I ++W  P+   G    
Sbjct: 14258 VRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPII 14317

Query: 495   GYVVELCSSDSLQWLPCHVGTVPVTTYTAK---GLRPGEGYFVRVTAVNEGGQSQPSALD 551
             GY VE+C   + +W+   V + P+     K   G+ P + Y +RV AVN  G S+PS + 
Sbjct: 14318 GYHVEMCPVGTEKWM--RVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEIS 14375

Query: 552   TLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRS- 610
               V A      P   +D  T D++ ++ G+ + +PV F A+P+P V+W KDG  +     
Sbjct: 14376 ENVVAKDPDCKP--TIDLETHDIIVIE-GEKLSIPVPFRAVPVPTVSWHKDGKEVKASDR 14432

Query: 611   VTVTKDGLT-QLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQEN 669
             +T+  D ++  L +P +  +D+G+YT+ L    G   A S  ++V   P     I   + 
Sbjct: 14433 LTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATA-SINVKVIGLPGPCKDIKASDI 14491

Query: 670   VPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHF 729
                +    WEP   +     LHY +  R +    +       +   +T+  ++P  EY F
Sbjct: 14492 TKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFF 14551

Query: 730   RVVAKNELGASKPSDTSQP 748
             RV A N++G  +  +   P
Sbjct: 14552 RVKAVNKVGGGEYIELKNP 14570



 Score =  213 bits (542), Expect = 6e-55
 Identities = 140/514 (27%), Positives = 236/514 (45%), Gaps = 13/514 (2%)

Query: 166   DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
             ++ E+ +E + V+ G  + + IP +        W K+G ++     + A +   + +T L
Sbjct: 30137 ELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDI----SKRAMIATSETHTEL 30192

Query: 226   CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPP 285
              +  A R D G Y + L ++ G     + ++VI  P+ P+GP+E  D     V + WRPP
Sbjct: 30193 VIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPP 30252

Query: 286   RDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAG 345
              D+GG  +  Y++ERR+  ++ W  + ++    T+     ++   +Y FRV A    G  
Sbjct: 30253 ADDGGADILGYILERREVPKAAWYTI-DSRVRGTSLVVKGLKENVEYHFRVSAENQFGIS 30311

Query: 346   EALESEEILVAPEAL--PKAPS-APAILSASSQGITLTWTAPRGPGSAHILGYLIERRKK 402
             + L+SEE +     L  P+ PS  P +L  +   ++L+W+ P+  G + + GY IER++ 
Sbjct: 30312 KPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKET 30371

Query: 403   GSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP 462
              ++ W   N   +    +TV  +    +Y+FR+ A    G  E  P S+ V  +DP   P
Sbjct: 30372 STDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKP 30431

Query: 463   GLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYT 522
                  L++   S  S+TL W  P+   G E  GY VE   S    W   +   +    +T
Sbjct: 30432 SQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFT 30491

Query: 523   AKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDT 582
               GL     Y  RV A NE G S+P      ++   +T      +    KD +T K+G+ 
Sbjct: 30492 IGGLLEATEYEFRVFAENETGLSRPRRTAMSIKT-KLTSGEAPGIRKEMKD-VTTKLGEA 30549

Query: 583   VRVPVSFEAMPMPEVTWLKDGLPL-PKRSVTVTKDGLTQ-LLIPVAGLSDSGLYTVVLRT 640
              ++       P+P++ W + G  L   R   ++ DG T  L +      D G+YT +   
Sbjct: 30550 AQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATN 30609

Query: 641   LQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTV 674
               G EV  S ++ + A PQ      L+E   G V
Sbjct: 30610 EVG-EVETSSKLLLQATPQFHPGYPLKEKYYGAV 30642



 Score =  203 bits (517), Expect = 5e-52
 Identities = 159/606 (26%), Positives = 257/606 (42%), Gaps = 32/606 (5%)

Query: 158   QDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVD 217
             Q++P I  DV  KL   L VKAG  + +          +  W K  A+++   D+   ++
Sbjct: 13685 QEAPEIFLDV--KLLAGLTVKAGTKIELPATVTGKPEPKITWTK--ADMILKQDKRITIE 13740

Query: 218   LGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAG 277
                  + + +  + R D G Y +   +  G   A + + V+DKP PP    ++ D     
Sbjct: 13741 NVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAA-FDITDVTNES 13799

Query: 278   VCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVR 337
               L W PPRD+GG  +  YVVERR      W K+     D T F    + P ++Y FRV 
Sbjct: 13800 CLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKD-TNFKATKLIPNKEYIFRVA 13858

Query: 338   AVTSEGAGEALESEEILVAPEALPKAPSAPAILSASS---QGITLTWTAPRGPGSAHILG 394
             A    G GE +++  I    +  P  P  P  L  S      +TLTW  P   G + I G
Sbjct: 13859 AENMYGVGEPVQASPITAKYQFDPPGP--PTRLEPSDITKDAVTLTWCEPDDDGGSPITG 13916

Query: 395   YLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVF 454
             Y +ER    ++ W   N  PV +  + V  +    +Y FRV A   +GPG+P   ++ + 
Sbjct: 13917 YWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPIL 13976

Query: 455   ARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVG 514
              +DP+ PP       V D   TS+ L+W  P+   G + + YV+E+  + + +W+    G
Sbjct: 13977 IKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEG 14036

Query: 515   TVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDL 574
              VP T +   GL  G+ Y  RV AVN+ G+S+PS       + PV    K    S  + L
Sbjct: 14037 -VPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSE-----PSDPVLCREKLYPPSPPRWL 14090

Query: 575   LTVKVGDT---VRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDS 631
               + +      ++  V  +    P   ++ +   + ++        +      V  L++ 
Sbjct: 14091 EVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEG 14150

Query: 632   GLYTVVLRTLQGKEVAHSFRIRVAACPQA------PGPIHLQENVPGT---VTAEWEPSP 682
              LY  V R      +  S    +     A      PGP +    V  T   V  +WEP  
Sbjct: 14151 SLY--VFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPK 14208

Query: 683   DEAQDVPLHYAVFTRSSAHGPWHEAADRIHTN-RFTLLGILPGHEYHFRVVAKNELGASK 741
             ++       Y +  +      W +A      +  F +  ++ G E  F+V A+NE G   
Sbjct: 14209 NDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGH 14268

Query: 742   PSDTSQ 747
             PS+ ++
Sbjct: 14269 PSEPTE 14274



 Score =  199 bits (506), Expect = 9e-51
 Identities = 178/707 (25%), Positives = 304/707 (42%), Gaps = 53/707 (7%)

Query: 79    LADMEVQPGEAATLSCTLTSDLGPGT-WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGT 137
             + D+  + GEAA LSC +     P   W++ G +L          DG  H+L +   +  
Sbjct: 30539 MKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQE 30598

Query: 138   QAGRYTFVA----GDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHL 193
               G YT +A    G+ ++ + L +Q +P   P     L+E      G  + + + +    
Sbjct: 30599 DEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYP--LKEKYYGAVGSTLRLHVMYIGR- 30655

Query: 194   PIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKD-CGQYSVTLRSEGGSVQAE 252
             P+ A     G +++ +S+    ++  + YT L + +  RK   G+Y V L +  G+V A 
Sbjct: 30656 PVPAMTWFHGQKLLQNSEN-ITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAI 30714

Query: 253   LTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVG 312
             L +++ DKPD P GP+ ++   +    + W+PP D+GG  +  YVVE+ +A      ++ 
Sbjct: 30715 LDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLV 30774

Query: 313   EAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILV--APEALPKAPSAPAIL 370
              +    TT    ++     Y FRV A  + G  + LE   +++  +P   P AP  P I 
Sbjct: 30775 SSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTIT 30834

Query: 371   SASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQ 430
             + +     + W  P   G A I  Y +E+R+K  N W +V  + + E  ++V ++ +G +
Sbjct: 30835 AVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLE 30894

Query: 431   YEFRVTAVAPSGPGEPGPPSDAVFARD--PMRPPGL---VRNLQVTDRSNTSITLSWAGP 485
             YEFRV      G  E    S+ +  +   P++ P     +RNL V  +SN ++     G 
Sbjct: 30895 YEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGH 30954

Query: 486   DT------QEGDE--AQG--YVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVR 535
                     ++G E  A G  Y ++       Q +   V     T Y             +
Sbjct: 30955 PKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVY-------------Q 31001

Query: 536   VTAVNEGGQSQPSALDTLVQAMPVTV-CPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPM 594
             V A N+GG    +A  +L   +P  +  PK L        L    G+ V + + F   P 
Sbjct: 31002 VRATNQGGSVSGTA--SLEVEVPAKIHLPKTLEGMGAVHALR---GEVVSIKIPFSGKPD 31056

Query: 595   PEVTWLK--DGLPLPKRSVTVTKDGLTQLLIP-VAGLSDSGLYTVVLRTLQGKEVAHSFR 651
             P +TW K  D +        +     T L+ P      D+G Y V  +   G +   +  
Sbjct: 31057 PVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGID-QKTVE 31115

Query: 652   IRVAACPQAPGPIHLQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADR 710
             + VA  P  P  + + +    +V   W EP+ D    +  +Y V   ++    W      
Sbjct: 31116 LDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKI-TNYIVEKCATTAERWLRVGQA 31174

Query: 711   IHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDR 757
               T R+T++ +     Y FRV+A+N+ G SKPS+ S+P      + R
Sbjct: 31175 RET-RYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTR 31220



 Score =  179 bits (453), Expect = 1e-44
 Identities = 119/400 (29%), Positives = 180/400 (45%), Gaps = 7/400 (1%)

Query: 350   SEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTA 409
             S EI V   A P AP        +   + LTW  P   G + + GY++E+R+    TWT 
Sbjct: 13477 SGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTK 13536

Query: 410   VNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQ 469
             V D  V +  +TV D+ QG +Y F+V A    GPGEP    + V    P   P    N++
Sbjct: 13537 VMDF-VTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVK 13595

Query: 470   VTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPG 529
               DR+  SI L+W  P    G   +GY+VE C   S +W+ C    V  T     GL  G
Sbjct: 13596 WRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACG-EPVAETKMEVTGLEEG 13654

Query: 530   EGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSF 589
             + Y  RV A+N  G S+PS     +QA+     P+  +D      LTVK G  + +P + 
Sbjct: 13655 KWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATV 13714

Query: 590   EAMPMPEVTWLKDGLPLPKRSVTVTKDGL---TQLLIPVAGLSDSGLYTVVLRTLQGKEV 646
                P P++TW K  + L K+   +T + +   + + I  +  SD+G Y +    + G+  
Sbjct: 13715 TGKPEPKITWTKADMIL-KQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRAT 13773

Query: 647   AHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHE 706
             A    + V   P  P    + +    +    W P  D+      +Y V  R++    WH+
Sbjct: 13774 A-VVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHK 13832

Query: 707   AADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS 746
              +  +    F    ++P  EY FRV A+N  G  +P   S
Sbjct: 13833 LSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQAS 13872



 Score =  168 bits (426), Expect = 2e-41
 Identities = 155/598 (25%), Positives = 246/598 (41%), Gaps = 56/598 (9%)

Query: 180   GKPVIVKIPFQSHLPIQAAWRK---DGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCG 236
             G P   K+   S   +  AW K   DG   V     E +    D +T  C P  G +   
Sbjct: 25004 GPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTT-CTPPTGLQG-K 25061

Query: 237   QYSVT--------------LRSEGGSVQAELTLQVI--DKPDPPQGPMEVQDCHRAGVCL 280
             Q++VT              + SEG    A L   V+  ++ +PP+  +E+    R  V L
Sbjct: 25062 QFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPE--IELDADLRKVVVL 25119

Query: 281   RWRPPRDNGGRTVECYV-VERRQAGRSTWLKVGEAPAD------STTFTDAHVEPGRKYT 333
             R          T+  +V ++ R      W K      D      +++FT   ++   ++ 
Sbjct: 25120 R-------ASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTMLVIDNVTRFD 25172

Query: 334   ---FRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSA 390
                + +    + G+  A  +  +L +P A    P    I       +TL+W  P   G A
Sbjct: 25173 SGRYNLTLENNSGSKTAFVNVRVLDSPSA----PVNLTIREVKKDSVTLSWEPPLIDGGA 25228

Query: 391   HILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPS 450
              I  Y++E+R+     +  + +    +  + + ++++GC Y FRV A    G G P   +
Sbjct: 25229 KITNYIVEKRETTRKAYATITNN-CTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETT 25287

Query: 451   DAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLP 510
             + V   +P  PPG V  + VT     + T+ W  P++  G +  GYVVE+ +  S +W  
Sbjct: 25288 EPVKVSEPPLPPGRVTLVDVT---RNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWST 25344

Query: 511   CHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSS 570
             C    V     T  GL  GE Y  RV AVNE G+S P  L   V A  + + P   +   
Sbjct: 25345 C--TQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFH 25402

Query: 571   TKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPK--RSVTVTKDGLTQLLIPVAGL 628
             T     VK  + +++ V F+  P   V W KDG  L +  R    +   +T L I  A  
Sbjct: 25403 T---FNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASK 25459

Query: 629   SDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDV 688
              D G Y + +    G  +     I V   P  PGPI + E    ++T  W P   +    
Sbjct: 25460 EDVGTYELCVSNSAG-SITVPITIIVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQ 25518

Query: 689   PLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS 746
               +Y V  + +    WH  +  +      ++ +  G EY FRV A+N  G S  S++S
Sbjct: 25519 ISNYIVEKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESS 25576



 Score =  166 bits (421), Expect = 7e-41
 Identities = 120/400 (30%), Positives = 179/400 (44%), Gaps = 18/400 (4%)

Query: 361   PKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRW 420
             P  P    +   +   +TLTW  P   G + I  Y++E+R+     ++ V      +  W
Sbjct: 21952 PGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATN-CHKTSW 22010

Query: 421   TVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITL 480
              V  +++GC Y FRV A    G G P   +++V A +   PPG +  + VT     S++L
Sbjct: 22011 KVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITLMDVT---RNSVSL 22067

Query: 481   SWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVN 540
             SW  P+   G    GY+VE+ +  S +W  C   TV VT  T  GL  GE Y  RV+A N
Sbjct: 22068 SWEKPEHDGGSRILGYIVEMQTKGSDKWATC--ATVKVTEATITGLIQGEEYSFRVSAQN 22125

Query: 541   EGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWL 600
             E G S P  L   V A  + + P F +  +T    TV  G+ ++V V F   P P VTW 
Sbjct: 22126 EKGISDPRQLSVPVIAKDLVIPPAFKLLFNT---FTVLAGEDLKVDVPFIGRPTPAVTWH 22182

Query: 601   KDGLPLPK--RSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACP 658
             KD +PL +  R    + +  + L I  A   D G Y V L    G E   +  + V   P
Sbjct: 22183 KDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAG-EAIETLNVIVLDKP 22241

Query: 659   QAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFT 717
               P GP+ + E    ++T  W P   +      +Y V  R ++   W   +  +      
Sbjct: 22242 GPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIK 22301

Query: 718   LLGILPGHEYHFRVVAKNELGA-----SKPSDTSQPWCIP 752
                +  G EY FR+ A+N  G      S+P+    P+ +P
Sbjct: 22302 ACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVP 22341



 Score =  160 bits (404), Expect = 6e-39
 Identities = 152/602 (25%), Positives = 240/602 (39%), Gaps = 42/602 (6%)

Query: 170   KLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKD----GAEVVGSSDREAQVDLGDG---- 221
             K REP V   G P +VK+   S   +   W K     G E++G      + DLGD     
Sbjct: 28246 KCREP-VNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVN 28304

Query: 222   --------YTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEV--Q 271
                     YT   L +         ++    +G S +   T++ +D+   P+  ++   +
Sbjct: 28305 AEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFK 28364

Query: 272   DCH--RAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADST-TFTDAHVEP 328
               H  RAG  +R        GR     V  +  +  S    +    + ST T  + +   
Sbjct: 28365 QTHVVRAGASIRLFIAYQ--GRPTPTAVWSKPDSNLSLRADIHTTDSFSTLTVENCNRND 28422

Query: 329   GRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQG-ITLTWTAPRGP 387
               KYT  V    + G+     + ++L  P      P  P      ++G  TL W AP   
Sbjct: 28423 AGKYTLTVE--NNSGSKSITFTVKVLDTP-----GPPGPITFKDVTRGSATLMWDAPLLD 28475

Query: 388   GSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPG 447
             G A I  Y++E+R+    +W  ++++    + + V D+ +G  Y FRV+AV   G GEP 
Sbjct: 28476 GGARIHHYVVEKREASRRSWQVISEK-CTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPY 28534

Query: 448   PPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQ 507
                + + A +   PP   R L V D S +S  L+W  PD   G    GY++E+    S  
Sbjct: 28535 EMPEPIVATEQPAPP---RRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDF 28591

Query: 508   WLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLV 567
             W+    G     T+T + L     Y  RV A N+ G S+P    + V      + P   +
Sbjct: 28592 WV--EAGHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADL 28649

Query: 568   DSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKR---SVTVTKDGLTQLLIP 624
                T  L+T K G    + V     P P+VTW  + + L +    S+T TKD  T L + 
Sbjct: 28650 TGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKD-RTTLTVK 28708

Query: 625   VAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDE 684
              +   DSG Y + L    G +      + +       GPI +      +    W    D 
Sbjct: 28709 DSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDG 28768

Query: 685   AQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSD 744
                   +Y V  R S    W      +   +  +  +    EY FRV ++N  G SKP +
Sbjct: 28769 GGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE 28828

Query: 745   TS 746
             ++
Sbjct: 28829 SA 28830



 Score =  158 bits (399), Expect = 2e-38
 Identities = 187/767 (24%), Positives = 303/767 (39%), Gaps = 57/767 (7%)

Query: 103   GTWFKDGVK--LTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDS 160
             G W K   +  + T+  V   Q G  +   ++ + G   G    V G  ++   LT  + 
Sbjct: 28298 GDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPEL 28357

Query: 161   PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGD 220
                  D+    ++  VV+AG  + + I +Q      A W K  + +       A +   D
Sbjct: 28358 -----DIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNL----SLRADIHTTD 28408

Query: 221   GYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCL 280
              ++ L + +  R D G+Y++T+ +  GS     T++V+D P PP GP+  +D  R    L
Sbjct: 28409 SFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPP-GPITFKDVTRGSATL 28467

Query: 281   RWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVT 340
              W  P  +GG  +  YVVE+R+A R +W  + E       F    +  G  Y FRV AV 
Sbjct: 28468 MWDAPLLDGGARIHHYVVEKREASRRSWQVISE-KCTRQIFKVNDLAEGVPYYFRVSAVN 28526

Query: 341   SEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERR 400
               G GE  E  E +VA E  P  P    ++  S     L W  P   G + I GYL+E R
Sbjct: 28527 EYGVGEPYEMPEPIVATEQ-PAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMR 28585

Query: 401   KKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMR 460
             +KGS+ W  V      +  +TV  + +  +YEFRV A   +G  EP     +V  ++P  
Sbjct: 28586 QKGSDFW--VEAGHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQI 28643

Query: 461   PPGLVRNLQVTDRSNTSITLSWAGPDTQE----GDEAQGYVVELCSSDSLQWLPCHVGTV 516
              P       +T  +N  IT     P T +    G  A     +L      +     + T 
Sbjct: 28644 EP----TADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTT 28699

Query: 517   -PVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLL 575
                TT T K    G+     +T  N  G  +  ++  +V   P  V     V S + +  
Sbjct: 28700 KDRTTLTVKDSMRGDSGRYFLTLENTAG-VKTFSVTVVVIGRPGPVTGPIEVSSVSAESC 28758

Query: 576   TVKVGD------TVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLS 629
              +  G+      T       E        W      + +  + VT   LT+ +     +S
Sbjct: 28759 VLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTH--LTKYMEYSFRVS 28816

Query: 630   DSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVP 689
                 +  V + L+   +         + P  P   H+  N    ++  WE    +     
Sbjct: 28817 SENRFG-VSKPLESAPIIAEHPFVPPSAPTRPEVYHVSAN---AMSIRWEEPYHDGGSKI 28872

Query: 690   LHYAVFTRSSAHGPW--HEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQ 747
             + Y V  +      W        +  N + + G++ G EY FR  A N  G SK S+ S+
Sbjct: 28873 IGYWVEKKERNTILWVKENKVPCLECN-YKVTGLVEGLEYQFRTYALNAAGVSKASEASR 28931

Query: 748   PWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGL-RSHLLPQGCECCMSCAVQGSPRPHVT 806
             P  I  Q     V AP    P+++   R  V L  S     G    +   ++  P   V+
Sbjct: 28932 P--IMAQN---PVDAP--GRPEVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKP---VS 28981

Query: 807   WFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLG 853
                + R L+ N  + S +       T+ ++S  D+ E++ +A+N  G
Sbjct: 28982 EVGDGRWLKCNYTIVSDNF-----FTVTALSEGDTYEFRVLAKNAAG 29023



 Score =  157 bits (397), Expect = 4e-38
 Identities = 114/426 (26%), Positives = 187/426 (43%), Gaps = 14/426 (3%)

Query: 318   STTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGI 377
             +++FT   ++   +Y      +T E +    +S  + V     P  P    +   +   +
Sbjct: 22992 TSSFTSLVLDNVNRYDSGKYTLTLENSS-GTKSAFVTVRVLDTPSPPVNLKVTEITKDSV 23050

Query: 378   TLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTA 437
             ++TW  P   G + I  Y++E+R+    ++ AV      +  W +  +++GC Y FRVTA
Sbjct: 23051 SITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTN-CHKNSWKIDQLQEGCSYYFRVTA 23109

Query: 438   VAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYV 497
                 G G P   +D +   +  +PPG    + V D +  S++LSW  P+   G +   Y+
Sbjct: 23110 ENEYGIGLPAQTADPIKVAEVPQPPG---KITVDDVTRNSVSLSWTKPEHDGGSKIIQYI 23166

Query: 498   VELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAM 557
             VE+ +  S +W  C    V         L  GE Y  RV AVNE G+S P +L   + A 
Sbjct: 23167 VEMQAKHSEKWSEC--ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAK 23224

Query: 558   PVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRS-VTVTKD 616
              + + P      S+    +V+VG  +++ V     P P +TW KDGLPL + + + VT  
Sbjct: 23225 DLVIEPDVKPAFSS---YSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDS 23281

Query: 617   -GLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTV 674
               LT L I      D G Y + +  + G++ A S  I     P  P GP+   +    ++
Sbjct: 23282 LDLTTLSIKETHKDDGGQYGITVANVVGQKTA-SIEIVTLDKPDPPKGPVKFDDVSAESI 23340

Query: 675   TAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAK 734
             T  W P          +Y V  R +    W   +  +      +  +  G EY FR+ A+
Sbjct: 23341 TLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFAE 23400

Query: 735   NELGAS 740
             N  G S
Sbjct: 23401 NRYGQS 23406



 Score =  155 bits (393), Expect = 1e-37
 Identities = 118/417 (28%), Positives = 184/417 (44%), Gaps = 44/417 (10%)

Query: 379   LTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAV 438
             LTW  P   G   IL Y++ERR+ G  T+  V      +  WTV D+    +Y FRV AV
Sbjct: 14498 LTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGE-NKLSWTVKDLIPNGEYFFRVKAV 14556

Query: 439   APSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVV 498
                G GE     + V A+DP +PP    +++V + +  ++T++W  P    G +  GY++
Sbjct: 14557 NKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYII 14616

Query: 499   ELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMP 558
             E  +    +W  C+   VP+ TYTAKGL  G+ Y  RV A N  G S+PS      +A+ 
Sbjct: 14617 EKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVD 14676

Query: 559   VTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDG--------------- 603
                 PK ++ +S    L VK GD + +  S    P P +TW+KD                
Sbjct: 14677 PIDAPKVILRTS----LEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPL 14732

Query: 604   ---------------LPLPKR-SVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVA 647
                            LPL +R S+  +K G +QL +  +   D GLY + +    G   A
Sbjct: 14733 VRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKA 14792

Query: 648   HSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAV--FTRSSAHGPWH 705
                 + V   P  P     ++    +V  +WEP  D+     ++Y +    ++     W 
Sbjct: 14793 -PCTVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWI 14851

Query: 706   EAADRIHTNRFTLLGILPGHEYHFRVVAKNELG-----ASKPSDTSQPWCIPRQRDR 757
                  +   ++++  ++ G EY FRV A+N  G      SKP     P+  P   D+
Sbjct: 14852 VVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDPFGPPDAPDK 14908



 Score =  155 bits (391), Expect = 2e-37
 Identities = 119/424 (28%), Positives = 186/424 (43%), Gaps = 39/424 (9%)

Query: 379   LTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERR--WTVADVRQGCQYEFRVT 436
             L W+ P   G + I G++IER+    +TW     QP+   R    +  + +G +Y+FRV 
Sbjct: 15215 LNWSDPEDDGGSEITGFIIERKDAKMHTWR----QPIETERSKCDITGLLEGQEYKFRVI 15270

Query: 437   AVAPSGPGEP---GPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEA 493
             A    G G P   GP    + A DP+ PP     L  T+R+ ++ITL W  P +  G   
Sbjct: 15271 AKNKFGCGPPVEIGP----ILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPI 15326

Query: 494   QGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPS-ALDT 552
             QGY++E    D   +   +    P T++  + L   + Y  RV AVNE G+S+PS  L+ 
Sbjct: 15327 QGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNV 15386

Query: 553   LVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLK---------DG 603
             ++Q   V    K  + S   D + VK G+ V +P     +PMP++ W K         D 
Sbjct: 15387 VIQDDEVPPTIKLRL-SVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDA 15445

Query: 604   LPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGP 663
             L + K  V+   +  T+L IP A   D G YTV      G  V  +  + V   P  P  
Sbjct: 15446 LQITKEEVS-RSEAKTELSIPKAVREDKGTYTVTASNRLG-SVFRNVHVEVYDRPSPPRN 15503

Query: 664   IHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAH--GPWHEAADRIHTNRFTLLGI 721
             + + +    +    W+   D       HY +  R ++     W E  +     R+ +  +
Sbjct: 15504 LAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKRYGIWKL 15563

Query: 722   LPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLR 781
             +P  +Y FRV A N+ G S             + D+  ++ P YR P    KP+ L   +
Sbjct: 15564 IPNGQYEFRVRAVNKYGISDEC----------KSDKVVIQDP-YRLPGPPGKPKVLARTK 15612

Query: 782   SHLL 785
               +L
Sbjct: 15613 GSML 15616



 Score =  152 bits (385), Expect = 1e-36
 Identities = 95/326 (29%), Positives = 165/326 (50%), Gaps = 7/326 (2%)

Query: 157   VQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQV 216
             V   P   P +  +  + +V++ G+ + + +PF++      +W KDG EV  S     + 
Sbjct: 14379 VAKDPDCKPTIDLETHDIIVIE-GEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKN 14437

Query: 217   DLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRA 276
             D    +  L +P + R D G Y++TL ++ GS  A + ++VI  P P +  ++  D  ++
Sbjct: 14438 DHISAH--LEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKD-IKASDITKS 14494

Query: 277   GVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRV 336
                L W PP  +GG  +  YV+ERR+AGR T++ V     +  ++T   + P  +Y FRV
Sbjct: 14495 SCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGE-NKLSWTVKDLIPNGEYFFRV 14553

Query: 337   RAVTSEGAGEALESEEILVA--PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILG 394
             +AV   G GE +E +  ++A  P+  P  P    + + +++ +T+TW  P   G + I+G
Sbjct: 14554 KAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMG 14613

Query: 395   YLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVF 454
             Y+IE+  KG   W   N+  VP   +T   + +G +Y+FRV A   +G  EP   +    
Sbjct: 14614 YIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTK 14673

Query: 455   ARDPMRPPGLVRNLQVTDRSNTSITL 480
             A DP+  P ++    +  +    I L
Sbjct: 14674 AVDPIDAPKVILRTSLEVKRGDEIAL 14699



 Score =  152 bits (384), Expect = 1e-36
 Identities = 117/462 (25%), Positives = 188/462 (40%), Gaps = 33/462 (7%)

Query: 318   STTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGI 377
             S T  +A+     KYT  ++ V S        S  ++V     P  P+   +   + +  
Sbjct: 26241 SLTIENANRNDSGKYTLTIQNVLSAA------SLTLVVKVLDTPGPPTNITVQDVTKESA 26294

Query: 378   TLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTA 437
              L+W  P   G A +  Y IE+R+     W +V +       + V ++++G  Y FRV+ 
Sbjct: 26295 VLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNN-CNRLSYKVTNLQEGAIYYFRVSG 26353

Query: 438   VAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYV 497
                 G G P    + V   +   PP     L VT  S  S++L+W  P+   G     YV
Sbjct: 26354 ENEFGVGIPAETKEGVKITEKPSPP---EKLGVTSISKDSVSLTWLKPEHDGGSRIVHYV 26410

Query: 498   VELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAM 557
             VE        W+ C V     T +   GLR    YF RV A N+ G S P  L   V   
Sbjct: 26411 VEALEKGQKNWVKCAVAKS--THHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIK 26468

Query: 558   PVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLP---KRSVTVT 614
                  P+  + +     + V+ G  ++V +     P+P+VT  +DG+PL    + +  +T
Sbjct: 26469 EQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEIT 26528

Query: 615   KDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGT 673
              + LT + +  +  +D+G Y +      G   A    I V   P  P GP+ + +    +
Sbjct: 26529 AENLT-INLKESVTADAGRYEITAANSSGTTKAF-INIVVLDRPGPPTGPVVISDITEES 26586

Query: 674   VTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVA 733
             VT +WEP   +      +Y +  R ++   W E +  +      ++ +  G EY FR+ A
Sbjct: 26587 VTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKA 26646

Query: 734   KNELGAS---------------KPSDTSQPWCIPRQRDRFTV 760
             +N  G S                P   S PW     R+  TV
Sbjct: 26647 ENRFGISDHIDSACVTVKLPYTTPGPPSTPWVTNVTRESITV 26688



 Score =  150 bits (379), Expect = 5e-36
 Identities = 119/443 (26%), Positives = 184/443 (41%), Gaps = 32/443 (7%)

Query: 321   FTD-AHVEPGRKYT--------------FRVRAVTSEGAGEALESEEILVAPEALPKAPS 365
             FTD   +E G  YT              + ++   S G+  A  + ++L  P      P 
Sbjct: 24065 FTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGP----PQ 24120

Query: 366   APAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADV 425
               A+         L W  P   G A +  Y+I++R+     +  V+ +   +  + V ++
Sbjct: 24121 NLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSK-CSKTSFKVENL 24179

Query: 426   RQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGP 485
              +G  Y FRV A    G G P    DAV A +P  PPG V    +TD S TS +L W  P
Sbjct: 24180 TEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVT---LTDVSQTSASLMWEKP 24236

Query: 486   DTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQS 545
             +   G    GYVVE+    + +W    V    V      GL  G+ Y  RV A NE G+S
Sbjct: 24237 EHDGGSRVLGYVVEMQPKGTEKW--SIVAESKVCNAVVTGLSSGQEYQFRVKAYNEKGKS 24294

Query: 546   QPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLP 605
              P  L   V A  +T+ P   +  +T    +++ G+ +++ +     P P ++W+KDG P
Sbjct: 24295 DPRVLGVPVIAKDLTIQPSLKLPFNT---YSIQAGEDLKIEIPVIGRPRPNISWVKDGEP 24351

Query: 606   LPKRSVTVTKDGLTQLLIPV--AGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-G 662
             L + +    ++  T  ++ +      D G YTV      G     +  + V   P  P G
Sbjct: 24352 LKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAG-TATENLSVIVLEKPGPPVG 24410

Query: 663   PIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGIL 722
             P+   E     V   WEP          +Y V  R +    WH  +  +      +  + 
Sbjct: 24411 PVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLK 24470

Query: 723   PGHEYHFRVVAKNELGASKPSDT 745
              G EY FR+ A+N  G S P D+
Sbjct: 24471 TGTEYQFRIFAENRYGKSAPLDS 24493



 Score =  150 bits (378), Expect = 6e-36
 Identities = 161/612 (26%), Positives = 252/612 (41%), Gaps = 64/612 (10%)

Query: 180   GKPVIVKIPFQSHLPIQAAWRKD----GAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDC 235
             G P   K+   +   +  +W K     G+ ++G      + D  D + R  LP   +K  
Sbjct: 19590 GPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRAD-SDNWVRCNLPQNLQKT- 19647

Query: 236   GQYSVTLRSEGGSVQAELTLQVIDK---------PD---------PPQGPMEVQDCHRAG 277
              ++ VT   E    Q +  +  ++K         PD         PP+G ++     R  
Sbjct: 19648 -RFEVTGLME--DTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDAD--LRKT 19702

Query: 278   VCLRWRPPRDNGGRTVECYV-VERRQAGRSTWLKVGEAPAD-------STTF-TDAHVEP 328
             + LR        G T+  YV V+ R   + TW K      D       ST F T    E 
Sbjct: 19703 LILR-------AGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCEN 19755

Query: 329   GRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPG 388
               KY      +T E +    E   I+V     P  P    +   S     +TW  P   G
Sbjct: 19756 VNKYDAGKYILTLENSCGKKEYT-IVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDG 19814

Query: 389   SAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGP 448
              + I+ Y++++R     +W+ V  +   +  + VA++ +G  Y FRV A    G G+PG 
Sbjct: 19815 GSPIINYVVQKRDAERKSWSTVTTE-CSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGE 19873

Query: 449   PSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQW 508
               DAV A    + PG V +L+V   S +S ++ W  P +  G    GYVV+  + ++ +W
Sbjct: 19874 TRDAVKAS---QTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTEEN-KW 19929

Query: 509   LPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVD 568
                 V       Y+AK L  G+ Y  RV+A NE G+  PS  +  V A    V P   + 
Sbjct: 19930 Q--RVMKSLSLQYSAKDLTEGKEYTFRVSAENENGEGTPS--EITVVARDDVVAPDLDLK 19985

Query: 569   SSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRS-VTVTKDGL-TQLLIPVA 626
                      K     R+ +  +  P P V+W K   PL   + V+V    + T L++   
Sbjct: 19986 GLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDC 20045

Query: 627   GLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEA 685
               SD+G YT+ L+ + G +   +  I+V   P  P GPI   E     +T +W P  D+ 
Sbjct: 20046 QKSDAGKYTITLKNVAGTKEG-TISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDG 20104

Query: 686   QDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGA-----S 740
                  +Y +  R S +  W   A  +    F +  +  G EY FRV A+N+ G      S
Sbjct: 20105 GSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKS 20164

Query: 741   KPSDTSQPWCIP 752
             +P     P+ +P
Sbjct: 20165 EPIVARHPFDVP 20176



 Score =  149 bits (375), Expect = 1e-35
 Identities = 106/394 (26%), Positives = 172/394 (43%), Gaps = 10/394 (2%)

Query: 349   ESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWT 408
             +S  +LV     P    +  +   S   +T+TW  P   G A +  Y++E+R+     + 
Sbjct: 29526 KSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREAAMRAFK 29585

Query: 409   AVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNL 468
              V  +   +  + ++ + +G  Y FRV      G GEP   SDAV   +    P     L
Sbjct: 29586 TVTTK-CSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPA---KL 29641

Query: 469   QVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRP 528
             +V D + +++TL+W  P    G    GYV+E C + + +W+        V  +T   L  
Sbjct: 29642 EVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNE 29701

Query: 529   GEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVS 588
             GE Y  R+ A NE G S+P    T V    + V P   + +  +  + V  G  V + + 
Sbjct: 29702 GEQYLFRIRAQNEKGVSEPRETVTAVTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIP 29761

Query: 589   FEAMPMPEVTWLKDGLPL--PKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEV 646
                 P P  +W   G  L   +R    T   + +L I    + D+G YT+ L+ + G   
Sbjct: 29762 IAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTG-TT 29820

Query: 647   AHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGP-W 704
             + + ++ +   P  P GPI + E    ++T  WEP P+     PL   V  +  AH P W
Sbjct: 29821 SETIKVIILDKPGPPTGPIKIDEIDATSITISWEP-PELDGGAPLSGYVVEQRDAHRPGW 29879

Query: 705   HEAADRIHTNRFTLLGILPGHEYHFRVVAKNELG 738
                ++ +  + F    +  G+EY FRV A N  G
Sbjct: 29880 LPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFG 29913



 Score =  147 bits (372), Expect = 3e-35
 Identities = 95/325 (29%), Positives = 157/325 (48%), Gaps = 14/325 (4%)

Query: 140   GRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAW 199
             G  T V G  + E  L   ++P +  D+  +LR+ +VV+AG    + IPF+     +  W
Sbjct: 24004 GEATSVPGTVKPEDKL---EAPEL--DLDSELRKGIVVRAGGSARIHIPFKGRPTPEITW 24058

Query: 200   RKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVID 259
              ++  E       + Q++ G  YT+L + +  R D G+Y + L +  GS  A +T++V+D
Sbjct: 24059 SREEGEFTD----KVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLD 24114

Query: 260   KPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADST 319
              P PPQ  + V++  +    L W PP  +GG  V+ YV+++R++ R  +  V  +    T
Sbjct: 24115 TPGPPQN-LAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVS-SKCSKT 24172

Query: 320   TFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITL 379
             +F   ++  G  Y FRV A    G G  +E+ + + A E  P  P    +   S    +L
Sbjct: 24173 SFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEP-PSPPGKVTLTDVSQTSASL 24231

Query: 380   TWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVA 439
              W  P   G + +LGY++E + KG+  W+ V +  V      V  +  G +Y+FRV A  
Sbjct: 24232 MWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNA--VVTGLSSGQEYQFRVKAYN 24289

Query: 440   PSGPGEPGPPSDAVFARDPMRPPGL 464
               G  +P      V A+D    P L
Sbjct: 24290 EKGKSDPRVLGVPVIAKDLTIQPSL 24314



 Score =  147 bits (371), Expect = 4e-35
 Identities = 123/458 (26%), Positives = 183/458 (39%), Gaps = 38/458 (8%)

Query: 330   RKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGS 389
             R +T +        AG+   +  + V    +P  P    +   +     L+W  P   G 
Sbjct: 15883 RSHTGKYSITAKNKAGQKTANCRVKVMD--VPGPPKDLKVSDITRGSCRLSWKMPDDDGG 15940

Query: 390   AHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPP 449
               I GY+IE+R      WT VN        + V D+    QY FRV A    G G P   
Sbjct: 15941 DRIKGYVIEKRTIDGKAWTKVNPD-CGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVET 15999

Query: 450   SDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSL--- 506
                  ARDP+ PP     L++   +  ++ LSW  P    G     Y+VE  + D     
Sbjct: 16000 IQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTK 16059

Query: 507   --QWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSA----LDTLVQAMPVT 560
                W  C+   V    +T + L  G  Y  RV AVN  G S+PSA     D     MP +
Sbjct: 16060 KEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQRPDMPPS 16119

Query: 561   VCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTV------- 613
             +          K+ + V+ G  V +    + +P P +TW K     P     V       
Sbjct: 16120 I--------DLKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVN 16171

Query: 614   --TKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENV 670
                 D    L+IP +  SD+GLYT+      G   +   R+ V   P  P GPI  +   
Sbjct: 16172 KLVVDDTCTLVIPQSRRSDTGLYTITAVNNLG-TASKEMRLNVLGRPGPPVGPIKFESVS 16230

Query: 671   PGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFR 730
                +T  W P  D+      +Y +  R +    W   +       +T+  +L GHEY FR
Sbjct: 16231 ADQMTLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPKLLEGHEYVFR 16290

Query: 731   VVAKNELGASKPSDTSQP------WCIPRQRDRFTVKA 762
             ++A+N+ G  +P D S+P      + +P   D+ TV +
Sbjct: 16291 IMAQNKYGIGEPLD-SEPETARNLFSVPGAPDKPTVSS 16327



 Score =  147 bits (370), Expect = 5e-35
 Identities = 147/617 (23%), Positives = 256/617 (41%), Gaps = 64/617 (10%)

Query: 163   IAPDVT--EKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGD 220
             ++PD+     +R+ +VV AG  + +        P    W  +   +     +EA ++   
Sbjct: 16520 VSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTL----PQEATIETTA 16575

Query: 221   GYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCL 280
               + + + +  R   G YS+  ++E G  +  + + V+D P P   P    +       L
Sbjct: 16576 ISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKL 16635

Query: 281   RWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVT 340
              W  P D+GG  +  YV+E+R++ R  W  V              ++ G+ Y FR+ A  
Sbjct: 16636 TWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNATVQGLIQ-GKAYFFRIAAEN 16694

Query: 341   SEGAGEALESEEILVA--PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIE 398
             S G G  +E+ E LV   P  +P+ P    +   +   +TLTW  P+  G + I+ Y++E
Sbjct: 16695 SIGMGPFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLE 16754

Query: 399   RRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDP 458
              R  G+  +  V +  +  R++TV  +++G  YE+RV+AV   G G+P   +  +  +D 
Sbjct: 16755 SRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDE 16814

Query: 459   MRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPV 518
             + PP L  +L   D+    +  ++A      G            +D L+    H+ T P 
Sbjct: 16815 LAPPTL--HLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPA 16872

Query: 519   T--TYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLT 576
             T      K  R   G +  V   + G +     ++ + +  P      F  D  TKD + 
Sbjct: 16873 TLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSF--DEVTKDYMV 16930

Query: 577   V---------------------KVGDTVRVPV-SFEAMPMPEVTWLKDGLPLPKRSVTVT 614
             +                     +VG  V +PV S  A    +V+ L +G           
Sbjct: 16931 ISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEG----------- 16979

Query: 615   KDGLTQLLIP-VAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGT 673
             KD + ++    + G+SD     +V  +++ K+     R RV   P AP    + E    +
Sbjct: 16980 KDYIFRIHAENLYGISD----PLVSDSMKAKD-----RFRV---PDAPDQPIVTEVTKDS 17027

Query: 674   VTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAA-DRIHT-NRFTLLGILPGHEYHFRV 731
                 W    D  + +  +Y +  R +    W     D IH   +F +  +L G +Y FRV
Sbjct: 17028 ALVTWNKPHDGGKPI-TNYILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRV 17086

Query: 732   VAKNELGASKPSDTSQP 748
              A+NE+G   PS  S+P
Sbjct: 17087 SAENEIGIGDPSPPSKP 17103



 Score =  145 bits (365), Expect = 2e-34
 Identities = 114/379 (30%), Positives = 172/379 (45%), Gaps = 16/379 (4%)

Query: 373   SSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYE 432
             +   +TL W  P   G + I  Y++E+R+    +++    +   +  + V  + +GC+Y 
Sbjct: 20880 TKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTK-CHKCTYKVTGLSEGCEYF 20938

Query: 433   FRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDE 492
             FRV A    G GEP   ++ V A +   PP    +L + D + ++++L+W  P    G +
Sbjct: 20939 FRVMAENEYGIGEPTETTEPVKASEAPSPPD---SLNIMDITKSTVSLAWPKPKHDGGSK 20995

Query: 493   AQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDT 552
               GYV+E     S QW   H+ TV       + L  GE Y  +V AVN  G+S P     
Sbjct: 20996 ITGYVIEAQRKGSDQW--THITTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRP 21053

Query: 553   LVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVT 612
             ++     T+ P+  +    + L+  K GD ++V +     P P VTW K G  + K++  
Sbjct: 21054 VI-VKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTW-KKGDQILKQTQR 21111

Query: 613   V---TKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQE 668
             V   T    T L I     SDSG Y +  R + G EV     I+V   P  P GPI   E
Sbjct: 21112 VNFETTATSTILNINECVRSDSGPYPLTARNIVG-EVGDVITIQVHDIPGPPTGPIKFDE 21170

Query: 669   NVPGTVTAEWEPSPDEAQDVPL-HYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEY 727
                  VT  W+P P+    VP+ +Y V  R +    W E A  +    +    +  G EY
Sbjct: 21171 VSSDFVTFSWDP-PENDGGVPISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGLEY 21229

Query: 728   HFRVVAKNELGASKPSDTS 746
              FRV A+N  G   P  TS
Sbjct: 21230 QFRVKAQNRYGVG-PGITS 21247



 Score =  143 bits (361), Expect = 6e-34
 Identities = 179/800 (22%), Positives = 302/800 (37%), Gaps = 91/800 (11%)

Query: 104   TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVA----GDQQSEATLTVQD 159
             TWFKDGV++  +  +         SLF+        G YT  A    G  ++E  + VQD
Sbjct: 27991 TWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQD 28050

Query: 160   SP--TIAP-DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQV 216
             +P   + P   T    E + +    P+       +H  I+       A  +     EAQ 
Sbjct: 28051 TPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQ- 28109

Query: 217   DLGDGYTRLCLPSAGRKD-----CGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQ 271
                  YT + L +            ++ V    +   V A++   V D P  P    E  
Sbjct: 28110 ----SYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTVPDAPGIP----EPS 28161

Query: 272   DCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKV-GEAPADSTTFTDAHVEPGR 330
             +     + L W  P  +GG  ++ Y++ERR+   + W+KV  + P   T F    +  G 
Sbjct: 28162 NITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGN 28221

Query: 331   KYTFRVRAVTSEGAGEALESEEILVAPEAL--PKAPSAPAILSASSQGITLTWTAPRGPG 388
             +Y F V A  + G G A     ++   E +  P  P+   +   S   ++L W+ P   G
Sbjct: 28222 EYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDG 28281

Query: 389   SAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGP 448
                I+GY+IE  K     W  VN +   + R+TV D++ G +Y+FRV+A+  +G G+   
Sbjct: 28282 GMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCE 28341

Query: 449   PSDAVFARDPMRPPGLV--RNLQVTD--RSNTSI------------TLSWAGPDTQEGDE 492
              +  + A D +  P L    N + T   R+  SI            T  W+ PD+     
Sbjct: 28342 VTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLR 28401

Query: 493   AQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDT 552
             A  +  +  S+ +++   C+       T T +     +     V  ++  G   P     
Sbjct: 28402 ADIHTTDSFSTLTVE--NCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPITFKD 28459

Query: 553   LVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVT 612
             + +     +    L+D   +              +    +   E +         +RS  
Sbjct: 28460 VTRGSATLMWDAPLLDGGAR--------------IHHYVVEKREAS---------RRSWQ 28496

Query: 613   VTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFR----IRVAACPQAPGPIHLQE 668
             V  +  T+ +  V  L++   Y   +  +    V   +     I     P  P  + + +
Sbjct: 28497 VISEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPAPPRRLDVVD 28556

Query: 669   NVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNR--FTLLGILPGHE 726
                 +    W     +       Y +  R      W EA    HT +  FT+  ++   E
Sbjct: 28557 TSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAG---HTKQLTFTVERLVEKTE 28613

Query: 727   YHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLP 786
             Y FRV AKN+ G S+P            R+ F+  +   +EP + +    L G+ + L+ 
Sbjct: 28614 YEFRVKAKNDAGYSEP------------REAFS--SVIIKEPQI-EPTADLTGITNQLIT 28658

Query: 787   --QGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEY 844
                G    +   + G P P VTW   +  L+    V  T      +LT+      DSG Y
Sbjct: 28659 CKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRY 28718

Query: 845   KAVAENTLGQAVSTATLIVI 864
                 ENT G    + T++VI
Sbjct: 28719 FLTLENTAGVKTFSVTVVVI 28738



 Score =  141 bits (355), Expect = 3e-33
 Identities = 109/406 (26%), Positives = 168/406 (41%), Gaps = 10/406 (2%)

Query: 344   AGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKG 403
             AG    S ++LV  +  P  P    +         LTW  P   G + I  Y++ERR   
Sbjct: 17295 AGSKTVSVKVLVLDK--PGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVA 17352

Query: 404   SNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPG 463
             S  W+ ++     +  +    + +G QY FRV A    G G        + A DP+ PPG
Sbjct: 17353 SAQWSPLSATSKKKSHFA-KHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPG 17411

Query: 464   LVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTA 523
               ++L   D   T ++L W  PD   G    GY+VE     +  W+     TV       
Sbjct: 17412 PPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWI--KFKTVTNLECVV 17469

Query: 524   KGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTV 583
              GL+ G+ Y  RV A N  G   P      ++     V P   +D    + L VK G TV
Sbjct: 17470 TGLQQGKTYRFRVKAENIVGLGLPDT-TIPIECQEKLVPPSVELDVKLIEGLVVKAGTTV 17528

Query: 584   RVPVSFEAMPMPEVTWLKDGLPL-PKRSVTVTKDGLTQLL-IPVAGLSDSGLYTVVLRTL 641
             R P     +P+P   W  DG  +      TV  D  + +L I      D+G Y + +   
Sbjct: 17529 RFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNA 17588

Query: 642   QGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSA 700
              G +   +  + V   P  P GPI++ +  P  +T  W+P  D+     ++Y V  + + 
Sbjct: 17589 AGSKTV-AVHLTVLDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTR 17647

Query: 701   HGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS 746
                W   +      +  +  +  G EY FRV A+N++G   P D++
Sbjct: 17648 KDTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENKIGVGPPLDST 17693



 Score =  141 bits (355), Expect = 3e-33
 Identities = 142/604 (23%), Positives = 248/604 (41%), Gaps = 50/604 (8%)

Query: 166   DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
             D+   +R+ ++V+AG P+ +    +     +  WRK G + V    R+ QVDL D    L
Sbjct: 18607 DLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVV---RKGQVDLVDTMAFL 18663

Query: 226   CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPP 285
              +P++ R D G+YS+TL +  G     + ++V+D P P    ++V D  +    + W PP
Sbjct: 18664 VIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSD-LKVSDVTKTSCHVSWAPP 18722

Query: 286   RDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAG 345
              ++GG  V  Y+VE+R+A R TW  V       T+F   ++ PG +Y FRV AV   G G
Sbjct: 18723 ENDGGSQVTHYIVEKREADRKTWSTV-TPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPG 18781

Query: 346   EALESEEILVAPEAL--PKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERR--K 401
                +  + ++A + L  P  P    +   +    TL W  P   G A I GY+   R  +
Sbjct: 18782 VPTDVPKPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEE 18841

Query: 402   KGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRP 461
             + ++ WT  +   V +    V  +++G +Y+FRV A    G   P        A++ + P
Sbjct: 18842 QPADRWTEYS--VVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLP 18899

Query: 462   PGLVRNLQVTDRSNTSITLS---WAGP-DTQEGDEAQGYVVELCSSDSLQWLPCHVGTVP 517
             P ++   Q+T ++   + +    +  P  T +  + +  VV      +   L  H     
Sbjct: 18900 PKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVV------TSSHLAVHKADSS 18953

Query: 518   VTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDL--- 574
                      R   GY+  +TA N  G +    +  +V   P    P F +     D    
Sbjct: 18954 SILIIKDVTRKDSGYY-SLTAENSSG-TDTQKIKVVVMDAPGPPQPPFDISDIDADACSL 19011

Query: 575   ---LTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDS 631
                + ++ G +       E   +    W+     + K S  V K      LIP       
Sbjct: 19012 SWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGK------LIP----GQE 19061

Query: 632   GLYTV-------VLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDE 684
              ++ V       +   L   ++   F   V   P  P    + +     +   W+    +
Sbjct: 19062 YIFRVRAENRFGISEPLTSPKMVAQFPFGV---PSEPKNARVTKVNKDCIFVAWDRPDSD 19118

Query: 685   AQDVPLHYAVFTRSSAHGPWHEAADR-IHTNRFTLLGILPGHEYHFRVVAKNELGASKPS 743
                  + Y +  +      W +A D  + +  +   G++ G EY FR+ A N+ G+S PS
Sbjct: 19119 GGSPIIGYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPS 19178

Query: 744   DTSQ 747
               ++
Sbjct: 19179 KPTE 19182



 Score =  141 bits (355), Expect = 3e-33
 Identities = 145/623 (23%), Positives = 250/623 (40%), Gaps = 81/623 (13%)

Query: 163   IAPD--VTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGD 220
             +APD  +  +LR  LVV+AG  + + +P +     +  W KD   +       A ++  +
Sbjct: 20772 MAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINL----KNRANIENTE 20827

Query: 221   GYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCL 280
              +T L +P   R D G++ +T+ +  G     + ++V+D P P    +   D  +  V L
Sbjct: 20828 SFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLN-LRPTDITKDSVTL 20886

Query: 281   RWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVT 340
              W  P  +GG  +  Y+VE+R+A R ++           T+    +  G +Y FRV A  
Sbjct: 20887 HWDLPLIDGGSRITNYIVEKREATRKSY-STATTKCHKCTYKVTGLSEGCEYFFRVMAEN 20945

Query: 341   SEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERR 400
               G GE  E+ E + A EA P  P +  I+  +   ++L W  P+  G + I GY+IE +
Sbjct: 20946 EYGIGEPTETTEPVKASEA-PSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQ 21004

Query: 401   KKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMR 460
             +KGS+ WT +    V      V ++ +G +Y F+V AV  +G   P      +     M 
Sbjct: 21005 RKGSDQWTHIT--TVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTML 21062

Query: 461   PPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTT 520
             P   +R +                         Q  V+     +    +P      P  T
Sbjct: 21063 PELDLRGIY------------------------QKLVIAKAGDNIKVEIPVLGRPKPTVT 21098

Query: 521   YTAKGLRPGEGYFVRVTAVNEGGQSQPSALD----TLVQAMPVTVCPKFLVDSSTKDLLT 576
             +     + G+    +   VN    +  + L+        + P  +  + +V     D++T
Sbjct: 21099 W-----KKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIV-GEVGDVIT 21152

Query: 577   VKVGD---TVRVPVSFEAMPMPEVTWLKD------GLPLPKRSVTVTKDGLTQLLIPVAG 627
             ++V D       P+ F+ +    VT+  D      G+P+    V + +   T  +     
Sbjct: 21153 IQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWV----E 21208

Query: 628   LSDSGLYTVVLRTLQGKEVAHSFRIR-----------VAAC---------PQAPGPIHLQ 667
             L+ + + T    T     + + FR++            +AC         P  PG   + 
Sbjct: 21209 LATTVIRTTYKATRLTTGLEYQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTPQVT 21268

Query: 668   ENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADR-IHTNRFTLLGILPGH 725
                  ++T  W EP  D    + L Y V  +      W   +   +  N F   G+  G 
Sbjct: 21269 AVTKDSMTISWHEPLSDGGSPI-LGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGI 21327

Query: 726   EYHFRVVAKNELGASKPSDTSQP 748
              Y FRV+A+N  G SKPS  S+P
Sbjct: 21328 AYEFRVIAENMAGKSKPSKPSEP 21350



 Score =  139 bits (350), Expect = 1e-32
 Identities = 155/649 (23%), Positives = 258/649 (39%), Gaps = 68/649 (10%)

Query: 246   GGSVQAELTLQVIDKPDPPQGPMEVQ--DCHRAGVCLRWRPPRDNGGRTVECYVVERRQA 303
             G  V+ +  ++   K D P  P+ V   D +R GV L W PP  +GG  +  YV+E R  
Sbjct: 13173 GEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDK 13232

Query: 304   GRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKA 363
                 W       A+  + T   V  G++Y+FRVRA    G G+   +   +   + + + 
Sbjct: 13233 TSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIER- 13291

Query: 364   PSAPAILSASSQ---GITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRW 420
             PS P  L++S Q    + L W  P   G + ILGY+IER ++G + W   N + VPE  +
Sbjct: 13292 PSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTY 13351

Query: 421   TVADVRQGCQYEFRVTAVAPSGPGEP----GP-PSDAVFARDPMRPPGLVRNLQVTDRSN 475
              V  + +G +Y +RV+A   +G  +P    GP  +D  F    M        L+V   + 
Sbjct: 13352 KVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNP 13411

Query: 476   TSITLSWAGPDTQEGDEAQGY---VVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGE-- 530
              +I +    P T       GY       C  D +      V    ++ Y    + P E  
Sbjct: 13412 ITILV----PST-------GYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERS 13460

Query: 531   GYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFE 590
                +    +    ++    +D  V A P          S+ K+L   K GD  +  V   
Sbjct: 13461 DKGIYTLKLENRVKTISGEIDVNVIARP----------SAPKEL---KFGDITKDSVHLT 13507

Query: 591   AMP------MPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSG--LYTVVLRTLQ 642
               P       P   ++ +   + +++ T   D +T L   V  L      L+ V  R   
Sbjct: 13508 WEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKC 13567

Query: 643   GK-EVAHSFR----IRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTR 697
             G  E A+          A  P  P  +  ++    ++   W+P  ++       Y V   
Sbjct: 13568 GPGEPAYVDEPVNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERC 13627

Query: 698   SSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDR 757
                   W    + +   +  + G+  G  Y +RV A N  GASKPS  ++          
Sbjct: 13628 PRGSDKWVACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEE--------- 13678

Query: 758   FTVKAPCYRE-PDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEG 816
               ++A   +E P++    + L GL    +  G +  +   V G P P +TW K D  L+ 
Sbjct: 13679 --IQAVDTQEAPEIFLDVKLLAGLT---VKAGTKIELPATVTGKPEPKITWTKADMILKQ 13733

Query: 817   NPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
             +  +   ++    ++TI      D+G Y   A N  G+A +   + V++
Sbjct: 13734 DKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLD 13782



 Score =  137 bits (344), Expect = 6e-32
 Identities = 86/292 (29%), Positives = 146/292 (50%), Gaps = 9/292 (3%)

Query: 171   LREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSA 230
             LR+ + ++A   + + +P +     +  W +D     G S  +A ++    YT L + + 
Sbjct: 21866 LRKVVTIRACCTLRLFVPIKGRPAPEVKWARDH----GESLDKASIESTSSYTLLIVGNV 21921

Query: 231   GRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGG 290
              R D G+Y +T+ +  GS  A + ++V+D P PPQ  ++V++  +  V L W PP  +GG
Sbjct: 21922 NRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQD-LKVKEVTKTSVTLTWDPPLLDGG 21980

Query: 291   RTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALES 350
               ++ Y+VE+R++ R  +  V       T++    ++ G  Y FRV A    G G   E+
Sbjct: 21981 SKIKNYIVEKRESTRKAYSTVA-TNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAET 22039

Query: 351   EEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAV 410
              E + A E  P  P    ++  +   ++L+W  P   G + ILGY++E + KGS+ W   
Sbjct: 22040 AESVKASER-PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATC 22098

Query: 411   NDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP 462
                 V E   T+  + QG +Y FRV+A    G  +P   S  V A+D + PP
Sbjct: 22099 ATVKVTEA--TITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPP 22148



 Score =  136 bits (343), Expect = 7e-32
 Identities = 176/818 (21%), Positives = 304/818 (37%), Gaps = 84/818 (10%)

Query: 82    MEVQPGEAATLSCTLTSDLGPG-TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAG 140
             + V+ G    L  T+     P  +W KDG  L   +G+       + +L +  V    +G
Sbjct: 19305 LTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSG 19364

Query: 141   RYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWR 200
              YT  A +           S TI   V +K   P  VK  K    +       P++    
Sbjct: 19365 DYTITAENSSG------SKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLE---- 19414

Query: 201   KDGAEVVG--------SSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAE 252
               G+E+          S    AQV      T   +         Q+ +   ++ G     
Sbjct: 19415 DGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPV 19474

Query: 253   LTLQVIDKP--DPPQ--GPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTW 308
              T   I K   DPP    P  + +  +  + + W+PP D+GG  +  Y++E+R+     W
Sbjct: 19475 FTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNW 19534

Query: 309   LKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA--PEALPKAPSA 366
              KV   P    T     ++ G +Y FRV A+   G G+  ++ +   A  P+  P  P+ 
Sbjct: 19535 TKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGPPAF 19594

Query: 367   PAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVN-DQPVPERRWTVADV 425
             P +   +   ++L+W  P   G + I+GYL+E ++  S+ W   N  Q + + R+ V  +
Sbjct: 19595 PKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGL 19654

Query: 426   RQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP----------------GLVRNLQ 469
              +  QY+FRV AV   G  +P    D  + +D + PP                G+   L 
Sbjct: 19655 MEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTMRLY 19714

Query: 470   VTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPG 529
             V  +      ++W+ P+    D      +++ S+D   +L C      V  Y A      
Sbjct: 19715 VPVKGRPPPKITWSKPNVNLRDRIG---LDIKSTDFDTFLRCE----NVNKYDA------ 19761

Query: 530   EGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSF 589
              G ++ +T  N  G+ + + +      + V   P   V+ + K++       T   P+  
Sbjct: 19762 -GKYI-LTLENSCGKKEYTIV------VKVLDTPGPPVNVTVKEISKDSAYVTWEPPIID 19813

Query: 590   EAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHS 649
                P+      K        S   T+   T   +       S  + V      G      
Sbjct: 19814 GGSPIINYVVQKRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGE 19873

Query: 650   FRIRVAACPQAPGPI---HLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHE 706
              R  V A  Q PGP+    ++     + +  W+    +     + Y V    +    W  
Sbjct: 19874 TRDAVKA-SQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVV-DFLTEENKWQR 19931

Query: 707   AADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYR 766
                 + + +++   +  G EY FRV A+NE G   PS+ +          R  V AP   
Sbjct: 19932 VMKSL-SLQYSAKDLTEGKEYTFRVSAENENGEGTPSEITVV-------ARDDVVAP--- 19980

Query: 767   EPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLL 826
             + DL   P        +L  +     +   ++G P P V+W K +  L  +  V      
Sbjct: 19981 DLDLKGLPDL-----CYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSA 20035

Query: 827   GVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVI 864
                +L +      D+G+Y    +N  G    T ++ V+
Sbjct: 20036 VNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVV 20073



 Score =  136 bits (342), Expect = 1e-31
 Identities = 143/638 (22%), Positives = 250/638 (39%), Gaps = 55/638 (8%)

Query: 250   QAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWL 309
             + E    +   P  P  P  V    R  + + W  P  +GG  V  Y +E +      W 
Sbjct: 16306 EPETARNLFSVPGAPDKPT-VSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWK 16364

Query: 310   KVGEAPADSTTFTDAH----VEPGRKYTFRVRAVTSEGAGEA-LESEEILVAPEALPKAP 364
             +V   P  + T   ++    +  G  Y FRV A+ + G G A L S+         P  P
Sbjct: 16365 RVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPGP 16424

Query: 365   SAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVAD 424
               P +   +     L W+ P   G + + GY++E +++G   W    D+ V   +  V  
Sbjct: 16425 PFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTG 16484

Query: 425   VRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAG 484
             +++G  Y+FRV AV  +G GEPG  +D +  +D +  P L  +  V DR      +  AG
Sbjct: 16485 LKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDR-----IVVHAG 16539

Query: 485   PDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGL-----RPGEGYFVRVTAV 539
                +      G      + +  +       T+  T  ++  +     R  +G +  + A 
Sbjct: 16540 GVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGVY-SLLAK 16598

Query: 540   NEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKD---LLTVKVGDTVRVPVS---FEAMP 593
             NE G+ + + +  ++  +P  V   FL  + T +   L      D    P++    E   
Sbjct: 16599 NEAGERKKTIIVDVLD-VPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRE 16657

Query: 594   MPEVTWLKDGLPLPKRSVTVTKDGLTQ---LLIPVAGLSDSGLYTVVLRTLQGKEVAHSF 650
                  W      + +++ TV   GL Q       +A  +  G+   V       E + + 
Sbjct: 16658 SDRRAWTPVTYTVTRQNATV--QGLIQGKAYFFRIAAENSIGMGPFV-------ETSEAL 16708

Query: 651   RIRVA-ACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAA- 708
              IR     P+ P  + ++E    TVT  W P   +     ++Y + +R      +H+   
Sbjct: 16709 VIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTN 16768

Query: 709   DRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREP 768
             D + + ++T+ G+  G  Y +RV A N +G  KPS  ++P          T K       
Sbjct: 16769 DNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKP---------ITCK------- 16812

Query: 769   DLSQKPRFLVGLRSHL-LPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLG 827
             D    P   +  R  L +  G    ++    G P+P V+WFK++  +  +   +      
Sbjct: 16813 DELAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPA 16872

Query: 828   VCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
               +L        DSG+Y  V EN+ G       + V++
Sbjct: 16873 TLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVD 16910



 Score =  136 bits (342), Expect = 1e-31
 Identities = 109/404 (26%), Positives = 170/404 (42%), Gaps = 14/404 (3%)

Query: 343   GAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKK 402
             G GE  +S  + V     P A     +   S   +TL W  P   G + I+ Y+IE+R  
Sbjct: 27349 GVGEP-KSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDA 27407

Query: 403   GSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP 462
                TW+ V+ +      + + D+ +   + FRV A    G GEP   ++ V A +   P 
Sbjct: 27408 TKRTWSVVSHK-CSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAP- 27465

Query: 463   GLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYT 522
               +R+L + D + TS+ LSW  PD   G     YVVE        W   H G        
Sbjct: 27466 --IRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTW--SHAGISKTCEIE 27521

Query: 523   AKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDT 582
                L+       RV A NE G S P  +   +    + + P+  +       +TV++G  
Sbjct: 27522 VSQLKEQSVLEFRVFAKNEKGLSDPVTIGP-ITVKELIITPEVDLSDIPGAQVTVRIGHN 27580

Query: 583   VRVPVSFEAMPMPEVTWLKDGLPLPKRS---VTVTKDGLTQLLIPVAGLSDSGLYTVVLR 639
             V + + ++  P P ++WLKDGLPL +      + T++ +T L I  A     G YTV+L 
Sbjct: 27581 VHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKIT-LSIKNAKKEHGGKYTVILD 27639

Query: 640   TLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRS 698
                 + +A    +     P  P GPI   E    +V   W+   D        Y++  R 
Sbjct: 27640 NAVCR-IAVPITVITLGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRE 27698

Query: 699   SAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKP 742
             ++   W      +    F +  ++   EY FRV A+N  G S+P
Sbjct: 27699 TSQTNWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQP 27742



 Score =  134 bits (337), Expect = 4e-31
 Identities = 99/381 (25%), Positives = 159/381 (41%), Gaps = 10/381 (2%)

Query: 369   ILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQG 428
             + + + +  T++W  P   G + I  +++E RK     W+ V       +R   A++   
Sbjct: 18010 VTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVT--KRLIKANLLAN 18067

Query: 429   CQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQ 488
              +Y FRV A    G G        + A +P+  PG   NL + D+  T + L W  PD  
Sbjct: 18068 NEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYD 18127

Query: 489   EGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPS 548
              G     Y VE     S  W   H G++  T Y        + Y  RV   NEGG+S   
Sbjct: 18128 GGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDWV 18187

Query: 549   ALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKD----GL 604
               + +V    +    K ++D     +LTVK GDT+R+       P PEV W KD     L
Sbjct: 18188 KTEEVVVKEDL---QKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDL 18244

Query: 605   PLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPI 664
                 R    T+   ++  +  A  SD G Y V      G  VA++  + V   P     +
Sbjct: 18245 TRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYA-TVNVLDKPGPVRNL 18303

Query: 665   HLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPG 724
              + +      T  W+P  D+      +Y +    +    W   +  + T   T+  ++ G
Sbjct: 18304 KIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIEG 18363

Query: 725   HEYHFRVVAKNELGASKPSDT 745
             +EY FRV A+N++G   P+++
Sbjct: 18364 NEYIFRVRAENKIGTGPPTES 18384



 Score =  134 bits (336), Expect = 5e-31
 Identities = 194/810 (23%), Positives = 310/810 (38%), Gaps = 107/810 (13%)

Query: 105   WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTF----VAGDQQSEATLTVQDS 160
             W  DG ++ T +    + D     L I +      G Y       AG +     LTV D 
Sbjct: 17544 WTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDV 17603

Query: 161   P----------TIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSS 210
             P           + P+      +P     G PVI      +++  +   RKD   VV S 
Sbjct: 17604 PGPPTGPINILDVTPEHMTISWQPPKDDGGSPVI------NYIVEKQDTRKDTWGVVSS- 17656

Query: 211   DREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSE-----GGSVQAELTL--QVIDKPDP 263
                     G   T+L +P   +K C +Y   +R+E     G  + +  T+       P P
Sbjct: 17657 --------GSSKTKLKIPHL-QKGC-EYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSP 17706

Query: 264   PQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTD 323
             P  P+ V D       + W  P+ +GG  +  Y +ERR+     W++V + P     F  
Sbjct: 17707 PGKPV-VTDITENAATVSWTLPKSDGGSPITGYYMERREV-TGKWVRVNKTPIADLKFRV 17764

Query: 324   AHVEPGRKYTFRVRAVTSEGAGEALESEEILVA--PEALPKAPSAPAILSASSQGITLTW 381
               +  G  Y FRV A    G  +   S + + A  P   P  P  P +   S +   L W
Sbjct: 17765 TGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKPPGPPINPKLKDKSRETADLVW 17824

Query: 382   TAPRGPGSAHILGYLIERRKKGSNTWTAVN-DQPVPERRWTVADVRQGCQYEFRVTAVAP 440
             T P   G + ILGY++E +K G+  W  +N D+ + +  + V  + +G +Y FR+ A   
Sbjct: 17825 TKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANI 17884

Query: 441   SGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWA-----------GPDTQE 489
              G GEP   +++V A+D + PP +   L VT R   ++ +               PD   
Sbjct: 17885 VGEGEPRELAESVIAKDILHPPEV--ELDVTCRDVITVRVGQTIRILARVKGRPEPDITW 17942

Query: 490   GDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSA 549
               E +  V E    D +Q LP       V     + +R   G ++ ++A N  G +Q SA
Sbjct: 17943 TKEGKVLVREK-RVDLIQDLP------RVELQIKEAVRADHGKYI-ISAKNSSGHAQGSA 17994

Query: 550   L-DTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVT-WLKDGLPLP 607
             + + L +  P   C    V + TK+  T+   + +    S       E+T ++ +     
Sbjct: 17995 IVNVLDRPGP---CQNLKVTNVTKENCTISWENPLDNGGS-------EITNFIVEYRKPN 18044

Query: 608   KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLR--------TLQGKEVAHSFRIRVAACPQ 659
             ++  ++    +T+ LI    L+++  Y  V          T++ K       I     P 
Sbjct: 18045 QKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVGPTIETK--TPILAINPIDRPG 18102

Query: 660   APGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEA-ADRIHTNRFTL 718
              P  +H+ +     V  +W     +     L Y V  R      W       I    + +
Sbjct: 18103 EPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMV 18162

Query: 719   LGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLV 778
                +    Y FRV  KNE G S        W    + +   VK       DL QKP   +
Sbjct: 18163 DRCVENQIYEFRVQTKNEGGES-------DWV---KTEEVVVK------EDL-QKPVLDL 18205

Query: 779   GLRSHL-LPQGCECCMSCAVQGSPRPHVTWFKND--RSLEGNPAVYSTDLLGVCSLTIPS 835
              L   L +  G    +   V+G P P V W K+     L  +P V           ++  
Sbjct: 18206 KLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTK 18265

Query: 836   VSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
                 D G+Y   A NT G  V+ AT+ V++
Sbjct: 18266 AKRSDGGKYVVTATNTAGSFVAYATVNVLD 18295



 Score =  129 bits (325), Expect = 9e-30
 Identities = 167/698 (23%), Positives = 261/698 (37%), Gaps = 106/698 (15%)

Query: 104   TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTF----VAGDQQSEATLTVQD 159
             +W K    L T   V  +   +  +L +   Q + AG+YT     VAG ++   ++ V  
Sbjct: 20015 SWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVVG 20074

Query: 160   SPTIAP---DVTEKLREPLVVKAGKP------VIVKIPFQSHLPIQAAWRKDGAEVVGSS 210
              P I        E   E + +K   P       I     +    +   W    + V  ++
Sbjct: 20075 KPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTT 20134

Query: 211   DREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEV 270
              R  ++  G  YT     SA  K    Y V    EG   +  +     D PD P  P  +
Sbjct: 20135 FRVTRLHEGMEYT--FRVSAENK----YGV---GEGLKSEPIVARHPFDVPDAPP-PPNI 20184

Query: 271   QDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGR 330
              D     V L W  P+  GG  +  Y +E ++     W +  + P     F    +  G 
Sbjct: 20185 VDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGL 20244

Query: 331   KYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSA 390
             +Y FRV A+   G G+     E +VA + +   P  P +++ +   +TL WT P+  G  
Sbjct: 20245 EYEFRVMAINLAGVGKPSLPSEPVVALDPI-DPPGKPEVINITRNSVTLIWTEPKYDGGH 20303

Query: 391   HILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGP-GEPGPP 449
              + GY++E+R   S +W   N   VPE  +TV D+ +G +YEFR+ A   +G    P   
Sbjct: 20304 KLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSES 20363

Query: 450   SDAVFARDPMRPPGLVRNLQVTD----RSNTSITL-------------SW--AGPDTQEG 490
             ++ +  +D    P +V +  + D    ++  +I L             SW  AG D +  
Sbjct: 20364 TETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPS 20423

Query: 491   DEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSAL 550
             D     + ++ S+ +   L     T           R   G +  +TA N  G       
Sbjct: 20424 D-----ITQITSTPTSSMLTIKYAT-----------RKDAGEYT-ITATNPFG------- 20459

Query: 551   DTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTW---LKDGLPLP 607
              T V+ + VTV             L V  G    V +S  +     +TW   L+DG   P
Sbjct: 20460 -TKVEHVKVTV-------------LDVP-GPPGPVEISNVSAEKATLTWTPPLEDG-GSP 20503

Query: 608   KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEV---------------AHSFRI 652
              +S  + K   ++LL  V          V  + +QG E                  S  +
Sbjct: 20504 IKSYILEKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQSEPV 20563

Query: 653   RVAACPQAPGPIHLQE--NV-PGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAAD 709
             ++      PGP    E  NV   T T  W+   D+       Y V  R      W  A  
Sbjct: 20564 KMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIK 20623

Query: 710   R-IHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS 746
               +   R  + G+  G  Y FRV A+N  G   PS+ S
Sbjct: 20624 TPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEAS 20661



 Score =  129 bits (323), Expect = 2e-29
 Identities = 157/660 (23%), Positives = 251/660 (38%), Gaps = 72/660 (10%)

Query: 237   QYSVTLRSEGGSVQAELTLQVIDKPDP--PQGPMEVQDCHRAGVCLRWRPPRDNGGRTVE 294
             +Y V   +  G  +   + + +   DP  P G  EV +  R  V L+W  P  +GG  + 
Sbjct: 25658 EYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKIT 25717

Query: 295   CYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTS-EGAGEALESE-E 352
              Y+VERR+     WLK        T F    +   ++Y FRV A  + +   E  ES   
Sbjct: 25718 GYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGP 25777

Query: 353   ILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGY---LIERRKKGSNTWTA 409
             I+V  +  P       ++    + + +         +A I G    +I   K G      
Sbjct: 25778 IIVKDDVEPPR----VMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEER 25833

Query: 410   VNDQPVPERRWTVADV-----RQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGL 464
                + +     T+  V     R   QY   +  VA       G  S AV  +   +P   
Sbjct: 25834 ARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVA-------GTRSVAVNCKVLDKPGPP 25886

Query: 465   VRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAK 524
                L++   +    +LSW  P    G +   Y+VE   +  L W  C  G + +T+    
Sbjct: 25887 AGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICE-GELQMTSCKVT 25945

Query: 525   GLRPGEGYFVRVTAVNEGGQSQP------SALDTLVQAMPVTVCPKFLVDSSTKDLLTV- 577
              L  G  Y  RVT VN+ G  +P       ALD      P T      + S TK+ +T+ 
Sbjct: 25946 KLLKGNEYIFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPT---SLEITSVTKESMTLC 26002

Query: 578   -----KVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSG 632
                    G +       E      + W++           V K  +  L +   GL +  
Sbjct: 26003 WSRPESDGGSEISGYIIERREKNSLRWVR-----------VNKKPVYDLRVKSTGLREGC 26051

Query: 633   LYT--VVLRTLQGKEVAHSFRIRVAA-----CPQAPGPIHLQENVPGTVTAEWEPSPDEA 685
              Y   V      G  +       + A      P  P    + ++   T+T  W     + 
Sbjct: 26052 EYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDG 26111

Query: 686   QDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
                   Y V  + S    W  +   +    +T+ G+  G EY FRV + N++GAS PSD+
Sbjct: 26112 GAPITGYTVEYKKSDDTDWKTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDS 26171

Query: 746   SQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHV 805
             S P  I ++R+    + P +   D+  + R     ++ ++  G    M+   +G P P+V
Sbjct: 26172 SDPQ-IAKERE----EEPLF---DIDSEMR-----KTLIVKAGASFTMTVPFRGRPVPNV 26218

Query: 806   TWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
              W K D  L     V +TD     SLTI + +  DSG+Y    +N L  A  T  + V++
Sbjct: 26219 LWSKPDTDLRTRAYVDTTD--SRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLD 26276



 Score =  128 bits (321), Expect = 3e-29
 Identities = 142/604 (23%), Positives = 235/604 (38%), Gaps = 88/604 (14%)

Query: 183   VIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTL 242
             +I  +PF      +  W+K+  +    +  +A++D+    ++L + +A  +D G YS+T+
Sbjct: 17241 IIKGVPFP-----KVTWKKEDRD----APTKARIDVTPVGSKLEIRNAAHEDGGIYSLTV 17291

Query: 243   RSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQ 302
              +  GS    + + V+DKP PP+  +EV +  +    L W+ P D+GG  +  YVVERR 
Sbjct: 17292 ENPAGSKTVSVKVLVLDKPGPPRD-LEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRD 17350

Query: 303   AGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEAL-- 360
                + W  +       + F   H+  G +Y FRV A    G G  +E+ + + A + L  
Sbjct: 17351 VASAQWSPLSATSKKKSHFAK-HLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHP 17409

Query: 361   PKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRW 420
             P  P     +      ++L W  P   G + I GYL+E +++G+  W  +  + V     
Sbjct: 17410 PGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDW--IKFKTVTNLEC 17467

Query: 421   TVADVRQGCQYEFRVTAVAPSGPGEPG------------PPSD----------AVFARDP 458
              V  ++QG  Y FRV A    G G P             PPS            V A   
Sbjct: 17468 VVTGLQQGKTYRFRVKAENIVGLGLPDTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTT 17527

Query: 459   MRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPV 518
             +R P ++R + V        T  W   D  E    + Y VE  +  S+            
Sbjct: 17528 VRFPAIIRGVPVP-------TAKWT-TDGSEIKTDEHYTVETDNFSSV------------ 17567

Query: 519   TTYTAKG-LRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTV 577
                T K  LR   G + ++T  N  G    +   T++        P  ++D + + +   
Sbjct: 17568 --LTIKNCLRRDTGEY-QITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHM--- 17621

Query: 578   KVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVV 637
                 T+      +    P + ++ +     K +  V   G ++  + +  L     Y   
Sbjct: 17622 ----TISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFR 17677

Query: 638   LRTLQGKEVA-----------HSFRIRVAACPQAPGPIHLQENVPGTVTAEWE-PSPDEA 685
             +R      V            H F     + P  PG   + +      T  W  P  D  
Sbjct: 17678 VRAENKIGVGPPLDSTPTVAKHKF-----SPPSPPGKPVVTDITENAATVSWTLPKSDGG 17732

Query: 686   QDVPLHYAVFTRSSAHGPWHEA-ADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSD 744
               +  +Y    R    G W       I   +F + G+  G+ Y FRV A+N  G SKPS 
Sbjct: 17733 SPITGYY--MERREVTGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSP 17790

Query: 745   TSQP 748
             +S P
Sbjct: 17791 SSDP 17794



 Score =  121 bits (304), Expect = 2e-27
 Identities = 151/635 (23%), Positives = 240/635 (37%), Gaps = 61/635 (9%)

Query: 253   LTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVG 312
             + +  I  P  PQ P  V D  R  V L W  P D GG  V  Y++E ++  +  W K  
Sbjct: 30025 VAMDPIAPPGKPQNP-RVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCN 30083

Query: 313   EAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESE------EILVAPEALPKAPSA 366
               P     +T  H+  G +Y FRV A  + G GE  E        E+L  P+        
Sbjct: 30084 TTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQ 30143

Query: 367   PAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVR 426
               I     QG  +  T P       I  +  E +        A ++    E     AD  
Sbjct: 30144 EGIFVR--QGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHT-ELVIKEADRG 30200

Query: 427   QGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPD 486
                 Y+     V  +  G+            P  P G    L+  D    S+ +SW  P 
Sbjct: 30201 DSGTYDL----VLENKCGKKAVYIKVRVIGSPNSPEG---PLEYDDIQVRSVRVSWRPPA 30253

Query: 487   TQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQ 546
                G +  GY++E        W       V  T+   KGL+    Y  RV+A N+ G S+
Sbjct: 30254 DDGGADILGYILERREVPKAAWYTID-SRVRGTSLVVKGLKENVEYHFRVSAENQFGISK 30312

Query: 547   PSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFE-AMPMPEVTWLKDGLP 605
             P     L    PVT  PK  ++         +V D  +  VS   + P  +      G  
Sbjct: 30313 P-----LKSEEPVT--PKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYY 30365

Query: 606   LPKRSVTV------TKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVA---A 656
             + ++  +        K  +T  +  V GL     Y    R +   +V  S     +    
Sbjct: 30366 IERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQ--FRIIAQNDVGLSETSPASEPVV 30423

Query: 657   C------PQAPGPIHLQENVPGTVTAEWE-PSPDEAQDVPLHYAVFTRSSAHGPWHEA-A 708
             C      P  PG + +      +VT +WE P  D  +++ L Y V  R S    W ++  
Sbjct: 30424 CKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEI-LGYWVEYRQSGDSAWKKSNK 30482

Query: 709   DRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREP 768
             +RI   +FT+ G+L   EY FRV A+NE G S+P           +R   ++K     + 
Sbjct: 30483 ERIKDKQFTIGGLLEATEYEFRVFAENETGLSRP-----------RRTAMSIKT----KL 30527

Query: 769   DLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGV 828
                + P     ++      G    +SC + G P P + W++  + L  +     +     
Sbjct: 30528 TSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRT 30587

Query: 829   CSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
              +LT+ +   +D G Y  +A N +G+  +++ L++
Sbjct: 30588 HTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLL 30622



 Score =  120 bits (300), Expect = 7e-27
 Identities = 101/335 (30%), Positives = 145/335 (43%), Gaps = 30/335 (8%)

Query: 147   GDQQSEATLTVQDSPTIAPDVTEK----------LREPLVVKAGKPVIVKIPFQSHLPIQ 196
             G+ Q       Q+ P +  DV+ K          LR P VV  G+PV  K+         
Sbjct: 15088 GETQPVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVV-TGRPVPTKV--------- 15137

Query: 197   AAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQ 256
               W K+  E+    DR    ++G   + L +  A RKD G+Y +T  +  GS  A   ++
Sbjct: 15138 --WTKEEGEL--DKDRVVIDNVGTK-SELIIKDALRKDHGRYVITATNSCGSKFAAARVE 15192

Query: 257   VIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPA 316
             V D P P      V   +R    L W  P D+GG  +  +++ER+ A   TW +  E   
Sbjct: 15193 VFDVPGPVLDLKPVVT-NRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETER 15251

Query: 317   DSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEIL-VAPEALPKAPSAPAILSASSQ 375
                  T   +  G++Y FRV A    G G  +E   IL V P   P +P        +  
Sbjct: 15252 SKCDITG--LLEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKS 15309

Query: 376   GITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRV 435
              ITL W  PR  G + I GY+IE+R+     +  VN +  P   + V ++ +   YEFRV
Sbjct: 15310 TITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRV 15369

Query: 436   TAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQV 470
              AV   G  EP  P + V   D + PP +   L V
Sbjct: 15370 KAVNEIGESEPSLPLNVVIQDDEV-PPTIKLRLSV 15403



 Score =  120 bits (300), Expect = 7e-27
 Identities = 173/828 (20%), Positives = 294/828 (35%), Gaps = 106/828 (12%)

Query: 82    MEVQPGEAATLSCT--LTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQA 139
             + ++ G+   L+    L   L   +W K G  +   D            L I +     A
Sbjct: 20388 LTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDA 20447

Query: 140   GRYTFVA----GDQQSEATLTVQDSP---------TIAPDVTEKLREPLVVKAGKPVIVK 186
             G YT  A    G +     +TV D P          ++ +       P +   G P+   
Sbjct: 20448 GEYTITATNPFGTKVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSY 20507

Query: 187   IPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEG 246
             I  +     +  W     ++   S R     L  G   +   SA         V    +G
Sbjct: 20508 I-LEKRETSRLLWTVVSEDI--QSCRHVATKLIQGNEYIFRVSA---------VNHYGKG 20555

Query: 247   GSVQAELTLQVIDK---PDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQA 303
               VQ+E  ++++D+   P PP+ P EV +  +    + W+ P D+GG  +  Y VERR+ 
Sbjct: 20556 EPVQSE-PVKMVDRFGPPGPPEKP-EVSNVTKNTATVSWKRPVDDGGSEITGYHVERREK 20613

Query: 304   GRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEAL--P 361
                 W++  + P          ++ G  Y FRV A    G G   E+ + ++  +A   P
Sbjct: 20614 KSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPP 20673

Query: 362   KAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTA-VNDQPVPERRW 420
               PS P +   + +  +L W  P   G   I GY++E +K G   W        +   ++
Sbjct: 20674 GPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQF 20733

Query: 421   TVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP---------------GLV 465
              V D++   +Y FR++A+  +G GEP    D       M P                GL 
Sbjct: 20734 VVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRAGLS 20793

Query: 466   RNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLP-CH---VGTVPVTTY 521
               + V  +   +  ++W   +    + A    +E   S +L  +P C+    G   +T  
Sbjct: 20794 IRIFVPIKGRPAPEVTWTKDNINLKNRAN---IENTESFTLLIIPECNRYDTGKFVMTIE 20850

Query: 522   TAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTK--DLLTVKV 579
                G + G   FV V  ++  G         ++   P  +      DS T   DL  +  
Sbjct: 20851 NPAGKKSG---FVNVRVLDTPGP--------VLNLRPTDITK----DSVTLHWDLPLIDG 20895

Query: 580   GDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLR 639
             G  +               ++ +     ++S +       +    V GLS+   Y   + 
Sbjct: 20896 GSRI-------------TNYIVEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVM 20942

Query: 640   TLQ----GKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVF 695
                    G+    +  ++ +  P  P  +++ +    TV+  W     +       Y + 
Sbjct: 20943 AENEYGIGEPTETTEPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIE 21002

Query: 696   TRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQR 755
              +      W      +      +  +  G EY F+V+A N  G S P + S+P  +  Q 
Sbjct: 21003 AQRKGSDQWTHITT-VKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRE-SRPVIVKEQT 21060

Query: 756   DRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLE 815
                        E DL    + LV     +   G    +   V G P+P VTW K D+ L+
Sbjct: 21061 --------MLPELDLRGIYQKLV-----IAKAGDNIKVEIPVLGRPKPTVTWKKGDQILK 21107

Query: 816   GNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
                 V          L I      DSG Y   A N +G+     T+ V
Sbjct: 21108 QTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQV 21155



 Score =  119 bits (298), Expect = 1e-26
 Identities = 74/292 (25%), Positives = 131/292 (44%), Gaps = 7/292 (2%)

Query: 166   DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
             ++ + L++ + ++AG  + + +      P    W K G ++       A +D  + Y+ L
Sbjct: 29447 ELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLAS----RAIIDTTESYSLL 29502

Query: 226   CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPP 285
              +    R D G+Y++   ++ G   A + ++V D P P    ++V++  R  V + W  P
Sbjct: 29503 IVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPS-VKVKEVSRDSVTITWEIP 29561

Query: 286   RDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAG 345
               +GG  V  Y+VE+R+A    + K        T +  + +  G  Y FRV      G G
Sbjct: 29562 TIDGGAPVNNYIVEKREAAMRAF-KTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIG 29620

Query: 346   EALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSN 405
             E  E+ + ++  E +P  P+   ++  +   +TL W  P   G + + GY++E  K G+ 
Sbjct: 29621 EPCETSDAVLVSE-VPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTE 29679

Query: 406   TWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARD 457
              W  V          TV  + +G QY FR+ A    G  EP     AV  +D
Sbjct: 29680 RWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQD 29731



 Score =  119 bits (297), Expect = 2e-26
 Identities = 118/502 (23%), Positives = 205/502 (40%), Gaps = 27/502 (5%)

Query: 75    FSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHV 134
             F + L D  V   + A  SC L+ +     W+++G ++       F++DG +H L I   
Sbjct: 12825 FVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDC 12884

Query: 135   QGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPL-VVKAGKPVIVKIPFQSHL 193
             +      Y     D++S A L V++ P       E +R P  +++A    +V +   +  
Sbjct: 12885 RLDDECEYACGVEDRKSRARLFVEEIP------VEIIRPPQDILEAPGADVVFLAELNKD 12938

Query: 194   PIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAEL 253
              ++  W ++   VV   D+   +  G  + RL +     +D G+Y    + +    +A+L
Sbjct: 12939 KVEVQWLRNNMVVV-QGDKHQMMSEGKIH-RLQICDIKPRDQGEYRFIAKDK--EARAKL 12994

Query: 254   TLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGE 313
              L    K       + V      G  L    P D   +    +  E       T     +
Sbjct: 12995 ELAAAPKIKTADQDLVVD----VGKPLTMVVPYDAYPKAEAEWFKENEPLSTKTI----D 13046

Query: 314   APADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSAS 373
               A+ T+F     + G K  +++      G  E   + +++  P      P     ++ +
Sbjct: 13047 TTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVP-----GPVRNLEVTET 13101

Query: 374   SQG-ITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQ-GCQY 431
               G ++L W  P   G + I+GY++ERR     TW    D+      +TV  +++ G +Y
Sbjct: 13102 FDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDR-AESCEFTVTGLQKGGVEY 13160

Query: 432   EFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGD 491
              FRV+A    G GEP    + V AR     PG   N+ +TD +   ++L+W  P+   G 
Sbjct: 13161 LFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGA 13220

Query: 492   EAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALD 551
             E   YV+EL    S++W           + T   +  G+ Y  RV A N  G  +PSA  
Sbjct: 13221 EITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAAT 13280

Query: 552   TLVQAMPVTVCPKFLVDSSTKD 573
               V+       P   V+ ++ D
Sbjct: 13281 PFVKVADPIERPSPPVNLTSSD 13302



 Score =  118 bits (296), Expect = 2e-26
 Identities = 143/634 (22%), Positives = 246/634 (38%), Gaps = 71/634 (11%)

Query: 261   PDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTT 320
             P PP  P EV    +  + + W  P  +GG  +  Y +E+R      W KV +     T 
Sbjct: 27066 PGPPGIP-EVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTR 27124

Query: 321   FTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEAL--PKAPSAPAILSASSQGIT 378
                  +     Y +RV AV + G G   E  E   A + +  P  P+   I  ++   IT
Sbjct: 27125 QKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSIT 27184

Query: 379   LTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQ-PVPERRWTVADVRQGCQYEFRVTA 437
             L W+ P   G + + GY++E R+     WT V+ +  V    + V++++ G  Y FRV+A
Sbjct: 27185 LGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSA 27244

Query: 438   VAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSI------------------T 479
             V  +G GEP   ++ V A+D +  P +  +L V  R++                     T
Sbjct: 27245 VNCAGQGEPIEMNEPVQAKDILEAPEI--DLDVALRTSVIAKAGEDVQVLIPFKGRPPPT 27302

Query: 480   LSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAV 539
             ++W   +   G +A+ Y +E   S SL        T+P  T      R   G ++ +T  
Sbjct: 27303 VTWRKDEKNLGSDAR-YSIENTDSSSLL-------TIPQVT------RNDTGKYI-LTIE 27347

Query: 540   NEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTW 599
             N  G+ + S +   V   P   C K  V   ++  +T+ + D   +         P + +
Sbjct: 27348 NGVGEPKSSTVSVKVLDTPAA-CQKLQVKHVSRGTVTL-LWDPPLIDGG-----SPIINY 27400

Query: 600   LKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVA------HSFRIR 653
             + +     KR+ +V     +     +  LS+   +    R L   E+        +  ++
Sbjct: 27401 VIEKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPF--FFRVLAENEIGIGEPCETTEPVK 27458

Query: 654   VAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHT 713
              A  P     + ++++   +V   W     +   V   Y V  +      W  A     T
Sbjct: 27459 AAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGIS-KT 27517

Query: 714   NRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYR-EPDLSQ 772
                 +  +       FRV AKNE G S P                TVK      E DLS 
Sbjct: 27518 CEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGP----------ITVKELIITPEVDLSD 27567

Query: 773   KPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLT 832
              P   V +R      G    +    +G P+P ++W K+   L+ +  V  +      +L+
Sbjct: 27568 IPGAQVTVRI-----GHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLS 27622

Query: 833   IPSVSPKDSGEYKAVAENTLGQAVSTATLIVIEP 866
             I +   +  G+Y  + +N + +     T+I + P
Sbjct: 27623 IKNAKKEHGGKYTVILDNAVCRIAVPITVITLGP 27656



 Score =  117 bits (292), Expect = 6e-26
 Identities = 187/808 (23%), Positives = 304/808 (37%), Gaps = 97/808 (12%)

Query: 104   TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVA----GDQQSEATLTVQD 159
             TW K+G  L  +  V   QD     L I        G+Y   A    G  Q  A + V D
Sbjct: 17941 TWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLD 18000

Query: 160   SPTIAPD--VTEKLREPLVVKAGKPV------IVKIPFQSHLPIQAAWRKDGAEVVGSSD 211
              P    +  VT   +E   +    P+      I     +   P Q  W    ++V     
Sbjct: 18001 RPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLI 18060

Query: 212   REAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAE---LTLQVIDKPDPPQGPM 268
             +   +   + Y R+C  +                G +++ +   L +  ID+P  P+  +
Sbjct: 18061 KANLLANNEYYFRVCAENKV------------GVGPTIETKTPILAINPIDRPGEPEN-L 18107

Query: 269   EVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEP 328
              + D  +  V L+WR P  +GG     Y VERR  G   W +V +     T +       
Sbjct: 18108 HIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVE 18167

Query: 329   GRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPG 388
              + Y FRV+     G  + +++EE++V  E L K      +L     G+ LT  A    G
Sbjct: 18168 NQIYEFRVQTKNEGGESDWVKTEEVVVK-EDLQKP-----VLDLKLSGV-LTVKA----G 18216

Query: 389   SAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGP 448
                 L   +  +      WT   D     R   V    +    +F +T    S  G+   
Sbjct: 18217 DTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVV 18276

Query: 449   PSD-------AVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELC 501
              +        A    + +  PG VRNL++ D S+   T+ W  P+   G E Q Y++E C
Sbjct: 18277 TATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKC 18336

Query: 502   SSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTV 561
              +  + W   +  TV     T   L  G  Y  RV A N+ G   P+      ++ PV  
Sbjct: 18337 ETKRMVW-STYSATVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPT------ESKPVIA 18389

Query: 562   CPKF---------LVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVT 612
               K+          V   +K+ +TV     V  P  ++        +L+       R V 
Sbjct: 18390 KTKYDKPGRPDPPEVTKVSKEEMTV-----VWNPPEYDGGKSITGYFLEKKEKHSTRWVP 18444

Query: 613   VTKDGLTQLLIPVAGLSDSGLYTVVLRT---LQGKEVAHSFRIRVAACP-QAPGP---IH 665
             V K  + +  + V  L     Y   ++    +   E +   R  VA  P + PGP     
Sbjct: 18445 VNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFR 18504

Query: 666   LQENVPGTVTAEWEPSPDEAQDVPLHYAVFTR-----SSAHGPWHE--AADRIHTNRFTL 718
             + +    ++T  W     +     + Y V  R     +S    W    AA ++    FT+
Sbjct: 18505 VVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTV 18564

Query: 719   LGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLV 778
               +    EY FRV A+N++G  +P++  +       + +  ++ P   E DL    R LV
Sbjct: 18565 TSLDENQEYEFRVCAQNQVGIGRPAELKEAI-----KPKEILEPP---EIDLDASMRKLV 18616

Query: 779   GLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCS-LTIPSVS 837
              +R+     GC   +   V+G P P VTW K    ++        DL+   + L IP+ +
Sbjct: 18617 IVRA-----GCPIRLFAIVRGRPAPKVTWRK--VGIDNVVRKGQVDLVDTMAFLVIPNST 18669

Query: 838   PKDSGEYKAVAENTLGQAVSTATLIVIE 865
               DSG+Y     N  G+      + V++
Sbjct: 18670 RDDSGKYSLTLVNPAGEKAVFVNVRVLD 18697



 Score =  115 bits (288), Expect = 2e-25
 Identities = 135/516 (26%), Positives = 209/516 (40%), Gaps = 57/516 (11%)

Query: 261   PDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTT 320
             PDPP+  ++ +D     + L W PP+++GG  ++ Y+VER   G   W+  GE P   T 
Sbjct: 13588 PDPPEN-VKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGE-PVAETK 13645

Query: 321   FTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLT 380
                  +E G+ Y +RV+A+  +GA +     E + A +       AP I         LT
Sbjct: 13646 MEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVD----TQEAPEIFLDVKLLAGLT 13701

Query: 381   WTAPRGPGSAHILGYLIERRKKGSNTWT----------AVNDQPVPERRW-TVADVRQGC 429
               A    G+   L   +  + +   TWT           +  + VP++   T+ D ++  
Sbjct: 13702 VKA----GTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSD 13757

Query: 430   QYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQE 489
                + + AV   G       + AV   + +  PG      +TD +N S  L+W  P    
Sbjct: 13758 TGTYIIEAVNVCG------RATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDG 13811

Query: 490   GDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSA 549
             G +   YVVE  ++DS  W      TV  T + A  L P + Y  RV A N  G  +P  
Sbjct: 13812 GSKITNYVVERRATDSEVWHKLS-STVKDTNFKATKLIPNKEYIFRVAAENMYGVGEP-- 13868

Query: 550   LDTLVQAMPVTVCPKF--------LVDSS-TKDLLTVKVGDTVRVPVSFEAMPMPEVTWL 600
                 VQA P+T   +F        L  S  TKD +T+    T   P      P+    W+
Sbjct: 13869 ----VQASPITAKYQFDPPGPPTRLEPSDITKDAVTL----TWCEPDDDGGSPITGY-WV 13919

Query: 601   KDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLY--TVVLRTLQG-----KEVAHSFRIR 653
             +   P   + V   K  +      V GL++   Y   V+   L G     K         
Sbjct: 13920 ERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKD 13979

Query: 654   VAACPQAPGPIHLQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIH 712
                 P  PG   +++    +V   W +P  D    +   Y +    +    W   A+ + 
Sbjct: 13980 PIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIE-SYVIEMLKTGTDEWVRVAEGVP 14038

Query: 713   TNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             T +  L G++ G EY FRV A N+ G S+PS+ S P
Sbjct: 14039 TTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDP 14074



 Score =  113 bits (282), Expect = 9e-25
 Identities = 154/665 (23%), Positives = 253/665 (38%), Gaps = 113/665 (16%)

Query: 251   AELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLK 310
             ++ TL V   P  P G  +  D  R  + L+W PP  +GG  +  Y +E+RQ G   W++
Sbjct: 27846 SKFTLAV--SPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVGYSIEKRQ-GNERWVR 27902

Query: 311   VGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAIL 370
                       +T   + PG +Y FR+ A  + G           ++P +           
Sbjct: 27903 CNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGT----------ISPPS----------- 27941

Query: 371   SASSQGITLTWTAPRGP----GSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVR 426
                S GI +T      P    G  +  G +I +  +       V  +PVP   W     +
Sbjct: 27942 --QSSGIIMTRDENVPPIVEFGPEYFDGLII-KSGESLRIKALVQGRPVPRVTW----FK 27994

Query: 427   QGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMR-------------------------- 460
              G + E R+        G     S ++F RD  R                          
Sbjct: 27995 DGVEIEKRMNMEITDVLG-----STSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQ 28049

Query: 461   --PPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPV 518
               P  +V  ++ T+ +   +TL W  P          Y++E   +  L W          
Sbjct: 28050 DTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIE-DKCEA 28108

Query: 519   TTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTV--CPKFLVDSS-TKDLL 575
              +YTA  L  G  Y  RV+AVN+ G  +P   D +V  +  TV   P     S+ T + +
Sbjct: 28109 QSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTVPDAPGIPEPSNITGNSI 28168

Query: 576   TV------KVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLS 629
             T+        G +       E        W+K           ++K  +++    V GL+
Sbjct: 28169 TLTWARPESDGGSEIQQYILERREKKSTRWVK----------VISKRPISETRFKVTGLT 28218

Query: 630   DSGLYTVVLRTLQGKEVAHSFRI-RVAACPQA---PGP---IHLQENVPGTVTAEW-EPS 681
             +   Y   +       V  +  I R+  C +    PGP   + + +    TV+ EW +P 
Sbjct: 28219 EGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPV 28278

Query: 682   PDEAQDVPLHYAVFTRSSAHGPWHEA-ADRIHTNRFTLLGILPGHEYHFRVVAKNELGAS 740
              D   ++ + Y +    +  G WH+  A+     R+T+  +  G EY FRV A N  GA 
Sbjct: 28279 FDGGMEI-IGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAIN--GAG 28335

Query: 741   KPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGS 800
             K  D+ +     +  DR T        P+L     F    ++H++  G    +  A QG 
Sbjct: 28336 K-GDSCEVTGTIKAVDRLTA-------PELDIDANFK---QTHVVRAGASIRLFIAYQGR 28384

Query: 801   PRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTAT 860
             P P   W K D +L     +++TD     +LT+ + +  D+G+Y    EN  G    T T
Sbjct: 28385 PTPTAVWSKPDSNLSLRADIHTTD--SFSTLTVENCNRNDAGKYTLTVENNSGSKSITFT 28442

Query: 861   LIVIE 865
             + V++
Sbjct: 28443 VKVLD 28447



 Score =  111 bits (278), Expect = 3e-24
 Identities = 160/634 (25%), Positives = 242/634 (38%), Gaps = 90/634 (14%)

Query: 259   DKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADS 318
             + P PP   + + D  ++ V L W  P+ +GG  +  YV+E ++ G   W  +       
Sbjct: 20963 EAPSPPDS-LNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHI--TTVKG 21019

Query: 319   TTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEA-LPKAPSAPAILSASSQGI 377
                   ++  G +YTF+V AV S G     ES  ++V  +  LP+       L    Q +
Sbjct: 21020 LECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELD-----LRGIYQKL 21074

Query: 378   TLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTA 437
              +            +LG     R K + TW   +      +R                  
Sbjct: 21075 VIAKAGDNIKVEIPVLG-----RPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECV 21129

Query: 438   VAPSGP---------GEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQ 488
              + SGP         GE G          P  P G ++  +V   S+  +T SW  P+  
Sbjct: 21130 RSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEV---SSDFVTFSWDPPEND 21186

Query: 489   EGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPS 548
              G     YVVE+  +DS  W+     TV  TTY A  L  G  Y  RV A N  G     
Sbjct: 21187 GGVPISNYVVEMRQTDSTTWVELAT-TVIRTTYKATRLTTGLEYQFRVKAQNRYGVGPGI 21245

Query: 549   ALDTLVQAMPVTV-----CPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDG 603
                 +V   P  V      P+  V + TKD +T+   +    P+S    P+     L   
Sbjct: 21246 TSACIVANYPFKVPGPPGTPQ--VTAVTKDSMTISWHE----PLSDGGSPI-----LGYH 21294

Query: 604   LPLPKRS----VTVTKDGLTQLLIPVAGLSDSGLYT--VVLRTLQGKEVAHSFRIRVAAC 657
             +   +R+     TV+K  +   +   +GL+D   Y   V+   + GK         + A 
Sbjct: 21295 VERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLAL 21354

Query: 658   -----PQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAA-DRI 711
                  P  P P+++  +   TVT +W             Y V  R   +G W +A    I
Sbjct: 21355 DPIDPPGKPVPLNITRH---TVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNI 21411

Query: 712   HTNRFTLLGILPGHEYHFRVVAKNELGA-SKPSDTSQPWCIPRQRDRFTVKAPCYREPDL 770
               N FT+ G+     Y FRV+AKN  GA S PS+ S         D  T +       D 
Sbjct: 21412 LENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPS---------DAITCR-------DD 21455

Query: 771   SQKPRFLVGLR---SHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP------AVY 821
              + P+  V ++   + +L  G    +   V G P P + W K+ + LEG        A +
Sbjct: 21456 VEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADF 21515

Query: 822   STDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQA 855
             ST+L+   S      + +DSG Y   A N  G A
Sbjct: 21516 STNLVNKDS------TRRDSGAYTLTATNPGGFA 21543



 Score =  110 bits (276), Expect = 4e-24
 Identities = 188/795 (23%), Positives = 286/795 (35%), Gaps = 129/795 (16%)

Query: 115   QDGVIFKQDGLVHSLFITHVQGTQAGRYTFV----AGDQQSEATLTVQDSPT-------- 162
             +D  I        SL + +V    +G+YT      +G + +  T+ V D+P+        
Sbjct: 22984 RDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVT 23043

Query: 163   -IAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREA----QVD 217
              I  D      EP ++  G  +   I     +  + A RK  A VV +  + +    Q+ 
Sbjct: 23044 EITKDSVSITWEPPLLDGGSKIKNYI-----VEKREATRKSYAAVVTNCHKNSWKIDQLQ 23098

Query: 218   LGDGYTRLCLPSAGRKDCGQYSVTLRSEGG---SVQAELTLQVIDKPDPPQGPMEVQDCH 274
              G  Y               + VT  +E G     Q    ++V + P PP G + V D  
Sbjct: 23099 EGCSY--------------YFRVTAENEYGIGLPAQTADPIKVAEVPQPP-GKITVDDVT 23143

Query: 275   RAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTF 334
             R  V L W  P  +GG  +  Y+VE +      W +     +     T  ++  G +Y F
Sbjct: 23144 RNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVIT--NLTQGEEYLF 23201

Query: 335   RVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQ-GITLTWTAPRGPGSAHIL 393
             RV AV  +G  +       +VA + + +    PA  S S Q G  L    P         
Sbjct: 23202 RVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVP--------- 23252

Query: 394   GYLIERRKKGSNTWTAVNDQPVPERRWTVAD-------------VRQGCQYEFRVTAVAP 440
                I  R K + TWT          R  V D                G QY   V  V  
Sbjct: 23253 ---ISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVV- 23308

Query: 441   SGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVEL 500
                G+     + V    P  P G V+     D S  SITLSW  P    G +   Y+V+ 
Sbjct: 23309 ---GQKTASIEIVTLDKPDPPKGPVK---FDDVSAESITLSWNPPLYTGGCQITNYIVQK 23362

Query: 501   CSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVT 560
               + +  W      TV  TT     L+ G  Y  R+ A N  GQS     D +V   P  
Sbjct: 23363 RDTTTTVW-DVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYK 23421

Query: 561   V-----CPKFLVDSSTKDLLTVKVGDTVR------VPVSFEAMPMPEVTWLKDGLPLPKR 609
                    P     + +KD + ++  + V       +    E      + W K        
Sbjct: 23422 EPGPPGTP--FATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTK-------- 23471

Query: 610   SVTVTKDGLTQLLIPVAGLSDSGLY--TVVLRTLQG-KEVAHSFRIRVAACP----QAPG 662
                V K  +         L +   Y   V    + G  + + +    VA  P      P 
Sbjct: 23472 ---VNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPE 23528

Query: 663   PIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAA-DRIHTNRFTLLGI 721
             PI ++ N    +T +W     +   +   Y V  R    G W +A+   +   +FT+ G+
Sbjct: 23529 PIMVKRN---EITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGL 23585

Query: 722   LPGHEYHFRVVAKNELGA-SKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGL 780
                  Y FRV+AKN  GA SKPSD++ P          T K      P +S  P+F   +
Sbjct: 23586 TEDQRYEFRVIAKNAAGAISKPSDSTGP---------ITAKDE-VELPRISMDPKFRDTI 23635

Query: 781   RSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP--AVYSTDLLGVCSLTIPSVSP 838
                ++  G    +   V G P P + W + D+ +E +    + +TD   +  L +     
Sbjct: 23636 ---VVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKAL--LIVKDAIR 23690

Query: 839   KDSGEYKAVAENTLG 853
              D G+Y   A N  G
Sbjct: 23691 IDGGQYILRASNVAG 23705



 Score =  108 bits (269), Expect = 3e-23
 Identities = 184/807 (22%), Positives = 303/807 (37%), Gaps = 106/807 (13%)

Query: 104   TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFV----AGDQQSEATLTVQD 159
             TW K  V L  + G+  K       L   +V    AG+Y        G ++    + V D
Sbjct: 19726 TWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLD 19785

Query: 160   SPTIAPDVTEK---------LREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSS 210
             +P    +VT K           EP ++  G P+I  +  Q     + +W     E   +S
Sbjct: 19786 TPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYV-VQKRDAERKSWSTVTTECSKTS 19844

Query: 211   DREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGP--- 267
              R A ++ G  Y               + V   +E G      T   +     P GP   
Sbjct: 19845 FRVANLEEGKSYF--------------FRVFAENEYGIGDPGETRDAVKASQTP-GPVVD 19889

Query: 268   MEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVE 327
             ++V+   ++   + W+ P  +GG  +  YVV+      + W +V ++   S  ++   + 
Sbjct: 19890 LKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVD-FLTEENKWQRVMKSL--SLQYSAKDLT 19946

Query: 328   PGRKYTFRVRAVTSEGAGEALE----SEEILVAPEALPKAPSAPAILSASSQGITLTWTA 383
              G++YTFRV A    G G   E    + + +VAP+   K    P +   + +        
Sbjct: 19947 EGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLK--GLPDLCYLAKENSNFRLKI 20004

Query: 384   PRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGP 443
             P     A  + +        ++T  +V    V      V D ++    ++ +T    +G 
Sbjct: 20005 PIKGKPAPSVSWKKGEDPLATDTRVSVESSAV-NTTLIVYDCQKSDAGKYTITLKNVAGT 20063

Query: 444   GEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSS 503
              E G  S  V  + P  P G ++  +VT     ++TL WA P    G E   Y++E   S
Sbjct: 20064 KE-GTISIKVVGK-PGIPTGPIKFDEVTAE---AMTLKWAPPKDDGGSEITNYILEKRDS 20118

Query: 504   DSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTV-- 561
              + +W+ C    V  TT+    L  G  Y  RV+A N+ G  +    + +V   P  V  
Sbjct: 20119 VNNKWVTC-ASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPD 20177

Query: 562   --CPKFLVDSSTKDLLTV-----KVGDTVRVPVSFEAMPMPEVTWLK-DGLPLPKRSVTV 613
                P  +VD     +        K G +       E      + W + +  P+  R   V
Sbjct: 20178 APPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKV 20237

Query: 614   TKDGLTQ--------LLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIH 665
             T  GLT+        + I +AG+    L +  +  L   +            P  P  I+
Sbjct: 20238 T--GLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDP-----------PGKPEVIN 20284

Query: 666   LQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTN----RFTLLG 720
             +  N   +VT  W EP  D    +   Y V  R      W +A    H N     FT+  
Sbjct: 20285 ITRN---SVTLIWTEPKYDGGHKL-TGYIVEKRDLPSKSWMKAN---HVNVPECAFTVTD 20337

Query: 721   ILPGHEYHFRVVAKNELGA-SKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVG 779
             ++ G +Y FR+ AKN  GA S PS++++      +          Y  P +   P    G
Sbjct: 20338 LVEGGKYEFRIRAKNTAGAISAPSESTETIICKDE----------YEAPTIVLDPTIKDG 20387

Query: 780   LRSHLLPQGCECCMSC-AVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSP 838
             L    +  G    ++  ++ G P P  +W K  + +  +     T       LTI   + 
Sbjct: 20388 L---TIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATR 20444

Query: 839   KDSGEYKAVAENTLGQAVSTATLIVIE 865
             KD+GEY   A N  G  V    + V++
Sbjct: 20445 KDAGEYTITATNPFGTKVEHVKVTVLD 20471



 Score =  107 bits (267), Expect = 5e-23
 Identities = 149/645 (23%), Positives = 251/645 (38%), Gaps = 86/645 (13%)

Query: 258   IDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPAD 317
             +D  DPP  P EV +  R  V L W  P+ +GG  +  Y+VE+R     +W+K       
Sbjct: 20271 LDPIDPPGKP-EVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVP 20329

Query: 318   STTFTDAHVEPGRKYTFRVRAVTSEGAGEA-LESEEILVAPEALPKAPSAPAIL--SASS 374
                FT   +  G KY FR+RA  + GA  A  ES E ++  +       AP I+      
Sbjct: 20330 ECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEY----EAPTIVLDPTIK 20385

Query: 375   QGITLTWTAPRGPGSAHILGYLIERR---KKGSNTW----TAVNDQPVPERRWTVADVRQ 427
              G+T+         +  ILG  + +    K G +      T +   P      T+    +
Sbjct: 20386 DGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSML-TIKYATR 20444

Query: 428   GCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDT 487
                 E+ +TA  P G          V   D   PPG V   ++++ S    TL+W  P  
Sbjct: 20445 KDAGEYTITATNPFGTKVEHVK---VTVLDVPGPPGPV---EISNVSAEKATLTWTPPLE 20498

Query: 488   QEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQP 547
               G   + Y++E   +  L W       +    + A  L  G  Y  RV+AVN  G+ +P
Sbjct: 20499 DGGSPIKSYILEKRETSRLLWTVVSED-IQSCRHVATKLIQGNEYIFRVSAVNHYGKGEP 20557

Query: 548   SALDTLVQAMPVTVCPKF---------LVDSSTKDLLTVKV------GDTVRVPVSFEAM 592
                   VQ+ PV +  +F          V + TK+  TV        G +       E  
Sbjct: 20558 ------VQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERR 20611

Query: 593   PMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYT--VVLRTLQG----KEV 646
                 + W++             K  ++ L   V GL +   Y   V      G     E 
Sbjct: 20612 EKKSLRWVR-----------AIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEA 20660

Query: 647   AHSFRIRVAACPQAPGPI---HLQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHG 702
             + S  ++ AA P  PGP    H+ +    + +  W +P  D   ++   Y V  +     
Sbjct: 20661 SDSVLMKDAAYP--PGPPSNPHVTDTTKKSASLAWGKPHYDGGLEIT-GYVVEHQKVGDE 20717

Query: 703   PWHE--AADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTV 760
              W +      +   +F +  +    +Y+FR+ A N+ G  +P+       + R+      
Sbjct: 20718 AWIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREM----- 20772

Query: 761   KAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAV 820
              AP +   +L  + R     R+ ++  G    +   ++G P P VTW K++ +L+    +
Sbjct: 20773 -APDF---ELDAELR-----RTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANI 20823

Query: 821   YSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
              +T+   +  L IP  +  D+G++    EN  G+      + V++
Sbjct: 20824 ENTESFTL--LIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLD 20866



 Score =  107 bits (267), Expect = 5e-23
 Identities = 142/642 (22%), Positives = 238/642 (37%), Gaps = 78/642 (12%)

Query: 254   TLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGE 313
             +++  ++P PP G + + D  R  V L W  P  +GG  +  Y+VE +  G   W     
Sbjct: 22042 SVKASERPLPP-GKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATCAT 22100

Query: 314   APADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESE-----EILVAPEALPKAPSAPA 368
                   T T   +  G +Y+FRV A   +G  +  +       + LV P A     +   
Sbjct: 22101 VKVTEATITG--LIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFT 22158

Query: 369   ILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQG 428
             +L+     + + +     P        +  ++    N  +  N+        ++  ++  
Sbjct: 22159 VLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENN--------SLLTIKDA 22210

Query: 429   CQYEFRVTAVA-PSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDT 487
             C+ +     V   +  GE     + +    P  P G V+  +VT     SITLSW  P  
Sbjct: 22211 CREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTA---DSITLSWGPPKY 22267

Query: 488   QEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQP 547
               G     Y+VE   + +  W      TV  TT  A  L+ G  Y  R+ A N  G+S  
Sbjct: 22268 DGGSSINNYIVEKRDTSTTTWQIVSA-TVARTTIKACRLKTGCEYQFRIAAENRYGKSTY 22326

Query: 548   SALDTLVQAMPVTV-----CPKFLVDSSTKDLLTVKVGDTVR------VPVSFEAMPMPE 596
                +  V   P  V      P  +V  S++D + V+  + +       +    E      
Sbjct: 22327 LNSEPTVAQYPFKVPGPPGTP--VVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNS 22384

Query: 597   VTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAA 656
             + W+K           + K  + Q      GL +   Y    R      V      +V+ 
Sbjct: 22385 ILWVK-----------LNKTPIPQTKFKTTGLEEGVEYE--FRVSAENIVGIGKPSKVSE 22431

Query: 657   C---------PQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEA 707
             C         P  P  I +  N   +VT +W+    +       Y V  +    G W +A
Sbjct: 22432 CYVARDPCDPPGRPEAIIVTRN---SVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKA 22488

Query: 708   A-DRIHTNRFTLLGILPGHEYHFRVVAKNELGA-SKPSDTSQPWCIPRQRDRFTVKAPCY 765
             +   I    F + G++  H Y FRV+A+N  G  S+PS+++       + D         
Sbjct: 22489 SFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVD--------- 22539

Query: 766   REPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP--AVYST 823
               P +S  P++   +  H    G    +   + G P P + W K D+ L       + ST
Sbjct: 22540 -PPRISMDPKYKDTIVVHA---GESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKST 22595

Query: 824   DLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
             D     SL++      DSG Y   A+N  G+   T  + V++
Sbjct: 22596 DF--ATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLD 22635



 Score =  106 bits (264), Expect = 1e-22
 Identities = 186/816 (22%), Positives = 293/816 (35%), Gaps = 93/816 (11%)

Query: 104   TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTI 163
             +W KDG ++   D +  K D +   L +       AG YT    ++   AT ++      
Sbjct: 14419 SWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIG 14478

Query: 164   APDVTEKLREPLVVKAGKPVIVKIP-FQSHLPI--QAAWRKDGAEVVGSSDREAQVDLGD 220
              P   + ++   + K+   +  + P F    PI      R++       + R   + +  
Sbjct: 14479 LPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERRE-------AGRRTYIPVMS 14531

Query: 221   GYTRLCLPSAGRKDCGQYSVTLRS---EGGSVQAELTLQVI--DKPDPPQGP--MEVQDC 273
             G  +L          G+Y   +++    GG    EL   VI  D   PP  P  +EV + 
Sbjct: 14532 GENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNP 14591

Query: 274   HRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYT 333
                 + + W+PP  +GG  +  Y++E+   G   W +  E      T+T   +E G++Y 
Sbjct: 14592 TAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQ 14651

Query: 334   FRVRAVTSEGAGE------ALESEEILVAPEALPKAP-----SAPAILSASSQGI---TL 379
             FRVRA  + G  E        ++ + + AP+ + +            L AS  G    T+
Sbjct: 14652 FRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYPTI 14711

Query: 380   TWTAPRG---PGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVT 436
             TW        P         + RR+KG          P+ +R       +   Q   R +
Sbjct: 14712 TWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDS 14771

Query: 437   AVAPSGPGEPGPPSDAVFARDP-----MRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGD 491
                  G       +D   A+ P     +  PG   N    D   TS+   W  P    G 
Sbjct: 14772 LRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGS 14831

Query: 492   EAQGYVVEL--CSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSA 549
             E   Y +E    +    +W+     T+    Y+   L  G+ Y  RV A N  G   P  
Sbjct: 14832 EIINYTLEKKDKTKPDSEWIVV-TSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCV 14890

Query: 550   LDTLVQAMPV---TVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPL 606
                LV   P        K +V+  T + + VK  +           P+        G  L
Sbjct: 14891 SKPLVAKDPFGPPDAPDKPIVEDVTSNSMLVKWNEP-----KDNGSPIL-------GYWL 14938

Query: 607   PKRSVT------VTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQA 660
              KR V       V K  L  L   V GL +    T V R    +  A   +    + P+ 
Sbjct: 14939 EKREVNSTHWSRVNKSLLNALKANVDGLLEG--LTYVFRVC-AENAAGPGKFSPPSDPKT 14995

Query: 661   -------PGP--IHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADR- 710
                    PGP    + +    T+  EWEP         + Y V  +      W    ++ 
Sbjct: 14996 AHDPISPPGPPIPRVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKM 15055

Query: 711   IHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDL 770
             I   ++T+  I  G +Y  RV A N  G   P +T QP  +   ++      P   E D+
Sbjct: 15056 IKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGET-QPVTVAEPQE------PPAVELDV 15108

Query: 771   SQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCS 830
             S K     G++   +  G    +   V G P P   W K +  L+ +  V   D +G  S
Sbjct: 15109 SVKG----GIQ---IMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVV--IDNVGTKS 15159

Query: 831   -LTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
              L I     KD G Y   A N+ G   + A + V +
Sbjct: 15160 ELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFD 15195



 Score =  103 bits (256), Expect = 9e-22
 Identities = 176/829 (21%), Positives = 298/829 (35%), Gaps = 139/829 (16%)

Query: 107   KDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPD 166
             KDGV    +D  +   +     + I   + +  G+Y+  A ++  + T   +      P 
Sbjct: 15855 KDGVHDIPEDAQLETAENS-SVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPG 15913

Query: 167   VTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLC 226
               + L+   + +    +  K+P             DG + +     E +   G  +T++ 
Sbjct: 15914 PPKDLKVSDITRGSCRLSWKMPDD-----------DGGDRIKGYVIEKRTIDGKAWTKV- 15961

Query: 227   LPSAGRKDCG-------------QYSVTLRSEGG--------SVQAELTLQVIDKPDPPQ 265
                    DCG             QY   +R+E          ++Q       I  PDPP 
Sbjct: 15962 -----NPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPPI 16016

Query: 266   GPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVE-----RRQAGRSTWLKVGEAPADSTT 320
               +++    +  V L W+PP+++GG  V  Y+VE          +  W +  +   +   
Sbjct: 16017 -KLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQ 16075

Query: 321   FTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAI----------- 369
             FT   +  G +Y FRV+AV + G  +   +    V P    +    P+I           
Sbjct: 16076 FTVEDLVEGGEYEFRVKAVNAAGVSKPSAT----VGPCDCQRPDMPPSIDLKEFMEVEEG 16131

Query: 370   ----LSASSQGI---TLTW--TAPRGPGSAHILGYLIERRKKG-SNTWTAVNDQPVPERR 419
                 + A  +G+   TLTW    P+ P +   + Y     K    +T T V    +P+ R
Sbjct: 16132 TNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLV----IPQSR 16187

Query: 420   ------WTVADVRQ--GCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVT 471
                   +T+  V        E R+  +     G PGPP               V  ++  
Sbjct: 16188 RSDTGLYTITAVNNLGTASKEMRLNVL-----GRPGPP---------------VGPIKFE 16227

Query: 472   DRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVT-TYTAKGLRPGE 530
               S   +TLSW  P    G +   YV+E   ++   W+  HV + P   TYT   L  G 
Sbjct: 16228 SVSADQMTLSWFPPKDDGGSKITNYVIEKREANRKTWV--HVSSEPKECTYTIPKLLEGH 16285

Query: 531   GYFVRVTAVNEGGQSQP--SALDTLVQAMPVTVCP-KFLVDSSTKDLLTVKVGDTVRVPV 587
              Y  R+ A N+ G  +P  S  +T      V   P K  V S T++ +TV   +      
Sbjct: 16286 EYVFRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEP----- 16340

Query: 588   SFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVA----GLSDSGLYTVVLRTLQG 643
              ++        WL+      KR   V +D +  + + V+    GL +   Y   +  +  
Sbjct: 16341 EYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINA 16400

Query: 644   KEVAHSF------RIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTR 697
               V  +         R    P  P    + +    +   EW P   +       Y V  +
Sbjct: 16401 AGVGPASLPSDPATARDPIAPPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYK 16460

Query: 698   SSAHGPWHEAADR-IHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRD 756
                   W +  D+ +   +  + G+  G  Y FRV A N  G  +P + +    +   +D
Sbjct: 16461 EEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTD---VIEMKD 16517

Query: 757   RFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEG 816
             R          PDL         +  H    G    +   V G P P VTW  N+R+L  
Sbjct: 16518 RLV-------SPDLQLDASVRDRIVVHA---GGVIRIIAYVSGKPPPTVTWNMNERTLPQ 16567

Query: 817   NPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
                + +T +    S+ I +      G Y  +A+N  G+   T  + V++
Sbjct: 16568 EATIETTAISS--SMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLD 16614



 Score =  102 bits (255), Expect = 1e-21
 Identities = 154/678 (22%), Positives = 257/678 (37%), Gaps = 84/678 (12%)

Query: 228   PSAGRKDCGQYSV---TLRSEGGSVQAELTLQVIDK-PDPPQGPMEVQDCHRAGVCLRWR 283
             P AG  +  +YS     L   G S  ++ T  V  + P  P G  EV D  ++ V L W 
Sbjct: 19152 PCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIWA 19211

Query: 284   PPRDNGGRTVECYVVERRQAGRSTWLKVGEAPAD--STTFTDAHVEPGRKYTFRVRAVTS 341
              P+ +GG  +  Y VE  +     W++   AP       +T   +E   +Y FR  A T+
Sbjct: 19212 RPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTA 19271

Query: 342   EGAGEALE-SEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERR 400
                    E S+ + +  E +P     P I  + +    LT  A    G+   L   +  +
Sbjct: 19272 VNISPPSEPSDPVTILAENVP-----PRIDLSVAMKSLLTVKA----GTNVCLDATVFGK 19322

Query: 401   KKGSNTWTAVNDQPVPERRWTVADVRQGCQYE-----------FRVTAVAPSGPGEPGPP 449
                + +W        P     +A  R  C  E           + +TA   SG       
Sbjct: 19323 PMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGS------ 19376

Query: 450   SDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWL 509
               A      +  PG   ++++    +    LSW  P    G E   Y+V+   +    W 
Sbjct: 19377 KSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWA 19436

Query: 510   PCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTV---CPKFL 566
                  TVP+T+ + + L  G  Y  R+ A N+ G   P   +  +   P      C   +
Sbjct: 19437 QVSA-TVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDPPV 19495

Query: 567   VDSSTKDLLTVK---VGDTVRVPVS---FEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQ 620
             + + TKD +TV      D    P++    E      V W K           V +  + +
Sbjct: 19496 ISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTK-----------VNRKPIIE 19544

Query: 621   LLIPVAGLSDSGLY----TVVLRTLQGKEVAHSFRIRVAACPQ-APGPI---HLQENVPG 672
               +   GL +   Y    T + +   GK  + + +   A  PQ  PGP     + +    
Sbjct: 19545 RTLKATGLQEGTEYEFRVTAINKAGPGKP-SDASKAAYARDPQYPPGPPAFPKVYDTTRS 19603

Query: 673   TVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEA--ADRIHTNRFTLLGILPGHEYHF 729
             +V+  W +P+ D    + + Y V  + +    W        +   RF + G++   +Y F
Sbjct: 19604 SVSLSWGKPAYDGGSPI-IGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLMEDTQYQF 19662

Query: 730   RVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGC 789
             RV A N++G S PSD      +P +     +  P   E D   +       ++ +L  G 
Sbjct: 19663 RVYAVNKIGYSDPSD------VPDKHYPKDILIPPEGELDADLR-------KTLILRAGV 19709

Query: 790   ECCMSCAVQGSPRPHVTWFKNDRSLEGNPA--VYSTDLLGVCSLTIPSVSPKDSGEYKAV 847
                +   V+G P P +TW K + +L       + STD      L   +V+  D+G+Y   
Sbjct: 19710 TMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDF--DTFLRCENVNKYDAGKYILT 19767

Query: 848   AENTLGQAVSTATLIVIE 865
              EN+ G+   T  + V++
Sbjct: 19768 LENSCGKKEYTIVVKVLD 19785



 Score =  102 bits (253), Expect = 2e-21
 Identities = 167/782 (21%), Positives = 280/782 (35%), Gaps = 102/782 (13%)

Query: 128   SLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKI 187
             SL I +     +G+YT    +  S A+LT+       P     +    V K    +   +
Sbjct: 26241 SLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDV 26300

Query: 188   PFQSHLPIQAAWRKDGAEVVGS-------SDREAQVDLGDGYTRLCLPSAGRKDCGQYSV 240
             P             DG   V +       + ++A V + +   RL       ++   Y  
Sbjct: 26301 P-----------ENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYF 26349

Query: 241   TLRSE---GGSVQAELT--LQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVEC 295
              +  E   G  + AE    +++ +KP PP+  + V    +  V L W  P  +GG  +  
Sbjct: 26350 RVSGENEFGVGIPAETKEGVKITEKPSPPE-KLGVTSISKDSVSLTWLKPEHDGGSRIVH 26408

Query: 296   YVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALES----- 350
             YVVE  + G+  W+K   A A ST    + +    +Y FRV A    G  +  E      
Sbjct: 26409 YVVEALEKGQKNWVKC--AVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVL 26466

Query: 351   -EEILVAPEA-LPKAPSAPAILSASSQ-GITLTWTAPRGPGSAHILGYLIERRKKGSNTW 407
              +E L  PE  +   PS    + A S   + +  +    P        +  +     NT 
Sbjct: 26467 IKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTE 26526

Query: 408   TAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGE----------PGPPSDAVFARD 457
                 +  +  +    AD  +     + +TA   SG  +          PGPP+  V    
Sbjct: 26527 ITAENLTINLKESVTADAGR-----YEITAANSSGTTKAFINIVVLDRPGPPTGPVV--- 26578

Query: 458   PMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVP 517
                         ++D +  S+TL W  P    G +   Y++    + +  W      TV 
Sbjct: 26579 ------------ISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSA-TVA 26625

Query: 518   VTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVC---PKFLVDSSTKDL 574
              T      L  GE Y  R+ A N  G S       +   +P T         V + T++ 
Sbjct: 26626 RTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPPSTPWVTNVTRES 26685

Query: 575   LTV------KVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGL 628
             +TV        G +  V    E      + W K      K  +  T   +T +    AGL
Sbjct: 26686 ITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKAN----KLVIRTTHFKVTTIS---AGL 26738

Query: 629   SDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDV 688
                           GK    S  +      + P  + + +    +V+  W+    +    
Sbjct: 26739 IYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSK 26798

Query: 689   PLHYAVFTRSSAHGPWHEAA-DRIHTNRFTLLGILPGHEYHFRVVAKNELGA-SKPSDTS 746
                Y V  R    G W +A+   +   +F + G+    +Y FRV A+N +G+ S PS+  
Sbjct: 26799 ITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVV 26858

Query: 747   QP-WCIPRQRDRFTVKAPCYREP--DLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRP 803
              P  CI             Y  P  DL  +   +V  R+     G    +   + G P P
Sbjct: 26859 GPITCIDS-----------YGGPVIDLPLEYTEVVKYRA-----GTSVKLRAGISGKPAP 26902

Query: 804   HVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
              + W+K+D+ L+ N  V   +   + S+ I      +SG Y+    N +G A +T  + +
Sbjct: 26903 TIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQI 26962

Query: 864   IE 865
             ++
Sbjct: 26963 LD 26964



 Score =  101 bits (252), Expect = 3e-21
 Identities = 191/808 (23%), Positives = 287/808 (35%), Gaps = 99/808 (12%)

Query: 104   TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTV----QD 159
             TW K G+ L ++   I         L +  V    AG+YT  A +Q  + + TV     D
Sbjct: 29479 TWSKQGIDLASR--AIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYD 29536

Query: 160   SPTIAPDVTEK--LREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGS---SDREA 214
             +P   P V  K   R+ + +    P I                 DG   V +     REA
Sbjct: 29537 TPGPCPSVKVKEVSRDSVTITWEIPTI-----------------DGGAPVNNYIVEKREA 29579

Query: 215   QVDLGDGYTRLCLPS----AGRKDCGQYSVTLRSE-----GGSVQAELTLQVIDKPDPPQ 265
              +      T  C  +    +G  +   Y   +  E     G   +    + V + P  P 
Sbjct: 29580 AMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVP- 29638

Query: 266   GPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAH 325
               +EV D  ++ V L W  P  +GG  +  YV+E  +AG   W+KV          T   
Sbjct: 29639 AKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTS 29698

Query: 326   VEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPR 385
             +  G +Y FR+RA   +G  E  E+    V  + L   P+    LS   Q    T   P 
Sbjct: 29699 LNEGEQYLFRIRAQNEKGVSEPRET-VTAVTVQDLRVLPTID--LSTMPQ---KTIHVPA 29752

Query: 386   GPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSG--- 442
             G     ++   I  R   + +W     +     R TV    +  +   R T +  +G   
Sbjct: 29753 GRPVELVIP--IAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYT 29810

Query: 443   ------PGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGY 496
                    G        +    P  P G ++   + +   TSIT+SW  P+   G    GY
Sbjct: 29811 LELKNVTGTTSETIKVIILDKPGPPTGPIK---IDEIDATSITISWEPPELDGGAPLSGY 29867

Query: 497   VVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGG-----QSQPSALD 551
             VVE   +    WLP    +V  +T+    L  G  Y  RV A N  G     QS+     
Sbjct: 29868 VVEQRDAHRPGWLPVS-ESVTRSTFKFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIECR 29926

Query: 552   TLVQAM-PVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEV---TWLKDGLPLP 607
             + ++   P      F V      L      D     V+   +   EV    W++    + 
Sbjct: 29927 SSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVR----VN 29982

Query: 608   KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQ 667
             K  VT+T+   T L     GL      T +     GK    S  I VA  P AP      
Sbjct: 29983 KVPVTMTRYRSTGL---TEGLEYEHRVTAINARGSGKPSRPSKPI-VAMDPIAPPGKPQN 30038

Query: 668   ENVPGT----VTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEA-ADRIHTNRFTLLGIL 722
               V  T    V+  W    DE       Y +  +      W +          +TL  + 
Sbjct: 30039 PRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREYTLTHLP 30098

Query: 723   PGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYRE-PDLSQKPRFLVGLR 781
              G EY FRV+A N  G  +P++              TVK     E PD     R+  G+ 
Sbjct: 30099 QGAEYRFRVLACNAGGPGEPAEVPG-----------TVKVTEMLEYPDYELDERYQEGI- 30146

Query: 782   SHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDS 841
                + QG    ++  ++G P P   W K  + +     + +++      L I      DS
Sbjct: 30147 --FVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSET--HTELVIKEADRGDS 30202

Query: 842   GEYKAVAENTLG-QAVSTATLIVIEPST 868
             G Y  V EN  G +AV     ++  P++
Sbjct: 30203 GTYDLVLENKCGKKAVYIKVRVIGSPNS 30230



 Score =  100 bits (248), Expect = 8e-21
 Identities = 149/651 (22%), Positives = 247/651 (37%), Gaps = 79/651 (12%)

Query: 246   GGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGR 305
             G  V+    ++  + P PP G + + D  +    L W  P  +GG  V  YVVE +  G 
Sbjct: 24198 GVPVETVDAVKAAEPPSPP-GKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGT 24256

Query: 306   STWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGA------GEALESEEILVAPEA 359
               W  V E+   +   T   +  G++Y FRV+A   +G       G  + ++++ + P  
Sbjct: 24257 EKWSIVAESKVCNAVVTG--LSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSL 24314

Query: 360   LPKAP-SAPAILSASSQGITLTWTAPRGPGSAHIL-GYLIERRKKGSNTWTAVNDQPVPE 417
               K P +  +I +     I +       P  + +  G  +++  + +   TA +      
Sbjct: 24315 --KLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATS------ 24366

Query: 418   RRWTVADVRQGCQYEF-RVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNT 476
                TV  +++G + +F + T  A +  G        +    P  P G VR  +V   S  
Sbjct: 24367 ---TVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEV---SAD 24420

Query: 477   SITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHV--GTVPVTTYTAKGLRPGEGYFV 534
              + +SW  P    G +   Y+VE   + +  W   H+   TV  TT     L+ G  Y  
Sbjct: 24421 FVVISWEPPAYTGGCQISNYIVEKRDTTTTTW---HMVSATVARTTIKITKLKTGTEYQF 24477

Query: 535   RVTAVNEGGQSQPSALDTLVQAMPVTVC----PKFLVDSSTKDLLT-----VKVGDTVRV 585
             R+ A N  G+S P     ++   P          F+   S   +L      V  G T  +
Sbjct: 24478 RIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKII 24537

Query: 586   PVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGL---YTVVLRTLQ 642
                 E      + W+K    L K  +  TK   T L        D GL   + V    + 
Sbjct: 24538 GYHLEQKEKNSILWVK----LNKTPIQDTKFKTTGL--------DEGLEYEFKVSAENIV 24585

Query: 643   G----KEVAHSFRIRVAACPQA-PGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTR 697
             G     +V+  F  R    P   P  I +  N    VT +W+    +       Y V  +
Sbjct: 24586 GIGKPSKVSECFVARDPCDPPGRPEAIVITRN---NVTLKWKKPAYDGGSKITGYIVEKK 24642

Query: 698   SSAHGPWHEAA-DRIHTNRFTLLGILPGHEYHFRVVAKNELGA-SKPSDTSQPWCIPRQR 755
                 G W +A+   +    FT+ G++    Y FRV+A+N  G  S+PSD+S       + 
Sbjct: 24643 DLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEI 24702

Query: 756   DRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLE 815
             D           P+ S  P++   +  H    G    +   ++G P P V W K+ + LE
Sbjct: 24703 DA----------PNASLDPKYKDVIVVHA---GETFVLEADIRGKPIPDVVWSKDGKELE 24749

Query: 816   GNPA-VYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
                A +     +   +L +      D G+Y     N  G      T+ V++
Sbjct: 24750 ETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLD 24800



 Score = 99.8 bits (247), Expect = 1e-20
 Identities = 144/687 (20%), Positives = 255/687 (37%), Gaps = 87/687 (12%)

Query: 105   WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTV------Q 158
             W KDG  L     V       V SL I        G Y     +     T+ +      +
Sbjct: 25428 WRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDR 25487

Query: 159   DSPTIAPDVTEKLREPLVVKAGKP------VIVKIPFQSHLPIQAAWRKDGAEVVGSSDR 212
               P     + E   + + +    P       I     +        W      V  +S +
Sbjct: 25488 PGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSIK 25547

Query: 213   EAQVDLGDGYT-RLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQ 271
               ++  G  Y  R+C  +       +Y  +  SE  +V AE        P  P G  +V 
Sbjct: 25548 IVRLTTGSEYQFRVCAEN-------RYGKSSYSESSAVVAEYPF----SPPGPPGTPKVV 25596

Query: 272   DCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRK 331
                ++ + + W+ P ++GG  V  Y +E ++     W K  +     T    + ++ G  
Sbjct: 25597 HATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLM 25656

Query: 332   YTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAH 391
             Y +RV A    G G+  +S E + A +     P  P + + + + ++L W+ P   G A 
Sbjct: 25657 YEYRVYAENIAGIGKCSKSCEPVPARDPC-DPPGQPEVTNITRKSVSLKWSKPHYDGGAK 25715

Query: 392   ILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTA-VAPSGPGEPGPPS 450
             I GY++ERR+     W   N   + E  + V ++ +  +YEFRV A  A     EP   +
Sbjct: 25716 ITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSEST 25775

Query: 451   DAVFARDPMRPPGLVRNLQVTD----------RSNTSI------TLSWAGPDTQEGDEAQ 494
               +  +D + PP ++ +++  D          + N  I       +SWA    +  + A+
Sbjct: 25776 GPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERAR 25835

Query: 495   GYVVELCSSDSLQWLPCHVGTVPVTTYTAKG-LRPGEGYFVRVTAVNEGGQSQPSALDTL 553
                 E+ S+D+             T  T K  +R   G +V +T  N  G ++  A++  
Sbjct: 25836 ---TEIISTDN------------HTLLTVKDCIRRDTGQYV-LTLKNVAG-TRSVAVNCK 25878

Query: 554   VQAMPVTVCPKFLVDSSTKDLLTVKVG---DTVRVPVSFEAMPMPEVTWL-----KDGLP 605
             V   P        ++  T +  ++  G   +     + +  +   E + L     +  L 
Sbjct: 25879 VLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQ 25938

Query: 606   LPKRSVTVTKDGLTQLLIPVAGLSDSG----LYTVVLRTLQGKEVAHSFRIRVAACPQAP 661
             +    VT    G  + +  V G++  G    L +V ++ L    V           P  P
Sbjct: 25939 MTSCKVTKLLKG-NEYIFRVTGVNKYGVGEPLESVAIKALDPFTV-----------PSPP 25986

Query: 662   GPIHLQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADR-IHTNRFTLL 719
               + +      ++T  W  P  D   ++   Y +  R      W     + ++  R    
Sbjct: 25987 TSLEITSVTKESMTLCWSRPESDGGSEIS-GYIIERREKNSLRWVRVNKKPVYDLRVKST 26045

Query: 720   GILPGHEYHFRVVAKNELGASKPSDTS 746
             G+  G EY +RV A+N  G S PS+TS
Sbjct: 26046 GLREGCEYEYRVYAENAAGLSLPSETS 26072



 Score = 99.4 bits (246), Expect = 1e-20
 Identities = 86/303 (28%), Positives = 136/303 (44%), Gaps = 23/303 (7%)

Query: 74    HFSQGLADMEVQPGEAATLSCTLTSDLGP-GTWFKDGVKLTTQDGVIFKQD---GLVHSL 129
             HF + L ++ V+    ATL C +T    P   W++ G ++   DG+ ++     G  H L
Sbjct: 30929 HFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIA-DGLKYRIQEFKGGYHQL 30987

Query: 130   FITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKA--------GK 181
              I  V    A  Y   A +Q      +V  + ++  +V  K+  P  ++         G+
Sbjct: 30988 IIASVTDDDATVYQVRATNQGG----SVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGE 31043

Query: 182   PVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPS-AGRKDCGQYSV 240
              V +KIPF         W+K G +++  ++   QV +   +T L  P+   RKD G Y V
Sbjct: 31044 VVSIKIPFSGKPDPVITWQK-GQDLI-DNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVV 31101

Query: 241   TLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVER 300
               ++  G  Q  + L V D PDPP+G ++V D  R  V L W  P  +GG  +  Y+VE+
Sbjct: 31102 CAKNRFGIDQKTVELDVADVPDPPRG-VKVSDVSRDSVNLTWTEPASDGGSKITNYIVEK 31160

Query: 301   RQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEAL 360
                    WL+VG+  A  T +T  ++     Y FRV A    G  +  E  E  +  E  
Sbjct: 31161 CATTAERWLRVGQ--ARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDK 31218

Query: 361   PKA 363
              +A
Sbjct: 31219 TRA 31221



 Score = 98.6 bits (244), Expect = 2e-20
 Identities = 93/395 (23%), Positives = 157/395 (39%), Gaps = 28/395 (7%)

Query: 84    VQPGEAATLSCTLTSDLGPG-TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRY 142
             +Q GE   +   +     P  +W KDG  L     V  ++      L I        G+Y
Sbjct: 24323 IQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKY 24382

Query: 143   TFVAGDQQSEAT------LTVQDSPTIAPDVTEKLREPLVVKAGKP-------VIVKIPF 189
             T  A +    AT      +  +  P + P   +++    VV + +P        I     
Sbjct: 24383 TVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIV 24442

Query: 190   QSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYT-RLCLPSAGRKDCGQYSVTLRSEGGS 248
             +        W    A V  ++ +  ++  G  Y  R+   +   K     S  L S+   
Sbjct: 24443 EKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGK-----SAPLDSKAVI 24497

Query: 249   VQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTW 308
             VQ         +P PP  P  V    +  + ++W  P ++GG  +  Y +E+++     W
Sbjct: 24498 VQ-----YPFKEPGPPGTPF-VTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILW 24551

Query: 309   LKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPA 368
             +K+ + P   T F    ++ G +Y F+V A    G G+  +  E  VA +     P  P 
Sbjct: 24552 VKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPC-DPPGRPE 24610

Query: 369   ILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQG 428
              +  +   +TL W  P   G + I GY++E++      W   +   V E  +TV+ + + 
Sbjct: 24611 AIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVED 24670

Query: 429   CQYEFRVTAVAPSGP-GEPGPPSDAVFARDPMRPP 462
              +YEFRV A   +G   EP   S A+ ARD +  P
Sbjct: 24671 QRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAP 24705



 Score = 95.5 bits (236), Expect = 2e-19
 Identities = 148/634 (23%), Positives = 251/634 (39%), Gaps = 62/634 (9%)

Query: 259   DKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADS 318
             ++P PP+  ++V D  ++   L W  P  +GG  +  Y++E RQ G   W++ G      
Sbjct: 28544 EQPAPPRR-LDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHTK--Q 28600

Query: 319   TTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGIT 378
              TFT   +    +Y FRV+A    G  E  E+   ++  E  P+      +   ++Q IT
Sbjct: 28601 LTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKE--PQIEPTADLTGITNQLIT 28658

Query: 379   LTWTAP-------RGPGSAHILGYLIERRKKGSN--TWTAVNDQPVPERRWTVADVRQGC 429
                 +P        G  +  +   L E R K ++  + T   D+       TV D  +G 
Sbjct: 28659 CKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTT----LTVKDSMRGD 28714

Query: 430   QYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQE 489
                + +T          G  + +V      RP  +   ++V+  S  S  LSW  P    
Sbjct: 28715 SGRYFLTL-----ENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGG 28769

Query: 490   GDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSA 549
             G E   Y+VE   S +  W   +  +V  T      L     Y  RV++ N  G S+P  
Sbjct: 28770 GTEITNYIVEKRESGTTAWQLVN-SSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE 28828

Query: 550   LDTLVQA---MPVTVCPKFLVDSSTKDLLTVKV------GDTVRVPVSFEAMPMPEVTWL 600
                ++     +P +   +  V   + + ++++       G +  +    E      + W+
Sbjct: 28829 SAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWV 28888

Query: 601   KDG-LPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACP- 658
             K+  +P  + +  VT  GL + L       +    T  L      + + + R  +A  P 
Sbjct: 28889 KENKVPCLECNYKVT--GLVEGL-------EYQFRTYALNAAGVSKASEASRPIMAQNPV 28939

Query: 659   QAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAH---GPWHEAADRIHT-N 714
              APG   + +    TV+  W     +     + Y +  +  +    G W +    I + N
Sbjct: 28940 DAPGRPEVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDN 28999

Query: 715   RFTLLGILPGHEYHFRVVAKNELGA-SKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQK 773
              FT+  +  G  Y FRV+AKN  G  SK S+++ P      RD +   AP   E D ++ 
Sbjct: 29000 FFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTC---RDEY---APPKAELD-ARL 29052

Query: 774   PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTI 833
                LV +R+     G +  +  AV G P P + W K D+ L+    V         +  I
Sbjct: 29053 HGDLVTIRA-----GSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVI 29107

Query: 834   PSVSPKDSGEYKAVAENTLG-QAVSTATLIVIEP 866
                   DSG+Y    +N  G +AVS    ++  P
Sbjct: 29108 KFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSP 29141



 Score = 94.0 bits (232), Expect = 5e-19
 Identities = 147/632 (23%), Positives = 240/632 (37%), Gaps = 61/632 (9%)

Query: 259   DKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADS 318
             D  DPP  P  +    R  + L+W  P  +GG  +  Y+VE+R      W+K        
Sbjct: 23519 DPCDPPGTPEPIM-VKRNEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIE 23577

Query: 319   TTFTDAHVEPGRKYTFRVRAVTSEGA-GEALESEEILVAPEA--LPKAPSAPAILSAS-- 373
             T FT + +   ++Y FRV A  + GA  +  +S   + A +   LP+    P        
Sbjct: 23578 TQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVV 23637

Query: 374   SQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVR-QGCQYE 432
             + G T    A         + +L   ++   +    + +            +R  G QY 
Sbjct: 23638 NAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYI 23697

Query: 433   FRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDE 492
              R + VA    G    P +      P  P G V   QVT  ++   +L+W+ P    G +
Sbjct: 23698 LRASNVA----GSKSFPVNVKVLDRPGPPEGPV---QVTGVTSEKCSLTWSPPLQDGGSD 23750

Query: 493   AQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDT 552
                YVVE   +  L W       V  +    K L  G  Y  R+ AVN+ G  +P     
Sbjct: 23751 ISHYVVEKRETSRLAWTVVASEVVTNSLKVTK-LLEGNEYVFRIMAVNKYGVGEPLESAP 23809

Query: 553   LVQAMPVTVC--PKFL-VDSSTKDLLTV------KVGDTVRVPVSFEAMPMPEVTWLKDG 603
             ++   P  +   PK L V +  KD +TV        G +  +    E      + W+K  
Sbjct: 23810 VLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIK-- 23867

Query: 604   LPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYT--VVLRTLQGKEVAHSFRIRVAACPQA- 660
                        K  +T L + V GL++   Y   V      G        +   AC    
Sbjct: 23868 ---------CNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVF 23918

Query: 661   -PGP---IHLQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADR--IHT 713
              PGP    H+ +    ++T  W +P  D   ++ L Y V    +    W     +  +  
Sbjct: 23919 KPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEI-LGYVVEICKADEEEWQIVTPQTGLRV 23977

Query: 714   NRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQK 773
              RF +  +    EY  RV A N++G  +   TS P  + +  D+  ++AP   E DL  +
Sbjct: 23978 TRFEISKLTEHQEYKIRVCALNKVGLGEA--TSVPGTV-KPEDK--LEAP---ELDLDSE 24029

Query: 774   PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTI 833
              R  + +R+     G    +    +G P P +TW + +   E    V     +    L+I
Sbjct: 24030 LRKGIVVRA-----GGSARIHIPFKGRPTPEITWSREEG--EFTDKVQIEKGVNYTQLSI 24082

Query: 834   PSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
              +    D+G+Y    EN+ G   +  T+ V++
Sbjct: 24083 DNCDRNDAGKYILKLENSSGSKSAFVTVKVLD 24114



 Score = 94.0 bits (232), Expect = 5e-19
 Identities = 146/640 (22%), Positives = 231/640 (36%), Gaps = 76/640 (11%)

Query: 259   DKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADS 318
             D  DPP  P E     R  V L+W+ P  +GG  +  Y+VE++      W+K        
Sbjct: 24601 DPCDPPGRP-EAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLE 24659

Query: 319   TTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGIT 378
             T FT + +   ++Y FRV  +    AG   E  +   A  A  +  +  A L    + + 
Sbjct: 24660 TEFTVSGLVEDQRYEFRV--IARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVI 24717

Query: 379   LTWTAPRGPGSAHILGYLI------ERRKKGSNTWTAVNDQPVPERRWTVAD--VR-QGC 429
             +          A I G  I      +  K+   T   +  +   ++   V    +R  G 
Sbjct: 24718 VVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGG 24777

Query: 430   QYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQE 489
             QY  +++ V     G    P        P  P G    L+VT  +     L+W  P    
Sbjct: 24778 QYILKLSNVG----GTKSIPITVKVLDRPGPPEG---PLKVTGVTAEKCYLAWNPPLQDG 24830

Query: 490   GDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSA 549
             G     Y++E   +  L W       V    Y    L PG  Y  RV AVN+ G  +P  
Sbjct: 24831 GANISHYIIEKRETSRLSWTQVST-EVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEP-- 24887

Query: 550   LDTLVQAMPVTVCPKFL---------VDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWL 600
                 +++ PVT C  +          V + TKD + V             A P+ +    
Sbjct: 24888 ----LESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTW-----------ARPVDDGGTE 24932

Query: 601   KDGLPLPKRS------VTVTKDGLTQLLIPVAGLSDSGLYT--VVLRTLQGKEVAHSFRI 652
              +G  L KR           K  LT L + V GL++   Y   V      G        +
Sbjct: 24933 IEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSV 24992

Query: 653   RVAAC-----PQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEA 707
                AC     P  P    + +    +V+  W     +       Y V  + +A   W   
Sbjct: 24993 FYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTC 25052

Query: 708   ADR--IHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCY 765
                  +   +FT+  +    EY+FR+ A N  G  +P+  + P  +  Q     ++ P  
Sbjct: 25053 TPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPA--TLPGSVVAQE---RIEPP-- 25105

Query: 766   REPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDL 825
              E +L    R +V LR+    +     +   ++G P P V W K +  L     +  T  
Sbjct: 25106 -EIELDADLRKVVVLRASATLR-----LFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSS 25159

Query: 826   LGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
               +  L I +V+  DSG Y    EN  G   +   + V++
Sbjct: 25160 FTM--LVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLD 25197



 Score = 87.0 bits (214), Expect = 7e-17
 Identities = 146/659 (22%), Positives = 230/659 (34%), Gaps = 113/659 (17%)

Query: 258   IDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPAD 317
             +D  DPP  P+ + +  R  V L+W  P   GG  +  Y+VE+R      WLK   +   
Sbjct: 21354 LDPIDPPGKPVPL-NITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNIL 21412

Query: 318   STTFTDAHVEPGRKYTFRVRAVTSEGA-------GEALESEEILVAPE----------AL 360
                FT + +     Y FRV A  + GA        +A+   + + AP+           +
Sbjct: 21413 ENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVI 21472

Query: 361   PKAPSA-----------PAILSASSQGITLTWTAPRGPGSAHILGYLIE----RRKKGSN 405
              KA  A           P  +  S  G  L  TA      A     L+     RR  G+ 
Sbjct: 21473 LKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAY 21532

Query: 406   TWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLV 465
             T TA N     +  + V  + +                  PGPP                
Sbjct: 21533 TLTATNPGGFAKHIFNVKVLDR------------------PGPPEGP------------- 21561

Query: 466   RNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKG 525
               L VT+ ++    LSW  P    G +   Y+V+   +  L W       V VT      
Sbjct: 21562 --LAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNV-ASEVQVTKLKVTK 21618

Query: 526   LRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVC--PKFL-VDSSTKDLLTV----- 577
             L  G  Y  RV AVN+ G  +P   + ++   P      PK   V + TKD + V     
Sbjct: 21619 LLKGNEYIFRVMAVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHP 21678

Query: 578   -KVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYT- 635
                G +  +    E        W+K             K  LT L   V+GL++   Y  
Sbjct: 21679 DSDGGSEIINYIVERRDKAGQRWIK-----------CNKKTLTDLRYKVSGLTEGHEYEF 21727

Query: 636   -VVLRTLQGKEVAHSFRIRVAAC-----PQAPGPIHLQENVPGTVTAEW-EPSPDEAQDV 688
              ++     G            AC     P  PG   + +    +++  W +P  D   ++
Sbjct: 21728 RIMAENAAGISAPSPTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEI 21787

Query: 689   PLHYAVFTRSSAHGPWHEAADR--IHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS 746
                Y V         W        +    +T+ G+    EY  R+ A N  G  +P+   
Sbjct: 21788 T-GYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVP 21846

Query: 747   QPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVT 806
                  P+  DR         E +L    R +V +R+      C   +   ++G P P V 
Sbjct: 21847 GT---PKAEDRMLPP-----EIELDADLRKVVTIRAC-----CTLRLFVPIKGRPAPEVK 21893

Query: 807   WFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
             W ++        ++ ST    +  L + +V+  DSG+Y    EN+ G   +   + V++
Sbjct: 21894 WARDHGESLDKASIESTSSYTL--LIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLD 21950



 Score = 86.3 bits (212), Expect = 1e-16
 Identities = 145/654 (22%), Positives = 246/654 (37%), Gaps = 78/654 (11%)

Query: 258   IDKPDPPQGPMEVQDCHR--AGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAP 315
             +D   PP  P  +    R  + + L W+ PR NGG  ++ Y++E+R+  +  + +V +  
Sbjct: 15289 VDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRL 15348

Query: 316   ADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQ 375
               +T+F   +++  + Y FRV+AV   G  E      +++  + +P  P+    LS    
Sbjct: 15349 CPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVP--PTIKLRLSVRGD 15406

Query: 376   GITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADV-RQGCQYEFR 434
              I +    P     A + G  + + +   N    V ++P    + T  +V R   + E  
Sbjct: 15407 TIKVKAGEPVHI-PADVTGLPMPKIEWSKNE--TVIEKPTDALQITKEEVSRSEAKTELS 15463

Query: 435   VTAVAPSGPGEPGPPSD----AVFAR------DPMRPPGLVRNLQVTDRSNTSITLSWAG 484
             +        G     +     +VF        D   PP   RNL VTD    S  L+W  
Sbjct: 15464 IPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPP---RNLAVTDIKAESCYLTWDA 15520

Query: 485   PDTQEGDEAQGYVVEL--CSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEG 542
             P    G E   YV++    S    +W      T     Y    L P   Y  RV AVN+ 
Sbjct: 15521 PLDNGGSEITHYVIDKRDASRKKAEWEEV-TNTAVEKRYGIWKLIPNGQYEFRVRAVNKY 15579

Query: 543   GQSQPSALDTLVQAMPVTVC-----PKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEV 597
             G S     D +V   P  +      PK L  + TK  + V    +   P+     P+   
Sbjct: 15580 GISDECKSDKVVIQDPYRLPGPPGKPKVL--ARTKGSMLV----SWTPPLDNGGSPITGY 15633

Query: 598   TWLK---DGLPLPKR--SVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEV---AHS 649
              WL+   +G P   R     +TK GL  +   V  L +   Y      +    +   +  
Sbjct: 15634 -WLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEP 15692

Query: 650   FRIRVAACPQ-APGPI---HLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPW- 704
                 VA  P   PGP     +++    +++  W+P   +       Y V  +      W 
Sbjct: 15693 SDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWK 15752

Query: 705   --HEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKA 762
               +E    I T    +  +    +Y FRV A NE G S+PSDT             T + 
Sbjct: 15753 RVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDT-------------TGEI 15799

Query: 763   PCYREPDLSQKPRFLVGLRSH---LLPQGCECCMSCAVQGSPRPHVTWFKNDRSL----E 815
             P     D+ ++P   + + +    +   G +  +   ++G P P  +W  + ++     +
Sbjct: 15800 PA---TDIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKD 15856

Query: 816   GNPAVYSTDLLGVCS----LTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
             G   +     L        + IP      +G+Y   A+N  GQ  +   + V++
Sbjct: 15857 GVHDIPEDAQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMD 15910



 Score = 84.7 bits (208), Expect = 3e-16
 Identities = 149/655 (22%), Positives = 232/655 (35%), Gaps = 88/655 (13%)

Query: 250   QAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWL 309
             +A +  + I  P+ P+  +EV++  +  V L W PP+ +GG  +  YV+E R  G   + 
Sbjct: 16706 EALVIREPITVPERPED-LEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFH 16764

Query: 310   KVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAI 369
             KV      S  +T   ++ G  Y +RV AV   G G+     + +   + L    + P +
Sbjct: 16765 KVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDEL----APPTL 16820

Query: 370   LSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGC 429
                    +T+        G A  L      + K   +W       + + R  +       
Sbjct: 16821 HLDFRDKLTIR------VGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATL 16874

Query: 430   QYEFRVTAVAPSGPG----EPGPPSDAVFARDPM--RPPGLVRNLQVTDRSNTSITLSWA 483
               E      + SG      E    S   F +  +  RP   V  +   + +   + +SW 
Sbjct: 16875 ALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWK 16934

Query: 484   GPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGG 543
              P    G +   Y++E        W+P    +   T   +K L  G+ Y  R+ A N  G
Sbjct: 16935 PPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSK-LLEGKDYIFRIHAENLYG 16993

Query: 544   QSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPE-VTWLKD 602
              S P                  LV  S K     +V D    P+  E       VTW K 
Sbjct: 16994 ISDP------------------LVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKP 17035

Query: 603   ---GLPLP-----------KRSVTVTKDGL---TQLLIPVAGLSDSGLYTVVLRTLQGKE 645
                G P+            KR   VTKD +   T+  +P   L +   Y    R     E
Sbjct: 17036 HDGGKPITNYILEKRETMSKRWARVTKDPIHPYTKFRVP--DLLEGCQYE--FRVSAENE 17091

Query: 646   VAHS---------FRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFT 696
             +            F     A P  P      +    +V   W+P   +     L Y V  
Sbjct: 17092 IGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEY 17151

Query: 697   RSSAHGPWHEA---ADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPR 753
             +      W  A    +     ++ + G+  G  Y FRV+A N  G S P+   +P  +  
Sbjct: 17152 QKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLV-- 17209

Query: 754   QRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRS 813
              +DR          P+L          R   +  G    +S  ++G P P VTW K DR 
Sbjct: 17210 -KDRL-------EPPELILDANMA---REQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRD 17258

Query: 814   LEGNPAVYSTDLLGVCS-LTIPSVSPKDSGEYKAVAENTLG-QAVSTATLIVIEP 866
                 P     D+  V S L I + + +D G Y    EN  G + VS   L++ +P
Sbjct: 17259 A---PTKARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKP 17310



 Score = 84.3 bits (207), Expect = 4e-16
 Identities = 179/804 (22%), Positives = 285/804 (35%), Gaps = 104/804 (12%)

Query: 79    LADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQ 138
             L D+E    ++ T  C +        W K+G ++   + V ++ D   H L I       
Sbjct: 12740 LKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPD 12799

Query: 139   AGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAA 198
              G Y   AG  +S A L + ++PT   +  E L +  V +    V     F   L  + A
Sbjct: 12800 EGEYIVTAGQDKSVAELLIIEAPT---EFVEHLEDQTVTEFDDAV-----FSCQLSREKA 12851

Query: 199   ---WRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTL 255
                W ++G E+     ++ + +      RL +      D  +Y+  +  E    +A L +
Sbjct: 12852 NVKWYRNGREI--KEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGV--EDRKSRARLFV 12907

Query: 256   QVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRD---NGGRTVECYVVERRQAGRSTWLKVG 312
             + I        P+E+            RPP+D     G  V       +      WL+  
Sbjct: 12908 EEI--------PVEI-----------IRPPQDILEAPGADVVFLAELNKDKVEVQWLRNN 12948

Query: 313   EAPADSTTFTDAH--VEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAIL 370
                       D H  +  G+ +  ++  +     GE     +   A   L  A +AP I 
Sbjct: 12949 MVVVQG----DKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELA-AAPKIK 13003

Query: 371   SASSQ-----GITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADV 425
             +A        G  LT   P          +  E     + T     D    +  + + + 
Sbjct: 13004 TADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKT----IDTTAEQTSFRILEA 13059

Query: 426   RQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGP 485
             ++G +  +++      G  E             +  PG VRNL+VT+  +  ++L+W  P
Sbjct: 13060 KKGDKGRYKIVLQNKHGKAE------GFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEP 13113

Query: 486   DTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGL-RPGEGYFVRVTAVNEGGQ 544
              T  G +  GYVVE        W+           +T  GL + G  Y  RV+A N  G 
Sbjct: 13114 LTDGGSKIIGYVVERRDIKRKTWV-LATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGT 13172

Query: 545   SQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPE-------- 596
              +P   D      PV    K+ V       L V + D  R  VS    P PE        
Sbjct: 13173 GEPVETDN-----PVEARSKYDVPGPP---LNVTITDVNRFGVSLTWEP-PEYDGGAEIT 13223

Query: 597   --VTWLKDGLPLP-KRSVTVTKDGLTQLLIPVA-GLSDSGLYTVVLRTLQGKEVAHSFRI 652
               V  L+D   +    ++TV  + L+  +  V  G   S       R   GK  A +  +
Sbjct: 13224 NYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFV 13283

Query: 653   RVAACPQAPGP---IHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAAD 709
             +VA   + P P   +   +    +V  +WEP   +     L Y +         W     
Sbjct: 13284 KVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNM 13343

Query: 710   RIHTN-RFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREP 768
             ++     + + G+  G++Y +RV A+N+ G S PS+   P                + EP
Sbjct: 13344 KLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGP----------LTADDAFVEP 13393

Query: 769   --DLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLL 826
               DLS    F  GL   ++P      +     G PRP  TW   D+ LE    V    L 
Sbjct: 13394 TMDLS---AFKDGLEV-IVPNPITILVPST--GYPRPTATWCFGDKVLETGDRVKMKTLS 13447

Query: 827   GVCSLTIPSVSPKDSGEYKAVAEN 850
                 L I      D G Y    EN
Sbjct: 13448 AYAELVISPSERSDKGIYTLKLEN 13471



 Score = 84.0 bits (206), Expect = 6e-16
 Identities = 57/214 (26%), Positives = 94/214 (43%), Gaps = 17/214 (7%)

Query: 652   IRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRI 711
             I+VA  PQ PG I + +    +V+  W     +     + Y V  ++     W E A R+
Sbjct: 23125 IKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECA-RV 23183

Query: 712   HTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLS 771
              + +  +  +  G EY FRVVA NE G S P   + P           V      EPD+ 
Sbjct: 23184 KSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVP----------IVAKDLVIEPDV- 23232

Query: 772   QKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSL 831
              KP F     S+ +  G +  +   + G P+P +TW K+   L+    +  TD L + +L
Sbjct: 23233 -KPAF----SSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTL 23287

Query: 832   TIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
             +I      D G+Y     N +GQ  ++  ++ ++
Sbjct: 23288 SIKETHKDDGGQYGITVANVVGQKTASIEIVTLD 23321



 Score = 82.8 bits (203), Expect = 1e-15
 Identities = 142/640 (22%), Positives = 236/640 (36%), Gaps = 77/640 (12%)

Query: 259   DKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADS 318
             D  DPP  P E     R  V L+W+ P  +GG  +  Y+VE+++     W+K        
Sbjct: 22437 DPCDPPGRP-EAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASFTNIID 22495

Query: 319   TTFTDAHVEPGRKYTFRVRAVTSEGA-GEALESEEILVAPEALPKAPSAPAILSASSQGI 377
             T F    +    +Y FRV A  + G   E  ES   + A + +                 
Sbjct: 22496 THFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDP--------------- 22540

Query: 378   TLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVAD--VRQGCQYEFRV 435
                   PR          ++    +       +  +P+P  +W   D  +    + E + 
Sbjct: 22541 ------PRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKS 22594

Query: 436   TAVAPSGPGEPGPPSDA----VFARDPMRPPGLVRNLQVTDRSNT-------------SI 478
             T  A S   +     D+    + A++      +  N++V DR                  
Sbjct: 22595 TDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGVTAEKC 22654

Query: 479   TLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTA 538
             TL+W  P    G +   Y+VE   +  L W         ++    K L  G  Y  R+ A
Sbjct: 22655 TLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTK-LLEGNEYTFRIMA 22713

Query: 539   VNEGGQSQPSALDTLVQAMPVTV--CPKFL-VDSSTKDLLTVKVGDTVRVPVSFEAMPMP 595
             VN+ G  +P   + +V   P  V   PK   V + TKD + V V +        E +   
Sbjct: 22714 VNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIV-VWERPASDGGSEILGYV 22772

Query: 596   EVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYT--VVLRTLQGKEVAHSFRIR 653
                  K+G+    R     K  + +L + V GL ++  Y   V      G          
Sbjct: 22773 LEKRDKEGI----RWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAY 22828

Query: 654   VAACPQA--PGPIHLQENVPGT---VTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEA 707
               AC     PGP +  + +  T   V   W +P  D   ++   Y V     + G W   
Sbjct: 22829 QKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQ-GYIVEKCDVSVGEWTMC 22887

Query: 708   ADRIHTNRFTLL--GILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCY 765
                   N+  +    +L  HEY+FR+ A N+ G  + +D   P  +  +     ++AP  
Sbjct: 22888 TPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEK-----LEAP-- 22940

Query: 766   REPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDL 825
              + DL  + R ++ +R+     G    +   ++G P P V W K D  +     +  T  
Sbjct: 22941 -DIDLDLELRKIINIRA-----GGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTS- 22993

Query: 826   LGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
                 SL + +V+  DSG+Y    EN+ G   +  T+ V++
Sbjct: 22994 -SFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLD 23032



 Score = 78.6 bits (192), Expect = 2e-14
 Identities = 177/858 (20%), Positives = 298/858 (34%), Gaps = 183/858 (21%)

Query: 82   MEVQPGEAATLSCTLTSDLGPGT-WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAG 140
            ++V  G+  TL CT+       T WFKDG +LT+ +         V  L I +V  + +G
Sbjct: 7595 IKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDSG 7654

Query: 141  RYTF----VAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQ 196
             Y+F      G     A+L V D  T+ P  T KL+E   + +G  V+++       PI 
Sbjct: 7655 VYSFEVQNPVGKDSCTASLQVSDR-TVPPSFTRKLKETNGL-SGSSVVMECKVYGSPPIS 7712

Query: 197  AAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQ 256
             +W  +G E+  SS R+ Q  L D    L +      D G Y+    +  GS +    L 
Sbjct: 7713 VSWFHEGNEI--SSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLT 7770

Query: 257  V------IDKPDPP-------------------------QGPMEVQDCHRAGVCLRWRPP 285
            V      + KPDP                          +G  E+    R  V L     
Sbjct: 7771 VREPPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSL----- 7825

Query: 286  RDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAG 345
             ++    +E + V+  Q+G  T +   EA   S T T  +++   K+  R+   + E   
Sbjct: 7826 -EDSVAELELFDVDTSQSGEYTCIVSNEAGKASCT-THLYIKAPAKFVKRLNDYSIE--- 7880

Query: 346  EALESEEILVAPEALPKAPSAPAILSASSQG---ITLTWTAPRGPGSAHILGYLIERRKK 402
                                 P IL  +  G   I++TW                  +K 
Sbjct: 7881 ------------------KGKPLILEGTFTGTPPISVTW------------------KKN 7904

Query: 403  GSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPG----EPGPPSDAVFARD- 457
            G N          P +R  +    +    E   + V  +G      E     D+  A+  
Sbjct: 7905 GINV--------TPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQIL 7956

Query: 458  PMRPPGLVRNLQ---VTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVG 514
             + PP  V+ L+   V+   + S+    AG                     + W      
Sbjct: 7957 ILEPPYFVKQLEPVKVSVGDSASLQCQLAG----------------TPEIGVSWYKGDTK 8000

Query: 515  TVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ---SQPSALDTLVQAMPVTVCPKFLVDSST 571
              P TTY                 +N+ G+      +++  +  +  +TV  + L  S +
Sbjct: 8001 LRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFS 8060

Query: 572  KDLLTVKVGDTVRVPVSFE-----AMPMPEVTWLKDGLPLPKRSVTVTK--DGLTQLLIP 624
            + L  V+  +TV +PV F+     + P+  V+W KDG PL       T   D    L I 
Sbjct: 8061 RQLRDVQ--ETVGLPVVFDCAISGSEPI-SVSWYKDGKPLKDSPNVQTSFLDNTATLNIF 8117

Query: 625  VAGLSDSGLYTVVLRTLQGKEVAHS------------FRIRVAACPQAPGPIHLQENVPG 672
                S +G Y+       G   + +            F IR+A      G          
Sbjct: 8118 KTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGE--------- 8168

Query: 673  TVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVV 732
              +A++E      Q + + +A  +R    G  ++ +   ++   T+L +  G    +   
Sbjct: 8169 --SADFECHVTGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCY 8226

Query: 733  AKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQK---PRFLVGLRSHL-LPQG 788
            A NE+G                      K  C  + ++ ++   P F   L   +   +G
Sbjct: 8227 AVNEVG----------------------KDSCTAQLNIKERLIPPSFTKRLSETVEETEG 8264

Query: 789  CECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVA 848
                +   V GS    V W+KN+  ++       T       L +      D+G Y    
Sbjct: 8265 NSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKV 8324

Query: 849  ENTLGQAVSTATLIVIEP 866
             N  G A+ T+++++ EP
Sbjct: 8325 SNDAGSALCTSSIVIKEP 8342



 Score = 73.2 bits (178), Expect = 1e-12
 Identities = 176/817 (21%), Positives = 282/817 (34%), Gaps = 116/817 (14%)

Query: 87   GEAATLSCTLTSDLGPGT-WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFV 145
            G+AA   CT+T      T W KDG  L+             H L ++++     G Y+  
Sbjct: 3565 GKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCK 3624

Query: 146  A----GDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRK 201
            A    G    +A L + D P    ++     EP+     K V ++        +   W K
Sbjct: 3625 ASNKFGADICQAELIIIDKPHFIKEL-----EPVQSAINKKVHLECQVDEDRKVTVTWSK 3679

Query: 202  DGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKP 261
            DG ++    D +  +   D    L +P A  KD G Y  T  +E GS     T+ V    
Sbjct: 3680 DGQKLPPGKDYK--ICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTV---R 3734

Query: 262  DPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTT- 320
            +PP    +V   +   + L     R      + C + +     + TW K  +  ++S T 
Sbjct: 3735 EPPSFVKKVDPSY---LMLPGESAR------LHCKL-KGSPVIQVTWFKNNKELSESNTV 3784

Query: 321  ------------FTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPA 368
                         TD  VE    Y+    AV   G+ ++  +E ++  P +  K      
Sbjct: 3785 RMYFVNSEAILDITDVKVEDSGSYS--CEAVNDVGS-DSCSTEIVIKEPPSFIKTLEPAD 3841

Query: 369  ILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQG 428
            I+  ++    L      G G   I  +  +++ + S  +   + + +        +    
Sbjct: 3842 IVRGTN---ALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADV 3898

Query: 429  CQYEFRVTAVAPSGPGEPG---------PPSDAVFARDPMRPPGLVRNLQVTDRSNTSIT 479
             +YE     V  +  G+ G         PP+      D +   G    LQ   R +  I+
Sbjct: 3899 GEYE----CVVANEVGKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPIS 3954

Query: 480  LSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAV 539
            ++W     QE     G +    S+              V       ++   G      A 
Sbjct: 3955 VTWM--KGQEVIREDGKIKMSFSNG-------------VAVLIIPDVQISFGGKYTCLAE 3999

Query: 540  NEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTW 599
            NE G SQ S  + +V+       P  +++ +  +L+ V  GD   +  +    P  +  W
Sbjct: 4000 NEAG-SQTSVGELIVKE------PAKIIERA--ELIQVTAGDPATLEYTVAGTPELKPKW 4050

Query: 600  LKDGLPL--PKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAAC 657
             KDG PL   K+     K+ + QL    A L DSG YT  +    G     +    V   
Sbjct: 4051 YKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCET-TFTVLDR 4109

Query: 658  PQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIH----- 712
              AP       NV   V          A  +P+  + F      G    A+DR       
Sbjct: 4110 DIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFK----DGKEIAASDRYRIAFVE 4165

Query: 713  -TNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLS 771
             T    ++ +      +F   A N +G+   S                  A   +EP   
Sbjct: 4166 GTASLEIIRVDMNDAGNFTCRATNSVGSKDSSG-----------------ALIVQEP--- 4205

Query: 772  QKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSL 831
              P F+    S  +  G   C+    QGS    + WFK ++ L    + Y T      SL
Sbjct: 4206 --PSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSL 4263

Query: 832  TIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIEPST 868
             +  V   DSG Y     N  G    +A L V EP+T
Sbjct: 4264 ELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPAT 4300



 Score = 67.8 bits (164), Expect = 4e-11
 Identities = 53/214 (24%), Positives = 86/214 (40%), Gaps = 17/214 (7%)

Query: 652   IRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRI 711
             ++V+  P  PG + L +    T T +WE    +       Y V  ++     W     ++
Sbjct: 25290 VKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKW-STCTQV 25348

Query: 712   HTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLS 771
              T   T+ G+  G EY FRV A NE G S P     P  I R               D+ 
Sbjct: 25349 KTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVP-VIAR---------------DIE 25392

Query: 772   QKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSL 831
              KP   +   +  +    +  +    +G P+  V W K+ ++L+    V  +    V SL
Sbjct: 25393 IKPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSL 25452

Query: 832   TIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
             +I   S +D G Y+    N+ G      T+IV++
Sbjct: 25453 SIKEASKEDVGTYELCVSNSAGSITVPITIIVLD 25486



 Score = 67.4 bits (163), Expect = 5e-11
 Identities = 178/838 (21%), Positives = 288/838 (34%), Gaps = 140/838 (16%)

Query: 75   FSQGLADMEVQPGEAATLSCTLT-SDLGPGTWFKDGVKLTTQDGVI-FKQDGLVHSLFIT 132
            F + + D+    G+  TL   +  S+    TW K G ++  +DG I       V  L I 
Sbjct: 3926 FVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMK-GQEVIREDGKIKMSFSNGVAVLIIP 3984

Query: 133  HVQGTQAGRYTFVA----GDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIP 188
             VQ +  G+YT +A    G Q S   L V++   I      +  E + V AG P  ++  
Sbjct: 3985 DVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKII-----ERAELIQVTAGDPATLEYT 4039

Query: 189  FQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGS 248
                  ++  W KDG  +V S  ++ ++   +   +L   SA   D GQY+  + +E GS
Sbjct: 4040 VAGTPELKPKWYKDGRPLVAS--KKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGS 4097

Query: 249  VQAELTLQVIDKPDPP--QGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRS 306
               E T  V+D+   P    P+   D    G C             ++C +       R 
Sbjct: 4098 SSCETTFTVLDRDIAPFFTKPLRNVDSVVNGTC------------RLDCKIAGSLPM-RV 4144

Query: 307  TWLKVGEAPADSTTFTDAHVEPGRKY-----------TFRVRAVTSEGAGEA------LE 349
            +W K G+  A S  +  A VE                 F  RA  S G+ ++       E
Sbjct: 4145 SWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQE 4204

Query: 350  SEEILVAPEALPKAPSAPAILSASSQG---ITLTWTAPRGPGSAHILGYLIERRKKGSNT 406
                +  P +    P +   L ++ QG   +T+ W        +    Y+ +   + S  
Sbjct: 4205 PPSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLE 4264

Query: 407  WTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVR 466
               V           V++V  G +    +    P+   E   PS        +   G   
Sbjct: 4265 LYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVEKLEPSQ-------LLKKGDAT 4317

Query: 467  NLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGL 526
             L         I ++W   D +               +S +     V +  V   T  G+
Sbjct: 4318 QLACKVTGTPPIKITWFANDRE-------------IKESSKHRMSFVESTAVLRLTDVGI 4364

Query: 527  RPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVP 586
                 Y     A NE G    S++  +V+  P            TK+   ++V     V 
Sbjct: 4365 EDSGEYMCE--AQNEAGSDHCSSI-VIVKESPY----------FTKEFKPIEVLKEYDVM 4411

Query: 587  VSFEAMPMP--EVTWLKDG--LPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQ 642
            +  E    P  E+TW KD   L   ++  T  +D L  L I     +D+G Y   +    
Sbjct: 4412 LLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEV 4471

Query: 643  GKEVAHSFRIRVAACPQ-----------APGPIHLQENVPGT--VTAEWEPSPDEAQDVP 689
            G  +  S R+ +   P              G    Q  + G+  +T  W    DE  +  
Sbjct: 4472 GSSIC-SARVTLREPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDD 4530

Query: 690  LHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPW 749
                 F  + A                 L GI   H+  +   AKN+ G           
Sbjct: 4531 NIRMTFENNVA--------------SLYLSGIEVKHDGKYVCQAKNDAG----------- 4565

Query: 750  CIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFK 809
             I R     +VK P     +            S  + QG    +     G+      WFK
Sbjct: 4566 -IQRCSALLSVKEPATITEEAV----------SIDVTQGDPATLQVKFSGTKEITAKWFK 4614

Query: 810  N--DRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
            +  + +L     +  TD + +  L I S   KDSGEY    +N +G++   A + V++
Sbjct: 4615 DGQELTLGSKYKISVTDTVSI--LKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLD 4670



 Score = 65.1 bits (157), Expect = 3e-10
 Identities = 72/324 (22%), Positives = 132/324 (40%), Gaps = 47/324 (14%)

Query: 75   FSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHV 134
            F + + D++V   + A   C ++       W KD  +L   D +  +++  VH L I   
Sbjct: 3060 FRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPST 3119

Query: 135  QGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQ-SHL 193
            + + AG+YT VAG   S A L V+        + ++++   V++  + V   + F+ +  
Sbjct: 3120 RMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQ---VIEKQRAV---VEFEVNED 3173

Query: 194  PIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAEL 253
             + A W KDG E+        +  +     R+ +    + D G+Y+       G  ++ +
Sbjct: 3174 DVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFV----AGRNRSSV 3229

Query: 254  TLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVE-CYVVERRQAGRSTWLKVG 312
            TL V + P+PPQ   E+Q            P     G+    C V+  R   + +W K  
Sbjct: 3230 TLYV-NAPEPPQVLQELQ------------PVTVQSGKPARFCAVISGRPQPKISWYK-- 3274

Query: 313  EAPADSTTFTDAHVEPGRKYTFRV------------------RAVTSEGAGEALESEEIL 354
            E    ST F    +  G++YT  +                    V +  A  ++E  E++
Sbjct: 3275 EEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVV 3334

Query: 355  VAPEALPKAPSAPAILSASSQGIT 378
               + +P  P  PAI++     +T
Sbjct: 3335 SPDQEMPVYP--PAIITPLQDTVT 3356



 Score = 65.1 bits (157), Expect = 3e-10
 Identities = 48/183 (26%), Positives = 84/183 (45%), Gaps = 12/183 (6%)

Query: 87   GEAATLSCTLTSDLG-PGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFV 145
            G  A    TL   L    TW KD  ++T  D +    +  V SL+++ ++    G+Y   
Sbjct: 4500 GGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQ 4559

Query: 146  ----AGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRK 201
                AG Q+  A L+V++  TI  +        + V  G P  +++ F     I A W K
Sbjct: 4560 AKNDAGIQRCSALLSVKEPATITEEAVS-----IDVTQGDPATLQVKFSGTKEITAKWFK 4614

Query: 202  DGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKP 261
            DG E+   S  + ++ + D  + L + S  +KD G+Y+  ++++ G    +  + V+D  
Sbjct: 4615 DGQELTLGS--KYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLI 4672

Query: 262  DPP 264
             PP
Sbjct: 4673 IPP 4675



 Score = 62.4 bits (150), Expect = 2e-09
 Identities = 198/937 (21%), Positives = 314/937 (33%), Gaps = 181/937 (19%)

Query: 14   EEMLNEDQSREPPGHLGSRRSG---------KDGRLDIYGERRDATRSST-------SRY 57
            EE ++ D ++  P  L  + SG         KDG+    G +   + + T       S  
Sbjct: 4583 EEAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTE 4642

Query: 58   KPGTGSFSKDAQGPMGH-----------------FSQGLADMEVQPGEAATLSCTLTSDL 100
            K  +G ++ + Q  +G                  F++ L  M+   G    L C +    
Sbjct: 4643 KKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSH 4702

Query: 101  GPGT-WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTF----VAGDQQSEATL 155
                 WFKD  +++  +   F        L I+ ++GT +G YT      AG  Q    L
Sbjct: 4703 PISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHL 4762

Query: 156  TVQDSPTI-----APDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSS 210
            TV++ P       + DV    R  L    G             P+   W KD  E+   +
Sbjct: 4763 TVKEPPYFVEKPQSQDVNPNTRVQLKALVG----------GTAPMTIKWFKDNKELHSGA 4812

Query: 211  DREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEV 270
             R    D  D  T L L +A   D G Y   L ++ G+  ++ TL V + P   + P  V
Sbjct: 4813 ARSVWKD--DTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQFIKKPSPV 4870

Query: 271  QDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPA---DSTTFTD---- 323
                           R+    T EC +    +   S +L   E  A      +F D    
Sbjct: 4871 LVL------------RNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLAT 4918

Query: 324  -----AHVEPGRKYTFRVRAVTSEGAGEALESEEILV-APEALPKAPSAPAILSASSQGI 377
                 A VE    Y    R      AG A  S E+ V  P    +      ++  S   +
Sbjct: 4919 FQISGARVENSGTYVCEAR----NDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVEL 4974

Query: 378  --TLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRV 435
               +T T P                     TW   N +    +++T+ D  +   +   +
Sbjct: 4975 ECEVTGTPP------------------FEVTWLKNNREIRSSKKYTLTD--RVSVFNLHI 5014

Query: 436  TAVAPSGPGE-------PGPPSDAVFARDPMRPPGLVRNL-------------QVTDRSN 475
            T   PS  GE        G             PP  ++ +             Q T   +
Sbjct: 5015 TKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKIENTTTVLKSSATFQSTVAGS 5074

Query: 476  TSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVR 535
              I+++W   D Q  DE     +    S              V T   + +  G      
Sbjct: 5075 PPISITWL-KDDQILDEDDNVYISFVDS--------------VATLQIRSVDNGHSGRYT 5119

Query: 536  VTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMP 595
              A NE G  +  A   LVQ     V     VD + KD +T++              P  
Sbjct: 5120 CQAKNESGVERCYAF-LLVQEPAQIVEKAKSVDVTEKDPMTLE--------CVVAGTPEL 5170

Query: 596  EVTWLKDGLPL-PKRSVTVT-KDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIR 653
            +V WLKDG  + P R  +++ ++ +    I      DSG YT  +    G     ++ +R
Sbjct: 5171 KVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAY-LR 5229

Query: 654  VAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSS--AHGPWHEAADRI 711
            V           L +N+P + T +     D+     +H       S      W +    I
Sbjct: 5230 V-----------LDQNIPPSFTKKL-TKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEI 5277

Query: 712  HTN-RFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDL 770
             T+ ++ L+        H R V+  E+   +  DT+   C   +         C     +
Sbjct: 5278 STSAKYRLV-------CHERSVSL-EVNNLELEDTANYTC---KVSNVAGDDACSGILTV 5326

Query: 771  SQKPRFLVGL-RSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVC 829
             + P FLV   R   +P          ++G+P   + WFK+D  L   P  +        
Sbjct: 5327 KEPPSFLVKPGRQQAIPDS-TVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTS 5385

Query: 830  SLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIEP 866
             L + SV    +G+Y     N +G    T  L+V EP
Sbjct: 5386 FLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEP 5422



 Score = 61.6 bits (148), Expect = 3e-09
 Identities = 73/304 (24%), Positives = 120/304 (39%), Gaps = 57/304 (18%)

Query: 593  PMPEVTWLKDGLPLP---KRSVTVTKD-GLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAH 648
            P P V W K G+PL    +  V+  K  G  +L+I +    D+G YT+V+R   G+  A 
Sbjct: 1109 PKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSAS 1168

Query: 649  S-------------------FRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVP 689
            +                   ++ +V A  Q P    + E  PG V +E+E   ++ Q   
Sbjct: 1169 ASLLEEADYELLMKSQQEMLYQTQVTAFVQEP---KVGETAPGFVYSEYEKEYEKEQ--A 1223

Query: 690  LHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPW 749
            L      + +     +      H + F    I    E  +R++ K  L      D  +  
Sbjct: 1224 LIRKKMAKDTVVVRTYVEDQEFHISSFEERLI---KEIEYRII-KTTLEELLEEDGEEKM 1279

Query: 750  CIPRQRDRFTVKAPCYREPDLSQKPRFLVG----LRSHLLPQGCECCMSCAVQGSPRPHV 805
             +                 D+S+      G    ++++ + +G      C + G P P +
Sbjct: 1280 AV-----------------DISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKI 1322

Query: 806  TWFKNDRSLEGNPAVYSTDLL--GVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
             W+K+ + ++     Y  D L  G  SL IP V P+D G Y A A N  G A+ +  L V
Sbjct: 1323 AWYKDGKRIKHGER-YQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYV 1381

Query: 864  IEPS 867
             EP+
Sbjct: 1382 -EPA 1384



 Score = 61.6 bits (148), Expect = 3e-09
 Identities = 83/336 (24%), Positives = 131/336 (38%), Gaps = 42/336 (12%)

Query: 538  AVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEV 597
            A NE G    +A  T+ +A P    P FL   S    LT  VG   +   +    P+ E 
Sbjct: 3530 ASNEYGSVSCTATLTVTEAYP----PTFL---SRPKSLTTFVGKAAKFICTVTGTPVIET 3582

Query: 598  TWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLS--DSGLYTVVLRTLQGKEVAHSFRIRVA 655
             W KDG  L         D   + ++ ++ L+  D G+Y+       G ++  +  I + 
Sbjct: 3583 IWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIII- 3641

Query: 656  ACPQAPGPIHLQENVPGTVTAE--WEPSPDEAQDVPLHYAVFTRSSAHGPWHEAA--DRI 711
                 P  I   E V   +  +   E   DE + V + ++   +    G  ++    D+I
Sbjct: 3642 ---DKPHFIKELEPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKI 3698

Query: 712  HTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLS 771
             T    L  +     Y     A NE G+S  S T             TV+ P        
Sbjct: 3699 ATLEIPLAKLKDSGTYV--CTASNEAGSSSCSAT------------VTVREP-------- 3736

Query: 772  QKPRFLVGLR-SHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCS 830
              P F+  +  S+L+  G    + C ++GSP   VTWFKN++ L  +  V    +     
Sbjct: 3737 --PSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAI 3794

Query: 831  LTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIEP 866
            L I  V  +DSG Y   A N +G    +  +++ EP
Sbjct: 3795 LDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEP 3830



 Score = 61.6 bits (148), Expect = 3e-09
 Identities = 36/103 (34%), Positives = 54/103 (52%), Gaps = 4/103 (3%)

Query: 769   DLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGV 828
             +LS  P F+   RS  + +G     +C + G P P + WFKN+  +  +  V  +    V
Sbjct: 33129 ELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNV 33188

Query: 829   CSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVI----EPS 867
              SL I + S  DSG+Y   A+N  GQ  +TA+L+V+    EPS
Sbjct: 33189 YSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPS 33231



 Score = 60.5 bits (145), Expect = 7e-09
 Identities = 169/835 (20%), Positives = 286/835 (34%), Gaps = 128/835 (15%)

Query: 75   FSQGLADMEVQPGEAATLSCTLTSDLGPG--TWFKDGVKLTTQDGV-IFKQDGLVHSLFI 131
            F + L   ++  G  A L C + S  GP   +WFKD  ++ +     +F Q  LV  L I
Sbjct: 3833 FIKTLEPADIVRGTNALLQCEV-SGTGPFEISWFKDKKQIRSSKKYRLFSQKSLV-CLEI 3890

Query: 132  THVQGTQAGRYTFVAGDQQSE----ATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKI 187
                    G Y  V  ++  +    AT  +++ PT    V +     L+   G+ V ++ 
Sbjct: 3891 FSFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFVKKVDD-----LIALGGQTVTLQA 3945

Query: 188  PFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGG 247
              +   PI   W K G EV+   D + ++   +G   L +P       G+Y+    +E G
Sbjct: 3946 AVRGSEPISVTWMK-GQEVI-REDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAG 4003

Query: 248  SV----------------QAEL---------TLQVIDKPDPPQGPMEVQDCHRAGVCLRW 282
            S                 +AEL         TL+      P   P   +D        ++
Sbjct: 4004 SQTSVGELIVKEPAKIIERAELIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKY 4063

Query: 283  RPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADS--TTFTDAHVEPGRKYTFRVRAVT 340
            R    N    ++ Y  E   +G+ T+    E  + S  TTFT    +    +T  +R V 
Sbjct: 4064 RISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVD 4123

Query: 341  SEGAGEA-LESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIER 399
            S   G   L+ +     P  +        I ++    I          G+A +    ++ 
Sbjct: 4124 SVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFV------EGTASLEIIRVDM 4177

Query: 400  RKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPM 459
               G+ T  A N     +    +            +    PS   +PG       ++D +
Sbjct: 4178 NDAGNFTCRATNSVGSKDSSGAL------------IVQEPPSFVTKPG-------SKDVL 4218

Query: 460  RPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVT 519
              PG    L+ T + +T +T+ W   + +       Y+ +     SL+     V T    
Sbjct: 4219 --PGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYL--VKTSDSG 4274

Query: 520  TYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKV 579
            TYT K               N  G  + SA   L    P T   K       +    +K 
Sbjct: 4275 TYTCK-------------VSNVAGGVECSA--NLFVKEPATFVEKL------EPSQLLKK 4313

Query: 580  GDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTK--DGLTQLLIPVAGLSDSGLYTVV 637
            GD  ++       P  ++TW  +   + + S       +    L +   G+ DSG Y   
Sbjct: 4314 GDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCE 4373

Query: 638  LRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPS--PDEAQDVPLHYAVF 695
             +   G +   S  I          P   +E  P  V  E++     + A   P     F
Sbjct: 4374 AQNEAGSDHCSSIVI------VKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWF 4427

Query: 696  TRSSA--HGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPR 753
              ++    G  ++   + H     +L  +      ++    NE+G+S             
Sbjct: 4428 KDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSI------------ 4475

Query: 754  QRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRS 813
                      C     L + P F+  + S    +G        ++GS    VTW K+   
Sbjct: 4476 ----------CSARVTLREPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDE 4525

Query: 814  LEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIEPST 868
            +  +  +  T    V SL +  +  K  G+Y   A+N  G    +A L V EP+T
Sbjct: 4526 ITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPAT 4580



 Score = 59.7 bits (143), Expect = 1e-08
 Identities = 42/139 (30%), Positives = 66/139 (47%), Gaps = 5/139 (3%)

Query: 79    LADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQ 138
             L D+ V  GE AT  C L+ +  P  W+  G KL   D V+ + +G VH+L +  V+   
Sbjct: 12202 LKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLED 12261

Query: 139   AGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAA 198
             AG     A D ++ A L V++ P    + T+ L E   V+ G   +++    S    +  
Sbjct: 12262 AGEVQLTAKDFKTHANLFVKEPPV---EFTKPL-EDQTVEEGATAVLECEV-SRENAKVK 12316

Query: 199   WRKDGAEVVGSSDREAQVD 217
             W K+G E++ S   E   D
Sbjct: 12317 WFKNGTEILKSKKYEIVAD 12335



 Score = 59.3 bits (142), Expect = 1e-08
 Identities = 75/310 (24%), Positives = 114/310 (36%), Gaps = 34/310 (10%)

Query: 563  PKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDG---LPLPKRSVTVTKDGLT 619
            P+F+   S   +L ++ G +          P   V+W  DG     + K  ++   DGL 
Sbjct: 4861 PQFIKKPSP--VLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFI-DGLA 4917

Query: 620  QLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWE 679
               I  A + +SG Y    R   G           A+C      I L+   P T   E +
Sbjct: 4918 TFQISGARVENSGTYVCEARNDAG----------TASCS-----IELKVKEPPTFIRELK 4962

Query: 680  P-SPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNR-FTLLGILPGHEYHFRVVAKNEL 737
            P    +  DV L   V         W +    I +++ +TL   +     H        +
Sbjct: 4963 PVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLH--------I 5014

Query: 738  GASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAV 797
                PSDT +  CI            C     L + P F+  + +              V
Sbjct: 5015 TKCDPSDTGEYQCIVSNEGG---SCSCSTRVALKEPPSFIKKIENTTTVLKSSATFQSTV 5071

Query: 798  QGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVS 857
             GSP   +TW K+D+ L+ +  VY + +  V +L I SV    SG Y   A+N  G    
Sbjct: 5072 AGSPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERC 5131

Query: 858  TATLIVIEPS 867
             A L+V EP+
Sbjct: 5132 YAFLLVQEPA 5141



 Score = 59.3 bits (142), Expect = 1e-08
 Identities = 95/399 (23%), Positives = 157/399 (39%), Gaps = 59/399 (14%)

Query: 498  VELCSSDSLQWLPCHV-GTVPVTTYTAKG---LRPGEGYFVRVTA-----------VNEG 542
            +E    DS+  L C V GT  +T    KG   LRP   Y    T            +N+ 
Sbjct: 6088 LEAAVGDSVS-LQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDS 6146

Query: 543  GQSQPSALDTLVQAMPVTVC---PKFLVDSSTKDLLTVKVGDTVRVPVSFE-----AMPM 594
            G+    A +++  A   TV     + L  S  + L  ++   TV +PV+       + P+
Sbjct: 6147 GEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIE--QTVGLPVTLTCRLNGSAPI 6204

Query: 595  PEVTWLKDGLPL--PKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRI 652
             +V W +DG+ L   +   T   D +  L I    LS SG Y+       G   + S R+
Sbjct: 6205 -QVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGT-ASSSARL 6262

Query: 653  RVAACPQAP----GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAA 708
                  ++P     P+ +  +V    +A++E     AQ + + ++   +    G  +   
Sbjct: 6263 TAREPKKSPFFDIKPVSI--DVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTIT 6320

Query: 709  DRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREP 768
               +T    +L +  G    +   A N++G                      K  C  + 
Sbjct: 6321 CVGNTPHLRILKVGKGDSGQYTCQATNDVG----------------------KDMCSAQL 6358

Query: 769  DLSQKPRFLVGLR-SHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLG 827
             + + P+F+  L  S +  QG    + C + GSP   V+WF+ND  L  +     + +  
Sbjct: 6359 SVKEPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINS 6418

Query: 828  VCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIEP 866
            V  LTI   S +DSG+Y   A N +G A  +  L V  P
Sbjct: 6419 VALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAP 6457



 Score = 59.3 bits (142), Expect = 1e-08
 Identities = 55/199 (27%), Positives = 89/199 (44%), Gaps = 15/199 (7%)

Query: 74   HFSQGLADMEVQPGEAATLSCTL--TSDLGPGTWFKDGVKL--TTQDGVIFKQDGLVHSL 129
            +F + L  ++V  G++A+L C L  T ++G  +W+K   KL  TT   + F+ +  V +L
Sbjct: 7962 YFVKQLEPVKVSVGDSASLQCQLAGTPEIGV-SWYKGDTKLRPTTTYKMHFRNN--VATL 8018

Query: 130  FITHVQGTQAGRYTFVA----GDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIV 185
                V    +G Y   A    G+  +   LTVQ+   + P  + +LR+ +    G PV+ 
Sbjct: 8019 VFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQK-LPPSFSRQLRD-VQETVGLPVVF 8076

Query: 186  KIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSE 245
                    PI  +W KDG  +  S +   Q    D    L +    R   GQYS T  + 
Sbjct: 8077 DCAISGSEPISVSWYKDGKPLKDSPN--VQTSFLDNTATLNIFKTDRSLAGQYSCTATNP 8134

Query: 246  GGSVQAELTLQVIDKPDPP 264
             GS  +   L + +  +PP
Sbjct: 8135 IGSASSSARLILTEGKNPP 8153



 Score = 59.3 bits (142), Expect = 1e-08
 Identities = 53/213 (24%), Positives = 87/213 (40%), Gaps = 17/213 (7%)

Query: 658   PQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAA-DRIHTNRF 716
             P APG   +      +    W+P   +      +Y +  R      W     + I    F
Sbjct: 30825 PGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVF 30884

Query: 717   TLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRF 776
             ++  ++ G EY FRV  +N  G S+ S+ S+P  I  + D   ++AP ++E         
Sbjct: 30885 SVKNLIEGLEYEFRVKCENLGGESEWSEISEP--ITPKSD-VPIQAPHFKEE-------- 30933

Query: 777   LVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLL--GVCSLTIP 834
                LR+  +       + C V G P+P V W++  + +  +   Y       G   L I 
Sbjct: 30934 ---LRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIA 30990

Query: 835   SVSPKDSGEYKAVAENTLGQAVSTATLIVIEPS 867
             SV+  D+  Y+  A N  G    TA+L V  P+
Sbjct: 30991 SVTDDDATVYQVRATNQGGSVSGTASLEVEVPA 31023



 Score = 58.5 bits (140), Expect = 3e-08
 Identities = 53/190 (27%), Positives = 81/190 (42%), Gaps = 12/190 (6%)

Query: 75    FSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHV 134
             F   L D  V+ GE AT  C L+ +     WFK+  KL T   V+   +G  H L +  V
Sbjct: 11576 FMSPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEV 11635

Query: 135   QGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLP 194
                   +      +  S A L V ++    P  T KL +   V+  + + +K      +P
Sbjct: 11636 TLDDISQIKAQVKELSSTAQLKVLEAD---PYFTVKLHDKTAVEKDE-ITLKCEVSKDVP 11691

Query: 195   IQAAWRKDGAEVVGSSDREAQVDLGDGYTR-LCLPSAGRKDCGQYSVTLRSE--GGSVQA 251
             ++  W KDG E+V S     +    DG  R L +  A  KD G+Y     ++    +V  
Sbjct: 11692 VK--WFKDGEEIVPSPKYSIK---ADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTV 11746

Query: 252   ELTLQVIDKP 261
             E  L  ++KP
Sbjct: 11747 EARLIKVEKP 11756



 Score = 58.2 bits (139), Expect = 3e-08
 Identities = 54/186 (29%), Positives = 74/186 (39%), Gaps = 11/186 (5%)

Query: 82   MEVQPGEAATLSCTL--TSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQA 139
            M V  GE  TL C +  T +L    W+KDG  LT+     F     + SL I  V+   A
Sbjct: 5713 MTVTVGETCTLECKVAGTPELSV-EWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDA 5771

Query: 140  GRYTFV----AGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPI 195
            G YTF      G     A + V D   + P  T +L+    V  G   I++       PI
Sbjct: 5772 GTYTFQVQNNVGKSSCTAVVDVSDR-AVPPSFTRRLKNTGGV-LGASCILECKVAGSSPI 5829

Query: 196  QAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTL 255
              AW  +  ++V  S  + Q    D    L L S    D G Y+    +  GS +    L
Sbjct: 5830 SVAWFHEKTKIV--SGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVL 5887

Query: 256  QVIDKP 261
             V + P
Sbjct: 5888 TVQEPP 5893



 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 33/94 (35%), Positives = 45/94 (47%)

Query: 770   LSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVC 829
             L   PR  + +RSH +P G        VQ  P   V W+ N   L+ +  ++ T+  GV 
Sbjct: 32370 LDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVL 32429

Query: 830   SLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
             +L I      DSG Y+AV  N  G+A   ATL V
Sbjct: 32430 TLEILDCHTDDSGTYRAVCTNYKGEASDYATLDV 32463



 Score = 56.2 bits (134), Expect = 1e-07
 Identities = 77/334 (23%), Positives = 125/334 (37%), Gaps = 38/334 (11%)

Query: 540  NEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTW 599
            N+ G  + SA+ T+++   +   P         + +TV  G+   +       P     W
Sbjct: 6628 NDAGMRECSAVLTVLEPARIIEKP---------EPMTVTTGNPFALECVVTGTPELSAKW 6678

Query: 600  LKDGLPLP---KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAA 656
             KDG  L    K  +T     +  L IP A +SD GLY+  ++   GK    +  + V+ 
Sbjct: 6679 FKDGRELSADSKHHITFINK-VASLKIPCAEMSDKGLYSFEVKNSVGKSNC-TVSVHVSD 6736

Query: 657  CPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSS--AHGPWHEAADRIHTN 714
                P  I   ++V   + A        +   P+    F   +    GP  +++   +  
Sbjct: 6737 RIVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVC 6796

Query: 715  RFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKP 774
               L  + P     +  VA N  G+ + S               TV+ P    P   Q P
Sbjct: 6797 TLNLSLLEPSDTGIYTCVAANVAGSDECSAV------------LTVQEP----PSFEQTP 6840

Query: 775  RFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIP 834
              +      +LP G     +  ++G+P   V WFK  R L    +   +    V  L + 
Sbjct: 6841 DSV-----EVLP-GMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELF 6894

Query: 835  SVSPKDSGEYKAVAENTLGQAVSTATLIVIEPST 868
             V P +SG+Y  +  N  G A  T  L V EP+T
Sbjct: 6895 EVQPLESGDYSCLVTNDAGSASCTTHLFVKEPAT 6928



 Score = 55.8 bits (133), Expect = 2e-07
 Identities = 33/95 (34%), Positives = 50/95 (52%), Gaps = 2/95 (2%)

Query: 771 SQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGN--PAVYSTDLLGV 828
           +Q P F   L+S ++ +G        + G P P V+WF++ + +  +  P V  +   G 
Sbjct: 3   TQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR 62

Query: 829 CSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
             LTIP+V+  +SG Y   A N  GQA STA L+V
Sbjct: 63  AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLV 97



 Score = 55.5 bits (132), Expect = 2e-07
 Identities = 55/211 (26%), Positives = 81/211 (38%), Gaps = 14/211 (6%)

Query: 42    IYGERRDATRSSTSRYKPGTGSFSKDAQGPMGHFSQGLADMEVQP----GEAATLSCTLT 97
             I  ERR     S     P    F+   +     F + + D+ +      G +A   C ++
Sbjct: 11084 IEAERRKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIILTESEFVGSSAIFECLVS 11143

Query: 98    SDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVA----GDQQSEA 153
                   TW KDG  +       F  DG    L I  VQ + AG YT V      ++ S A
Sbjct: 11144 PSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTA 11203

Query: 154   TLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDRE 213
              L V++ P       + L E + V  G+P+ +         +   WRKDG  VV    R 
Sbjct: 11204 KLVVEELPV---RFVKTLEEEVTVVKGQPLYLSCELNKERDV--VWRKDGKIVVEKPGRI 11258

Query: 214   AQVDLGDGYTRLCLPSAGRKDCGQYSVTLRS 244
                 +G     L +  A   D G Y+VT+ +
Sbjct: 11259 VPGVIG-LMRALTINDADDTDAGTYTVTVEN 11288



 Score = 54.7 bits (130), Expect = 4e-07
 Identities = 176/846 (20%), Positives = 300/846 (35%), Gaps = 162/846 (19%)

Query: 82   MEVQPGEAATLSCTLTSDLG-PGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAG 140
            +EV PG+  T +  +         WF+   +L   D      +  V  L + ++  +Q+G
Sbjct: 5902 LEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSG 5961

Query: 141  RYTFVAGDQQSEATLT----VQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQ 196
             YT V  +   +A+ T    V++       +++   EP     GK +I++  +   LPI 
Sbjct: 5962 EYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDHSVEP-----GKSIILESTYTGTLPIS 6016

Query: 197  AAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQ 256
              W+KDG  +  ++  +  +   +    L + ++ ++D GQYS  + +E G    ++   
Sbjct: 6017 VTWKKDGFNI--TTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAG---RDVCGA 6071

Query: 257  VIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTW---LKVGE 313
            ++   +PP    E++    A               +++C V    +   S +    K+  
Sbjct: 6072 LVSTLEPPYFVTELEPLEAA----------VGDSVSLQCQVAGTPEITVSWYKGDTKLRP 6121

Query: 314  APADSTTFTD---------AHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAP 364
             P   T FT+          ++    +YT +         G A       +    LP + 
Sbjct: 6122 TPEYRTYFTNNVATLVFNKVNINDSGEYTCK----AENSIGTASSKTVFRIQERQLPPSF 6177

Query: 365  SAPAILSASSQGITLTWTAPRGPGSAHIL------GYLIERRKKGSNTWTAVNDQPVPER 418
            +        + G+ +T T  R  GSA I       G L+   +   N  T+  D  V   
Sbjct: 6178 ARQLKDIEQTVGLPVTLTC-RLNGSAPIQVCWYRDGVLL---RDDENLQTSFVDN-VATL 6232

Query: 419  RWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSI 478
            +    D+    QY     + + S P      S  + AR+P + P         D    SI
Sbjct: 6233 KILQTDLSHSGQY-----SCSASNPLGTASSSARLTAREPKKSP-------FFDIKPVSI 6280

Query: 479  TLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHV-GTVPVTTYTAKG---LRPGEGYFV 534
                   D   G+ A                 CHV G  P+    +K    +RPG  Y +
Sbjct: 6281 -------DVIAGESAD--------------FECHVTGAQPMRITWSKDNKEIRPGGNYTI 6319

Query: 535  ---------RVTAVNEGGQSQPS-------ALDTLVQAMPVTVCPKFLVDSSTKDLLTVK 578
                     R+  V +G   Q +         D     + V   PKF+       +   K
Sbjct: 6320 TCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKV--AK 6377

Query: 579  VGDTVRVPVSFEAMPMPEVTWLKDGLPLP---KRSVTVTKDGLTQLLIPVAGLSDSGLYT 635
             G+++++       P  +V+W ++   L    K +++   + +  L I  A   DSG Y 
Sbjct: 6378 QGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFI-NSVALLTINEASAEDSGDYI 6436

Query: 636  VVLRTLQGKEVAHSFRIRVAACP---QAPGPIH--------LQENVPGTVTAEWEPSPDE 684
                   G + + S  + V A P   Q P P+         LQ  + GT   E     D 
Sbjct: 6437 CEAHNGVG-DASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDR 6495

Query: 685  AQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSD 744
             Q    +   F  +S H    + +  I     + +G     EYH +  A NE+G    SD
Sbjct: 6496 KQ--VRNSKKFKITSKH---FDTSLHILNLEASDVG-----EYHCK--ATNEVG----SD 6539

Query: 745  TSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPH 804
            T                  C       + PRF+  L       G    +   V+G     
Sbjct: 6540 T------------------CSCSVKFKEPPRFVKKLSDTSTLIGDAVELRAIVEGFQPIS 6581

Query: 805  VTWFKNDRSL---EGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATL 861
            V W K+   +     N  +   D +    L  P  S  +SG+Y    +N  G    +A L
Sbjct: 6582 VVWLKDRGEVIRESENTRISFIDNIATLQLGSPEAS--NSGKYICQIKNDAGMRECSAVL 6639

Query: 862  IVIEPS 867
             V+EP+
Sbjct: 6640 TVLEPA 6645



 Score = 52.8 bits (125), Expect = 1e-06
 Identities = 80/327 (24%), Positives = 120/327 (36%), Gaps = 46/327 (14%)

Query: 580  GDTVRVPVSFEAMPMPEVTWLKDGLPLPK---RSVTVTKDGLTQLLIPVAGLSDSGLYTV 636
            G T R  +     PMPE  W  DG  +       V + +DG   L+I  A  SDSG +TV
Sbjct: 1471 GQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTV 1530

Query: 637  VLRTLQGKEVAHSFRIRVAACPQAPGPIHLQE----------NVPGTVTAEWEPSPD--- 683
            V +   G+  + S  + V A      P+ +++           +   V A   P+PD   
Sbjct: 1531 VAQNRAGRS-SISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVW 1589

Query: 684  -EAQDVPLHYAVFTRSSAHGPWHEAADRIHTN------RFTLLGILPGHEYHFRVVAKNE 736
             +  D+ + +  + +    G   EAA +I +        +T   I        R     E
Sbjct: 1590 LKNSDIIVPHK-YPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVE 1648

Query: 737  LGASKPSDTSQPWCIPRQRDRFTVKAPCYREP------------------DLSQKPRFLV 778
            +  ++P +  +   IPR   R    A    EP                  +  QKP F  
Sbjct: 1649 VEFAEP-EPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKK 1707

Query: 779  GLRSHLLPQGCECCMSCAVQ--GSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSV 836
             L S  L +       C +   G P   V W  + + LE    +   +  G CSL     
Sbjct: 1708 KLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVA 1767

Query: 837  SPKDSGEYKAVAENTLGQAVSTATLIV 863
              +DSG     A N  G   ++ATLIV
Sbjct: 1768 YSRDSGIITCRATNKYGTDHTSATLIV 1794



 Score = 52.8 bits (125), Expect = 1e-06
 Identities = 71/302 (23%), Positives = 111/302 (36%), Gaps = 29/302 (9%)

Query: 577  VKVGDTVRVPVSFEAMPMP-EVTWLKDGLPL----PKRSVTVTKDGLTQLLIPVAGLSDS 631
            V+V +  R  V FE      +  W KDG+ +     +R   V +  + ++ I     SD+
Sbjct: 3156 VQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDA 3215

Query: 632  GLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIH-LQENVPGTVTAEWEPSPDEAQDVPL 690
            G YT V         A   R  V     AP P   LQE  P TV +         +    
Sbjct: 3216 GEYTFV---------AGRNRSSVTLYVNAPEPPQVLQELQPVTVQS--------GKPARF 3258

Query: 691  HYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVV-AKNELGASKPSDTSQPW 749
               +  R      W++    + T  F    +  G EY   ++ A  E  A    +    +
Sbjct: 3259 CAVISGRPQPKISWYKEEQLLSTG-FKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDY 3317

Query: 750  CIPRQRDRFTVKAPCYREPDLSQK---PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVT 806
             +       +V+ P    PD       P  +  L+  +  +G      C V G+    V+
Sbjct: 3318 GVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLK-VS 3376

Query: 807  WFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIEP 866
            W+  D+ ++ +     T       L I    P+D G Y  VA N +GQ  STA L +  P
Sbjct: 3377 WYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAP 3436

Query: 867  ST 868
             +
Sbjct: 3437 ES 3438



 Score = 52.4 bits (124), Expect = 2e-06
 Identities = 35/133 (26%), Positives = 62/133 (46%), Gaps = 7/133 (5%)

Query: 74   HFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITH 133
            H ++ + ++EV   + A+  C ++    P  W K+GV++   +       G +H L I +
Sbjct: 2883 HITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMN 2942

Query: 134  VQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHL 193
                 +  YTFV G+ Q  ATLTV  +P +   +T  L++  +    K  I      ++ 
Sbjct: 2943 TSTEDSAEYTFVCGNDQVSATLTV--TPIM---ITSMLKD--INAEEKDTITFEVTVNYE 2995

Query: 194  PIQAAWRKDGAEV 206
             I   W K+G E+
Sbjct: 2996 GISYKWLKNGVEI 3008



 Score = 52.4 bits (124), Expect = 2e-06
 Identities = 71/324 (21%), Positives = 120/324 (37%), Gaps = 37/324 (11%)

Query: 551  DTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRS 610
            DT V  + +   P+F+   S  + LTV  G+   +  S E      V WLK+   + + S
Sbjct: 5598 DTCVCTVKLKEPPRFV---SKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRES 5654

Query: 611  VTVT---KDGLTQLLIPVAGLSDSGLYTVVLRTLQG--KEVAHSFRIRVAACPQAPGPIH 665
              +     + +  L    A  +++G Y   ++   G  + +A    +  A   +  GP+ 
Sbjct: 5655 ENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMT 5714

Query: 666  LQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGH 725
            +      T+  +   +P+ + +      + T S  H       ++I + R   +      
Sbjct: 5715 VTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHK--FSFYNKISSLRILSVERQDAG 5772

Query: 726  EYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQK---PRFLVGLRS 782
             Y F+V  +N +G                      K+ C    D+S +   P F   L++
Sbjct: 5773 TYTFQV--QNNVG----------------------KSSCTAVVDVSDRAVPPSFTRRLKN 5808

Query: 783  HLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSG 842
                 G  C + C V GS    V WF     +       +T    VC+L + S+   D G
Sbjct: 5809 TGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMG 5868

Query: 843  EYKAVAENTLGQAVSTATLIVIEP 866
             Y  VA N  G     A L V EP
Sbjct: 5869 NYTCVAANVAGSDECRAVLTVQEP 5892



 Score = 52.4 bits (124), Expect = 2e-06
 Identities = 78/321 (24%), Positives = 116/321 (36%), Gaps = 55/321 (17%)

Query: 563  PKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTK---DGLT 619
            P+F+   S    L   +GD V +    E      V WLKD   + + S        D + 
Sbjct: 6551 PRFVKKLSDTSTL---IGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIA 6607

Query: 620  QLLIPVAGLSDSGLYTVVLRTLQG-KEVAHSFRI----RVAACPQ-----APGPIHLQEN 669
             L +     S+SG Y   ++   G +E +    +    R+   P+        P  L+  
Sbjct: 6608 TLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARIIEKPEPMTVTTGNPFALECV 6667

Query: 670  VPGT--VTAEWEPSPDEAQDVPLHYAVFTR--SSAHGPWHEAADRIHTNRFTLLGILPGH 725
            V GT  ++A+W     E      H+  F    +S   P  E +D+         G+    
Sbjct: 6668 VTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDK---------GL---- 6714

Query: 726  EYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLL 785
             Y F V  KN +G S                  TV        D    P F+  L+    
Sbjct: 6715 -YSFEV--KNSVGKSN----------------CTVSV---HVSDRIVPPSFIRKLKDVNA 6752

Query: 786  PQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYK 845
              G    + C V GS    V WF++   +   P   S+    VC+L +  + P D+G Y 
Sbjct: 6753 ILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYT 6812

Query: 846  AVAENTLGQAVSTATLIVIEP 866
             VA N  G    +A L V EP
Sbjct: 6813 CVAANVAGSDECSAVLTVQEP 6833



 Score = 52.4 bits (124), Expect = 2e-06
 Identities = 49/196 (25%), Positives = 85/196 (43%), Gaps = 13/196 (6%)

Query: 75   FSQGLADMEVQPGEAATLSCTLT-SDLGPGTWFKD-GVKLTTQDGVIFKQDGLVHSLFIT 132
            F + L+D+    G+   L  T+  ++     WFKD G  +   D +       + +L  +
Sbjct: 7494 FVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIATLQFS 7553

Query: 133  HVQGTQAGRYTFV----AGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIP 188
             V+   AG+YT      AG Q+  ATL+V +  TI      +  E + V  G    ++  
Sbjct: 7554 RVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIV-----EKPESIKVTTGDTCTLECT 7608

Query: 189  FQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGS 248
                  +   W KDG E+  +SD + ++   +  + L + +    D G YS  +++  G 
Sbjct: 7609 VAGTPELSTKWFKDGKEL--TSDNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGK 7666

Query: 249  VQAELTLQVIDKPDPP 264
                 +LQV D+  PP
Sbjct: 7667 DSCTASLQVSDRTVPP 7682



 Score = 52.0 bits (123), Expect = 2e-06
 Identities = 49/193 (25%), Positives = 74/193 (38%), Gaps = 5/193 (2%)

Query: 82   MEVQPGEAATLSCTLTSDLG-PGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAG 140
            M V  G    L C +T        WFKDG +L+            V SL I   + +  G
Sbjct: 6654 MTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKG 6713

Query: 141  RYTFVAGDQ--QSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAA 198
             Y+F   +   +S  T++V  S  I P    +  + +    G  V+++       PI   
Sbjct: 6714 LYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVG 6773

Query: 199  WRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVI 258
            W +DG E+V  S  + Q    +    L L      D G Y+    +  GS +    L V 
Sbjct: 6774 WFQDGNEIV--SGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQ 6831

Query: 259  DKPDPPQGPMEVQ 271
            + P   Q P  V+
Sbjct: 6832 EPPSFEQTPDSVE 6844



 Score = 51.6 bits (122), Expect = 3e-06
 Identities = 84/371 (22%), Positives = 145/371 (39%), Gaps = 49/371 (13%)

Query: 75   FSQGLADMEVQPGEAATLSCTLTSDLG-PGTWFKDGVKLTTQDGVIFKQDGLVHSLFIT- 132
            F   LA ++   GE+A   C +T       +W KD  ++  + G  ++   L +S  +T 
Sbjct: 8155 FDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREI--RSGGKYQISYLENSAHLTV 8212

Query: 133  -HVQGTQAGRYTFVAGDQQSEATLTVQ---DSPTIAPDVTEKLREPLVVKAGKPVIVKIP 188
              V    +G+YT  A ++  + + T Q       I P  T++L E +    G    ++  
Sbjct: 8213 LKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKRLSETVEETEGNSFKLEGR 8272

Query: 189  FQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGS 248
                 PI  AW K+  E+  +S+ E  +   +    L +  AG  D G Y+  + ++ GS
Sbjct: 8273 VAGSQPITVAWYKNNIEIQPTSNCE--ITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGS 8330

Query: 249  VQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVE--CYVVERRQAGRS 306
                 ++ + +   PP     V D H   V +       + G  V+  C+ V+  +  R 
Sbjct: 8331 ALCTSSIVIKEPKKPP-----VFDQHLTPVTV-------SEGEYVQLSCH-VQGSEPIRI 8377

Query: 307  TWLKVGE--APADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEAL---- 360
             WLK G    P+D  +F+ A           +R V    +G+ +     +   +      
Sbjct: 8378 QWLKAGREIKPSDRCSFSFA----SGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKV 8433

Query: 361  ---PKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTA-VNDQPVP 416
                K   APA   A+  G     + P+           I   +K + T+ A V   P+P
Sbjct: 8434 TIKDKPAVAPATKKAAVDGRLFFVSEPQS----------IRVVEKTTATFIAKVGGDPIP 8483

Query: 417  ERRWTVADVRQ 427
              +WT    RQ
Sbjct: 8484 NVKWTKGKWRQ 8494



 Score = 51.2 bits (121), Expect = 4e-06
 Identities = 46/171 (26%), Positives = 78/171 (45%), Gaps = 10/171 (5%)

Query: 79   LADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQ 138
            L D+  +  +  T   T+  +     W K+GV++ + D    +   L HSL I +V    
Sbjct: 2975 LKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGD 3034

Query: 139  AGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAA 198
            A  YTFVAG   S ATL V+       +  + +++  V++  + +      +  + +Q  
Sbjct: 3035 AADYTFVAGKATSTATLYVEARHI---EFRKHIKDIKVLEKKRAMFECEVSEPDITVQ-- 3089

Query: 199  WRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSV 249
            W KD  E +  +DR  ++       RL +PS    D G+Y+V     GG+V
Sbjct: 3090 WMKDDQE-LQITDR-IKIQKEKYVHRLLIPSTRMSDAGKYTVV---AGGNV 3135



 Score = 51.2 bits (121), Expect = 4e-06
 Identities = 28/92 (30%), Positives = 41/92 (44%)

Query: 772  QKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSL 831
            + P F+  L       G    + C V G+P   ++W+K    L   PA        V SL
Sbjct: 7018 EPPYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASL 7077

Query: 832  TIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
             I  V   D GEY   A+N++G   S+A L++
Sbjct: 7078 VINKVDHSDVGEYSCKADNSVGAVASSAVLVI 7109



 Score = 50.8 bits (120), Expect = 5e-06
 Identities = 27/98 (27%), Positives = 50/98 (51%), Gaps = 1/98 (1%)

Query: 770  LSQKPRFLVGLR-SHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGV 828
            +++ P+F+  L  S ++  G    + C + GSP   V WF+N+  L  +     T +  V
Sbjct: 5419 VTEPPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSV 5478

Query: 829  CSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIEP 866
              + + ++S +DSG++   A+N  G    +  +IV EP
Sbjct: 5479 AVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEP 5516



 Score = 50.8 bits (120), Expect = 5e-06
 Identities = 87/386 (22%), Positives = 142/386 (36%), Gaps = 59/386 (15%)

Query: 511  CHV-GTVPVTTYTAKG---LRPGEGY---FVRVTAV--------NEGGQ-----SQPSAL 550
            CHV GT P+    AK    +RPG  Y    V  TA          + GQ     S  +  
Sbjct: 7233 CHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGK 7292

Query: 551  DTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRS 610
            D+    + V   P+F+       +  VK  +  R        P  +V W KD   + + S
Sbjct: 7293 DSCSAQLGVQEPPRFIKKLEPSRI--VKQDEFTRYECKIGGSPEIKVLWYKDETEIQESS 7350

Query: 611  VTVTK--DGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACP---QAPGPIH 665
                   D +  L +    + DSG YT       G   + S  ++V   P   + P PI 
Sbjct: 7351 KFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGS-ASSSTSLKVKEPPIFRKKPHPIE 7409

Query: 666  LQENVPGTVTAEWEPSPDEAQDVPLHYAVFT--RSSAHGPWHEAADRIHTNRFTLLGILP 723
              +     +  E + +P      P H + +   R    G  ++           +L +  
Sbjct: 7410 TLKGADVHLECELQGTP------PFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDA 7463

Query: 724  GHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSH 783
                 ++  A N++G    SDT    C+        +KAP          PRF+  L   
Sbjct: 7464 ADIGEYQCKATNDVG----SDT----CV----GSIALKAP----------PRFVKKLSDI 7501

Query: 784  LLPQGCECCMSCAVQGSPRPHVTWFKNDRSL-EGNPAVYSTDLLGVCSLTIPSVSPKDSG 842
                G E  +   ++G+    V WFK+   +   +  ++ +    + +L    V P ++G
Sbjct: 7502 STVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAG 7561

Query: 843  EYKAVAENTLGQAVSTATLIVIEPST 868
            +Y    +N  G     ATL V+EP+T
Sbjct: 7562 KYTCQIKNDAGMQECFATLSVLEPAT 7587



 Score = 50.4 bits (119), Expect = 7e-06
 Identities = 46/193 (23%), Positives = 81/193 (41%), Gaps = 14/193 (7%)

Query: 75   FSQGLADMEVQPGEAATLSCTLTSDLGPGT------WFKDGVKLTTQDGVIFKQDGLVHS 128
            F Q    +EV PG    +S T TS +  GT      WFK   +L   +      +  V  
Sbjct: 6836 FEQTPDSVEVLPG----MSLTFTSVIR-GTPPFKVKWFKGSRELVPGESCNISLEDFVTE 6890

Query: 129  LFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIP 188
            L +  VQ  ++G Y+ +  +    A+ T            ++L +   V+ G P++++  
Sbjct: 6891 LELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLAD-FSVETGSPIVLEAT 6949

Query: 189  FQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGS 248
            +    PI  +W KD  E + S      + + +  T L +  +  +D  QYS  + +E G 
Sbjct: 6950 YTGTPPISVSWIKD--EYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQ 7007

Query: 249  VQAELTLQVIDKP 261
               E  + V++ P
Sbjct: 7008 DICEALVSVLEPP 7020



 Score = 50.1 bits (118), Expect = 9e-06
 Identities = 44/196 (22%), Positives = 84/196 (42%), Gaps = 9/196 (4%)

Query: 69   QGPMGHFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHS 128
            +G +  F + L D+EV    +  L C ++ +   G W+ + V+L +             +
Sbjct: 2263 EGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQN 2322

Query: 129  LFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAG-KPVIVKI 187
            L +  V     G Y+FV   +++   L ++  P     + + L +  V +     + VK+
Sbjct: 2323 LTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIA---ILQGLSDQKVCEGDIVQLEVKV 2379

Query: 188  PFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGG 247
              +S   ++  W KDG E V  SDR   + +      L +    ++D G YS T+ + G 
Sbjct: 2380 SLES---VEGVWMKDGQE-VQPSDR-VHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGL 2434

Query: 248  SVQAELTLQVIDKPDP 263
            S    +++  +D   P
Sbjct: 2435 STSGRVSVYSVDVITP 2450



 Score = 50.1 bits (118), Expect = 9e-06
 Identities = 50/198 (25%), Positives = 81/198 (40%), Gaps = 13/198 (6%)

Query: 74   HFSQGLADMEVQPGEAATLSCTLTSDLGPG---TWFKDGVKLTTQDGVIFKQDGLVHSLF 130
            +F + L  +E   GE ATL C +  D  P    +W+K+  KL +      +    V SL 
Sbjct: 7021 YFIEPLEHVEAVIGEPATLQCKV--DGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLV 7078

Query: 131  ITHVQGTQAGRYTFVA----GDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVK 186
            I  V  +  G Y+  A    G   S A L ++ +  + P    KL++ +    G PV  +
Sbjct: 7079 INKVDHSDVGEYSCKADNSVGAVASSAVLVIK-ARKLPPFFARKLKD-VHETLGFPVAFE 7136

Query: 187  IPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEG 246
                   P+Q +W KDG  V+   D   Q         L +    +   GQY+ +  +  
Sbjct: 7137 CRINGSEPLQVSWYKDG--VLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPL 7194

Query: 247  GSVQAELTLQVIDKPDPP 264
            G+  +   L + +   PP
Sbjct: 7195 GTASSSAKLILSEHEVPP 7212



 Score = 49.3 bits (116), Expect = 2e-05
 Identities = 49/195 (25%), Positives = 75/195 (38%), Gaps = 13/195 (6%)

Query: 75    FSQGLADMEVQPGEAATLSCTLTSDLGPG-TWFKDGVKLTTQDG---VIFKQDGLVHSLF 130
             F+  L +     GE      T+T    P  TW+K G K+   D      F+ D  ++ L 
Sbjct: 31692 FTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLT 31751

Query: 131   ITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKA--------GKP 182
             I  V       YT VA ++  E +   + + T+ P  T+    P+  +         G+ 
Sbjct: 31752 INSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQS 31811

Query: 183   VIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTL 242
             V  +I      P    W KDG  +    + E  +  G  Y  L +     +D G Y VT 
Sbjct: 31812 VCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEI-IHEGLDYYALHIRDTLPEDTGYYRVTA 31870

Query: 243   RSEGGSVQAELTLQV 257
              +  GS   +  LQV
Sbjct: 31871 TNTAGSTSCQAHLQV 31885



 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 28/90 (31%), Positives = 47/90 (52%)

Query: 774 PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTI 833
           P F+  L+S  + QG +  +   V G P P V ++++   ++ +     +    + SL I
Sbjct: 104 PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLI 163

Query: 834 PSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
               P+DSG Y   A N++G+A STA L+V
Sbjct: 164 AEAYPEDSGTYSVNATNSVGRATSTAELLV 193



 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 1/94 (1%)

Query: 774  PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTI 833
            P  + GL++  + +G    + C + G P P VTW++ D  +E +     T   G+  L I
Sbjct: 943  PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMI 1002

Query: 834  PSVSPKDSGEYKAVAENTLGQAVSTATLIVIEPS 867
                 +DSG +   A N  G  VST+  + ++ S
Sbjct: 1003 REAFAEDSGRFTCSAVNEAG-TVSTSCYLAVQVS 1035



 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 53/208 (25%), Positives = 82/208 (39%), Gaps = 18/208 (8%)

Query: 65   SKDAQGPM-----GHFSQGLADMEVQPGEAATLSCTLTSDLGPGT--WFKDGVKLTTQDG 117
            SKD+ G +       F       +V PG A  L  T      P T  WFK   +L +   
Sbjct: 4193 SKDSSGALIVQEPPSFVTKPGSKDVLPGSAVCLKSTFQGST-PLTIRWFKGNKELVSGGS 4251

Query: 118  VIFKQDGLVHSLFITHVQGTQAGRYTF----VAGDQQSEATLTVQDSPTIAPDVTEKLRE 173
                ++ L  SL +  V+ + +G YT     VAG  +  A L V++  T      EKL  
Sbjct: 4252 CYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFV----EKLEP 4307

Query: 174  PLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRK 233
              ++K G    +        PI+  W  +  E+  SS    ++   +    L L   G +
Sbjct: 4308 SQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKH--RMSFVESTAVLRLTDVGIE 4365

Query: 234  DCGQYSVTLRSEGGSVQAELTLQVIDKP 261
            D G+Y    ++E GS      + V + P
Sbjct: 4366 DSGEYMCEAQNEAGSDHCSSIVIVKESP 4393



 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 46/166 (27%), Positives = 73/166 (43%), Gaps = 9/166 (5%)

Query: 75    FSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHV 134
             F   L D+  +  E+A  +  L+ D     WFK+  +L T   V  + +G  HS+    +
Sbjct: 11931 FLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDL 11990

Query: 135   QGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLP 194
                   +    A    SEA LTV +     P  T KL++   V+  + ++     ++  P
Sbjct: 11991 SIDDTSQIRVEAMGMSSEAKLTVLEGD---PYFTGKLQDYTGVEKDEVILQCEISKADAP 12047

Query: 195   IQAAWRKDGAEVVGSSDREAQVDLGDGYTR-LCLPSAGRKDCGQYS 239
             ++  W KDG E+  S +    V   DG  R L L  A + D GQY+
Sbjct: 12048 VK--WFKDGKEIKPSKN---AVIKADGKKRMLILKKALKSDIGQYT 12088



 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 51/215 (23%), Positives = 93/215 (43%), Gaps = 27/215 (12%)

Query: 658   PQAPGPIHLQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTN-- 714
             P  P    + +    +++  W +P  D   D+ + Y +  +      W+    R+HTN  
Sbjct: 29342 PGPPSAPRVVDTTKHSISLAWTKPMYDGGTDI-VGYVLEMQEKDTDQWY----RVHTNAT 29396

Query: 715   ----RFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDL 770
                  FT+  +  G +Y FRV A N  G S+ S++      P +R    ++ P   + +L
Sbjct: 29397 IRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAE-IEPVER----IEIP---DLEL 29448

Query: 771   SQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCS 830
             +   +  V +R+     G    +  +V G P P +TW K    L     + +T+   +  
Sbjct: 29449 ADDLKKTVTIRA-----GASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSL-- 29501

Query: 831   LTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
             L +  V+  D+G+Y   AEN  G+  +T  + V +
Sbjct: 29502 LIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYD 29536



 Score = 48.1 bits (113), Expect = 3e-05
 Identities = 61/279 (21%), Positives = 101/279 (36%), Gaps = 54/279 (19%)

Query: 593  PMPEVTWLKDGLPLP---KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHS 649
            P+P++ W KDG  +    +  +   +DG   L IPV    D G+YT     ++G  +  S
Sbjct: 1318 PLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAIC-S 1376

Query: 650  FRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAAD 709
             ++ V        P ++    P +      P                RS +  P   +  
Sbjct: 1377 GKLYVEPAAPLGAPTYIPTLEPVSRIRSLSP----------------RSVSRSPIRMSPA 1420

Query: 710  RIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPD 769
            R+   R +                        P+  S     P +R   T ++   R   
Sbjct: 1421 RMSPARMS------------------------PARMSPARMSPGRRLEETDESQLER--- 1453

Query: 770  LSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGN---PAVYSTDLL 826
               KP F++   S    +G        V G P P   WF + + +  +     V   D  
Sbjct: 1454 -LYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKED-- 1510

Query: 827  GVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
            G  SL I   +P DSGE+  VA+N  G++ S + ++ +E
Sbjct: 1511 GTQSLIIVPATPSDSGEWTVVAQNRAGRS-SISVILTVE 1548



 Score = 47.4 bits (111), Expect = 6e-05
 Identities = 68/314 (21%), Positives = 110/314 (35%), Gaps = 37/314 (11%)

Query: 575  LTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKR-SVTVTKDGLTQLLIPVAGL-SDSG 632
            +TV+ G   R        P P+++W K+   L          DG    L+ +     D+ 
Sbjct: 3248 VTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAA 3307

Query: 633  LYTVVLRTLQG---KEVAHSFRIRVAACPQAPGPIH---LQENVPGTVTAEWEPSPDEAQ 686
            +YT   +   G      + S  +     P    P++   +   +  TVT+E +P+  + +
Sbjct: 3308 VYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCR 3367

Query: 687  DVPLHYAVFTRSSAHGPWHEAADRIHTNRF------------TLLGILPGHEYHFRVVAK 734
                     + +     W+    +I  +RF             +    P  E  +  VA 
Sbjct: 3368 --------VSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVAS 3419

Query: 735  NELG-ASKPSDTS--QPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCEC 791
            N +G  S  ++ S   P  I  +R    ++      P + +K   L     HL    CE 
Sbjct: 3420 NAVGQVSSTANLSLEAPESILHERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCE- 3478

Query: 792  CMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENT 851
                 +Q +P     WFK  R +  +          + SL I      D GEY   A N 
Sbjct: 3479 -----IQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNE 3533

Query: 852  LGQAVSTATLIVIE 865
             G    TATL V E
Sbjct: 3534 YGSVSCTATLTVTE 3547



 Score = 47.4 bits (111), Expect = 6e-05
 Identities = 156/852 (18%), Positives = 283/852 (33%), Gaps = 120/852 (14%)

Query: 61   TGSFSKDAQGPMGHFSQGL-----------------ADMEVQPGEAATLSCTLTSDLGPG 103
            +G +S  A  P+G  S                      ++V  GE+A   C +T      
Sbjct: 6242 SGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMR 6301

Query: 104  -TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPT 162
             TW KD  ++           G    L I  V    +G+YT  A +   +   + Q S  
Sbjct: 6302 ITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVK 6361

Query: 163  IAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGY 222
              P   +KL    V K G+ + ++        I+ +W ++ +E+      +  +   +  
Sbjct: 6362 EPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSEL--HESWKYNMSFINSV 6419

Query: 223  TRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRW 282
              L +  A  +D G Y     +  G       L V   P   Q P  V     + V L+ 
Sbjct: 6420 ALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQC 6479

Query: 283  R----PPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRA 338
                 PP +        +V +R+Q   S   K+     D T+    ++E      +  +A
Sbjct: 6480 EISGTPPFE------VVWVKDRKQVRNSKKFKITSKHFD-TSLHILNLEASDVGEYHCKA 6532

Query: 339  VTSEGAGEALESEEILVAPEALPKAPSAPAILS---------ASSQGITLTWTAPRGPGS 389
                G+     S +    P  + K      ++             Q I++ W   RG   
Sbjct: 6533 TNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRG--- 6589

Query: 390  AHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQG---CQYEFRVTAVAPSGPGEP 446
                    E  ++  NT  +  D     +  +      G   CQ +        S     
Sbjct: 6590 --------EVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTV 6641

Query: 447  GPPSDAVFARDPMR-PPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDS 505
              P+  +   +PM    G    L+        ++  W     +   +++ ++  +    S
Sbjct: 6642 LEPARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVAS 6701

Query: 506  LQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKF 565
            L+        +P    + KGL   E         N  G+S        V      V P F
Sbjct: 6702 LK--------IPCAEMSDKGLYSFE-------VKNSVGKSN---CTVSVHVSDRIVPPSF 6743

Query: 566  LVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPL---PKRSVTVTKDGLTQLL 622
            +     KD+  + +G +V +           V W +DG  +   PK   + +++  T L 
Sbjct: 6744 I--RKLKDVNAI-LGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCT-LN 6799

Query: 623  IPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSP 682
            + +   SD+G+YT V   + G +             +    + +QE         +E +P
Sbjct: 6800 LSLLEPSDTGIYTCVAANVAGSD-------------ECSAVLTVQE------PPSFEQTP 6840

Query: 683  DEAQDVPLHYAVFTRSSAHGP-----WHEAADRIHTNRFTLLGILPGHEYHFRV---VAK 734
            D  + +P     FT      P     W + +            ++PG   +  +   V +
Sbjct: 6841 DSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRE----------LVPGESCNISLEDFVTE 6890

Query: 735  NELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMS 794
             EL   +P ++    C+          A C     + +   F+  L    +  G    + 
Sbjct: 6891 LELFEVQPLESGDYSCLVTND---AGSASCTTHLFVKEPATFVKRLADFSVETGSPIVLE 6947

Query: 795  CAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQ 854
                G+P   V+W K++  +  +     T       L I   + +D  +Y  + EN  GQ
Sbjct: 6948 ATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQ 7007

Query: 855  AVSTATLIVIEP 866
             +  A + V+EP
Sbjct: 7008 DICEALVSVLEP 7019



 Score = 47.4 bits (111), Expect = 6e-05
 Identities = 163/825 (19%), Positives = 276/825 (33%), Gaps = 106/825 (12%)

Query: 75   FSQGLADMEVQPGEAATLSCTLT-SDLGPGTWFKDGVKLTTQDGVIFKQDGLVHS---LF 130
            F++ L D+    G      C +  S+    +W+KDGV L     +   Q   VH+   L 
Sbjct: 7118 FARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANL---QTSFVHNVATLQ 7174

Query: 131  ITHVQGTQAGRYTFVA----GDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVK 186
            I     +  G+Y   A    G   S A L + +     P   +     + +  G+    K
Sbjct: 7175 ILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEV--PPFFDLKPVSVDLALGESGTFK 7232

Query: 187  IPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEG 246
                   PI+  W KD  E+    + +  + L +    L +   G+ D GQY+    +  
Sbjct: 7233 CHVTGTAPIKITWAKDNREIRPGGNYK--MTLVENTATLTVLKVGKGDAGQYTCYASNIA 7290

Query: 247  G--SVQAELTLQVIDKPDPPQ--GPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQ 302
            G  S  A+L +Q     +PP+    +E     +     R+             +  +  +
Sbjct: 7291 GKDSCSAQLGVQ-----EPPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETE 7345

Query: 303  AGRSTWLKVGEAPADSTTFTDAH---VEPGRKYTFRVRAVTSEGAGEALESEEILVA-PE 358
               S+  ++     DS    + H   VE    YT          AG A  S  + V  P 
Sbjct: 7346 IQESSKFRMSFV--DSVAVLEMHNLSVEDSGDYTCEAH----NAAGSASSSTSLKVKEPP 7399

Query: 359  ALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPER 418
               K P     L  +   +       +G    H+  Y  +R  +    +  +++  +   
Sbjct: 7400 IFRKKPHPIETLKGADVHLECEL---QGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSI 7456

Query: 419  RWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMR-PPGLVRNLQ-----VTD 472
                 D     +Y+ + T        + G  SD       ++ PP  V+ L      V  
Sbjct: 7457 HILNVDAADIGEYQCKAT-------NDVG--SDTCVGSIALKAPPRFVKKLSDISTVVGK 7507

Query: 473  RSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGY 532
                  T+  A P +    + +G +V    SD++ W+        + T     + P    
Sbjct: 7508 EVQLQTTIEGAEPISVVWFKDKGEIVR--ESDNI-WISYSEN---IATLQFSRVEPANAG 7561

Query: 533  FVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAM 592
                   N+ G  +  A  TL    P T+  K        + + V  GDT  +  +    
Sbjct: 7562 KYTCQIKNDAGMQECFA--TLSVLEPATIVEK-------PESIKVTTGDTCTLECTVAGT 7612

Query: 593  PMPEVTWLKDGLPLP---KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHS 649
            P     W KDG  L    K  ++         +I VA  SDSG+Y+  ++   GK+   +
Sbjct: 7613 PELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAP-SDSGVYSFEVQNPVGKDSCTA 7671

Query: 650  FRIRVAACPQAPGPIHLQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAA 708
              ++V+              VP + T +  E +      V +   V+        W    
Sbjct: 7672 -SLQVS-----------DRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEG 7719

Query: 709  DRIHTNRFTLLGILPGHEYHFRVVAKN---ELGASKPSDTSQPWCIPRQR---DRFTVKA 762
            + I +          G +Y   +        +   + SD+    CI       D  +   
Sbjct: 7720 NEISS----------GRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPL 7769

Query: 763  PCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYS 822
                 P   QKP  +  L       G     +  V+G+P   V+WFK    L        
Sbjct: 7770 TVREPPSFVQKPDPMDVLT------GTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNV 7823

Query: 823  TDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIEPS 867
            +    V  L +  V    SGEY  +  N  G+A  T  L +  P+
Sbjct: 7824 SLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPA 7868



 Score = 46.2 bits (108), Expect = 1e-04
 Identities = 63/289 (21%), Positives = 96/289 (33%), Gaps = 25/289 (8%)

Query: 577   VKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVT--VTKDGLTQLLIPVAGLSDSGLY 634
             V  G   R  ++ ++ P  EV W  +G+ L + S        G+  L I      DSG Y
Sbjct: 32385 VPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTY 32444

Query: 635   TVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAV 694
               V    +G+   ++                  E VP +V  E   +  EA  V   +  
Sbjct: 32445 RAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRT--EAYAVS-SFKK 32501

Query: 695   FTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQ 754
              +   A     E   ++   R +L           +  A  E    + S T         
Sbjct: 32502 TSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTT--------- 32552

Query: 755   RDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSL 814
                        R+   +   R L   RS  + +G     SC   G P P VTW +  + L
Sbjct: 32553 -----------RKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVL 32601

Query: 815   EGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
               +     T      +  I SV   D G Y  V EN+ G+  +  TL +
Sbjct: 32602 STSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTI 32650



 Score = 45.4 bits (106), Expect = 2e-04
 Identities = 46/187 (24%), Positives = 71/187 (37%), Gaps = 13/187 (6%)

Query: 24    EPPGHLGSRRSGKDGRL---DIYGERRDATRSSTSRYKPGTGSFSKDAQGPMGHFSQGLA 80
             EP   +  R  GK   L   D+  E     + +   +K     F K+   P   F++ L 
Sbjct: 12236 EPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKE---PPVEFTKPLE 12292

Query: 81    DMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAG 140
             D  V+ G  A L C ++ +     WFK+G ++          DG V  L I         
Sbjct: 12293 DQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIK 12352

Query: 141   RYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQ-SHLPIQAAW 199
              YT  A D ++   L V       P   E LR    ++  +  + +   + S    +  W
Sbjct: 12353 TYTCDAKDFKTSCNLNV------VPPHVEFLRPLTDLQVREKEMARFECELSRENAKVKW 12406

Query: 200   RKDGAEV 206
              KDGAE+
Sbjct: 12407 FKDGAEI 12413



 Score = 45.1 bits (105), Expect = 3e-04
 Identities = 62/239 (25%), Positives = 88/239 (36%), Gaps = 28/239 (11%)

Query: 82   MEVQPGEAATLSCTLTSDLGPGT---WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQ 138
            +EV  G  A  +C + S   P     WFK G ++   D    +    + SL I   Q   
Sbjct: 3465 LEVALGHLAKFTCEIQS--APNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVD 3522

Query: 139  AGRYTFVA----GDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLP 194
             G YT  A    G     ATLTV ++    P       + L    GK             
Sbjct: 3523 CGEYTCKASNEYGSVSCTATLTVTEA---YPPTFLSRPKSLTTFVGKAAKFICTVTGTPV 3579

Query: 195  IQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELT 254
            I+  W+KDGA +  S     ++   +    L L +   +D G YS    ++ G+   +  
Sbjct: 3580 IETIWQKDGAAL--SPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAE 3637

Query: 255  LQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGE 313
            L +IDKP   +    VQ      V L             EC V E R+    TW K G+
Sbjct: 3638 LIIIDKPHFIKELEPVQSAINKKVHL-------------ECQVDEDRKV-TVTWSKDGQ 3682



 Score = 45.1 bits (105), Expect = 3e-04
 Identities = 47/214 (21%), Positives = 79/214 (36%), Gaps = 17/214 (7%)

Query: 61   TGSFSKDAQGPMGH--------------FSQGLADMEVQPGEAATLSCTLTSDLG-PGTW 105
            +G F  +AQ P G               FS     +E       +L C L+        W
Sbjct: 5491 SGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAEVSLECELSGTPPFEVVW 5550

Query: 106  FKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAP 165
            +KD  +L +             S+ I +V  +  G Y   A ++    T          P
Sbjct: 5551 YKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPP 5610

Query: 166  DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
                KL   L V AG+P  ++   +   PI   W K+  EV+  S+   ++   +    L
Sbjct: 5611 RFVSKLNS-LTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESE-NIRITFVENVATL 5668

Query: 226  CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVID 259
                A   + G+Y   ++++GG  +   TL V++
Sbjct: 5669 QFAKAEPANAGKYICQIKNDGGMRENMATLMVLE 5702



 Score = 45.1 bits (105), Expect = 3e-04
 Identities = 48/216 (22%), Positives = 77/216 (35%), Gaps = 32/216 (14%)

Query: 658   PQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADR------I 711
             P  P  + + E    + T  W P   +       Y    R        + ADR      +
Sbjct: 18799 PDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREE-----EQPADRWTEYSVV 18853

Query: 712   HTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLS 771
                   + G+  G +Y FRV A+N +G S P +                    Y   +  
Sbjct: 18854 KDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAE----------------GVYEAKEQL 18897

Query: 772   QKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSL--EGNPAVYSTDLLGVC 829
               P+ L+      +  G +  +   V G P P   W K +  +    + AV+  D   + 
Sbjct: 18898 LPPKILMP-EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSI- 18955

Query: 830   SLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
              L I  V+ KDSG Y   AEN+ G       ++V++
Sbjct: 18956 -LIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMD 18990



 Score = 44.7 bits (104), Expect = 4e-04
 Identities = 52/219 (23%), Positives = 94/219 (42%), Gaps = 17/219 (7%)

Query: 162 TIAPDVTEKLREPLVVKAGKPVIVKIPFQSHL---PI-QAAWRKDGAEVVGSSDREAQVD 217
           T AP  T+ L+  +V++          F++H+   P+ + +W +DG  +  S+    Q+ 
Sbjct: 3   TQAPTFTQPLQSVVVLEGSTAT-----FEAHISGFPVPEVSWFRDGQVISTSTLPGVQIS 57

Query: 218 LGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPD--PPQGPMEVQDCH- 274
             DG  +L +P+  + + G+YS  L++  GS QA  T +++ K +  PP     +Q    
Sbjct: 58  FSDGRAKLTIPAVTKANSGRYS--LKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTV 115

Query: 275 RAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTF 334
           R G  +R +         V  +  +  +   S   ++ +   D  +   A   P    T+
Sbjct: 116 RQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQ-EGDLYSLLIAEAYPEDSGTY 174

Query: 335 RVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSAS 373
            V A  S   G A  + E+LV  E    A     I+S +
Sbjct: 175 SVNATNS--VGRATSTAELLVQGEEEVPAKKTKTIVSTA 211



 Score = 44.7 bits (104), Expect = 4e-04
 Identities = 48/201 (23%), Positives = 76/201 (37%), Gaps = 24/201 (11%)

Query: 71    PMGHFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLF 130
             P   F + L D++V+  E A   C L+ +     WFKDG ++           G V  L 
Sbjct: 12372 PHVEFLRPLTDLQVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILV 12431

Query: 131   ITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAP------DVTEKLREPLVVKAGKPVI 184
             I          Y+      ++   LTV +   +        +V+E     LV +  KP  
Sbjct: 12432 INKCLLDDEAEYSCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKP-- 12489

Query: 185   VKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTR-LCLPSAGRKDCGQYSVTL- 242
                        +  W K   E++ +   E    L +G  R L + +A  +D G Y+  L 
Sbjct: 12490 ---------GAEVIWYKGDEEIIETGRYEI---LTEGRKRILVIQNAHLEDAGNYNCRLP 12537

Query: 243   --RSEGGSVQAELTLQVIDKP 261
               R++G     EL  + I KP
Sbjct: 12538 SSRTDGKVKVHELAAEFISKP 12558



 Score = 44.3 bits (103), Expect = 5e-04
 Identities = 44/191 (23%), Positives = 77/191 (40%), Gaps = 11/191 (5%)

Query: 73   GHFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFIT 132
            G  S+ L D  V   + A   C + +    G W +DG  L   + +  + DG    L I 
Sbjct: 2620 GAISKPLTDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIA 2679

Query: 133  HVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVI-VKIPFQS 191
              +    G YT+     ++ A L V+     A  + + L+   V +    V  V++   +
Sbjct: 2680 ATKLDDIGEYTYKVATSKTSAKLKVE-----AVKIKKTLKNLTVTETQDAVFTVELTHPN 2734

Query: 192  HLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQA 251
               +Q  W K+G  VV  S+ +  + +      L + +    D   Y   L   G S + 
Sbjct: 2735 VKGVQ--WIKNG--VVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARL 2790

Query: 252  EL-TLQVIDKP 261
             + T+++I KP
Sbjct: 2791 HVETVKIIKKP 2801



 Score = 44.3 bits (103), Expect = 5e-04
 Identities = 74/306 (24%), Positives = 122/306 (39%), Gaps = 47/306 (15%)

Query: 572  KDLLTVKVGDTVRVPVSFEAMPMPEVT--WLKDG--LPLPKRSVTVTKDGLTQLLIPVAG 627
            K +  +KV +  R     E    P++T  W+KD   L +  R     +  + +LLIP   
Sbjct: 3062 KHIKDIKVLEKKRAMFECEVSE-PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTR 3120

Query: 628  LSDSGLYTVVL--RTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEA 685
            +SD+G YTVV        K       +R+ +  +    I  Q  V      E+E + D  
Sbjct: 3121 MSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAV-----VEFEVNED-- 3173

Query: 686  QDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHF-RVVAKNELGASKPSD 744
             DV  H            W++  D I  N      +   H+Y   R + +  +  ++ SD
Sbjct: 3174 -DVDAH------------WYK--DGIEIN----FQVQERHKYVVERRIHRMFISETRQSD 3214

Query: 745  TSQ-PWCIPRQRDRFT--VKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSP 801
              +  +   R R   T  V AP        + P+ L  L+   +  G        + G P
Sbjct: 3215 AGEYTFVAGRNRSSVTLYVNAP--------EPPQVLQELQPVTVQSGKPARFCAVISGRP 3266

Query: 802  RPHVTWFKNDRSLE-GNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTAT 860
            +P ++W+K ++ L  G    +  D      L I +  P+D+  Y   A+N  G A ++A+
Sbjct: 3267 QPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAF-PEDAAVYTCEAKNDYGVATTSAS 3325

Query: 861  LIVIEP 866
            L V  P
Sbjct: 3326 LSVEVP 3331



 Score = 44.3 bits (103), Expect = 5e-04
 Identities = 76/323 (23%), Positives = 130/323 (40%), Gaps = 35/323 (10%)

Query: 551  DTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLP--- 607
            D+    + VT  PKF+       +  VK GD+ R+       P   V W ++   LP   
Sbjct: 5411 DSCTTMLLVTEPPKFVKKLEASKI--VKAGDSSRLECKIAGSPEIRVVWFRNEHELPASD 5468

Query: 608  KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQ 667
            K  +T   D +  + +      DSG +    +   G   + S ++ V   P       + 
Sbjct: 5469 KYRMTFI-DSVAVIQMNNLSTEDSGDFICEAQNPAGS-TSCSTKVIVKEPPVFSSFPPIV 5526

Query: 668  ENVPGT-VTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTL-LGILPGH 725
            E +    V+ E E S     +V + Y    +  +   +  A+   HT+   L +      
Sbjct: 5527 ETLKNAEVSLECELSGTPPFEV-VWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIG 5585

Query: 726  EYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLL 785
            EYH +  A+NE+G    SDT    C+       TVK        L + PRF+  L S  +
Sbjct: 5586 EYHCK--AQNEVG----SDT----CV------CTVK--------LKEPPRFVSKLNSLTV 5621

Query: 786  PQGCECCMSCAVQGSPRPHVTWFKN-DRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEY 844
              G    +  +++G+    V W K  +  +  +  +  T +  V +L      P ++G+Y
Sbjct: 5622 VAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKY 5681

Query: 845  KAVAENTLGQAVSTATLIVIEPS 867
                +N  G   + ATL+V+EP+
Sbjct: 5682 ICQIKNDGGMRENMATLMVLEPA 5704



 Score = 44.3 bits (103), Expect = 5e-04
 Identities = 30/97 (30%), Positives = 44/97 (45%), Gaps = 3/97 (3%)

Query: 770   LSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLE--GNPAVYSTDL-L 826
             L + P F + L +     G        +   P PHVTW+K+ + ++   N   Y+ +   
Sbjct: 31686 LERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDK 31745

Query: 827   GVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
             G+  LTI SV+  D  EY  VA N  G+    A L V
Sbjct: 31746 GLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 31782



 Score = 43.9 bits (102), Expect = 6e-04
 Identities = 28/95 (29%), Positives = 42/95 (44%), Gaps = 5/95 (5%)

Query: 772  QKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVY---STDLLGV 828
            + P+    ++S  + QG +      V G P P   W+KN   +E +  +Y     D   V
Sbjct: 2076 EAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPED--NV 2133

Query: 829  CSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
            C L I  V+ +DS      A N  G+  S A L+V
Sbjct: 2134 CELVIRDVTAEDSASIMVKAINIAGETSSHAFLLV 2168



 Score = 43.5 bits (101), Expect = 8e-04
 Identities = 28/91 (30%), Positives = 39/91 (42%), Gaps = 2/91 (2%)

Query: 774  PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEG--NPAVYSTDLLGVCSL 831
            P F+       L +G      C V G+P+PHV W K+   L       V      G C L
Sbjct: 1082 PYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKL 1141

Query: 832  TIPSVSPKDSGEYKAVAENTLGQAVSTATLI 862
             I      D+GEY  V  N  G+  ++A+L+
Sbjct: 1142 VISMTFADDAGEYTIVVRNKHGETSASASLL 1172



 Score = 43.5 bits (101), Expect = 8e-04
 Identities = 62/297 (20%), Positives = 114/297 (38%), Gaps = 33/297 (11%)

Query: 576  TVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKR---SVTVTKDGLTQLLIPVAGLSDSG 632
            +V+ G  + +  ++   P   V+W+KD   + +    S+T+T+   T L I  + + D  
Sbjct: 6937 SVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKS-TILEILESTIEDYA 6995

Query: 633  LYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENV---PGTVTAEWEPSPDEAQDVP 689
             Y+ ++    G+++  +  + V   P    P+   E V   P T+  + + +P+      
Sbjct: 6996 QYSCLIENEAGQDICEAL-VSVLEPPYFIEPLEHVEAVIGEPATLQCKVDGTPE------ 7048

Query: 690  LHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRV-VAKNELGASKPSDTSQP 748
                   R S    W++          T L   P ++  F+  VA   +     SD  + 
Sbjct: 7049 ------IRIS----WYK--------EHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEY 7090

Query: 749  WCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWF 808
             C           +           P F   L+      G      C + GS    V+W+
Sbjct: 7091 SCKADNSVGAVASSAVLVIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWY 7150

Query: 809  KNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
            K+   L+ +  + ++ +  V +L I        G+Y   A N LG A S+A LI+ E
Sbjct: 7151 KDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSE 7207



 Score = 43.1 bits (100), Expect = 0.001
 Identities = 49/204 (24%), Positives = 73/204 (35%), Gaps = 22/204 (10%)

Query: 79   LADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQ 138
            L D     G+ A   C ++      +W+    K+         Q    + L I       
Sbjct: 3351 LQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPED 3410

Query: 139  AGRYTFVA----GDQQSEATLTVQDSPTI---------------APDVTEKLREPLVVKA 179
             G YTFVA    G   S A L+++   +I               AP +  K+ EPL V  
Sbjct: 3411 EGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKAAPVIKRKI-EPLEVAL 3469

Query: 180  GKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYS 239
            G         QS   ++  W K G E+  S   +  +      + L +      DCG+Y+
Sbjct: 3470 GHLAKFTCEIQSAPNVRFQWFKAGREIYESD--KCSIRSSKYISSLEILRTQVVDCGEYT 3527

Query: 240  VTLRSEGGSVQAELTLQVIDKPDP 263
                +E GSV    TL V +   P
Sbjct: 3528 CKASNEYGSVSCTATLTVTEAYPP 3551



 Score = 43.1 bits (100), Expect = 0.001
 Identities = 46/199 (23%), Positives = 77/199 (38%), Gaps = 15/199 (7%)

Query: 74   HFSQGLADMEVQPGEAATLSCTL--TSDLGPGTWFKDGVKL--TTQDGVIFKQDGLVHSL 129
            +F   L  +E   G++ +L C +  T ++   +W+K   KL  T +    F  +  V +L
Sbjct: 6080 YFVTELEPLEAAVGDSVSLQCQVAGTPEITV-SWYKGDTKLRPTPEYRTYFTNN--VATL 6136

Query: 130  FITHVQGTQAGRYTFVA----GDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIV 185
                V    +G YT  A    G   S+    +Q+   + P    +L++ +    G PV +
Sbjct: 6137 VFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQ-LPPSFARQLKD-IEQTVGLPVTL 6194

Query: 186  KIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSE 245
                    PIQ  W +DG  V+   D   Q    D    L +        GQYS +  + 
Sbjct: 6195 TCRLNGSAPIQVCWYRDG--VLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNP 6252

Query: 246  GGSVQAELTLQVIDKPDPP 264
             G+  +   L   +    P
Sbjct: 6253 LGTASSSARLTAREPKKSP 6271



 Score = 42.7 bits (99), Expect = 0.001
 Identities = 43/203 (21%), Positives = 78/203 (38%), Gaps = 12/203 (5%)

Query: 75   FSQGLADMEVQPGEAATLSCTLTSDLGPG-TWFKDGVKLTTQDGVIFKQDGLVHSLFITH 133
            F + L+D  V+PG++  L  T T  L    TW KDG  +TT +            L I +
Sbjct: 5988 FLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILN 6047

Query: 134  VQGTQAGRYTF----VAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPF 189
                 AG+Y+      AG     A ++  + P    ++     EPL    G  V ++   
Sbjct: 6048 STKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTEL-----EPLEAAVGDSVSLQCQV 6102

Query: 190  QSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSV 249
                 I  +W K   ++      E +    +    L        D G+Y+    +  G+ 
Sbjct: 6103 AGTPEITVSWYKGDTKL--RPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTA 6160

Query: 250  QAELTLQVIDKPDPPQGPMEVQD 272
             ++   ++ ++  PP    +++D
Sbjct: 6161 SSKTVFRIQERQLPPSFARQLKD 6183



 Score = 42.0 bits (97), Expect = 0.002
 Identities = 33/137 (24%), Positives = 58/137 (42%), Gaps = 5/137 (3%)

Query: 24   EPPGHLGSRRSGKDGRLDIYGERRDATRSSTSRYKPGTGSFSKDAQGPMGHFSQGLADME 83
            +P G   +    K  +L I   R +     T +Y+    S     +     F++ + ++ 
Sbjct: 8785 KPQGRHKTEVEHKVHKLTIADVRAEDQGQYTCKYEDLETSAELRIEAEPIQFTKRIQNIV 8844

Query: 84   VQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYT 143
            V   ++AT  C ++ D    TW+K   +LT      F+ DG  H + I +V     G Y+
Sbjct: 8845 VSEHQSATFECEVSFDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYS 8904

Query: 144  FVA-----GDQQSEATL 155
             +A     G+ +S A L
Sbjct: 8905 VIARLEPRGEARSTAEL 8921



 Score = 42.0 bits (97), Expect = 0.002
 Identities = 81/402 (20%), Positives = 144/402 (35%), Gaps = 33/402 (8%)

Query: 477   SITLSWAGPDTQEGDEAQGYVVELCSS-DSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVR 535
             S  +SW  P    G     YVVE C + +  +W       + VTT     L    GY+ R
Sbjct: 30739 SAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVS-SAISVTTCRIVNLTENAGYYFR 30797

Query: 536   VTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRV---PVSFEAM 592
             V+A N  G S P  + ++V    +   P     +  K  +T    D+  V   P + +  
Sbjct: 30798 VSAQNTFGISDPLEVSSVV----IIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGG 30853

Query: 593   PMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRI 652
                   +L+       + ++VT + + + +  V  L +   Y   ++       +    I
Sbjct: 30854 AKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEI 30913

Query: 653   RVAACPQAPGPI---HLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAAD 709
                  P++  PI   H +E +   +   ++ +      V  H     +      W+    
Sbjct: 30914 SEPITPKSDVPIQAPHFKEELRN-LNVRYQSNATLVCKVTGHPKPIVK------WYRQGK 30966

Query: 710   RIHTN--RFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYRE 767
              I  +  ++ +     G  YH  ++A      S   D +  + +       +V      E
Sbjct: 30967 EIIADGLKYRIQEFKGG--YHQLIIA------SVTDDDATVYQVRATNQGGSVSGTASLE 31018

Query: 768   PDLSQK---PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTD 824
              ++  K   P+ L G+ +    +G    +     G P P +TW K    ++ N       
Sbjct: 31019 VEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIV 31078

Query: 825   LLGVCSLTIPS-VSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
                  SL  P+ V  KD+G Y   A+N  G    T  L V +
Sbjct: 31079 TRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVAD 31120



 Score = 41.6 bits (96), Expect = 0.003
 Identities = 21/86 (24%), Positives = 36/86 (41%)

Query: 74    HFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITH 133
             +F+  L D      +   L C ++    P  WFKDG ++      + K DG    L +  
Sbjct: 12019 YFTGKLQDYTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKK 12078

Query: 134   VQGTQAGRYTFVAGDQQSEATLTVQD 159
                +  G+YT   G  ++   L ++D
Sbjct: 12079 ALKSDIGQYTCDCGTDKTSGKLDIED 12104



 Score = 41.6 bits (96), Expect = 0.003
 Identities = 69/281 (24%), Positives = 108/281 (38%), Gaps = 72/281 (25%)

Query: 575   LTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPL---PKRSVTVTKDGLTQLLIPVAGLSDS 631
             +TV  G++ R     +  P+P VTWL+ G  L    +  VT TK   T  +  V   SD 
Sbjct: 32570 MTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQA-SDE 32628

Query: 632   GLYTVVLRTLQGKEVAH-SFRIRVAACPQ--APGPIHLQENVPGTVTAEWEPSPDEAQDV 688
             G Y+VV+   +GK+ A  +  I+ A   +     P  ++   P   + E   SP   +  
Sbjct: 32629 GNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSP 32688

Query: 689   PLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
                                               P H    + V+  E   +KP+ T + 
Sbjct: 32689 E---------------------------------PSHP---KAVSPTE---TKPTPTEKV 32709

Query: 749   WCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGS--PRPHVT 806
               +P       V AP    P ++Q   FL    S  + +     ++C V+ S      VT
Sbjct: 32710 QHLP-------VSAP----PKITQ---FLKAEASKEIAK-----LTCVVESSVLRAKEVT 32750

Query: 807   WFKNDRSLEGNPAV---YSTDLLGVCSLTIPSVSPKDSGEY 844
             W+K+ + L+ N      YS D  G   L I +++  D GEY
Sbjct: 32751 WYKDGKKLKENGHFQFHYSAD--GTYELKINNLTESDQGEY 32789



 Score = 41.2 bits (95), Expect = 0.004
 Identities = 37/176 (21%), Positives = 67/176 (38%), Gaps = 2/176 (1%)

Query: 105  WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIA 164
            WFKD V+L +        +G    L +  V  ++ G+YT    +     + T     T  
Sbjct: 5363 WFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEP 5422

Query: 165  PDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTR 224
            P   +KL    +VKAG    ++        I+  W ++  E+  S   + ++   D    
Sbjct: 5423 PKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASD--KYRMTFIDSVAV 5480

Query: 225  LCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCL 280
            + + +   +D G +    ++  GS      + V + P     P  V+    A V L
Sbjct: 5481 IQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAEVSL 5536



 Score = 40.8 bits (94), Expect = 0.005
 Identities = 31/117 (26%), Positives = 48/117 (41%), Gaps = 6/117 (5%)

Query: 77   QGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQG 136
            QGL+D +V  G+   L   ++ +   G W KDG ++   D V    D   H L I  +  
Sbjct: 2360 QGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTK 2419

Query: 137  TQAGRYTFV--AGDQQSEATLTVQDSPTIAP----DVTEKLREPLVVKAGKPVIVKI 187
              AG Y+F   A    +   ++V     I P    +V E  +  L  K   P +  +
Sbjct: 2420 EDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSV 2476



 Score = 40.8 bits (94), Expect = 0.005
 Identities = 36/178 (20%), Positives = 73/178 (41%), Gaps = 11/178 (6%)

Query: 81   DMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAG 140
            D+            +++ D  P  WF   V++   D      +  VH L + ++  + AG
Sbjct: 2803 DVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAG 2862

Query: 141  RYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWR 200
             YT V G  + +A L V+        +T+ ++  + V   K    +    SH  + + W 
Sbjct: 2863 EYTAVVGQLECKAKLFVE-----TLHITKTMKN-IEVPETKTASFECEV-SHFNVPSMWL 2915

Query: 201  KDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVI 258
            K+G E+      + ++ +     +L + +   +D  +Y+    ++   V A LT+  I
Sbjct: 2916 KNGVEI--EMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGND--QVSATLTVTPI 2969



 Score = 40.8 bits (94), Expect = 0.005
 Identities = 69/280 (24%), Positives = 106/280 (37%), Gaps = 25/280 (8%)

Query: 597  VTWLKDGLPL-PKRSVTVT-KDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRV 654
            V W K+ + + P  +  +T K+    L +  AG++D+GLYT  +    G  +  S    V
Sbjct: 8281 VAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTS--SIV 8338

Query: 655  AACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTN 714
               P+ P P+  Q   P TV+        E + V L   V         W +A   I  +
Sbjct: 8339 IKEPKKP-PVFDQHLTPVTVS--------EGEYVQLSCHVQGSEPIRIQWLKAGREIKPS 8389

Query: 715  RFTLLGILPGHE-YHFRVVAKNELG--ASKPSDTSQPWCIPRQRDRFTVK-----APCYR 766
                     G      R VAK + G    K S+ +        + + T+K     AP  +
Sbjct: 8390 DRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGS---DTTKSKVTIKDKPAVAPATK 8446

Query: 767  EPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKND-RSLEGNPAVYSTDL 825
            +  +  +  F+   +S  + +         V G P P+V W K   R L     V+    
Sbjct: 8447 KAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQK 8506

Query: 826  LGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
                 L I   +  DSG Y+ VA N  G+  S   L V E
Sbjct: 8507 GDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDE 8546



 Score = 40.8 bits (94), Expect = 0.005
 Identities = 48/209 (22%), Positives = 81/209 (38%), Gaps = 32/209 (15%)

Query: 75   FSQGLADMEVQPGEAATLSCTLT-SDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITH 133
            F Q L  + V  GE   LSC +  S+     W K G ++   D   F        L +  
Sbjct: 8348 FDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRD 8407

Query: 134  VQGTQAGRYTF----VAGDQQSEATLTVQDSPTIAPD------------VTEKLREPLVV 177
            V    +G Y      VAG   +++ +T++D P +AP             V+E     +V 
Sbjct: 8408 VAKADSGDYVCKASNVAGSDTTKSKVTIKDKPAVAPATKKAAVDGRLFFVSEPQSIRVVE 8467

Query: 178  KAGKPVIVKI---PFQSHLPIQAAWR---KDGAEVVGSSDREAQVDLGDGYTRLCLPSAG 231
            K     I K+   P  +    +  WR   + G   +     EA++++ D           
Sbjct: 8468 KTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRD---------TT 8518

Query: 232  RKDCGQYSVTLRSEGGSVQAELTLQVIDK 260
            + D G Y     +E G +++ + LQV ++
Sbjct: 8519 KTDSGLYRCVAFNEHGEIESNVNLQVDER 8547



 Score = 40.4 bits (93), Expect = 0.007
 Identities = 26/75 (34%), Positives = 33/75 (44%), Gaps = 5/75 (6%)

Query: 576   TVKVGDTVRVPVSFEAMPMPEVTWLKDGLPL-----PKRSVTVTKDGLTQLLIPVAGLSD 630
             T  VG+ VR  V+    P P VTW K G  +      K+    +  GL QL I      D
Sbjct: 31700 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDD 31759

Query: 631   SGLYTVVLRTLQGKE 645
                YTVV R   G++
Sbjct: 31760 DAEYTVVARNKYGED 31774



 Score = 39.7 bits (91), Expect = 0.012
 Identities = 22/83 (26%), Positives = 39/83 (46%)

Query: 79   LADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQ 138
            L D+ ++ G+  T++C  +       WF++G  L  Q     + +  VH L I  V+   
Sbjct: 8751 LQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRHKTEVEHKVHKLTIADVRAED 8810

Query: 139  AGRYTFVAGDQQSEATLTVQDSP 161
             G+YT    D ++ A L ++  P
Sbjct: 8811 QGQYTCKYEDLETSAELRIEAEP 8833



 Score = 38.9 bits (89), Expect = 0.021
 Identities = 34/136 (25%), Positives = 57/136 (41%), Gaps = 8/136 (5%)

Query: 736  ELGASKPSDTSQPWC-IPRQRDRFTVKAPCY--REPDLSQKPRFLVGLRSHLLPQGCECC 792
            EL A+K +D+    C +       T KA  +    P   +KP  ++ LR+     G    
Sbjct: 4826 ELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQFIKKPSPVLVLRN-----GQSTT 4880

Query: 793  MSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTL 852
              C + G+P+  V+W+ +   +        + + G+ +  I     ++SG Y   A N  
Sbjct: 4881 FECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDA 4940

Query: 853  GQAVSTATLIVIEPST 868
            G A  +  L V EP T
Sbjct: 4941 GTASCSIELKVKEPPT 4956



 Score = 38.9 bits (89), Expect = 0.021
 Identities = 41/160 (25%), Positives = 63/160 (39%), Gaps = 13/160 (8%)

Query: 105  WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVA----GDQQSEATLTVQDS 160
            WF +  K+ +           V +L +  +  +  G YT VA    G  +  A LTVQ+ 
Sbjct: 5833 WFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEP 5892

Query: 161  PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGD 220
            P+       K  EPL V  GK V      +   P +  W +   E+V   DR   +   D
Sbjct: 5893 PSFV-----KEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELV-KGDR-CNIYFED 5945

Query: 221  GYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDK 260
                L L +      G+Y+  + +  G  QA  T ++  K
Sbjct: 5946 TVAELELFNIDISQSGEYTCVVSNNAG--QASCTTRLFVK 5983



 Score = 38.9 bits (89), Expect = 0.021
 Identities = 28/96 (29%), Positives = 41/96 (42%), Gaps = 1/96 (1%)

Query: 769   DLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAV-YSTDLLG 827
             D + +P F   L +    +G   C    V G P P + W K+ + L   P +    + L 
Sbjct: 31790 DSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLD 31849

Query: 828   VCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
               +L I    P+D+G Y+  A NT G     A L V
Sbjct: 31850 YYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 31885



 Score = 38.1 bits (87), Expect = 0.036
 Identities = 27/103 (26%), Positives = 42/103 (40%), Gaps = 4/103 (3%)

Query: 761   KAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAV 820
             KAP   EP +S KP  + GL+   +        +    G PRP   W K+ +++      
Sbjct: 32843 KAP---EP-ISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKY 32898

Query: 821   YSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
               ++  G   L I      DSG Y    +N+ G   S+  L +
Sbjct: 32899 KLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTI 32941



 Score = 37.4 bits (85), Expect = 0.061
 Identities = 38/153 (24%), Positives = 65/153 (42%), Gaps = 11/153 (7%)

Query: 104  TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTI 163
            +W+K   KL   D      DG  H+L + + Q    G Y  V G   + A LTV     I
Sbjct: 8689 SWYKGTEKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLVCGPHIASAKLTV-----I 8743

Query: 164  APDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYT 223
             P   E+  + + +K G+   +   F S   +++ W ++G  +      + +V+      
Sbjct: 8744 EP-AWERHLQDVTLKEGQTCTMTCQF-SVPNVKSEWFRNGRILKPQGRHKTEVE--HKVH 8799

Query: 224  RLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQ 256
            +L +     +D GQY  T + E     AEL ++
Sbjct: 8800 KLTIADVRAEDQGQY--TCKYEDLETSAELRIE 8830



 Score = 37.0 bits (84), Expect = 0.079
 Identities = 26/85 (30%), Positives = 36/85 (42%)

Query: 79    LADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQ 138
             L  +EV  GE A     L+     G W   G  LT        +DG  H L + + Q   
Sbjct: 11757 LYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGM 11816

Query: 139   AGRYTFVAGDQQSEATLTVQDSPTI 163
              G  +F A + +S A L V++ P I
Sbjct: 11817 TGEVSFQAANAKSAANLKVKELPLI 11841



 Score = 37.0 bits (84), Expect = 0.079
 Identities = 27/106 (25%), Positives = 44/106 (41%), Gaps = 4/106 (3%)

Query: 75    FSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHV 134
             F   L+D++V   + A   C ++ +     W K   ++T  D     +DG  HS+ I   
Sbjct: 11842 FITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSA 11901

Query: 135   QGTQAGRYTFVAGDQQSEATLTVQDSP----TIAPDVTEKLREPLV 176
                   +Y F A D+ +   L ++       T   DVT K +E  V
Sbjct: 11902 AFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAV 11947



 Score = 37.0 bits (84), Expect = 0.079
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 2/70 (2%)

Query: 577   VKVGDTVRVPVSFEAMPMPEVTWLKDGLPLP-KRSVTVTKD-GLTQLLIPVAGLSDSGLY 634
             +  G  V         P PE+ W K+ LP+    +V++++   +  L I  A +SDSG Y
Sbjct: 33145 INEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKY 33204

Query: 635   TVVLRTLQGK 644
             T+  +  +G+
Sbjct: 33205 TIKAKNFRGQ 33214



 Score = 36.6 bits (83), Expect = 0.10
 Identities = 33/101 (32%), Positives = 51/101 (50%), Gaps = 8/101 (7%)

Query: 538 AVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEV 597
           A N  GQ+  +A + LV+A   T  P F+    +   +TV+ G  VR+ V    +P P V
Sbjct: 82  ATNGSGQATSTA-ELLVKAE--TAPPNFVQRLQS---MTVRQGSQVRLQVRVTGIPTPVV 135

Query: 598 TWLKDGLPLPKR-SVTVTKDG-LTQLLIPVAGLSDSGLYTV 636
            + +DG  +       ++++G L  LLI  A   DSG Y+V
Sbjct: 136 KFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSV 176



 Score = 36.6 bits (83), Expect = 0.10
 Identities = 23/98 (23%), Positives = 47/98 (47%), Gaps = 3/98 (3%)

Query: 84    VQPGEAATLSCTLTSDLGPGT-WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRY 142
             +  G+    +C ++ +  P   WFK+ + ++    V   +   V+SL I +   + +G+Y
Sbjct: 33145 INEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKY 33204

Query: 143   TFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAG 180
             T  A + + + + T   S  + P V E  RE ++  +G
Sbjct: 33205 TIKAKNFRGQCSATA--SLMVLPLVEEPSREVVLRTSG 33240



 Score = 35.8 bits (81), Expect = 0.18
 Identities = 35/147 (23%), Positives = 58/147 (39%), Gaps = 16/147 (10%)

Query: 720   GILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVG 779
             G+  G  Y FRV A+N +G   P  T     IP +     V       P +    + + G
Sbjct: 17471 GLQQGKTYRFRVKAENIVGLGLPDTT-----IPIECQEKLVP------PSVELDVKLIEG 17519

Query: 780   LRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCS-LTIPSVSP 838
             L   ++  G        ++G P P   W  +   ++ +   Y+ +     S LTI +   
Sbjct: 17520 L---VVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEH-YTVETDNFSSVLTIKNCLR 17575

Query: 839   KDSGEYKAVAENTLGQAVSTATLIVIE 865
             +D+GEY+    N  G       L V++
Sbjct: 17576 RDTGEYQITVSNAAGSKTVAVHLTVLD 17602



 Score = 35.0 bits (79), Expect = 0.30
 Identities = 66/318 (20%), Positives = 113/318 (35%), Gaps = 41/318 (12%)

Query: 541  EGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWL 600
            EG  + P+     ++  P    PK      ++   TV  G      V     P PE  W 
Sbjct: 2056 EGKITIPTFKPDKIELSPSMEAPKIFERIQSQ---TVGQGSDAHFRVRVVGKPDPECEWY 2112

Query: 601  KDGLPLPKRSVTV----TKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAA 656
            K+G+ + +RS  +     +D + +L+I      DS    V    + G+  +H+F +    
Sbjct: 2113 KNGVKI-ERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLL---- 2167

Query: 657  CPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSS-AHGPWHEAADRIHTNR 715
                     +Q     T T E +    + +D    +   T        W++    +H   
Sbjct: 2168 ---------VQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHE-- 2216

Query: 716  FTLLGILPGHEYHFRVVAKNELGASKPSDTSQPW---CIPRQRDRFTVKAPCYREPDLSQ 772
                    G +Y      K    +    DTS      C+  + +     A    E  + +
Sbjct: 2217 --------GDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVE 2268

Query: 773  KPRFLVGLRSHLLPQGCECCMSCAVQGSPRP-HVTWFKNDRSLEGNPAVYSTDLLGVCSL 831
               F+  L+   +P+     + C V  SP      W+ ND  L+ N     T   G  +L
Sbjct: 2269 ---FVKELQDIEVPESYSGELECIV--SPENIEGKWYHNDVELKSNGKYTITSRRGRQNL 2323

Query: 832  TIPSVSPKDSGEYKAVAE 849
            T+  V+ +D GEY  V +
Sbjct: 2324 TVKDVTKEDQGEYSFVID 2341



 Score = 34.7 bits (78), Expect = 0.39
 Identities = 47/225 (20%), Positives = 81/225 (36%), Gaps = 48/225 (21%)

Query: 78   GLADMEVQPGEAATLSCTLTSDLGPG-TWFKDGVKLTTQ-DGVIFKQDGLVHSLFITHVQ 135
            GL ++ V  GE+ TL C ++    P  TW+++  ++ +  D  I  Q G+   L I    
Sbjct: 948  GLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIAR-LMIREAF 1006

Query: 136  GTQAGRYTF----VAGDQQSEATLTVQDSPTIAPD---VTEK------------------ 170
               +GR+T      AG   +   L VQ S     +   VTEK                  
Sbjct: 1007 AEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTD 1066

Query: 171  ------------------LREPLVVK--AGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSS 210
                              + +P+V K   G  V+       +      W+K G  +    
Sbjct: 1067 TSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGY 1126

Query: 211  DREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTL 255
              +   +   G  +L +      D G+Y++ +R++ G   A  +L
Sbjct: 1127 RYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1171



 Score = 34.7 bits (78), Expect = 0.39
 Identities = 47/213 (22%), Positives = 81/213 (38%), Gaps = 19/213 (8%)

Query: 79   LADMEVQPGEAATLSCTLT-SDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGT 137
            L D+ V  G  A L C ++  D+    W+ +  ++   D V     G    L I     +
Sbjct: 2451 LKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHAS 2510

Query: 138  QAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQA 197
              G Y  + G  ++   L+V+    I       LR+ L     + V+ ++   SH  I  
Sbjct: 2511 DEGPYKLIVGRVETNCNLSVEKIKII-----RGLRD-LTCTETQNVVFEVEL-SHSGIDV 2563

Query: 198  AWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQY---------SVTLRSEGGS 248
             W     E+  SS  + +++      +L + +  + D G+Y         S  L   GG+
Sbjct: 2564 LWNFKDKEIKPSS--KYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGA 2621

Query: 249  VQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLR 281
            +   LT Q + +        EV +    G  LR
Sbjct: 2622 ISKPLTDQTVAESQEAVFECEVANPDSKGEWLR 2654



 Score = 34.7 bits (78), Expect = 0.39
 Identities = 55/236 (23%), Positives = 86/236 (36%), Gaps = 29/236 (12%)

Query: 79    LADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQ 138
             L  +EV   E A     ++ D     W   G  L        K++G +HSL + + +  Q
Sbjct: 12113 LHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQ 12172

Query: 139   AGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLR--EPLVVKAGKPVIVKIPFQSHLPIQ 196
              G   F A + +S A L V+      P V   LR  + + V AG+         S+  I 
Sbjct: 12173 TGGVDFQAANVKSSAHLRVK------PRVIGLLRPLKDVTVTAGETATFDCEL-SYEDIP 12225

Query: 197   AAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQ 256
               W   G + +  SD+      G  +T L L     +D G+  +T +      +    L 
Sbjct: 12226 VEWYLKGKK-LEPSDKVVPRSEGKVHT-LTLRDVKLEDAGEVQLTAK----DFKTHANLF 12279

Query: 257   VIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVG 312
             V + P     P+E Q        +            +EC V   R+  +  W K G
Sbjct: 12280 VKEPPVEFTKPLEDQTVEEGATAV------------LECEV--SRENAKVKWFKNG 12321



 Score = 34.7 bits (78), Expect = 0.39
 Identities = 52/213 (24%), Positives = 82/213 (38%), Gaps = 36/213 (16%)

Query: 648   HSFRIRVAACPQAPGPIHLQENVPGTVTAEWE-PSPDEAQDVP-LHYAVFTRSSAHGPWH 705
             H FRI     P  PG   +       ++  W+ P  D   +V   H     R+S    W 
Sbjct: 27752 HQFRI-----PGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSIL--WQ 27804

Query: 706   EA-ADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPC 764
             +     I    +   G++ G +Y FRV A+N  G S PSD S          +FT+    
Sbjct: 27805 KVNTSPISGREYRATGLVEGLDYQFRVYAENSAGLSSPSDPS----------KFTLAVSP 27854

Query: 765   Y---REPDLSQKPRFLVGLR-SHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAV 820
                   PD     R  + L+ +  L  G    +  +++           N+R +  N   
Sbjct: 27855 VDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVGYSIEKRQ-------GNERWVRCN--- 27904

Query: 821   YSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLG 853
               TD +  C  T+  +SP D  E++ +A N +G
Sbjct: 27905 -FTD-VSECQYTVTGLSPGDRYEFRIIARNAVG 27935



 Score = 34.3 bits (77), Expect = 0.51
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 6/67 (8%)

Query: 575 LTVKVGDTVRVPVSFEAMPMPEVTWLKDG-----LPLPKRSVTVTKDGLTQLLIPVAGLS 629
           + V  G T          P+PEV+W +DG       LP   ++ + DG  +L IP    +
Sbjct: 15  VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFS-DGRAKLTIPAVTKA 73

Query: 630 DSGLYTV 636
           +SG Y++
Sbjct: 74  NSGRYSL 80



 Score = 34.3 bits (77), Expect = 0.51
 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 1/82 (1%)

Query: 772  QKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSL 831
            QKP  ++      + +G      C V G P+P V W+ N + +  +   +     G+  L
Sbjct: 1839 QKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKR-FRVRYDGIHYL 1897

Query: 832  TIPSVSPKDSGEYKAVAENTLG 853
             I      D+GE K  AEN  G
Sbjct: 1898 DIVDCKSYDTGEVKVTAENPEG 1919



 Score = 34.3 bits (77), Expect = 0.51
 Identities = 46/183 (25%), Positives = 75/183 (40%), Gaps = 24/183 (13%)

Query: 105  WFKDGVKLTTQDGVI-FKQDGLVHSLFITHVQGTQAG----RYTFVAGDQQSEATLTVQD 159
            W+K+GVK+   D +  +  +  V  L I  V    +     +   +AG+  S A L VQ 
Sbjct: 2111 WYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQA 2170

Query: 160  SPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLP-IQAAWRKDGAEVVGS------SDR 212
               I    T++L++  VV   K  +     ++  P ++  W KDG EV         SDR
Sbjct: 2171 KQLIT--FTQELQD--VVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDR 2226

Query: 213  EAQ------VDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQG 266
            +        +D  D     C+      +  + +  L  EG  V+    LQ I+ P+   G
Sbjct: 2227 KVHFLSILTIDTSDAEDYSCV--LVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSG 2284

Query: 267  PME 269
             +E
Sbjct: 2285 ELE 2287



 Score = 34.3 bits (77), Expect = 0.51
 Identities = 31/143 (21%), Positives = 59/143 (41%), Gaps = 11/143 (7%)

Query: 126  VHSLFITHVQGTQAGRYTFV----AGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGK 181
            V +L     +   AG+Y        G +++ ATL V     + P V  +   P+ V  G+
Sbjct: 5665 VATLQFAKAEPANAGKYICQIKNDGGMRENMATLMV-----LEPAVIVEKAGPMTVTVGE 5719

Query: 182  PVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVT 241
               ++        +   W KDG  +  +S ++ +    +  + L + S  R+D G Y+  
Sbjct: 5720 TCTLECKVAGTPELSVEWYKDGKLL--TSSQKHKFSFYNKISSLRILSVERQDAGTYTFQ 5777

Query: 242  LRSEGGSVQAELTLQVIDKPDPP 264
            +++  G       + V D+  PP
Sbjct: 5778 VQNNVGKSSCTAVVDVSDRAVPP 5800



 Score = 34.3 bits (77), Expect = 0.51
 Identities = 20/93 (21%), Positives = 38/93 (40%)

Query: 165   PDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTR 224
             P   E L   + +  GK + V   F      +  W   G ++         ++  D  T 
Sbjct: 33328 PPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTT 33387

Query: 225   LCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQV 257
             L +    ++D G Y+++L +E GS  A + + +
Sbjct: 33388 LIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 33420



 Score = 34.3 bits (77), Expect = 0.51
 Identities = 24/77 (31%), Positives = 33/77 (42%), Gaps = 4/77 (5%)

Query: 575   LTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPK----RSVTVTKDGLTQLLIPVAGLSD 630
             +++  G  + V  +F   P PEVTW   G  +      R      D LT L+I      D
Sbjct: 33338 ISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQD 33397

Query: 631   SGLYTVVLRTLQGKEVA 647
              GLYT+ L    G + A
Sbjct: 33398 GGLYTLSLGNEFGSDSA 33414



 Score = 33.9 bits (76), Expect = 0.67
 Identities = 40/189 (21%), Positives = 69/189 (36%), Gaps = 22/189 (11%)

Query: 81    DMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAG 140
             ++E+  GE A   C+++ +  P  W +D   L + D      DG    L +        G
Sbjct: 12560 NLEILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMG 12619

Query: 141   RYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWR 200
              Y  + G  ++ A LT          V EKLR  + +K       ++  Q  +       
Sbjct: 12620 TYVVMVGAARAAAHLT----------VIEKLRIVVPLKD-----TRVKEQQEVVFNCEVN 12664

Query: 201   KDGAEVVGSSDREAQVDLG-------DGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAEL 253
              +GA+     + EA  D         D    L +  A   D   Y+V+L +  G      
Sbjct: 12665 TEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSA 12724

Query: 254   TLQVIDKPD 262
                ++++ D
Sbjct: 12725 ANLIVEEED 12733



 Score = 33.5 bits (75), Expect = 0.88
 Identities = 22/81 (27%), Positives = 35/81 (43%), Gaps = 6/81 (7%)

Query: 785   LPQGCECCMSCAVQGSPRPHVTWFKNDRSL----EGNPAVYSTDLLGVCSLTIPSVSPKD 840
             + +G    ++CA  G P P VTW    R +    +G   + +TD   + +L I  V  +D
Sbjct: 33340 IDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTD--DLTTLIIMDVQKQD 33397

Query: 841   SGEYKAVAENTLGQAVSTATL 861
              G Y     N  G   +T  +
Sbjct: 33398 GGLYTLSLGNEFGSDSATVNI 33418



 Score = 33.1 bits (74), Expect = 1.1
 Identities = 34/169 (20%), Positives = 69/169 (40%), Gaps = 5/169 (2%)

Query: 75   FSQGLADMEVQPGEA-ATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITH 133
            F+Q L D+  +  +  AT  C  +       W+KDG+++   D      D  VH L I  
Sbjct: 2176 FTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILT 2235

Query: 134  VQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHL 193
            +  + A  Y+ V  + ++  T           +  ++L++  V ++    +  I    + 
Sbjct: 2236 IDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPEN- 2294

Query: 194  PIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTL 242
             I+  W  +  E+   S+ +  +    G   L +    ++D G+YS  +
Sbjct: 2295 -IEGKWYHNDVEL--KSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVI 2340



 Score = 32.7 bits (73), Expect = 1.5
 Identities = 33/115 (28%), Positives = 49/115 (42%), Gaps = 10/115 (8%)

Query: 536  VTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMP 595
            V A N  G+S  S + T V+A+   V P F+        + +K G  + + V     P P
Sbjct: 1530 VVAQNRAGRSSISVILT-VEAVEHQVKPMFVEKLKN---VNIKEGSRLEMKVRATGNPNP 1585

Query: 596  EVTWLKDG---LP--LPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKE 645
            ++ WLK+    +P   PK  +  TK G   L I      DS  YT       G++
Sbjct: 1586 DIVWLKNSDIIVPHKYPKIRIEGTK-GEAALKIDSTVSQDSAWYTATAINKAGRD 1639



 Score = 32.3 bits (72), Expect = 2.0
 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 1/86 (1%)

Query: 74  HFSQGLADMEVQPGEAATLSCTLTSDLGPGT-WFKDGVKLTTQDGVIFKQDGLVHSLFIT 132
           +F Q L  M V+ G    L   +T    P   +++DG ++ +       Q+G ++SL I 
Sbjct: 105 NFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIA 164

Query: 133 HVQGTQAGRYTFVAGDQQSEATLTVQ 158
                 +G Y+  A +    AT T +
Sbjct: 165 EAYPEDSGTYSVNATNSVGRATSTAE 190



 Score = 32.3 bits (72), Expect = 2.0
 Identities = 40/205 (19%), Positives = 75/205 (36%), Gaps = 12/205 (5%)

Query: 75   FSQGLADMEVQPGEAATLSCTLTSDLGPG-TWFKDGVKLTTQDGVIFKQDGLVHSLFITH 133
            F + LAD  V+ G    L  T T       +W KD   ++  +            L I  
Sbjct: 6929 FVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILE 6988

Query: 134  VQGTQAGRYTFV----AGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPF 189
                   +Y+ +    AG    EA ++V + P     +     E +    G+P  ++   
Sbjct: 6989 STIEDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPL-----EHVEAVIGEPATLQCKV 7043

Query: 190  QSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSV 249
                 I+ +W K+  ++  +   + Q    +    L +      D G+YS    +  G+V
Sbjct: 7044 DGTPEIRISWYKEHTKLRSAPAYKMQFK--NNVASLVINKVDHSDVGEYSCKADNSVGAV 7101

Query: 250  QAELTLQVIDKPDPPQGPMEVQDCH 274
             +   L +  +  PP    +++D H
Sbjct: 7102 ASSAVLVIKARKLPPFFARKLKDVH 7126



 Score = 31.6 bits (70), Expect = 3.3
 Identities = 19/59 (32%), Positives = 26/59 (44%)

Query: 805   VTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
             VTW+   R LE +     T   GV  L +  ++  D G Y+    N  G+  S A L V
Sbjct: 31600 VTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFV 31658



 Score = 31.6 bits (70), Expect = 3.3
 Identities = 32/130 (24%), Positives = 54/130 (41%), Gaps = 11/130 (8%)

Query: 535   RVTAVNEGGQSQPSALDTLVQAM-----PVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSF 589
             +V+ ++E  +S     ++ V        P  +  K ++ +  +D  TV      +  V  
Sbjct: 32817 KVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDT-TVSSDSVAKFAVKA 32875

Query: 590   EAMPMPEVTWLKDGLPLP---KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEV 646
                P P   W KDG  +    K  ++  K G   L I     SDSGLYT  ++   G  V
Sbjct: 32876 TGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFF-LEIHKTDTSDSGLYTCTVKNSAG-SV 32933

Query: 647   AHSFRIRVAA 656
             + S ++ + A
Sbjct: 32934 SSSCKLTIKA 32943



 Score = 31.2 bits (69), Expect = 4.3
 Identities = 21/97 (21%), Positives = 42/97 (43%), Gaps = 3/97 (3%)

Query: 161  PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGD 220
            P   P +   L+   V++ G+ V ++     +      W ++  ++  S D   Q+    
Sbjct: 939  PVTPPTLVSGLKNVTVIE-GESVTLECHISGYPSPTVTWYREDYQIESSID--FQITFQS 995

Query: 221  GYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQV 257
            G  RL +  A  +D G+++ +  +E G+V     L V
Sbjct: 996  GIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 1032



 Score = 31.2 bits (69), Expect = 4.3
 Identities = 31/153 (20%), Positives = 66/153 (43%), Gaps = 17/153 (11%)

Query: 124  GLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPV 183
            G ++ L + ++     G+YTF AG+  +   LTV         +++ L +  V ++ + V
Sbjct: 2584 GKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGA-----ISKPLTDQTVAESQEAV 2638

Query: 184  IVKIPFQSHL---PIQAAWRKDGAEVVGSSDREAQVDLGDGY-TRLCLPSAGRKDCGQYS 239
                 F+  +     +  W +DG  +  +++  ++    DG+  RL + +    D G+Y+
Sbjct: 2639 -----FECEVANPDSKGEWLRDGKHLPLTNNIRSE---SDGHKRRLIIAATKLDDIGEYT 2690

Query: 240  VTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQD 272
              + +   S + ++    I K        E QD
Sbjct: 2691 YKVATSKTSAKLKVEAVKIKKTLKNLTVTETQD 2723



 Score = 31.2 bits (69), Expect = 4.3
 Identities = 39/124 (31%), Positives = 56/124 (45%), Gaps = 15/124 (12%)

Query: 542   GGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEV---T 598
             GG+  P       Q   V +  KF+ +   KD++  +  + V     FE +  P     T
Sbjct: 11096 GGEKPPDEAPFTYQLKAVPL--KFVKE--IKDIILTE-SEFVGSSAIFECLVSPSTAITT 11150

Query: 599   WLKDGLPL---PK-RSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRV 654
             W+KDG  +   PK R +   KD   +L I    LSD+G YT VLR L  KE   + ++ V
Sbjct: 11151 WMKDGSNIRESPKHRFIADGKD--RKLHIIDVQLSDAGEYTCVLR-LGNKEKTSTAKLVV 11207

Query: 655   AACP 658
                P
Sbjct: 11208 EELP 11211



 Score = 30.8 bits (68), Expect = 5.7
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 4/79 (5%)

Query: 559  VTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKR-SVTVT-KD 616
            + V P  LV S  K++ TV  G++V +       P P VTW ++   +       +T + 
Sbjct: 938  IPVTPPTLV-SGLKNV-TVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQS 995

Query: 617  GLTQLLIPVAGLSDSGLYT 635
            G+ +L+I  A   DSG +T
Sbjct: 996  GIARLMIREAFAEDSGRFT 1014



 Score = 30.8 bits (68), Expect = 5.7
 Identities = 39/199 (19%), Positives = 70/199 (35%), Gaps = 4/199 (2%)

Query: 75   FSQGLADMEVQPGEAATLSCTLTSDLGPG-TWFKDGVKLTTQDGVIFKQDGLVHSLFITH 133
            F + L D  ++ G+   L  T T       TW K+G+ +T               L I  
Sbjct: 7870 FVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPS 7929

Query: 134  VQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHL 193
                 AG+Y     +   + + + Q    + P    K  EP+ V  G    ++       
Sbjct: 7930 STVEDAGQYNCYIENASGKDSCSAQIL-ILEPPYFVKQLEPVKVSVGDSASLQCQLAGTP 7988

Query: 194  PIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAEL 253
             I  +W K   ++  ++  +  +   +    L        D G+Y     +  G V A  
Sbjct: 7989 EIGVSWYKGDTKLRPTTTYK--MHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSAST 8046

Query: 254  TLQVIDKPDPPQGPMEVQD 272
             L V ++  PP    +++D
Sbjct: 8047 FLTVQEQKLPPSFSRQLRD 8065



 Score = 30.0 bits (66), Expect = 9.7
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 5/60 (8%)

Query: 805  VTWFKNDRSL-EGNPAVYSTDLLGVCS-LTIPSVSPKDSGEYKAVAE-NTLGQAVSTATL 861
            VTW+K    L E     +  D  G C  +TI +V+P D G Y  +A     G+A STA L
Sbjct: 8864 VTWYKGPTELTESQKYNFRND--GRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAEL 8921


>gi|110349717 titin isoform novex-2 [Homo sapiens]
          Length = 27118

 Score =  332 bits (851), Expect = 9e-91
 Identities = 188/609 (30%), Positives = 306/609 (50%), Gaps = 11/609 (1%)

Query: 145   VAGDQQSEATLTVQDS---PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRK 201
             V+  +++   +TVQD    PTI  D++   ++ + V AG+PV + IP     P  A+W  
Sbjct: 23412 VSEPRETVTAVTVQDLRVLPTI--DLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFF 23469

Query: 202   DGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKP 261
              G+++  S      V+      +L +     +D G+Y++ L++  G+    + + ++DKP
Sbjct: 23470 AGSKLRESE--RVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKP 23527

Query: 262   DPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTF 321
              PP GP+++ +     + + W PP  +GG  +  YVVE+R A R  WL V E+   ST F
Sbjct: 23528 GPPTGPIKIDEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRST-F 23586

Query: 322   TDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEA-LPKAPSAPAILSASSQGITLT 380
                 +  G +Y FRV A    G G  L+SE I       +P  P    I   S  G+TLT
Sbjct: 23587 KFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIECRSSIRIPGPPETLQIFDVSRDGMTLT 23646

Query: 381   WTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAP 440
             W  P   G + + GY++ER++  ++ W  VN  PV   R+    + +G +YE RVTA+  
Sbjct: 23647 WYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINA 23706

Query: 441   SGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVEL 500
              G G+P  PS  + A DP+ PPG  +N +VTD + TS++L+W+ P+ + G +  GY++E+
Sbjct: 23707 RGSGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEM 23766

Query: 501   CSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVT 560
                D  +W  C+     +  YT   L  G  Y  RV A N GG  +P+ +   V+   + 
Sbjct: 23767 QKVDQHEWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEML 23826

Query: 561   VCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQ 620
               P + +D   ++ + V+ G  +R+ +  +  P P   W K+G  + KR++  T +  T+
Sbjct: 23827 EYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTE 23886

Query: 621   LLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWE 679
             L+I  A   DSG Y +VL    GK+  +  ++RV   P +P GP+   +    +V   W 
Sbjct: 23887 LVIKEADRGDSGTYDLVLENKCGKKAVY-IKVRVIGSPNSPEGPLEYDDIQVRSVRVSWR 23945

Query: 680   PSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGA 739
             P  D+     L Y +  R      W+    R+      + G+    EYHFRV A+N+ G 
Sbjct: 23946 PPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGI 24005

Query: 740   SKPSDTSQP 748
             SKP  + +P
Sbjct: 24006 SKPLKSEEP 24014



 Score =  295 bits (755), Expect = 1e-79
 Identities = 176/588 (29%), Positives = 283/588 (48%), Gaps = 9/588 (1%)

Query: 166   DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
             D+  +  E +  +AG  V ++            W KD  E+   ++    V+       +
Sbjct: 20568 DLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKEL--QTNALVCVENTTDLASI 20625

Query: 226   CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPP 285
              +  A R + G Y + LR+  GS  A + +Q++DKP PP GP+E +      + L WRPP
Sbjct: 20626 LIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPP 20685

Query: 286   RDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAG 345
              D+GG  +  Y+VE+R+  R  W  V E   +    T   +  G +Y FRVRAV   G G
Sbjct: 20686 ADDGGAKITHYIVEKRETSRVVWSMVSEH-LEECIITTTKIIKGNEYIFRVRAVNKYGIG 20744

Query: 346   EALESEEILVAPEAL--PKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKG 403
             E LES+ + VA  A   P  P  P +   +   +T+ W+ P   G + I GY +E+R K 
Sbjct: 20745 EPLESDSV-VAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKK 20803

Query: 404   SNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPG 463
             S  W  V  + + + R  V  + +   Y++RV AV  +G G    PS+   A DP+ PPG
Sbjct: 20804 SLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPG 20863

Query: 464   LVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHV-GTVPVTTYT 522
                 +++ D + +SITL W+ P    G    GYVVE+   +  +W      G V  T Y 
Sbjct: 20864 PPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYV 20923

Query: 523   AKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDT 582
                L+PG  Y+ RV+AVN  GQ +P  ++  VQA  +   P+  +D + +  +  K G+ 
Sbjct: 20924 VSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGED 20983

Query: 583   VRVPVSFEAMPMPEVTWLKD--GLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRT 640
             V+V + F+  P P VTW KD   L    R      D  + L IP    +D+G Y + +  
Sbjct: 20984 VQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIEN 21043

Query: 641   LQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSA 700
               G+  + +  ++V   P A   + ++    GTVT  W+P   +     ++Y +  R + 
Sbjct: 21044 GVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDAT 21103

Query: 701   HGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
                W   + +  +  F L+ +     + FRV+A+NE+G  +P +T++P
Sbjct: 21104 KRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEP 21151



 Score =  286 bits (733), Expect = 4e-77
 Identities = 183/608 (30%), Positives = 287/608 (47%), Gaps = 13/608 (2%)

Query: 145   VAGDQQSEATLTVQDS---PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSH-LPIQAAWR 200
             V+   +S   + V+D    P +  DV  K R+ +VVKAG+ + +        LP+  +W 
Sbjct: 19463 VSEPSESTGPIIVKDDVEPPRVMMDV--KFRDVIVVKAGEVLKINADIAGRPLPV-ISWA 19519

Query: 201   KDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDK 260
             KDG E+        ++   D +T L +    R+D GQY +TL++  G+    +  +V+DK
Sbjct: 19520 KDGIEI--EERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDK 19577

Query: 261   PDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTT 320
             P PP GP+E+         L W  P+++GG  ++ Y+VE+R+     W  + E     T+
Sbjct: 19578 PGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWT-ICEGELQMTS 19636

Query: 321   FTDAHVEPGRKYTFRVRAVTSEGAGEALESEEI-LVAPEALPKAPSAPAILSASSQGITL 379
                  +  G +Y FRV  V   G GE LES  I  + P  +P  P++  I S + + +TL
Sbjct: 19637 CKVTKLLKGNEYIFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLEITSVTKESMTL 19696

Query: 380   TWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVA 439
              W+ P   G + I GY+IERR+K S  W  VN +PV + R     +R+GC+YE+RV A  
Sbjct: 19697 CWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAEN 19756

Query: 440   PSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVE 499
              +G   P   S  + A DP+  P      ++ D   T+IT++W  P    G    GY VE
Sbjct: 19757 AAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVE 19816

Query: 500   LCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPV 559
                SD   W    + ++  T YT  GL  G  Y  RV +VN+ G S PS       A   
Sbjct: 19817 YKKSDDTDW-KTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKER 19875

Query: 560   TVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLT 619
                P F +DS  +  L VK G +  + V F   P+P V W K    L  R+   T D  T
Sbjct: 19876 EEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRT 19935

Query: 620   QLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWE 679
              L I  A  +DSG YT+ ++ +     + +  ++V   P  P  I +Q+    +    W+
Sbjct: 19936 SLTIENANRNDSGKYTLTIQNVL-SAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWD 19994

Query: 680   PSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGA 739
                ++      +Y +  R ++   W    +  +   + +  +  G  Y+FRV  +NE G 
Sbjct: 19995 VPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGV 20054

Query: 740   SKPSDTSQ 747
               P++T +
Sbjct: 20055 GIPAETKE 20062



 Score =  284 bits (727), Expect = 2e-76
 Identities = 189/655 (28%), Positives = 304/655 (46%), Gaps = 13/655 (1%)

Query: 99    DLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITH--VQGTQAGRYTFVAGDQQSEATLT 156
             DL  G W K     T      F   GLV         +    AG ++  +    +     
Sbjct: 18338 DLPDGRWMK--ASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARD 18395

Query: 157   VQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQV 216
               D+P  + D   K ++ +VV AG+  +++   +        W KDG E+  ++ R  ++
Sbjct: 18396 EIDAPNASLD--PKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAAR-MEI 18452

Query: 217   DLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRA 276
                   T L +    R D GQY + L + GG+    +T++V+D+P PP+GP++V      
Sbjct: 18453 KSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAE 18512

Query: 277   GVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRV 336
                L W PP  +GG  +  Y++E+R+  R +W +V      +  +    + PG +Y FRV
Sbjct: 18513 KCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVS-TEVQALNYKVTKLLPGNEYIFRV 18571

Query: 337   RAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGY 395
              AV   G GE LES  +    P   P  PS P + + +   + +TW  P   G   I GY
Sbjct: 18572 MAVNKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGY 18631

Query: 396   LIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFA 455
             ++E+R K    WT  N + + + R  V  + +G  YEFRV A   +G GEP  PS    A
Sbjct: 18632 ILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRA 18691

Query: 456   RDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGT 515
              D + PPG   N +VTD S +S++L+W+ P    G   +GYVVE+  + + +W  C   T
Sbjct: 18692 CDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPT 18751

Query: 516   -VPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDL 574
              +    +T   L+    Y  R+ A+N  G  +P+ L   V A      P+  +D+  + +
Sbjct: 18752 GLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKV 18811

Query: 575   LTVKVGDTVRVPVSFEAMPMPEVTWLK-DGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGL 633
             + ++   T+R+ V+ +  P PEV W K +G+   +  + VT    T L+I      DSG 
Sbjct: 18812 VVLRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVT-SSFTMLVIDNVTRFDSGR 18870

Query: 634   YTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYA 693
             Y + L    G + A    +RV   P AP  + ++E    +VT  WEP   +      +Y 
Sbjct: 18871 YNLTLENNSGSKTAF-VNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYI 18929

Query: 694   VFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             V  R +    +    +      F +  +  G  Y+FRV+A NE G   P++T++P
Sbjct: 18930 VEKRETTRKAYATITNNCTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEP 18984



 Score =  284 bits (726), Expect = 3e-76
 Identities = 190/641 (29%), Positives = 304/641 (47%), Gaps = 26/641 (4%)

Query: 137   TQAGRYTF-VAGDQQ------SEATLTVQDSPTIAPDVTEKLREPL--VVKAGKPVIVKI 187
             T+   YTF V+ + +      SE T+  +D   +APD+  K    L  + K      +KI
Sbjct: 13641 TEGKEYTFRVSAENENGEGTPSEITVVARDD-VVAPDLDLKGLPDLCYLAKENSNFRLKI 13699

Query: 188   PFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGG 247
             P +       +W+K   E   ++D    V+     T L +    + D G+Y++TL++  G
Sbjct: 13700 PIKGKPAPSVSWKK--GEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAG 13757

Query: 248   SVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRST 307
             + +  ++++V+ KP  P GP++  +     + L+W PP+D+GG  +  Y++E+R +  + 
Sbjct: 13758 TKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNK 13817

Query: 308   WLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA-PEALPKAPSA 366
             W+    A    TTF    +  G +YTFRV A    G GE L+SE I+   P  +P AP  
Sbjct: 13818 WVTCASA-VQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPP 13876

Query: 367   PAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVR 426
             P I+      ++LTWT P+  G + I GY +E +++ S  W   N  P+  R + V  + 
Sbjct: 13877 PNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLT 13936

Query: 427   QGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPD 486
             +G +YEFRV A+  +G G+P  PS+ V A DP+ PPG    + +T     S+TL W  P 
Sbjct: 13937 EGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINIT---RNSVTLIWTEPK 13993

Query: 487   TQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ-S 545
                G +  GY+VE     S  W+  +   VP   +T   L  G  Y  R+ A N  G  S
Sbjct: 13994 YDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAIS 14053

Query: 546   QPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRV-PVSFEAMPMPEVTWLKDGL 604
              PS     +        P  ++D + KD LT+K GDT+ +  +S    P+P+ +W K G 
Sbjct: 14054 APSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGK 14113

Query: 605   PLPKRSVT-VTKDGLTQLL-IPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPG 662
              +    +T +T    + +L I  A   D+G YT+      G +V H  ++ V   P  PG
Sbjct: 14114 DIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEH-VKVTVLDVPGPPG 14172

Query: 663   PIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGIL 722
             P+ +        T  W P  ++       Y +  R ++   W   ++ I + R     ++
Sbjct: 14173 PVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKLI 14232

Query: 723   PGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAP 763
              G+EY FRV A N  G  +P   S+P    +  DRF    P
Sbjct: 14233 QGNEYIFRVSAVNHYGKGEPVQ-SEP---VKMVDRFGPPGP 14269



 Score =  284 bits (726), Expect = 3e-76
 Identities = 173/592 (29%), Positives = 290/592 (48%), Gaps = 10/592 (1%)

Query: 159   DSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDL 218
             ++P I  DV  K ++ +++KAG+   ++       P    W KDG E+ G++  E  + +
Sbjct: 15152 EAPKIKVDV--KFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLE--IKI 15207

Query: 219   GDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGV 278
              D  T L    + R+D G Y++T  + GG  +    ++V+D+P PP+GP+ V +      
Sbjct: 15208 ADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKC 15267

Query: 279   CLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRA 338
              L W PP D+GG  ++ Y+V++R+  R  W  V  +    T      +  G +Y FRV A
Sbjct: 15268 VLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVA-SEVQVTKLKVTKLLKGNEYIFRVMA 15326

Query: 339   VTSEGAGEALESEEIL-VAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLI 397
             V   G GE LESE +L V P   P  P  P + + +   + + W  P   G + I+ Y++
Sbjct: 15327 VNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIV 15386

Query: 398   ERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARD 457
             ERR K    W   N + + + R+ V+ + +G +YEFR+ A   +G   P P S    A D
Sbjct: 15387 ERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACD 15446

Query: 458   PMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQW-LPCHVGTV 516
              +  PG   N +V D S +SI+++W  P    G E  GY+VE+   +  +W +      +
Sbjct: 15447 TVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGL 15506

Query: 517   PVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLT 576
               T+YT  GL   + Y +R+ A+N  G  +P+ +    +A    + P+  +D+  + ++T
Sbjct: 15507 KATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVT 15566

Query: 577   VKVGDTVRVPVSFEAMPMPEVTWLKD-GLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYT 635
             ++   T+R+ V  +  P PEV W +D G  L K S+  T    T L++      DSG Y 
Sbjct: 15567 IRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIEST-SSYTLLIVGNVNRFDSGKYI 15625

Query: 636   VVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVF 695
             + +    G + A    +RV   P  P  + ++E    +VT  W+P   +      +Y V 
Sbjct: 15626 LTVENSSGSKSAF-VNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVE 15684

Query: 696   TRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQ 747
              R S    +   A   H   + +  +  G  Y+FRV+A+NE G   P++T++
Sbjct: 15685 KRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAE 15736



 Score =  281 bits (719), Expect = 2e-75
 Identities = 181/627 (28%), Positives = 302/627 (48%), Gaps = 24/627 (3%)

Query: 138   QAGRYTF----------VAGDQQSEATLTVQD---SPTIAPDVTEKLREPLVVKAGKPVI 184
             + G+Y F          ++   +S  T+  +D   +PTI  D T  +++ L +KAG  ++
Sbjct: 14035 EGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIVLDPT--IKDGLTIKAGDTIV 14092

Query: 185   VKIPFQSHLPI-QAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLR 243
             +        P+ +++W K G ++  S     Q+      + L +  A RKD G+Y++T  
Sbjct: 14093 LNAISILGKPLPKSSWSKAGKDIRPSDI--TQITSTPTSSMLTIKYATRKDAGEYTITAT 14150

Query: 244   SEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQA 303
             +  G+    + + V+D P PP GP+E+ +       L W PP ++GG  ++ Y++E+R+ 
Sbjct: 14151 NPFGTKVEHVKVTVLDVPGPP-GPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRET 14209

Query: 304   GRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEI-LVAPEALPK 362
              R  W  V E    S       +  G +Y FRV AV   G GE ++SE + +V     P 
Sbjct: 14210 SRLLWTVVSE-DIQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQSEPVKMVDRFGPPG 14268

Query: 363   APSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTV 422
              P  P + + +    T++W  P   G + I GY +ERR+K S  W      PV + R  V
Sbjct: 14269 PPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDLRCKV 14328

Query: 423   ADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSW 482
               +++G  YEFRV+A   +G G P   SD+V  +D   PPG   N  VTD +  S +L+W
Sbjct: 14329 TGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSASLAW 14388

Query: 483   AGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGT-VPVTTYTAKGLRPGEGYFVRVTAVNE 541
               P    G E  GYVVE        W+    GT + +T +    L+  E Y  R++A+N+
Sbjct: 14389 GKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAIND 14448

Query: 542   GGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLK 601
              G  +P+ +   V+ +   + P F +D+  +  L V+ G ++R+ V  +  P PEVTW K
Sbjct: 14449 AGVGEPAVIPD-VEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTK 14507

Query: 602   DGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP 661
             D + L  R+     +  T L+IP     D+G + + +    GK+ +    +RV   P   
Sbjct: 14508 DNINLKNRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKK-SGFVNVRVLDTPGPV 14566

Query: 662   GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGI 721
               +   +    +VT  W+    +      +Y V  R +    +  A  + H   + + G+
Sbjct: 14567 LNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTKCHKCTYKVTGL 14626

Query: 722   LPGHEYHFRVVAKNELGASKPSDTSQP 748
               G EY FRV+A+NE G  +P++T++P
Sbjct: 14627 SEGCEYFFRVMAENEYGIGEPTETTEP 14653



 Score =  279 bits (714), Expect = 7e-75
 Identities = 165/576 (28%), Positives = 281/576 (48%), Gaps = 6/576 (1%)

Query: 175   LVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKD 234
             L++K+G+ + +K   Q     +  W KDG E+    + E    LG   T L +  A R  
Sbjct: 21663 LIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGS--TSLFVRDATRDH 21720

Query: 235   CGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVE 294
              G Y+V  ++  GS +AE+ ++V D P    GP+   +     + L W  P ++G   + 
Sbjct: 21721 RGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPIT 21780

Query: 295   CYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEIL 354
              Y++E+R+  R  W  + E   ++ ++T   +  G +Y FRV AV   G G  L+S+ ++
Sbjct: 21781 HYIIEKRETSRLAWALI-EDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVV 21839

Query: 355   VAPE-ALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAV-ND 412
                +  +P AP  P   + +   ITLTW  P   G + I  Y++ERR+K S  W  V + 
Sbjct: 21840 AQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISK 21899

Query: 413   QPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTD 472
             +P+ E R+ V  + +G +YEF V A   +G G     S  +  R+P+ PPG    ++VTD
Sbjct: 21900 RPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTD 21959

Query: 473   RSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGY 532
              S T+++L W+ P    G E  GY++E+C +D   W   +      T YT   L+ GE Y
Sbjct: 21960 TSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEY 22019

Query: 533   FVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAM 592
               RV+A+N  G+     +   ++A+     P+  +D++ K    V+ G ++R+ ++++  
Sbjct: 22020 KFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGR 22079

Query: 593   PMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRI 652
             P P   W K    L  R+   T D  + L +     +D+G YT+ +    G + + +F +
Sbjct: 22080 PTPTAVWSKPDSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSK-SITFTV 22138

Query: 653   RVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIH 712
             +V   P  PGPI  ++   G+ T  W+    +      HY V  R ++   W   +++  
Sbjct: 22139 KVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISEKCT 22198

Query: 713   TNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
                F +  +  G  Y+FRV A NE G  +P +  +P
Sbjct: 22199 RQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEP 22234



 Score =  277 bits (708), Expect = 3e-74
 Identities = 194/673 (28%), Positives = 302/673 (44%), Gaps = 19/673 (2%)

Query: 81   DMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAG 140
            D+   PG        L  D     W ++ + +   D      +G +H L I  ++    G
Sbjct: 6615 DILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQG 6674

Query: 141  RYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWR 200
             Y F+A D+++ A L +  +P I     +   + LVV  GKP+ + +P+ ++   +A W 
Sbjct: 6675 EYRFIAKDKEARAKLELAAAPKI-----KTADQDLVVDVGKPLTMVVPYDAYPKAEAEWF 6729

Query: 201  KDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDK 260
            K+   +   +     +D     T   +  A + D G+Y + L+++ G  +  + L+VID 
Sbjct: 6730 KENEPLSTKT-----IDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDV 6784

Query: 261  PDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTT 320
            P P +  +EV +     V L W  P  +GG  +  YVVERR   R TW+   +  A+S  
Sbjct: 6785 PGPVRN-LEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDR-AESCE 6842

Query: 321  FTDAHVEPGR-KYTFRVRAVTSEGAGEALESEEILVAPEA--LPKAPSAPAILSASSQGI 377
            FT   ++ G  +Y FRV A    G GE +E++  + A     +P  P    I   +  G+
Sbjct: 6843 FTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGV 6902

Query: 378  TLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTA 437
            +LTW  P   G A I  Y+IE R K S  W         +   TV DV +G +Y FRV A
Sbjct: 6903 SLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRA 6962

Query: 438  VAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYV 497
                G G+P   +  V   DP+  P    NL  +D++ +S+ L W  P    G    GY+
Sbjct: 6963 QNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYI 7022

Query: 498  VELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAM 557
            +E C      W+ C++  VP  TY   GL  G  Y  RV+A N+ G S PS +   + A 
Sbjct: 7023 IERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTAD 7082

Query: 558  PVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWL--KDGLPLPKRSVTVTK 615
               V P   + S+ KD L V V + + + V     P P  TW      L    R    T 
Sbjct: 7083 DAFVEPTMDL-SAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTL 7141

Query: 616  DGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVT 675
                +L+I  +  SD G+YT+ L   + K ++    + V A P AP  +   +    +V 
Sbjct: 7142 SAYAELVISPSERSDKGIYTLKLEN-RVKTISGEIDVNVIARPSAPKELKFGDITKDSVH 7200

Query: 676  AEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKN 735
              WEP  D+       Y V  R  +   W +  D +    FT+  ++ G EY F+V A+N
Sbjct: 7201 LTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARN 7260

Query: 736  ELGASKPSDTSQP 748
            + G  +P+   +P
Sbjct: 7261 KCGPGEPAYVDEP 7273



 Score =  266 bits (679), Expect = 8e-71
 Identities = 174/592 (29%), Positives = 269/592 (45%), Gaps = 11/592 (1%)

Query: 165   PDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTR 224
             P +  KL   L VKAG  + ++   +     + AW KD      +     ++D     ++
Sbjct: 11896 PVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSK 11955

Query: 225   LCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRP 284
               L  A R D G+Y VT  +  GS  A  T+ V+DKP P +  +++ D       + W P
Sbjct: 11956 FSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRN-LKIVDVSSDRCTVCWDP 12014

Query: 285   PRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGA 344
             P D+GG  ++ Y++E+ +  R  W           T     +E G +Y FRVRA    G 
Sbjct: 12015 PEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIE-GNEYIFRVRAENKIGT 12073

Query: 345   GEALESEEILVAPEA-LPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKG 403
             G   ES+ ++   +   P  P  P +   S + +T+ W  P   G   I GY +E+++K 
Sbjct: 12074 GPPTESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKH 12133

Query: 404   SNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPG 463
             S  W  VN   +PERR  V ++    +Y+FRV A    G GEP  PS  V A+DP+ PPG
Sbjct: 12134 STRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPG 12193

Query: 464   LVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVEL-----CSSDSLQWLPCHVGTVPV 518
                N +V D +  SITL W  P    G    GYVVE+      +S    W  C+     V
Sbjct: 12194 PPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLV 12253

Query: 519   -TTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTV 577
                +T   L   + Y  RV A N+ G  +P+ L   ++   +   P+  +D+S + L+ V
Sbjct: 12254 RKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVIV 12313

Query: 578   KVGDTVRVPVSFEAMPMPEVTWLKDGLP-LPKRSVTVTKDGLTQLLIPVAGLSDSGLYTV 636
             + G  +R+       P P+VTW K G+  + ++      D +  L+IP +   DSG Y++
Sbjct: 12314 RAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSL 12373

Query: 637   VLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFT 696
              L    G E A    +RV   P     + + +    +    W P  ++      HY V  
Sbjct: 12374 TLVNPAG-EKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEK 12432

Query: 697   RSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             R +    W      +    F +  ++PG+EY+FRV A NE G   P+D  +P
Sbjct: 12433 READRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKP 12484



 Score =  266 bits (679), Expect = 8e-71
 Identities = 184/657 (28%), Positives = 293/657 (44%), Gaps = 18/657 (2%)

Query: 99    DLGPGTWFKDGVKLTTQDGVIFKQDGLV--HSLFITHVQGTQAGRYTFVAGDQQSEATLT 156
             +L  G W K     T      F+  GLV  H      +    AG ++      +S   +T
Sbjct: 16174 ELPEGRWMK--ASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFS---EPSESTGAIT 16228

Query: 157   VQDS---PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDRE 213
              +D    P I+ D   K ++ +VV AG+   V             W K   E+  S+   
Sbjct: 16229 ARDEVDPPRISMD--PKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL--SNTAR 16284

Query: 214   AQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDC 273
              ++   D  T L +  A R D G Y +  ++  G     + ++V+D+P PP+GP+ +   
Sbjct: 16285 LEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGV 16344

Query: 274   HRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYT 333
                   L W+PP  +GG  +  Y+VERR+  R  W  V +A   + +     +  G +YT
Sbjct: 16345 TAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVV-DANVQTLSCKVTKLLEGNEYT 16403

Query: 334   FRVRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHI 392
             FR+ AV   G GE LESE ++   P  +P AP AP + + +   + + W  P   G + I
Sbjct: 16404 FRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEI 16463

Query: 393   LGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDA 452
             LGY++E+R K    WT  + + + E R  V  + +   YEFRV+A   +G  EP PPS  
Sbjct: 16464 LGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAY 16523

Query: 453   VFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCH 512
               A DP+  PG   N +V D + +S+ LSW+ P    G E QGY+VE C     +W  C 
Sbjct: 16524 QKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCT 16583

Query: 513   VGT-VPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSST 571
               T +  T    + L     Y  R+ A+N+ G  + + +   +        P   +D   
Sbjct: 16584 PPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLEL 16643

Query: 572   KDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDS 631
             + ++ ++ G ++R+ V  +  P PEV W K    +   ++       T L++      DS
Sbjct: 16644 RKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTSLVLDNVNRYDS 16703

Query: 632   GLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLH 691
             G YT+ L    G + A    +RV   P  P  + + E    +V+  WEP   +      +
Sbjct: 16704 GKYTLTLENSSGTKSAF-VTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKN 16762

Query: 692   YAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             Y V  R +    +       H N + +  +  G  Y+FRV A+NE G   P+ T+ P
Sbjct: 16763 YIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADP 16819



 Score =  264 bits (674), Expect = 3e-70
 Identities = 169/584 (28%), Positives = 277/584 (47%), Gaps = 9/584 (1%)

Query: 166   DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
             D++  ++  L VKAG  V +            +W+KDG  +  +     ++ +      L
Sbjct: 12991 DLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEG--IKMAMQRNLCTL 13048

Query: 226   CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPP 285
              L S  RKD G Y++T  +  GS  A + L+V+DKP PP   +++   +     L W PP
Sbjct: 13049 ELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPAS-VKINKMYSDRAMLSWEPP 13107

Query: 286   RDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAG 345
              ++GG  +  Y+V++R+  R  W +V      ++   +  +E G +Y FR+ A    G G
Sbjct: 13108 LEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIE-GHEYQFRICAENKYGVG 13166

Query: 346   EALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGS 404
             + + +E  +   P   P     P I + +   +T++W  P   G + I GYL+E+R+  +
Sbjct: 13167 DPVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQA 13226

Query: 405   NTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGL 464
               WT VN +P+ ER      +++G +YEFRVTA+  +GPG+P   S A +ARDP  PPG 
Sbjct: 13227 VNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGP 13286

Query: 465   VRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHV-GTVPVTTYTA 523
                 +V D + +S++LSW  P    G    GY+VE+  +DS  W+ C++   +  T +  
Sbjct: 13287 PAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEV 13346

Query: 524   KGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTV 583
              GL     Y  RV AVN+ G S PS +        + + P+  +D+  +  L ++ G T+
Sbjct: 13347 TGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTM 13406

Query: 584   RVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTK--DGLTQLLIPVAGLSDSGLYTVVLRTL 641
             R+ V  +  P P++TW K  + L  R     K  D  T L        D+G Y + L   
Sbjct: 13407 RLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENS 13466

Query: 642   QGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAH 701
              GK+  ++  ++V   P  P  + ++E    +    WEP   +     ++Y V  R +  
Sbjct: 13467 CGKK-EYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAER 13525

Query: 702   GPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
               W           F +  +  G  Y FRV A+NE G   P +T
Sbjct: 13526 KSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGET 13569



 Score =  263 bits (673), Expect = 4e-70
 Identities = 167/589 (28%), Positives = 274/589 (46%), Gaps = 11/589 (1%)

Query: 165   PDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTR 224
             P +    R+ L ++ G+   +   +      + +W KD A+V+   D    +        
Sbjct: 10513 PTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVL--EDDRTHIKTTPATLA 10570

Query: 225   LCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRP 284
             L    A R D G+Y V + +  GS +    + V+D+P PP GP+   +  +  + + W+P
Sbjct: 10571 LEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKP 10630

Query: 285   PRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGA 344
             P D+GG  +  Y++E+++ G+  W+ V  A A +T      +E G+ Y FR+ A    G 
Sbjct: 10631 PLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLE-GKDYIFRIHAENLYGI 10689

Query: 345   GEALESEEILVAPE-ALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKG 403
              + L S+ +       +P AP  P +   +     +TW  P   G   I  Y++E+R+  
Sbjct: 10690 SDPLVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKPHDGGKP-ITNYILEKRETM 10748

Query: 404   SNTWTAVNDQPV-PERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP 462
             S  W  V   P+ P  ++ V D+ +GCQYEFRV+A    G G+P PPS  VFA+DP+  P
Sbjct: 10749 SKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKP 10808

Query: 463   GLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCH--VGTVPVTT 520
                 N +  D +  S+ L+W  P    G +  GY+VE       +W   +    + P T 
Sbjct: 10809 SPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETK 10868

Query: 521   YTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVG 580
             Y   GLR G+ Y  RV AVN  G+S P+ +   V        P+ ++D++      +KVG
Sbjct: 10869 YKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVG 10928

Query: 581   DTVRVPVSFEAMPMPEVTWLKDGLPLP-KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLR 639
             DT+R+    + +P P+VTW K+    P K  + VT  G ++L I  A   D G+Y++ + 
Sbjct: 10929 DTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVG-SKLEIRNAAHEDGGIYSLTVE 10987

Query: 640   TLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSS 699
                G +   S ++ V   P  P  + + E    +    W+   D+   V  +Y V  R  
Sbjct: 10988 NPAGSKTV-SVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDV 11046

Query: 700   AHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             A   W   +            +  G++Y FRV A+N+ G     +T +P
Sbjct: 11047 ASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKP 11095



 Score =  263 bits (672), Expect = 5e-70
 Identities = 187/652 (28%), Positives = 297/652 (45%), Gaps = 30/652 (4%)

Query: 114   TQDGVIFKQDGLVHSLFITHVQGTQAGR-YTF------VAGDQQSEATLTVQDSPTIAPD 166
             TQD + FK    +  +    V G Q G+ Y F      + G    + T+ ++    + P 
Sbjct: 11148 TQDWIKFKTVTNLECV----VTGLQQGKTYRFRVKAENIVGLGLPDTTIPIECQEKLVPP 11203

Query: 167   VTE---KLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYT 223
               E   KL E LVVKAG  V      +      A W  DG+E+   +D    V+  +  +
Sbjct: 11204 SVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEI--KTDEHYTVETDNFSS 11261

Query: 224   RLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWR 283
              L + +  R+D G+Y +T+ +  GS    + L V+D P PP GP+ + D     + + W+
Sbjct: 11262 VLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTISWQ 11321

Query: 284   PPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEG 343
             PP+D+GG  V  Y+VE++   + TW  V    +  T     H++ G +Y FRVRA    G
Sbjct: 11322 PPKDDGGSPVINYIVEKQDTRKDTWGVVSSG-SSKTKLKIPHLQKGCEYVFRVRAENKIG 11380

Query: 344   AGEALESEEILVAPE-ALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKK 402
              G  L+S   +   + + P  P  P +   +    T++WT P+  G + I GY +ERR+ 
Sbjct: 11381 VGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREV 11440

Query: 403   GSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP 462
              +  W  VN  P+ + ++ V  + +G  YEFRV A   +G  +P P SD + A  P++PP
Sbjct: 11441 -TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKPP 11499

Query: 463   GLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVG-TVPVTTY 521
             G   N ++ D+S  +  L W  P +  G    GYVVE     + QW   +    +    +
Sbjct: 11500 GPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAF 11559

Query: 522   TAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGD 581
                GL  G  Y  R+ A N  G+ +P  L   V A  +   P+  +D + +D++TV+VG 
Sbjct: 11560 RVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQ 11619

Query: 582   TVRVPVSFEAMPMPEVTWLKDG--LPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLR 639
             T+R+    +  P P++TW K+G  L   KR   +      +L I  A  +D G Y +  +
Sbjct: 11620 TIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAK 11679

Query: 640   TLQGKEVAHSFRIRVAACPQAPGP---IHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFT 696
                G    H+    +      PGP   + +        T  WE   D       ++ V  
Sbjct: 11680 NSSG----HAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEY 11735

Query: 697   RSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             R      W   A  + T R     +L  +EY+FRV A+N++G     +T  P
Sbjct: 11736 RKPNQKGWSIVASDV-TKRLIKANLLANNEYYFRVCAENKVGVGPTIETKTP 11786



 Score =  259 bits (661), Expect = 1e-68
 Identities = 166/575 (28%), Positives = 261/575 (45%), Gaps = 12/575 (2%)

Query: 173   EPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGR 232
             E + +KAGK + ++            W+K   EVV SS     V   D  + L +    R
Sbjct: 12601 EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSS--HLAVHKADSSSILIIKDVTR 12658

Query: 233   KDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRT 292
             KD G YS+T  +  G+   ++ + V+D P PPQ P ++ D       L W  P ++GG  
Sbjct: 12659 KDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHIPLEDGGSN 12718

Query: 293   VECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEE 352
             +  Y+VE+    R  W+    A    T+     + PG++Y FRVRA    G  E L S +
Sbjct: 12719 ITNYIVEKCDVSRGDWV-TALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPLTSPK 12777

Query: 353   ILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVN 411
             ++   P  +P  P    +   +   I + W  P   G + I+GYLIER+++ S  W   N
Sbjct: 12778 MVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVKAN 12837

Query: 412   DQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVT 471
             D  V    +  A + +G +Y FR+ A+  +G   P  P++ V AR P+ PPG     +V 
Sbjct: 12838 DTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPG---KPEVI 12894

Query: 472   DRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVG--TVPVTTYTAKGLRPG 529
             D + ++++L WA P    G +  GY VE C     +W+ C+     +P   YTA GL   
Sbjct: 12895 DVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEEK 12954

Query: 530   EGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSF 589
               Y  R  A      S PS     V  +   V P+  +  + K LLTVK G  V +  + 
Sbjct: 12955 AQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCLDATV 13014

Query: 590   EAMPMPEVTWLKDGLPL-PKRSVTVT-KDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVA 647
                PMP V+W KDG  L P   + +  +  L  L +      DSG YT+      G + A
Sbjct: 13015 FGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSA 13074

Query: 648   HSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEA 707
              + +++V   P  P  + + +         WEP  ++      +Y V  R ++   W + 
Sbjct: 13075 -TIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQV 13133

Query: 708   ADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKP 742
             +  +     ++  ++ GHEY FR+ A+N+ G   P
Sbjct: 13134 SATVPITSCSVEKLIEGHEYQFRICAENKYGVGDP 13168



 Score =  258 bits (658), Expect = 2e-68
 Identities = 170/617 (27%), Positives = 289/617 (46%), Gaps = 36/617 (5%)

Query: 173  EPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDR----EAQVDLGDGYTRLCLP 228
            + + VKAG+PV +          +  W K+   +   +D     + +V   +  T L +P
Sbjct: 9101 DTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIP 9160

Query: 229  SAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDN 288
             A R+D G Y+VT  +  GSV   + ++V D+P PP+  + V D       L W  P DN
Sbjct: 9161 KAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRN-LAVTDIKAESCYLTWDAPLDN 9219

Query: 289  GGRTVECYVVERRQAGR--STWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGE 346
            GG  +  YV+++R A R  + W +V     +   +    + P  +Y FRVRAV   G  +
Sbjct: 9220 GGSEITHYVIDKRDASRKKAEWEEVTNTAVEKR-YGIWKLIPNGQYEFRVRAVNKYGISD 9278

Query: 347  ALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSN 405
              +S+++++  P  LP  P  P +L+ +   + ++WT P   G + I GY +E+R++GS 
Sbjct: 9279 ECKSDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSP 9338

Query: 406  TWTAVNDQPVPER-----RWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMR 460
             W+ V+  P+ +       + V  + +G +Y+FR  A+  +G G P  PSD   A DP+ 
Sbjct: 9339 YWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIF 9398

Query: 461  PPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTT 520
            PPG     +V D++ +SI+L W  P    G   +GY+VE+    +  W   +     +TT
Sbjct: 9399 PPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITT 9458

Query: 521  --YTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVK 578
                   L+    Y  RV AVNE G+S+PS     + A  +   P+  +D   +D L  K
Sbjct: 9459 CECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCK 9518

Query: 579  VGDTVRVPVSFEAMPMPEVTW---------LKDGL-PLPKRSVTVTKDGLTQLLIPVAGL 628
             G  +R+P   +  P P+ +W         +KDG+  +P+ +   T +  + ++IP    
Sbjct: 9519 AGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKR 9578

Query: 629  SDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDV 688
            S +G Y++  +   G++ A+  R++V   P  P  + + +   G+    W+   D+  D 
Sbjct: 9579 SHTGKYSITAKNKAGQKTANC-RVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDR 9637

Query: 689  PLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
               Y +  R+     W +      +  F +  +L   +Y FRV A+N  G   P +T Q 
Sbjct: 9638 IKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQ- 9696

Query: 749  WCIPRQRDRFTVKAPCY 765
                    R T + P Y
Sbjct: 9697 --------RTTARDPIY 9705



 Score =  257 bits (656), Expect = 4e-68
 Identities = 167/606 (27%), Positives = 278/606 (45%), Gaps = 11/606 (1%)

Query: 145   VAGDQQSEATLTVQDS---PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRK 201
             ++    S   +T +D    P I+ D   K R+ +VV AG+   ++            W +
Sbjct: 17299 ISKPSDSTGPITAKDEVELPRISMD--PKFRDTIVVNAGETFRLEADVHGKPLPTIEWLR 17356

Query: 202   DGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKP 261
                E+  S+    ++   D    L +  A R D GQY +   +  GS    + ++V+D+P
Sbjct: 17357 GDKEIEESA--RCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRP 17414

Query: 262   DPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTF 321
              PP+GP++V         L W PP  +GG  +  YVVE+R+  R  W  V      ++  
Sbjct: 17415 GPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLK 17474

Query: 322   TDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLT 380
                 +E G +Y FR+ AV   G GE LES  +L+  P  LP  P +  + + +   +T+ 
Sbjct: 17475 VTKLLE-GNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVC 17533

Query: 381   WTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAP 440
             W  P   G + I+GY++E+R +    W   N + + + R  V  + +  +YEFRV+A   
Sbjct: 17534 WNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENA 17593

Query: 441   SGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVEL 500
             +G GEP P +    A DP+  PG   N  + D +  SITL+W  P    G E  GYVVE+
Sbjct: 17594 AGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEI 17653

Query: 501   CSSDSLQWLPCHVGT-VPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPV 559
             C +D  +W      T + VT +    L   + Y +RV A+N+ G  + +++   V+    
Sbjct: 17654 CKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDK 17713

Query: 560   TVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLT 619
                P+  +DS  +  + V+ G + R+ + F+  P PE+TW ++      +         T
Sbjct: 17714 LEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTDKVQIEKGVNYT 17773

Query: 620   QLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWE 679
             QL I     +D+G Y + L    G + A    ++V   P  P  + ++E    +    WE
Sbjct: 17774 QLSIDNCDRNDAGKYILKLENSSGSKSAF-VTVKVLDTPGPPQNLAVKEVRKDSAFLVWE 17832

Query: 680   PSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGA 739
             P   +      +Y +  R S    +   + +     F +  +  G  Y+FRV+A+NE G 
Sbjct: 17833 PPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGV 17892

Query: 740   SKPSDT 745
               P +T
Sbjct: 17893 GVPVET 17898



 Score =  256 bits (655), Expect = 5e-68
 Identities = 185/660 (28%), Positives = 300/660 (45%), Gaps = 39/660 (5%)

Query: 101   GPGTWFKDGVKLTTQDGV--IFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQ 158
             G  TW   G+  T +  V  + +Q  L   +F  + +G           D  +   +TV+
Sbjct: 21200 GEQTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLS---------DPVTIGPITVK 21250

Query: 159   DSPTIAP--DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDG-----AEVVGSSD 211
             +   I P  D+++     + V+ G  V +++P++       +W KDG     +E V  S 
Sbjct: 21251 EL-IITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSK 21309

Query: 212   REAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQ 271
              E ++ L        + +A ++  G+Y+V L +    +   +T+  +  P  P+GP+   
Sbjct: 21310 TENKITLS-------IKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKGPIRFD 21362

Query: 272   DCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRK 331
             +     V L W  P DNGG  + CY +E+R+  ++ W  V  + A  TTF   ++    +
Sbjct: 21363 EIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCSSVA-RTTFKVPNLVKDAE 21421

Query: 332   YTFRVRAVTSEGAGEALESEEILVAPE-ALPKAPSAPAILSASSQGITLTWTAPRGPGSA 390
             Y FRVRA    G  + L S  I+   +  +P  P  P I + +S G++LTW AP   G +
Sbjct: 21422 YQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGS 21481

Query: 391   HILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPS 450
              + G+ +E++++ S  W  VN  P+  R +    + +G  Y+FRV A   +G   P  PS
Sbjct: 21482 EVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGLSSPSDPS 21541

Query: 451   DAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLP 510
                 A  P+ PPG    + VT     +ITL W  P    G +  GY +E    +  +W+ 
Sbjct: 21542 KFTLAVSPVDPPGTPDYIDVT---RETITLKWNPPLRDGGSKIVGYSIEKRQGNE-RWVR 21597

Query: 511   CHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ-SQPSALDTLVQAMPVTVCPKFLVDS 569
             C+   V    YT  GL PG+ Y  R+ A N  G  S PS    ++      V P      
Sbjct: 21598 CNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGP 21657

Query: 570   STKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKD--GLTQLLIPVAG 627
                D L +K G+++R+    +  P+P VTW KDG+ + KR      D  G T L +  A 
Sbjct: 21658 EYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDAT 21717

Query: 628   LSDSGLYTVVLRTLQGKEVAHSFRIRVAACP-QAPGPIHLQENVPGTVTAEWEPSPDEAQ 686
                 G+YTV  +   G   A   +++V   P +  GPI    N+ G     W  +P    
Sbjct: 21718 RDHRGVYTVEAKNASGSAKA-EIKVKVQDTPGKVVGPIRF-TNITGEKMTLWWDAPLNDG 21775

Query: 687   DVPL-HYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
               P+ HY +  R ++   W    D+     +T + ++ G+EY FRV A N+ G  +P D+
Sbjct: 21776 CAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDS 21835



 Score =  254 bits (650), Expect = 2e-67
 Identities = 170/576 (29%), Positives = 260/576 (45%), Gaps = 12/576 (2%)

Query: 175   LVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKD 234
             ++ KAG  + V+IP          W+K G +++  + R    +     T L +    R D
Sbjct: 14770 VIAKAGDNIKVEIPVLGRPKPTVTWKK-GDQILKQTQR-VNFETTATSTILNINECVRSD 14827

Query: 235   CGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVE 294
              G Y +T R+  G V   +T+QV D P PP GP++  +     V   W PP ++GG  + 
Sbjct: 14828 SGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPIS 14887

Query: 295   CYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEIL 354
              YVVE RQ   +TW+++       TT+    +  G +Y FRV+A    G G  + S  I+
Sbjct: 14888 NYVVEMRQTDSTTWVELATTVI-RTTYKATRLTTGLEYQFRVKAQNRYGVGPGITSACIV 14946

Query: 355   VA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQ 413
                P  +P  P  P + + +   +T++W  P   G + ILGY +ER+++    W  V+  
Sbjct: 14947 ANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKA 15006

Query: 414   PVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDR 473
              VP   +  + +  G  YEFRV A   +G  +P  PS+ + A DP+ PPG    L +T  
Sbjct: 15007 LVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNIT-- 15064

Query: 474   SNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYF 533
                ++TL WA P+   G +   Y+VE     + +WL  +   +    +T  GL     Y 
Sbjct: 15065 -RHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYE 15123

Query: 534   VRVTAVNEGGQ-SQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAM 592
              RV A N  G  S PS     +        PK  VD   KD + +K G+  R+       
Sbjct: 15124 FRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGR 15183

Query: 593   PMPEVTWLKDGLPLPKRSVTVTK--DGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSF 650
             P P + W KDG  L   +    K  D  T L+   +   DSG YT+   T  G    H F
Sbjct: 15184 PPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLT-ATNPGGFAKHIF 15242

Query: 651   RIRVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAAD 709
              ++V   P  P GP+ + E         W P  D+      HY V  R ++   W   A 
Sbjct: 15243 NVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVAS 15302

Query: 710   RIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
              +   +  +  +L G+EY FRV+A N+ G  +P ++
Sbjct: 15303 EVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLES 15338



 Score =  254 bits (650), Expect = 2e-67
 Identities = 189/666 (28%), Positives = 307/666 (46%), Gaps = 37/666 (5%)

Query: 98    SDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTF------VAG--DQ 149
             S++G G W K    + + +             F T    ++   Y F       AG   +
Sbjct: 22676 SEVGDGRWLKCNYTIVSDN-------------FFTVTALSEGDTYEFRVLAKNAAGVISK 22722

Query: 150   QSEATLTVQDSPTIAPDVTE---KLREPLV-VKAGKPVIVKIPFQSHLPIQAAWRKDGAE 205
              SE+T  V      AP   E   +L   LV ++AG  +++          +  W K G +
Sbjct: 22723 GSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTK-GDK 22781

Query: 206   VVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQ 265
              +   ++ +    G   T + +    R D G+Y++T+++  G+    + ++V+D P P  
Sbjct: 22782 ELDLCEKVSLQYTGKRATAV-IKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPC- 22839

Query: 266   GPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKV-GEAPADSTTFTDA 324
             G + V    +    L W  P+++GG  +  Y+VERR+  R  W+ V GE P  S   T  
Sbjct: 22840 GKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYVVT-- 22897

Query: 325   HVEPGRKYTFRVRAVTSEGAGEALESEEILVAPE-ALPKAPSAPAILSASSQGITLTWTA 383
              +    +Y FRVRAV   G G  +ESE I+      +P  P  P  +    + I + WT 
Sbjct: 22898 RLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTK 22957

Query: 384   PRGPGSAHILGYLIERRKKGSNTWTAVN-DQPVPERRWTVADVRQGCQYEFRVTAVAPSG 442
             P   G   I  YL+++R+K S  WT VN D  V + R  V  + +GC Y+FRVTAV  +G
Sbjct: 22958 PESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAG 23017

Query: 443   PGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCS 502
               EP   S+ +  R+P   PG     +V D +  SI+L+W  P    G +  GYV+E+  
Sbjct: 23018 NSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQE 23077

Query: 503   SDSLQWLPCHV-GTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTV 561
              D+ QW   H   T+  T +T   L+ G+ Y  RV AVN  G S+ S     ++ +    
Sbjct: 23078 KDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIE 23137

Query: 562   CPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQL 621
              P   +    K  +T++ G ++R+ VS    P P +TW K G+ L  R++  T +  + L
Sbjct: 23138 IPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSLL 23197

Query: 622   LIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWE-P 680
             ++      D+G YT+      GK+ A +  ++V   P     + ++E    +VT  WE P
Sbjct: 23198 IVDKVNRYDAGKYTIEAENQSGKKSA-TVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIP 23256

Query: 681   SPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGAS 740
             + D    V  +Y V  R +A   +     +     + + G++ G  Y+FRV+ +N  G  
Sbjct: 23257 TIDGGAPVN-NYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIG 23315

Query: 741   KPSDTS 746
             +P +TS
Sbjct: 23316 EPCETS 23321



 Score =  251 bits (640), Expect = 3e-66
 Identities = 182/661 (27%), Positives = 289/661 (43%), Gaps = 30/661 (4%)

Query: 126   VHSLFITHVQGTQAGRYTF------VAGDQQSEATLTVQDS--PTIAPDVTEKLREPLVV 177
             V  L  T     + G Y F       AG  +  AT+   D   P + P +   L+E + V
Sbjct: 9766  VEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQRPDMPPSID--LKEFMEV 9823

Query: 178   KAGKPV-----IVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGR 232
             + G  V     I  +PF +    +A  +K   +     D      + D    L +P + R
Sbjct: 9824  EEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRR 9883

Query: 233   KDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRT 292
              D G Y++T  +  G+   E+ L V+ +P PP GP++ +      + L W PP+D+GG  
Sbjct: 9884  SDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSK 9943

Query: 293   VECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESE- 351
             +  YV+E+R+A R TW+ V   P +  T+T   +  G +Y FR+ A    G GE L+SE 
Sbjct: 9944  ITNYVIEKREANRKTWVHVSSEPKE-CTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEP 10002

Query: 352   EILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVN 411
             E      ++P AP  P + S +   +T+ W  P   G + + GY +E +   S  W  VN
Sbjct: 10003 ETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVN 10062

Query: 412   DQPVPER----RWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRN 467
               P+        + V  + +G  Y+FRV A+  +G G    PSD   ARDP+ PPG    
Sbjct: 10063 RDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPG-PPF 10121

Query: 468   LQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLR 527
              +VTD + +S  L W+ P    G +  GY+VE       +W       V  T     GL+
Sbjct: 10122 PKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTGLK 10181

Query: 528   PGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPV 587
              G  Y  RV AVN  G  +P  +  +++     V P   +D+S +D + V  G  +R+  
Sbjct: 10182 EGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRIIA 10241

Query: 588   SFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVA 647
                  P P VTW  +   LP+ +   T    + ++I     S  G+Y+++ +   G E  
Sbjct: 10242 YVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAG-ERK 10300

Query: 648   HSFRIRVAACPQAPGPIHLQENVPG-TVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHE 706
              +  + V   P   G   L  N+   +    W    D+      +Y +  R S    W  
Sbjct: 10301 KTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTP 10360

Query: 707   AADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS------QPWCIPRQRDRFTV 760
                 +     T+ G++ G  Y FR+ A+N +G     +TS      +P  +P + +   V
Sbjct: 10361 VTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPERPEDLEV 10420

Query: 761   K 761
             K
Sbjct: 10421 K 10421



 Score =  250 bits (639), Expect = 3e-66
 Identities = 163/600 (27%), Positives = 269/600 (44%), Gaps = 17/600 (2%)

Query: 163   IAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGY 222
             + P   + L     V AG+ + V +PF         W KD   +  ++   A+    +  
Sbjct: 15840 VIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAEST--ENN 15897

Query: 223   TRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRW 282
             + L +  A R+D G Y V L +  G     L + V+DKP PP GP+++ +     + L W
Sbjct: 15898 SLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTADSITLSW 15957

Query: 283   RPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSE 342
              PP+ +GG ++  Y+VE+R    +TW ++  A    TT     ++ G +Y FR+ A    
Sbjct: 15958 GPPKYDGGSSINNYIVEKRDTSTTTW-QIVSATVARTTIKACRLKTGCEYQFRIAAENRY 16016

Query: 343   GAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRK 401
             G    L SE  +   P  +P  P  P +  +S   + + W  P   G + ++GY +ER++
Sbjct: 16017 GKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKE 16076

Query: 402   KGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRP 461
             + S  W  +N  P+P+ ++    + +G +YEFRV+A    G G+P   S+   ARDP  P
Sbjct: 16077 RNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDP 16136

Query: 462   PGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTY 521
             PG    + VT     S+TL W  P    G +  GY+VE       +W+      +  T +
Sbjct: 16137 PGRPEAIIVT---RNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASFTNIIDTHF 16193

Query: 522   TAKGLRPGEGYFVRVTAVNEGGQ-SQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVG 580
                GL     Y  RV A N  G  S+PS     + A      P+  +D   KD + V  G
Sbjct: 16194 EVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVVHAG 16253

Query: 581   DTVRVPVSFEAMPMPEVTWLKDGLPLPK--RSVTVTKDGLTQLLIPVAGLSDSGLYTVVL 638
             ++ +V       P+P + W+K    L    R    + D  T L +  A   DSG Y +  
Sbjct: 16254 ESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKA 16313

Query: 639   RTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTR 697
             + + G E + +  ++V   P  P GP+ +        T  W+P   +     ++Y V  R
Sbjct: 16314 KNVAG-ERSVTVNVKVLDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERR 16372

Query: 698   SSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT-----SQPWCIP 752
              ++   W      + T    +  +L G+EY FR++A N+ G  +P ++       P+ +P
Sbjct: 16373 ETSRLVWTVVDANVQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVP 16432



 Score =  249 bits (635), Expect = 1e-65
 Identities = 176/633 (27%), Positives = 288/633 (45%), Gaps = 32/633 (5%)

Query: 131   ITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVT--EKLREPL---VVKAGKPVIV 185
             +T +   Q  ++   A +++ ++   V   P IA D+T    L+ P     ++AG+ + +
Sbjct: 17967 VTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKI 18026

Query: 186   KIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSE 245
             +IP         +W KDG  +  ++     V+     T L +    + D G+Y+VT  + 
Sbjct: 18027 EIPVIGRPRPNISWVKDGEPLKQTT--RVNVEETATSTVLHIKEGNKDDFGKYTVTATNS 18084

Query: 246   GGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGR 305
              G+    L++ V++KP PP GP+   +     V + W PP   GG  +  Y+VE+R    
Sbjct: 18085 AGTATENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTT 18144

Query: 306   STWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA-PEALPKAP 364
             +TW  V    A  TT     ++ G +Y FR+ A    G    L+S+ ++V  P   P  P
Sbjct: 18145 TTWHMVSATVA-RTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPGPP 18203

Query: 365   SAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVAD 424
               P + S S   + + W  P   G   I+GY +E+++K S  W  +N  P+ + ++    
Sbjct: 18204 GTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTG 18263

Query: 425   VRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAG 484
             + +G +YEF+V+A    G G+P   S+   ARDP  PPG    + +T     ++TL W  
Sbjct: 18264 LDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVIT---RNNVTLKWKK 18320

Query: 485   PDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ 544
             P    G +  GY+VE       +W+      V  T +T  GL   + Y  RV A N  G 
Sbjct: 18321 PAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGN 18380

Query: 545   -SQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDG 603
              S+PS     + A      P   +D   KD++ V  G+T  +       P+P+V W KDG
Sbjct: 18381 FSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDG 18440

Query: 604   LPLPKRSV------TVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAAC 657
               L + +       T+ K   T L++     +D G Y + L  + G +   S  I V   
Sbjct: 18441 KELEETAARMEIKSTIQK---TTLVVKDCIRTDGGQYILKLSNVGGTK---SIPITVKVL 18494

Query: 658   PQAPGPIHLQENVPGTVTAE-----WEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIH 712
              + PGP      V G VTAE     W P   +      HY +  R ++   W + +  + 
Sbjct: 18495 DR-PGPPEGPLKVTG-VTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQ 18552

Query: 713   TNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
                + +  +LPG+EY FRV+A N+ G  +P ++
Sbjct: 18553 ALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLES 18585



 Score =  246 bits (627), Expect = 9e-65
 Identities = 164/614 (26%), Positives = 286/614 (46%), Gaps = 24/614 (3%)

Query: 161   PTIAPDVTEKLREPLV-----VKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQ 215
             P IA D+  K    L      VKA + + + +PF+        WRKDG  +  ++     
Sbjct: 19080 PVIARDIEIKPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETT--RVN 19137

Query: 216   VDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHR 275
             V      T L +  A ++D G Y + + +  GS+   +T+ V+D+P PP GP+ + +   
Sbjct: 19138 VSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPP-GPIRIDEVSC 19196

Query: 276   AGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFR 335
               + + W PP  +GG  +  Y+VE+++   +TW  V +A A  T+     +  G +Y FR
Sbjct: 19197 DSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVA-RTSIKIVRLTTGSEYQFR 19255

Query: 336   VRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILG 394
             V A    G     ES  ++   P + P  P  P ++ A+   + +TW  P   G + ++G
Sbjct: 19256 VCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIG 19315

Query: 395   YLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVF 454
             Y +E +++ S  W+  N   + + +  V+ + +G  YE+RV A   +G G+     + V 
Sbjct: 19316 YHLEYKERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVP 19375

Query: 455   ARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVG 514
             ARDP  PPG     +VT+ +  S++L W+ P    G +  GY+VE       +WL C+  
Sbjct: 19376 ARDPCDPPG---QPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYT 19432

Query: 515   TVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ-SQPSALDTLVQAMPVTVCPKFLVDSSTKD 573
              +  T +    L   + Y  RV A N     S+PS     +        P+ ++D   +D
Sbjct: 19433 NIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRD 19492

Query: 574   LLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVT--VTKDGLTQLLIPVAGLSDS 631
             ++ VK G+ +++       P+P ++W KDG+ + +R+ T  ++ D  T L +      D+
Sbjct: 19493 VIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDT 19552

Query: 632   GLYTVVLRTLQG-KEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEW-EPSPDEAQDVP 689
             G Y + L+ + G + VA + ++     P A GP+ +        +  W  P  D   D+ 
Sbjct: 19553 GQYVLTLKNVAGTRSVAVNCKVLDKPGPPA-GPLEINGLTAEKCSLSWGRPQEDGGADID 19611

Query: 690   LHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPW 749
              +Y V  R ++H  W      +      +  +L G+EY FRV   N+ G  +P ++    
Sbjct: 19612 -YYIVEKRETSHLAWTICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLES---- 19666

Query: 750   CIPRQRDRFTVKAP 763
                +  D FTV +P
Sbjct: 19667 VAIKALDPFTVPSP 19680



 Score =  244 bits (624), Expect = 2e-64
 Identities = 172/644 (26%), Positives = 276/644 (42%), Gaps = 35/644 (5%)

Query: 148   DQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVV 207
             D +S A   V     I PDV         V+ G+ + +++P          W KDG  + 
Sbjct: 16908 DPRSLAVPIVAKDLVIEPDVKPAFSS-YSVQVGQDLKIEVPISGRPKPTITWTKDGLPL- 16965

Query: 208   GSSDREAQVDLGDGY--TRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQ 265
                 +  ++++ D    T L +    + D GQY +T+ +  G   A + +  +DKPDPP+
Sbjct: 16966 ---KQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPK 17022

Query: 266   GPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAH 325
             GP++  D     + L W PP   GG  +  Y+V++R    + W  V  A    TT     
Sbjct: 17023 GPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVW-DVVSATVARTTLKVTK 17081

Query: 326   VEPGRKYTFRVRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAP 384
             ++ G +Y FR+ A    G   ALES+ I+   P   P  P  P   + S   + + W  P
Sbjct: 17082 LKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEP 17141

Query: 385   RGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPG 444
                G + ++GY +ER+++ S  WT VN   + + ++   ++ +G +YEFRV A    G G
Sbjct: 17142 VNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVG 17201

Query: 445   EPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSD 504
             +    S+   ARDP  PPG    + V       ITL W  P    G    GY+VE     
Sbjct: 17202 KASKNSECYVARDPCDPPGTPEPIMV---KRNEITLQWTKPVYDGGSMITGYIVEKRDLP 17258

Query: 505   SLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ-SQPSALDTLVQAMPVTVCP 563
               +W+      V  T +T  GL   + Y  RV A N  G  S+PS     + A      P
Sbjct: 17259 DGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELP 17318

Query: 564   KFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPK--RSVTVTKDGLTQL 621
             +  +D   +D + V  G+T R+       P+P + WL+    + +  R      D    L
Sbjct: 17319 RISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALL 17378

Query: 622   LIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWEP 680
             ++  A   D G Y +    + G + +    ++V   P  P GP+ +        +  W P
Sbjct: 17379 IVKDAIRIDGGQYILRASNVAGSK-SFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSP 17437

Query: 681   SPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGAS 740
                +      HY V  R ++   W   A  + TN   +  +L G+EY FR++A N+ G  
Sbjct: 17438 PLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVG 17497

Query: 741   KPSDTS-----QPWCIPR----------QRDRFTVKAPCYREPD 769
             +P +++      P+ +P            +D  TV   C+  PD
Sbjct: 17498 EPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTV---CWNRPD 17538



 Score =  235 bits (600), Expect = 1e-61
 Identities = 155/574 (27%), Positives = 257/574 (44%), Gaps = 12/574 (2%)

Query: 177   VKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCG 236
             V+AG  + V IP       +    +DG  +  +     ++   +    + L  +   D G
Sbjct: 20183 VRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAEN--LTINLKESVTADAG 20240

Query: 237   QYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECY 296
             +Y +T  +  G+ +A + + V+D+P PP GP+ + D     V L+W PP+ +GG  V  Y
Sbjct: 20241 RYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNY 20300

Query: 297   VVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA 356
             ++ +R+   + W +V    A  T      +  G +Y FR++A    G  + ++S  + V 
Sbjct: 20301 ILLKRETSTAVWTEVSATVA-RTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVK 20359

Query: 357   -PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPV 415
              P   P  PS P + + + + IT+ W  P   G + ++GY +E + + S  W   N   +
Sbjct: 20360 LPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVI 20419

Query: 416   PERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSN 475
                 + V  +  G  YEFRV A   +G G+P  PS+ V A D   PP   RN+++TD S 
Sbjct: 20420 RTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPP---RNVRITDISK 20476

Query: 476   TSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVR 535
              S++LSW  P    G +  GY+VE       +W       V  T +   GL     Y  R
Sbjct: 20477 NSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFR 20536

Query: 536   VTAVNE-GGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPM 594
             V A N  G  S PS +   +  +     P   +     +++  + G +V++       P 
Sbjct: 20537 VFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPA 20596

Query: 595   PEVTWLKDGLPLPKRSVTVTKD--GLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRI 652
             P + W KD   L   ++   ++   L  +LI  A   +SG Y + LR   G   A + R+
Sbjct: 20597 PTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASA-TIRV 20655

Query: 653   RVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRI 711
             ++   P  P GPI  +      +T  W P  D+      HY V  R ++   W   ++ +
Sbjct: 20656 QILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHL 20715

Query: 712   HTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
                  T   I+ G+EY FRV A N+ G  +P ++
Sbjct: 20716 EECIITTTKIIKGNEYIFRVRAVNKYGIGEPLES 20749



 Score =  225 bits (574), Expect = 1e-58
 Identities = 172/598 (28%), Positives = 266/598 (44%), Gaps = 43/598 (7%)

Query: 157  VQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQV 216
            ++D   I P+  +K   PLV +    V  + PF   LP+      D ++           
Sbjct: 8409 IKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFV--LPLTQRLSIDNSK----------- 8455

Query: 217  DLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRA 276
                G ++L +  + R D G Y + + ++ G  +A  T+ V+D P PP      +D  + 
Sbjct: 8456 ---KGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPIN-FVFEDIRKT 8511

Query: 277  GVCLRWRPPRDNGGRTVECYVVERRQAGR--STWLKVGEAPADSTTFTDAHVEPGRKYTF 334
             V  +W PP D+GG  +  Y +E++   +  S W+ V              +E G++Y F
Sbjct: 8512 SVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIE-GKEYLF 8570

Query: 335  RVRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHIL 393
            RVRA    G G    S+ ++   P   P AP  P +   +S  + + W  P+  GS  IL
Sbjct: 8571 RVRAENRFGPGPPCVSKPLVAKDPFGPPDAPDKPIVEDVTSNSMLVKWNEPKDNGSP-IL 8629

Query: 394  GYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAV 453
            GY +E+R+  S  W+ VN   +   +  V  + +G  Y FRV A   +GPG+  PPSD  
Sbjct: 8630 GYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPK 8689

Query: 454  FARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHV 513
             A DP+ PPG     +VTD S+T+I L W  P    G E  GY V+     + +W  C  
Sbjct: 8690 TAHDPISPPGPPIP-RVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTE 8748

Query: 514  GTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVC-----PKFLVD 568
              + V  YT K +R G  Y +RV+AVN  G+  P       +  PVTV      P   +D
Sbjct: 8749 KMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPG------ETQPVTVAEPQEPPAVELD 8802

Query: 569  SSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGL-TQLLIPVAG 627
             S K  + +  G T+R+P      P+P   W K+   L K  V +   G  ++L+I  A 
Sbjct: 8803 VSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSELIIKDAL 8862

Query: 628  LSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPI-HLQENVPG--TVTAEWEPSPDE 684
              D G Y +      G + A + R+ V      PGP+  L+  V         W    D+
Sbjct: 8863 RKDHGRYVITATNSCGSKFA-AARVEVF---DVPGPVLDLKPVVTNRKMCLLNWSDPEDD 8918

Query: 685  AQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKP 742
                   + +  + +    W +  +    ++  + G+L G EY FRV+AKN+ G   P
Sbjct: 8919 GGSEITGFIIERKDAKMHTWRQPIE-TERSKCDITGLLEGQEYKFRVIAKNKFGCGPP 8975



 Score =  219 bits (559), Expect = 7e-57
 Identities = 163/614 (26%), Positives = 274/614 (44%), Gaps = 23/614 (3%)

Query: 161   PTIAP--DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDL 218
             P I P  D+T    + +  KAG P  + +P       +  W+ +   +   +DR +    
Sbjct: 22336 PQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLK-ETDRVSITTT 22394

Query: 219   GDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGV 278
              D  T L +  + R D G+Y +TL +  G     +T+ VI +P P  GP+EV        
Sbjct: 22395 KDR-TTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESC 22453

Query: 279   CLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRA 338
              L W  P+D GG  +  Y+VE+R++G + W  V  +    T     H+    +Y+FRV +
Sbjct: 22454 VLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSS-VKRTQIKVTHLTKYMEYSFRVSS 22512

Query: 339   VTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLI 397
                 G  + LES  I+   P   P AP+ P +   S+  +++ W  P   G + I+GY +
Sbjct: 22513 ENRFGVSKPLESAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWV 22572

Query: 398   ERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARD 457
             E++++ +  W   N  P  E  + V  + +G +Y+FR  A+  +G  +    S  + A++
Sbjct: 22573 EKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQN 22632

Query: 458   PMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVE---LCSSDSLQWLPCHVG 514
             P+  PG     +VTD + ++++L W+ P    G +  GY++E   +      +WL C+  
Sbjct: 22633 PVDAPG---RPEVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYT 22689

Query: 515   TVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ-SQPSALDTLVQAMPVTVCPKFLVDSSTK- 572
              V    +T   L  G+ Y  RV A N  G  S+ S     V        PK  +D+    
Sbjct: 22690 IVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHG 22749

Query: 573   DLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPL---PKRSVTVTKDGLTQLLIPVAGLS 629
             DL+T++ G  + +  +    P P++ W K    L    K S+  T    T  +I     S
Sbjct: 22750 DLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRAT-AVIKFCDRS 22808

Query: 630   DSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVP 689
             DSG YT+ ++   G + A S  ++V   P   G + +        T  W    ++     
Sbjct: 22809 DSGKYTLTVKNASGTK-AVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEI 22867

Query: 690   LHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPW 749
              HY V  R ++   W        T  + +  ++  +EY FRV A N+ G   P + S+P 
Sbjct: 22868 THYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVE-SEPI 22926

Query: 750   CIPRQRDRFTVKAP 763
                  R+ FT+ +P
Sbjct: 22927 V---ARNSFTIPSP 22937



 Score =  213 bits (543), Expect = 5e-55
 Identities = 165/619 (26%), Positives = 276/619 (44%), Gaps = 48/619 (7%)

Query: 165  PDVTEKLREPLVVK--------AGKPVIVKIPFQSHLPIQAAWRK---DGAEVVGS---- 209
            P    K  EP+++K         GKP +  +   S   ++  W K   DG   + S    
Sbjct: 7660 PGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTS---VRLNWTKPEHDGGAKIESYVIE 7716

Query: 210  -----SDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAE--------LTLQ 256
                 +D   +V  G   T+  LP  G  +  +YS  +R+   + ++E        L  +
Sbjct: 7717 MLKTGTDEWVRVAEGVPTTQHLLP--GLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCRE 7774

Query: 257  VIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPA 316
             +  P PP+  +EV +  +    L+W  P  +GG  +  Y+VE+R   R  W  V     
Sbjct: 7775 KLYPPSPPRW-LEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVK 7833

Query: 317  DSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEAL--PKAPSAPAILSASS 374
            D T  T   +  G  Y FRV A  + G  +  E E+ ++A +    P  P A A++  + 
Sbjct: 7834 D-TKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTK 7892

Query: 375  QGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFR 434
            + + L W  P+  G   I  Y+IE++++    W        P+  + V DV +G + +F+
Sbjct: 7893 RHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQ 7952

Query: 435  VTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQ 494
            V A   +G G P  P++ +   DP  PP    +L VTD     I ++W  P+   G    
Sbjct: 7953 VRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPII 8012

Query: 495  GYVVELCSSDSLQWLPCHVGTVPVTTYTAK---GLRPGEGYFVRVTAVNEGGQSQPSALD 551
            GY VE+C   + +W+   V + P+     K   G+ P + Y +RV AVN  G S+PS + 
Sbjct: 8013 GYHVEMCPVGTEKWM--RVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEIS 8070

Query: 552  TLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRS- 610
              V A      P   +D  T D++ ++ G+ + +PV F A+P+P V+W KDG  +     
Sbjct: 8071 ENVVAKDPDCKP--TIDLETHDIIVIE-GEKLSIPVPFRAVPVPTVSWHKDGKEVKASDR 8127

Query: 611  VTVTKDGLT-QLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQEN 669
            +T+  D ++  L +P +  +D+G+YT+ L    G   A S  ++V   P     I   + 
Sbjct: 8128 LTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATA-SINVKVIGLPGPCKDIKASDI 8186

Query: 670  VPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHF 729
               +    WEP   +     LHY +  R +    +       +   +T+  ++P  EY F
Sbjct: 8187 TKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFF 8246

Query: 730  RVVAKNELGASKPSDTSQP 748
            RV A N++G  +  +   P
Sbjct: 8247 RVKAVNKVGGGEYIELKNP 8265



 Score =  213 bits (542), Expect = 6e-55
 Identities = 140/514 (27%), Positives = 236/514 (45%), Gaps = 13/514 (2%)

Query: 166   DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
             ++ E+ +E + V+ G  + + IP +        W K+G ++     + A +   + +T L
Sbjct: 23832 ELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDI----SKRAMIATSETHTEL 23887

Query: 226   CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPP 285
              +  A R D G Y + L ++ G     + ++VI  P+ P+GP+E  D     V + WRPP
Sbjct: 23888 VIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPP 23947

Query: 286   RDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAG 345
              D+GG  +  Y++ERR+  ++ W  + ++    T+     ++   +Y FRV A    G  
Sbjct: 23948 ADDGGADILGYILERREVPKAAWYTI-DSRVRGTSLVVKGLKENVEYHFRVSAENQFGIS 24006

Query: 346   EALESEEILVAPEAL--PKAPS-APAILSASSQGITLTWTAPRGPGSAHILGYLIERRKK 402
             + L+SEE +     L  P+ PS  P +L  +   ++L+W+ P+  G + + GY IER++ 
Sbjct: 24007 KPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKET 24066

Query: 403   GSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP 462
              ++ W   N   +    +TV  +    +Y+FR+ A    G  E  P S+ V  +DP   P
Sbjct: 24067 STDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKP 24126

Query: 463   GLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYT 522
                  L++   S  S+TL W  P+   G E  GY VE   S    W   +   +    +T
Sbjct: 24127 SQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFT 24186

Query: 523   AKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDT 582
               GL     Y  RV A NE G S+P      ++   +T      +    KD +T K+G+ 
Sbjct: 24187 IGGLLEATEYEFRVFAENETGLSRPRRTAMSIKT-KLTSGEAPGIRKEMKD-VTTKLGEA 24244

Query: 583   VRVPVSFEAMPMPEVTWLKDGLPL-PKRSVTVTKDGLTQ-LLIPVAGLSDSGLYTVVLRT 640
              ++       P+P++ W + G  L   R   ++ DG T  L +      D G+YT +   
Sbjct: 24245 AQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATN 24304

Query: 641   LQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTV 674
               G EV  S ++ + A PQ      L+E   G V
Sbjct: 24305 EVG-EVETSSKLLLQATPQFHPGYPLKEKYYGAV 24337



 Score =  203 bits (517), Expect = 5e-52
 Identities = 159/606 (26%), Positives = 257/606 (42%), Gaps = 32/606 (5%)

Query: 158  QDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVD 217
            Q++P I  DV  KL   L VKAG  + +          +  W K  A+++   D+   ++
Sbjct: 7380 QEAPEIFLDV--KLLAGLTVKAGTKIELPATVTGKPEPKITWTK--ADMILKQDKRITIE 7435

Query: 218  LGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAG 277
                 + + +  + R D G Y +   +  G   A + + V+DKP PP    ++ D     
Sbjct: 7436 NVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAA-FDITDVTNES 7494

Query: 278  VCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVR 337
              L W PPRD+GG  +  YVVERR      W K+     D T F    + P ++Y FRV 
Sbjct: 7495 CLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKD-TNFKATKLIPNKEYIFRVA 7553

Query: 338  AVTSEGAGEALESEEILVAPEALPKAPSAPAILSASS---QGITLTWTAPRGPGSAHILG 394
            A    G GE +++  I    +  P  P  P  L  S      +TLTW  P   G + I G
Sbjct: 7554 AENMYGVGEPVQASPITAKYQFDPPGP--PTRLEPSDITKDAVTLTWCEPDDDGGSPITG 7611

Query: 395  YLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVF 454
            Y +ER    ++ W   N  PV +  + V  +    +Y FRV A   +GPG+P   ++ + 
Sbjct: 7612 YWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPIL 7671

Query: 455  ARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVG 514
             +DP+ PP       V D   TS+ L+W  P+   G + + YV+E+  + + +W+    G
Sbjct: 7672 IKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEG 7731

Query: 515  TVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDL 574
             VP T +   GL  G+ Y  RV AVN+ G+S+PS       + PV    K    S  + L
Sbjct: 7732 -VPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSE-----PSDPVLCREKLYPPSPPRWL 7785

Query: 575  LTVKVGDT---VRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDS 631
              + +      ++  V  +    P   ++ +   + ++        +      V  L++ 
Sbjct: 7786 EVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEG 7845

Query: 632  GLYTVVLRTLQGKEVAHSFRIRVAACPQA------PGPIHLQENVPGT---VTAEWEPSP 682
             LY  V R      +  S    +     A      PGP +    V  T   V  +WEP  
Sbjct: 7846 SLY--VFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPK 7903

Query: 683  DEAQDVPLHYAVFTRSSAHGPWHEAADRIHTN-RFTLLGILPGHEYHFRVVAKNELGASK 741
            ++       Y +  +      W +A      +  F +  ++ G E  F+V A+NE G   
Sbjct: 7904 NDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGH 7963

Query: 742  PSDTSQ 747
            PS+ ++
Sbjct: 7964 PSEPTE 7969



 Score =  199 bits (506), Expect = 9e-51
 Identities = 178/707 (25%), Positives = 304/707 (42%), Gaps = 53/707 (7%)

Query: 79    LADMEVQPGEAATLSCTLTSDLGPGT-WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGT 137
             + D+  + GEAA LSC +     P   W++ G +L          DG  H+L +   +  
Sbjct: 24234 MKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQE 24293

Query: 138   QAGRYTFVA----GDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHL 193
               G YT +A    G+ ++ + L +Q +P   P     L+E      G  + + + +    
Sbjct: 24294 DEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYP--LKEKYYGAVGSTLRLHVMYIGR- 24350

Query: 194   PIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKD-CGQYSVTLRSEGGSVQAE 252
             P+ A     G +++ +S+    ++  + YT L + +  RK   G+Y V L +  G+V A 
Sbjct: 24351 PVPAMTWFHGQKLLQNSEN-ITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAI 24409

Query: 253   LTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVG 312
             L +++ DKPD P GP+ ++   +    + W+PP D+GG  +  YVVE+ +A      ++ 
Sbjct: 24410 LDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLV 24469

Query: 313   EAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILV--APEALPKAPSAPAIL 370
              +    TT    ++     Y FRV A  + G  + LE   +++  +P   P AP  P I 
Sbjct: 24470 SSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTIT 24529

Query: 371   SASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQ 430
             + +     + W  P   G A I  Y +E+R+K  N W +V  + + E  ++V ++ +G +
Sbjct: 24530 AVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLE 24589

Query: 431   YEFRVTAVAPSGPGEPGPPSDAVFARD--PMRPPGL---VRNLQVTDRSNTSITLSWAGP 485
             YEFRV      G  E    S+ +  +   P++ P     +RNL V  +SN ++     G 
Sbjct: 24590 YEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGH 24649

Query: 486   DT------QEGDE--AQG--YVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVR 535
                     ++G E  A G  Y ++       Q +   V     T Y             +
Sbjct: 24650 PKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVY-------------Q 24696

Query: 536   VTAVNEGGQSQPSALDTLVQAMPVTV-CPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPM 594
             V A N+GG    +A  +L   +P  +  PK L        L    G+ V + + F   P 
Sbjct: 24697 VRATNQGGSVSGTA--SLEVEVPAKIHLPKTLEGMGAVHALR---GEVVSIKIPFSGKPD 24751

Query: 595   PEVTWLK--DGLPLPKRSVTVTKDGLTQLLIP-VAGLSDSGLYTVVLRTLQGKEVAHSFR 651
             P +TW K  D +        +     T L+ P      D+G Y V  +   G +   +  
Sbjct: 24752 PVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGID-QKTVE 24810

Query: 652   IRVAACPQAPGPIHLQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADR 710
             + VA  P  P  + + +    +V   W EP+ D    +  +Y V   ++    W      
Sbjct: 24811 LDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKI-TNYIVEKCATTAERWLRVGQA 24869

Query: 711   IHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDR 757
               T R+T++ +     Y FRV+A+N+ G SKPS+ S+P      + R
Sbjct: 24870 RET-RYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTR 24915



 Score =  179 bits (453), Expect = 1e-44
 Identities = 119/400 (29%), Positives = 180/400 (45%), Gaps = 7/400 (1%)

Query: 350  SEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTA 409
            S EI V   A P AP        +   + LTW  P   G + + GY++E+R+    TWT 
Sbjct: 7172 SGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTK 7231

Query: 410  VNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQ 469
            V D  V +  +TV D+ QG +Y F+V A    GPGEP    + V    P   P    N++
Sbjct: 7232 VMDF-VTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVK 7290

Query: 470  VTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPG 529
              DR+  SI L+W  P    G   +GY+VE C   S +W+ C    V  T     GL  G
Sbjct: 7291 WRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACG-EPVAETKMEVTGLEEG 7349

Query: 530  EGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSF 589
            + Y  RV A+N  G S+PS     +QA+     P+  +D      LTVK G  + +P + 
Sbjct: 7350 KWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATV 7409

Query: 590  EAMPMPEVTWLKDGLPLPKRSVTVTKDGL---TQLLIPVAGLSDSGLYTVVLRTLQGKEV 646
               P P++TW K  + L K+   +T + +   + + I  +  SD+G Y +    + G+  
Sbjct: 7410 TGKPEPKITWTKADMIL-KQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRAT 7468

Query: 647  AHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHE 706
            A    + V   P  P    + +    +    W P  D+      +Y V  R++    WH+
Sbjct: 7469 A-VVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHK 7527

Query: 707  AADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS 746
             +  +    F    ++P  EY FRV A+N  G  +P   S
Sbjct: 7528 LSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQAS 7567



 Score =  168 bits (426), Expect = 2e-41
 Identities = 155/598 (25%), Positives = 246/598 (41%), Gaps = 56/598 (9%)

Query: 180   GKPVIVKIPFQSHLPIQAAWRK---DGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCG 236
             G P   K+   S   +  AW K   DG   V     E +    D +T  C P  G +   
Sbjct: 18699 GPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTT-CTPPTGLQG-K 18756

Query: 237   QYSVT--------------LRSEGGSVQAELTLQVI--DKPDPPQGPMEVQDCHRAGVCL 280
             Q++VT              + SEG    A L   V+  ++ +PP+  +E+    R  V L
Sbjct: 18757 QFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPE--IELDADLRKVVVL 18814

Query: 281   RWRPPRDNGGRTVECYV-VERRQAGRSTWLKVGEAPAD------STTFTDAHVEPGRKYT 333
             R          T+  +V ++ R      W K      D      +++FT   ++   ++ 
Sbjct: 18815 R-------ASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTMLVIDNVTRFD 18867

Query: 334   ---FRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSA 390
                + +    + G+  A  +  +L +P A    P    I       +TL+W  P   G A
Sbjct: 18868 SGRYNLTLENNSGSKTAFVNVRVLDSPSA----PVNLTIREVKKDSVTLSWEPPLIDGGA 18923

Query: 391   HILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPS 450
              I  Y++E+R+     +  + +    +  + + ++++GC Y FRV A    G G P   +
Sbjct: 18924 KITNYIVEKRETTRKAYATITNN-CTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETT 18982

Query: 451   DAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLP 510
             + V   +P  PPG V  + VT     + T+ W  P++  G +  GYVVE+ +  S +W  
Sbjct: 18983 EPVKVSEPPLPPGRVTLVDVT---RNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWST 19039

Query: 511   CHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSS 570
             C    V     T  GL  GE Y  RV AVNE G+S P  L   V A  + + P   +   
Sbjct: 19040 C--TQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFH 19097

Query: 571   TKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPK--RSVTVTKDGLTQLLIPVAGL 628
             T     VK  + +++ V F+  P   V W KDG  L +  R    +   +T L I  A  
Sbjct: 19098 T---FNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASK 19154

Query: 629   SDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDV 688
              D G Y + +    G  +     I V   P  PGPI + E    ++T  W P   +    
Sbjct: 19155 EDVGTYELCVSNSAG-SITVPITIIVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQ 19213

Query: 689   PLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS 746
               +Y V  + +    WH  +  +      ++ +  G EY FRV A+N  G S  S++S
Sbjct: 19214 ISNYIVEKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESS 19271



 Score =  166 bits (421), Expect = 7e-41
 Identities = 120/400 (30%), Positives = 179/400 (44%), Gaps = 18/400 (4%)

Query: 361   PKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRW 420
             P  P    +   +   +TLTW  P   G + I  Y++E+R+     ++ V      +  W
Sbjct: 15647 PGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATN-CHKTSW 15705

Query: 421   TVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITL 480
              V  +++GC Y FRV A    G G P   +++V A +   PPG +  + VT     S++L
Sbjct: 15706 KVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITLMDVT---RNSVSL 15762

Query: 481   SWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVN 540
             SW  P+   G    GY+VE+ +  S +W  C   TV VT  T  GL  GE Y  RV+A N
Sbjct: 15763 SWEKPEHDGGSRILGYIVEMQTKGSDKWATC--ATVKVTEATITGLIQGEEYSFRVSAQN 15820

Query: 541   EGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWL 600
             E G S P  L   V A  + + P F +  +T    TV  G+ ++V V F   P P VTW 
Sbjct: 15821 EKGISDPRQLSVPVIAKDLVIPPAFKLLFNT---FTVLAGEDLKVDVPFIGRPTPAVTWH 15877

Query: 601   KDGLPLPK--RSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACP 658
             KD +PL +  R    + +  + L I  A   D G Y V L    G E   +  + V   P
Sbjct: 15878 KDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAG-EAIETLNVIVLDKP 15936

Query: 659   QAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFT 717
               P GP+ + E    ++T  W P   +      +Y V  R ++   W   +  +      
Sbjct: 15937 GPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIK 15996

Query: 718   LLGILPGHEYHFRVVAKNELGA-----SKPSDTSQPWCIP 752
                +  G EY FR+ A+N  G      S+P+    P+ +P
Sbjct: 15997 ACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVP 16036



 Score =  160 bits (404), Expect = 6e-39
 Identities = 152/602 (25%), Positives = 240/602 (39%), Gaps = 42/602 (6%)

Query: 170   KLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKD----GAEVVGSSDREAQVDLGDG---- 221
             K REP V   G P +VK+   S   +   W K     G E++G      + DLGD     
Sbjct: 21941 KCREP-VNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVN 21999

Query: 222   --------YTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEV--Q 271
                     YT   L +         ++    +G S +   T++ +D+   P+  ++   +
Sbjct: 22000 AEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFK 22059

Query: 272   DCH--RAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADST-TFTDAHVEP 328
               H  RAG  +R        GR     V  +  +  S    +    + ST T  + +   
Sbjct: 22060 QTHVVRAGASIRLFIAYQ--GRPTPTAVWSKPDSNLSLRADIHTTDSFSTLTVENCNRND 22117

Query: 329   GRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQG-ITLTWTAPRGP 387
               KYT  V    + G+     + ++L  P      P  P      ++G  TL W AP   
Sbjct: 22118 AGKYTLTVE--NNSGSKSITFTVKVLDTP-----GPPGPITFKDVTRGSATLMWDAPLLD 22170

Query: 388   GSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPG 447
             G A I  Y++E+R+    +W  ++++    + + V D+ +G  Y FRV+AV   G GEP 
Sbjct: 22171 GGARIHHYVVEKREASRRSWQVISEK-CTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPY 22229

Query: 448   PPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQ 507
                + + A +   PP   R L V D S +S  L+W  PD   G    GY++E+    S  
Sbjct: 22230 EMPEPIVATEQPAPP---RRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDF 22286

Query: 508   WLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLV 567
             W+    G     T+T + L     Y  RV A N+ G S+P    + V      + P   +
Sbjct: 22287 WV--EAGHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADL 22344

Query: 568   DSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKR---SVTVTKDGLTQLLIP 624
                T  L+T K G    + V     P P+VTW  + + L +    S+T TKD  T L + 
Sbjct: 22345 TGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKD-RTTLTVK 22403

Query: 625   VAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDE 684
              +   DSG Y + L    G +      + +       GPI +      +    W    D 
Sbjct: 22404 DSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDG 22463

Query: 685   AQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSD 744
                   +Y V  R S    W      +   +  +  +    EY FRV ++N  G SKP +
Sbjct: 22464 GGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE 22523

Query: 745   TS 746
             ++
Sbjct: 22524 SA 22525



 Score =  158 bits (399), Expect = 2e-38
 Identities = 187/767 (24%), Positives = 303/767 (39%), Gaps = 57/767 (7%)

Query: 103   GTWFKDGVK--LTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDS 160
             G W K   +  + T+  V   Q G  +   ++ + G   G    V G  ++   LT  + 
Sbjct: 21993 GDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPEL 22052

Query: 161   PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGD 220
                  D+    ++  VV+AG  + + I +Q      A W K  + +       A +   D
Sbjct: 22053 -----DIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNL----SLRADIHTTD 22103

Query: 221   GYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCL 280
              ++ L + +  R D G+Y++T+ +  GS     T++V+D P PP GP+  +D  R    L
Sbjct: 22104 SFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPP-GPITFKDVTRGSATL 22162

Query: 281   RWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVT 340
              W  P  +GG  +  YVVE+R+A R +W  + E       F    +  G  Y FRV AV 
Sbjct: 22163 MWDAPLLDGGARIHHYVVEKREASRRSWQVISE-KCTRQIFKVNDLAEGVPYYFRVSAVN 22221

Query: 341   SEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERR 400
               G GE  E  E +VA E  P  P    ++  S     L W  P   G + I GYL+E R
Sbjct: 22222 EYGVGEPYEMPEPIVATEQ-PAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMR 22280

Query: 401   KKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMR 460
             +KGS+ W  V      +  +TV  + +  +YEFRV A   +G  EP     +V  ++P  
Sbjct: 22281 QKGSDFW--VEAGHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQI 22338

Query: 461   PPGLVRNLQVTDRSNTSITLSWAGPDTQE----GDEAQGYVVELCSSDSLQWLPCHVGTV 516
              P       +T  +N  IT     P T +    G  A     +L      +     + T 
Sbjct: 22339 EP----TADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTT 22394

Query: 517   -PVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLL 575
                TT T K    G+     +T  N  G  +  ++  +V   P  V     V S + +  
Sbjct: 22395 KDRTTLTVKDSMRGDSGRYFLTLENTAG-VKTFSVTVVVIGRPGPVTGPIEVSSVSAESC 22453

Query: 576   TVKVGD------TVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLS 629
              +  G+      T       E        W      + +  + VT   LT+ +     +S
Sbjct: 22454 VLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTH--LTKYMEYSFRVS 22511

Query: 630   DSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVP 689
                 +  V + L+   +         + P  P   H+  N    ++  WE    +     
Sbjct: 22512 SENRFG-VSKPLESAPIIAEHPFVPPSAPTRPEVYHVSAN---AMSIRWEEPYHDGGSKI 22567

Query: 690   LHYAVFTRSSAHGPW--HEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQ 747
             + Y V  +      W        +  N + + G++ G EY FR  A N  G SK S+ S+
Sbjct: 22568 IGYWVEKKERNTILWVKENKVPCLECN-YKVTGLVEGLEYQFRTYALNAAGVSKASEASR 22626

Query: 748   PWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGL-RSHLLPQGCECCMSCAVQGSPRPHVT 806
             P  I  Q     V AP    P+++   R  V L  S     G    +   ++  P   V+
Sbjct: 22627 P--IMAQN---PVDAP--GRPEVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKP---VS 22676

Query: 807   WFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLG 853
                + R L+ N  + S +       T+ ++S  D+ E++ +A+N  G
Sbjct: 22677 EVGDGRWLKCNYTIVSDNF-----FTVTALSEGDTYEFRVLAKNAAG 22718



 Score =  157 bits (397), Expect = 4e-38
 Identities = 114/426 (26%), Positives = 187/426 (43%), Gaps = 14/426 (3%)

Query: 318   STTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGI 377
             +++FT   ++   +Y      +T E +    +S  + V     P  P    +   +   +
Sbjct: 16687 TSSFTSLVLDNVNRYDSGKYTLTLENSS-GTKSAFVTVRVLDTPSPPVNLKVTEITKDSV 16745

Query: 378   TLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTA 437
             ++TW  P   G + I  Y++E+R+    ++ AV      +  W +  +++GC Y FRVTA
Sbjct: 16746 SITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTN-CHKNSWKIDQLQEGCSYYFRVTA 16804

Query: 438   VAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYV 497
                 G G P   +D +   +  +PPG    + V D +  S++LSW  P+   G +   Y+
Sbjct: 16805 ENEYGIGLPAQTADPIKVAEVPQPPG---KITVDDVTRNSVSLSWTKPEHDGGSKIIQYI 16861

Query: 498   VELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAM 557
             VE+ +  S +W  C    V         L  GE Y  RV AVNE G+S P +L   + A 
Sbjct: 16862 VEMQAKHSEKWSEC--ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAK 16919

Query: 558   PVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRS-VTVTKD 616
              + + P      S+    +V+VG  +++ V     P P +TW KDGLPL + + + VT  
Sbjct: 16920 DLVIEPDVKPAFSS---YSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDS 16976

Query: 617   -GLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTV 674
               LT L I      D G Y + +  + G++ A S  I     P  P GP+   +    ++
Sbjct: 16977 LDLTTLSIKETHKDDGGQYGITVANVVGQKTA-SIEIVTLDKPDPPKGPVKFDDVSAESI 17035

Query: 675   TAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAK 734
             T  W P          +Y V  R +    W   +  +      +  +  G EY FR+ A+
Sbjct: 17036 TLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFAE 17095

Query: 735   NELGAS 740
             N  G S
Sbjct: 17096 NRYGQS 17101



 Score =  155 bits (393), Expect = 1e-37
 Identities = 118/417 (28%), Positives = 184/417 (44%), Gaps = 44/417 (10%)

Query: 379  LTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAV 438
            LTW  P   G   IL Y++ERR+ G  T+  V      +  WTV D+    +Y FRV AV
Sbjct: 8193 LTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGE-NKLSWTVKDLIPNGEYFFRVKAV 8251

Query: 439  APSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVV 498
               G GE     + V A+DP +PP    +++V + +  ++T++W  P    G +  GY++
Sbjct: 8252 NKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYII 8311

Query: 499  ELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMP 558
            E  +    +W  C+   VP+ TYTAKGL  G+ Y  RV A N  G S+PS      +A+ 
Sbjct: 8312 EKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVD 8371

Query: 559  VTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDG--------------- 603
                PK ++ +S    L VK GD + +  S    P P +TW+KD                
Sbjct: 8372 PIDAPKVILRTS----LEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPL 8427

Query: 604  ---------------LPLPKR-SVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVA 647
                           LPL +R S+  +K G +QL +  +   D GLY + +    G   A
Sbjct: 8428 VRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKA 8487

Query: 648  HSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAV--FTRSSAHGPWH 705
                + V   P  P     ++    +V  +WEP  D+     ++Y +    ++     W 
Sbjct: 8488 -PCTVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWI 8546

Query: 706  EAADRIHTNRFTLLGILPGHEYHFRVVAKNELG-----ASKPSDTSQPWCIPRQRDR 757
                 +   ++++  ++ G EY FRV A+N  G      SKP     P+  P   D+
Sbjct: 8547 VVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDPFGPPDAPDK 8603



 Score =  155 bits (391), Expect = 2e-37
 Identities = 119/424 (28%), Positives = 186/424 (43%), Gaps = 39/424 (9%)

Query: 379  LTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERR--WTVADVRQGCQYEFRVT 436
            L W+ P   G + I G++IER+    +TW     QP+   R    +  + +G +Y+FRV 
Sbjct: 8910 LNWSDPEDDGGSEITGFIIERKDAKMHTWR----QPIETERSKCDITGLLEGQEYKFRVI 8965

Query: 437  AVAPSGPGEP---GPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEA 493
            A    G G P   GP    + A DP+ PP     L  T+R+ ++ITL W  P +  G   
Sbjct: 8966 AKNKFGCGPPVEIGP----ILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPI 9021

Query: 494  QGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPS-ALDT 552
            QGY++E    D   +   +    P T++  + L   + Y  RV AVNE G+S+PS  L+ 
Sbjct: 9022 QGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNV 9081

Query: 553  LVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLK---------DG 603
            ++Q   V    K  + S   D + VK G+ V +P     +PMP++ W K         D 
Sbjct: 9082 VIQDDEVPPTIKLRL-SVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDA 9140

Query: 604  LPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGP 663
            L + K  V+   +  T+L IP A   D G YTV      G  V  +  + V   P  P  
Sbjct: 9141 LQITKEEVS-RSEAKTELSIPKAVREDKGTYTVTASNRLG-SVFRNVHVEVYDRPSPPRN 9198

Query: 664  IHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAH--GPWHEAADRIHTNRFTLLGI 721
            + + +    +    W+   D       HY +  R ++     W E  +     R+ +  +
Sbjct: 9199 LAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKRYGIWKL 9258

Query: 722  LPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLR 781
            +P  +Y FRV A N+ G S             + D+  ++ P YR P    KP+ L   +
Sbjct: 9259 IPNGQYEFRVRAVNKYGISDEC----------KSDKVVIQDP-YRLPGPPGKPKVLARTK 9307

Query: 782  SHLL 785
              +L
Sbjct: 9308 GSML 9311



 Score =  152 bits (385), Expect = 1e-36
 Identities = 95/326 (29%), Positives = 165/326 (50%), Gaps = 7/326 (2%)

Query: 157  VQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQV 216
            V   P   P +  +  + +V++ G+ + + +PF++      +W KDG EV  S     + 
Sbjct: 8074 VAKDPDCKPTIDLETHDIIVIE-GEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKN 8132

Query: 217  DLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRA 276
            D    +  L +P + R D G Y++TL ++ GS  A + ++VI  P P +  ++  D  ++
Sbjct: 8133 DHISAH--LEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKD-IKASDITKS 8189

Query: 277  GVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRV 336
               L W PP  +GG  +  YV+ERR+AGR T++ V     +  ++T   + P  +Y FRV
Sbjct: 8190 SCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGE-NKLSWTVKDLIPNGEYFFRV 8248

Query: 337  RAVTSEGAGEALESEEILVA--PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILG 394
            +AV   G GE +E +  ++A  P+  P  P    + + +++ +T+TW  P   G + I+G
Sbjct: 8249 KAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMG 8308

Query: 395  YLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVF 454
            Y+IE+  KG   W   N+  VP   +T   + +G +Y+FRV A   +G  EP   +    
Sbjct: 8309 YIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTK 8368

Query: 455  ARDPMRPPGLVRNLQVTDRSNTSITL 480
            A DP+  P ++    +  +    I L
Sbjct: 8369 AVDPIDAPKVILRTSLEVKRGDEIAL 8394



 Score =  152 bits (384), Expect = 1e-36
 Identities = 117/462 (25%), Positives = 188/462 (40%), Gaps = 33/462 (7%)

Query: 318   STTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGI 377
             S T  +A+     KYT  ++ V S        S  ++V     P  P+   +   + +  
Sbjct: 19936 SLTIENANRNDSGKYTLTIQNVLSAA------SLTLVVKVLDTPGPPTNITVQDVTKESA 19989

Query: 378   TLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTA 437
              L+W  P   G A +  Y IE+R+     W +V +       + V ++++G  Y FRV+ 
Sbjct: 19990 VLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNN-CNRLSYKVTNLQEGAIYYFRVSG 20048

Query: 438   VAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYV 497
                 G G P    + V   +   PP     L VT  S  S++L+W  P+   G     YV
Sbjct: 20049 ENEFGVGIPAETKEGVKITEKPSPP---EKLGVTSISKDSVSLTWLKPEHDGGSRIVHYV 20105

Query: 498   VELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAM 557
             VE        W+ C V     T +   GLR    YF RV A N+ G S P  L   V   
Sbjct: 20106 VEALEKGQKNWVKCAVAKS--THHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIK 20163

Query: 558   PVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLP---KRSVTVT 614
                  P+  + +     + V+ G  ++V +     P+P+VT  +DG+PL    + +  +T
Sbjct: 20164 EQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEIT 20223

Query: 615   KDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGT 673
              + LT + +  +  +D+G Y +      G   A    I V   P  P GP+ + +    +
Sbjct: 20224 AENLT-INLKESVTADAGRYEITAANSSGTTKAF-INIVVLDRPGPPTGPVVISDITEES 20281

Query: 674   VTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVA 733
             VT +WEP   +      +Y +  R ++   W E +  +      ++ +  G EY FR+ A
Sbjct: 20282 VTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKA 20341

Query: 734   KNELGAS---------------KPSDTSQPWCIPRQRDRFTV 760
             +N  G S                P   S PW     R+  TV
Sbjct: 20342 ENRFGISDHIDSACVTVKLPYTTPGPPSTPWVTNVTRESITV 20383



 Score =  150 bits (379), Expect = 5e-36
 Identities = 119/443 (26%), Positives = 184/443 (41%), Gaps = 32/443 (7%)

Query: 321   FTD-AHVEPGRKYT--------------FRVRAVTSEGAGEALESEEILVAPEALPKAPS 365
             FTD   +E G  YT              + ++   S G+  A  + ++L  P      P 
Sbjct: 17760 FTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGP----PQ 17815

Query: 366   APAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADV 425
               A+         L W  P   G A +  Y+I++R+     +  V+ +   +  + V ++
Sbjct: 17816 NLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSK-CSKTSFKVENL 17874

Query: 426   RQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGP 485
              +G  Y FRV A    G G P    DAV A +P  PPG V    +TD S TS +L W  P
Sbjct: 17875 TEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVT---LTDVSQTSASLMWEKP 17931

Query: 486   DTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQS 545
             +   G    GYVVE+    + +W    V    V      GL  G+ Y  RV A NE G+S
Sbjct: 17932 EHDGGSRVLGYVVEMQPKGTEKW--SIVAESKVCNAVVTGLSSGQEYQFRVKAYNEKGKS 17989

Query: 546   QPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLP 605
              P  L   V A  +T+ P   +  +T    +++ G+ +++ +     P P ++W+KDG P
Sbjct: 17990 DPRVLGVPVIAKDLTIQPSLKLPFNT---YSIQAGEDLKIEIPVIGRPRPNISWVKDGEP 18046

Query: 606   LPKRSVTVTKDGLTQLLIPV--AGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-G 662
             L + +    ++  T  ++ +      D G YTV      G     +  + V   P  P G
Sbjct: 18047 LKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAG-TATENLSVIVLEKPGPPVG 18105

Query: 663   PIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGIL 722
             P+   E     V   WEP          +Y V  R +    WH  +  +      +  + 
Sbjct: 18106 PVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLK 18165

Query: 723   PGHEYHFRVVAKNELGASKPSDT 745
              G EY FR+ A+N  G S P D+
Sbjct: 18166 TGTEYQFRIFAENRYGKSAPLDS 18188



 Score =  150 bits (378), Expect = 6e-36
 Identities = 161/612 (26%), Positives = 252/612 (41%), Gaps = 64/612 (10%)

Query: 180   GKPVIVKIPFQSHLPIQAAWRKD----GAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDC 235
             G P   K+   +   +  +W K     G+ ++G      + D  D + R  LP   +K  
Sbjct: 13285 GPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRAD-SDNWVRCNLPQNLQKT- 13342

Query: 236   GQYSVTLRSEGGSVQAELTLQVIDK---------PD---------PPQGPMEVQDCHRAG 277
              ++ VT   E    Q +  +  ++K         PD         PP+G ++     R  
Sbjct: 13343 -RFEVTGLME--DTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDAD--LRKT 13397

Query: 278   VCLRWRPPRDNGGRTVECYV-VERRQAGRSTWLKVGEAPAD-------STTF-TDAHVEP 328
             + LR        G T+  YV V+ R   + TW K      D       ST F T    E 
Sbjct: 13398 LILR-------AGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCEN 13450

Query: 329   GRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPG 388
               KY      +T E +    E   I+V     P  P    +   S     +TW  P   G
Sbjct: 13451 VNKYDAGKYILTLENSCGKKEYT-IVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDG 13509

Query: 389   SAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGP 448
              + I+ Y++++R     +W+ V  +   +  + VA++ +G  Y FRV A    G G+PG 
Sbjct: 13510 GSPIINYVVQKRDAERKSWSTVTTE-CSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGE 13568

Query: 449   PSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQW 508
               DAV A    + PG V +L+V   S +S ++ W  P +  G    GYVV+  + ++ +W
Sbjct: 13569 TRDAVKAS---QTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTEEN-KW 13624

Query: 509   LPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVD 568
                 V       Y+AK L  G+ Y  RV+A NE G+  PS  +  V A    V P   + 
Sbjct: 13625 Q--RVMKSLSLQYSAKDLTEGKEYTFRVSAENENGEGTPS--EITVVARDDVVAPDLDLK 13680

Query: 569   SSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRS-VTVTKDGL-TQLLIPVA 626
                      K     R+ +  +  P P V+W K   PL   + V+V    + T L++   
Sbjct: 13681 GLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDC 13740

Query: 627   GLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEA 685
               SD+G YT+ L+ + G +   +  I+V   P  P GPI   E     +T +W P  D+ 
Sbjct: 13741 QKSDAGKYTITLKNVAGTKEG-TISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDG 13799

Query: 686   QDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGA-----S 740
                  +Y +  R S +  W   A  +    F +  +  G EY FRV A+N+ G      S
Sbjct: 13800 GSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKS 13859

Query: 741   KPSDTSQPWCIP 752
             +P     P+ +P
Sbjct: 13860 EPIVARHPFDVP 13871



 Score =  149 bits (375), Expect = 1e-35
 Identities = 106/394 (26%), Positives = 172/394 (43%), Gaps = 10/394 (2%)

Query: 349   ESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWT 408
             +S  +LV     P    +  +   S   +T+TW  P   G A +  Y++E+R+     + 
Sbjct: 23221 KSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREAAMRAFK 23280

Query: 409   AVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNL 468
              V  +   +  + ++ + +G  Y FRV      G GEP   SDAV   +    P     L
Sbjct: 23281 TVTTK-CSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPA---KL 23336

Query: 469   QVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRP 528
             +V D + +++TL+W  P    G    GYV+E C + + +W+        V  +T   L  
Sbjct: 23337 EVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNE 23396

Query: 529   GEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVS 588
             GE Y  R+ A NE G S+P    T V    + V P   + +  +  + V  G  V + + 
Sbjct: 23397 GEQYLFRIRAQNEKGVSEPRETVTAVTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIP 23456

Query: 589   FEAMPMPEVTWLKDGLPL--PKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEV 646
                 P P  +W   G  L   +R    T   + +L I    + D+G YT+ L+ + G   
Sbjct: 23457 IAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTG-TT 23515

Query: 647   AHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGP-W 704
             + + ++ +   P  P GPI + E    ++T  WEP P+     PL   V  +  AH P W
Sbjct: 23516 SETIKVIILDKPGPPTGPIKIDEIDATSITISWEP-PELDGGAPLSGYVVEQRDAHRPGW 23574

Query: 705   HEAADRIHTNRFTLLGILPGHEYHFRVVAKNELG 738
                ++ +  + F    +  G+EY FRV A N  G
Sbjct: 23575 LPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFG 23608



 Score =  147 bits (372), Expect = 3e-35
 Identities = 95/325 (29%), Positives = 157/325 (48%), Gaps = 14/325 (4%)

Query: 140   GRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAW 199
             G  T V G  + E  L   ++P +  D+  +LR+ +VV+AG    + IPF+     +  W
Sbjct: 17699 GEATSVPGTVKPEDKL---EAPEL--DLDSELRKGIVVRAGGSARIHIPFKGRPTPEITW 17753

Query: 200   RKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVID 259
              ++  E       + Q++ G  YT+L + +  R D G+Y + L +  GS  A +T++V+D
Sbjct: 17754 SREEGEFTD----KVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLD 17809

Query: 260   KPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADST 319
              P PPQ  + V++  +    L W PP  +GG  V+ YV+++R++ R  +  V  +    T
Sbjct: 17810 TPGPPQN-LAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVS-SKCSKT 17867

Query: 320   TFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITL 379
             +F   ++  G  Y FRV A    G G  +E+ + + A E  P  P    +   S    +L
Sbjct: 17868 SFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEP-PSPPGKVTLTDVSQTSASL 17926

Query: 380   TWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVA 439
              W  P   G + +LGY++E + KG+  W+ V +  V      V  +  G +Y+FRV A  
Sbjct: 17927 MWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNA--VVTGLSSGQEYQFRVKAYN 17984

Query: 440   PSGPGEPGPPSDAVFARDPMRPPGL 464
               G  +P      V A+D    P L
Sbjct: 17985 EKGKSDPRVLGVPVIAKDLTIQPSL 18009



 Score =  147 bits (371), Expect = 4e-35
 Identities = 123/458 (26%), Positives = 183/458 (39%), Gaps = 38/458 (8%)

Query: 330   RKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGS 389
             R +T +        AG+   +  + V    +P  P    +   +     L+W  P   G 
Sbjct: 9578  RSHTGKYSITAKNKAGQKTANCRVKVMD--VPGPPKDLKVSDITRGSCRLSWKMPDDDGG 9635

Query: 390   AHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPP 449
               I GY+IE+R      WT VN        + V D+    QY FRV A    G G P   
Sbjct: 9636  DRIKGYVIEKRTIDGKAWTKVNPD-CGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVET 9694

Query: 450   SDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSL--- 506
                  ARDP+ PP     L++   +  ++ LSW  P    G     Y+VE  + D     
Sbjct: 9695  IQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTK 9754

Query: 507   --QWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSA----LDTLVQAMPVT 560
                W  C+   V    +T + L  G  Y  RV AVN  G S+PSA     D     MP +
Sbjct: 9755  KEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQRPDMPPS 9814

Query: 561   VCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTV------- 613
             +          K+ + V+ G  V +    + +P P +TW K     P     V       
Sbjct: 9815  I--------DLKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVN 9866

Query: 614   --TKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENV 670
                 D    L+IP +  SD+GLYT+      G   +   R+ V   P  P GPI  +   
Sbjct: 9867  KLVVDDTCTLVIPQSRRSDTGLYTITAVNNLG-TASKEMRLNVLGRPGPPVGPIKFESVS 9925

Query: 671   PGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFR 730
                +T  W P  D+      +Y +  R +    W   +       +T+  +L GHEY FR
Sbjct: 9926  ADQMTLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPKLLEGHEYVFR 9985

Query: 731   VVAKNELGASKPSDTSQP------WCIPRQRDRFTVKA 762
             ++A+N+ G  +P D S+P      + +P   D+ TV +
Sbjct: 9986  IMAQNKYGIGEPLD-SEPETARNLFSVPGAPDKPTVSS 10022



 Score =  147 bits (370), Expect = 5e-35
 Identities = 147/617 (23%), Positives = 256/617 (41%), Gaps = 64/617 (10%)

Query: 163   IAPDVT--EKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGD 220
             ++PD+     +R+ +VV AG  + +        P    W  +   +     +EA ++   
Sbjct: 10215 VSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTL----PQEATIETTA 10270

Query: 221   GYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCL 280
               + + + +  R   G YS+  ++E G  +  + + V+D P P   P    +       L
Sbjct: 10271 ISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKL 10330

Query: 281   RWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVT 340
              W  P D+GG  +  YV+E+R++ R  W  V              ++ G+ Y FR+ A  
Sbjct: 10331 TWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNATVQGLIQ-GKAYFFRIAAEN 10389

Query: 341   SEGAGEALESEEILVA--PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIE 398
             S G G  +E+ E LV   P  +P+ P    +   +   +TLTW  P+  G + I+ Y++E
Sbjct: 10390 SIGMGPFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLE 10449

Query: 399   RRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDP 458
              R  G+  +  V +  +  R++TV  +++G  YE+RV+AV   G G+P   +  +  +D 
Sbjct: 10450 SRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDE 10509

Query: 459   MRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPV 518
             + PP L  +L   D+    +  ++A      G            +D L+    H+ T P 
Sbjct: 10510 LAPPTL--HLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPA 10567

Query: 519   T--TYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLT 576
             T      K  R   G +  V   + G +     ++ + +  P      F  D  TKD + 
Sbjct: 10568 TLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSF--DEVTKDYMV 10625

Query: 577   V---------------------KVGDTVRVPV-SFEAMPMPEVTWLKDGLPLPKRSVTVT 614
             +                     +VG  V +PV S  A    +V+ L +G           
Sbjct: 10626 ISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEG----------- 10674

Query: 615   KDGLTQLLIP-VAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGT 673
             KD + ++    + G+SD     +V  +++ K+     R RV   P AP    + E    +
Sbjct: 10675 KDYIFRIHAENLYGISD----PLVSDSMKAKD-----RFRV---PDAPDQPIVTEVTKDS 10722

Query: 674   VTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAA-DRIHT-NRFTLLGILPGHEYHFRV 731
                 W    D  + +  +Y +  R +    W     D IH   +F +  +L G +Y FRV
Sbjct: 10723 ALVTWNKPHDGGKPI-TNYILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRV 10781

Query: 732   VAKNELGASKPSDTSQP 748
              A+NE+G   PS  S+P
Sbjct: 10782 SAENEIGIGDPSPPSKP 10798



 Score =  145 bits (365), Expect = 2e-34
 Identities = 114/379 (30%), Positives = 172/379 (45%), Gaps = 16/379 (4%)

Query: 373   SSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYE 432
             +   +TL W  P   G + I  Y++E+R+    +++    +   +  + V  + +GC+Y 
Sbjct: 14575 TKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTK-CHKCTYKVTGLSEGCEYF 14633

Query: 433   FRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDE 492
             FRV A    G GEP   ++ V A +   PP    +L + D + ++++L+W  P    G +
Sbjct: 14634 FRVMAENEYGIGEPTETTEPVKASEAPSPPD---SLNIMDITKSTVSLAWPKPKHDGGSK 14690

Query: 493   AQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDT 552
               GYV+E     S QW   H+ TV       + L  GE Y  +V AVN  G+S P     
Sbjct: 14691 ITGYVIEAQRKGSDQW--THITTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRP 14748

Query: 553   LVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVT 612
             ++     T+ P+  +    + L+  K GD ++V +     P P VTW K G  + K++  
Sbjct: 14749 VI-VKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTW-KKGDQILKQTQR 14806

Query: 613   V---TKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQE 668
             V   T    T L I     SDSG Y +  R + G EV     I+V   P  P GPI   E
Sbjct: 14807 VNFETTATSTILNINECVRSDSGPYPLTARNIVG-EVGDVITIQVHDIPGPPTGPIKFDE 14865

Query: 669   NVPGTVTAEWEPSPDEAQDVPL-HYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEY 727
                  VT  W+P P+    VP+ +Y V  R +    W E A  +    +    +  G EY
Sbjct: 14866 VSSDFVTFSWDP-PENDGGVPISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGLEY 14924

Query: 728   HFRVVAKNELGASKPSDTS 746
              FRV A+N  G   P  TS
Sbjct: 14925 QFRVKAQNRYGVG-PGITS 14942



 Score =  143 bits (361), Expect = 6e-34
 Identities = 179/800 (22%), Positives = 302/800 (37%), Gaps = 91/800 (11%)

Query: 104   TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVA----GDQQSEATLTVQD 159
             TWFKDGV++  +  +         SLF+        G YT  A    G  ++E  + VQD
Sbjct: 21686 TWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQD 21745

Query: 160   SP--TIAP-DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQV 216
             +P   + P   T    E + +    P+       +H  I+       A  +     EAQ 
Sbjct: 21746 TPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQ- 21804

Query: 217   DLGDGYTRLCLPSAGRKD-----CGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQ 271
                  YT + L +            ++ V    +   V A++   V D P  P    E  
Sbjct: 21805 ----SYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTVPDAPGIP----EPS 21856

Query: 272   DCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKV-GEAPADSTTFTDAHVEPGR 330
             +     + L W  P  +GG  ++ Y++ERR+   + W+KV  + P   T F    +  G 
Sbjct: 21857 NITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGN 21916

Query: 331   KYTFRVRAVTSEGAGEALESEEILVAPEAL--PKAPSAPAILSASSQGITLTWTAPRGPG 388
             +Y F V A  + G G A     ++   E +  P  P+   +   S   ++L W+ P   G
Sbjct: 21917 EYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDG 21976

Query: 389   SAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGP 448
                I+GY+IE  K     W  VN +   + R+TV D++ G +Y+FRV+A+  +G G+   
Sbjct: 21977 GMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCE 22036

Query: 449   PSDAVFARDPMRPPGLV--RNLQVTD--RSNTSI------------TLSWAGPDTQEGDE 492
              +  + A D +  P L    N + T   R+  SI            T  W+ PD+     
Sbjct: 22037 VTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLR 22096

Query: 493   AQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDT 552
             A  +  +  S+ +++   C+       T T +     +     V  ++  G   P     
Sbjct: 22097 ADIHTTDSFSTLTVE--NCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPITFKD 22154

Query: 553   LVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVT 612
             + +     +    L+D   +              +    +   E +         +RS  
Sbjct: 22155 VTRGSATLMWDAPLLDGGAR--------------IHHYVVEKREAS---------RRSWQ 22191

Query: 613   VTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFR----IRVAACPQAPGPIHLQE 668
             V  +  T+ +  V  L++   Y   +  +    V   +     I     P  P  + + +
Sbjct: 22192 VISEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPAPPRRLDVVD 22251

Query: 669   NVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNR--FTLLGILPGHE 726
                 +    W     +       Y +  R      W EA    HT +  FT+  ++   E
Sbjct: 22252 TSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAG---HTKQLTFTVERLVEKTE 22308

Query: 727   YHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLP 786
             Y FRV AKN+ G S+P            R+ F+  +   +EP + +    L G+ + L+ 
Sbjct: 22309 YEFRVKAKNDAGYSEP------------REAFS--SVIIKEPQI-EPTADLTGITNQLIT 22353

Query: 787   --QGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEY 844
                G    +   + G P P VTW   +  L+    V  T      +LT+      DSG Y
Sbjct: 22354 CKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRY 22413

Query: 845   KAVAENTLGQAVSTATLIVI 864
                 ENT G    + T++VI
Sbjct: 22414 FLTLENTAGVKTFSVTVVVI 22433



 Score =  141 bits (355), Expect = 3e-33
 Identities = 109/406 (26%), Positives = 168/406 (41%), Gaps = 10/406 (2%)

Query: 344   AGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKG 403
             AG    S ++LV  +  P  P    +         LTW  P   G + I  Y++ERR   
Sbjct: 10990 AGSKTVSVKVLVLDK--PGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVA 11047

Query: 404   SNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPG 463
             S  W+ ++     +  +    + +G QY FRV A    G G        + A DP+ PPG
Sbjct: 11048 SAQWSPLSATSKKKSHFA-KHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPG 11106

Query: 464   LVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTA 523
               ++L   D   T ++L W  PD   G    GY+VE     +  W+     TV       
Sbjct: 11107 PPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWI--KFKTVTNLECVV 11164

Query: 524   KGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTV 583
              GL+ G+ Y  RV A N  G   P      ++     V P   +D    + L VK G TV
Sbjct: 11165 TGLQQGKTYRFRVKAENIVGLGLPDT-TIPIECQEKLVPPSVELDVKLIEGLVVKAGTTV 11223

Query: 584   RVPVSFEAMPMPEVTWLKDGLPL-PKRSVTVTKDGLTQLL-IPVAGLSDSGLYTVVLRTL 641
             R P     +P+P   W  DG  +      TV  D  + +L I      D+G Y + +   
Sbjct: 11224 RFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNA 11283

Query: 642   QGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSA 700
              G +   +  + V   P  P GPI++ +  P  +T  W+P  D+     ++Y V  + + 
Sbjct: 11284 AGSKTV-AVHLTVLDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTR 11342

Query: 701   HGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS 746
                W   +      +  +  +  G EY FRV A+N++G   P D++
Sbjct: 11343 KDTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENKIGVGPPLDST 11388



 Score =  141 bits (355), Expect = 3e-33
 Identities = 142/604 (23%), Positives = 248/604 (41%), Gaps = 50/604 (8%)

Query: 166   DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
             D+   +R+ ++V+AG P+ +    +     +  WRK G + V    R+ QVDL D    L
Sbjct: 12302 DLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVV---RKGQVDLVDTMAFL 12358

Query: 226   CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPP 285
              +P++ R D G+YS+TL +  G     + ++V+D P P    ++V D  +    + W PP
Sbjct: 12359 VIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSD-LKVSDVTKTSCHVSWAPP 12417

Query: 286   RDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAG 345
              ++GG  V  Y+VE+R+A R TW  V       T+F   ++ PG +Y FRV AV   G G
Sbjct: 12418 ENDGGSQVTHYIVEKREADRKTWSTV-TPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPG 12476

Query: 346   EALESEEILVAPEAL--PKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERR--K 401
                +  + ++A + L  P  P    +   +    TL W  P   G A I GY+   R  +
Sbjct: 12477 VPTDVPKPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEE 12536

Query: 402   KGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRP 461
             + ++ WT  +   V +    V  +++G +Y+FRV A    G   P        A++ + P
Sbjct: 12537 QPADRWTEYS--VVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLP 12594

Query: 462   PGLVRNLQVTDRSNTSITLS---WAGP-DTQEGDEAQGYVVELCSSDSLQWLPCHVGTVP 517
             P ++   Q+T ++   + +    +  P  T +  + +  VV      +   L  H     
Sbjct: 12595 PKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVV------TSSHLAVHKADSS 12648

Query: 518   VTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDL--- 574
                      R   GY+  +TA N  G +    +  +V   P    P F +     D    
Sbjct: 12649 SILIIKDVTRKDSGYY-SLTAENSSG-TDTQKIKVVVMDAPGPPQPPFDISDIDADACSL 12706

Query: 575   ---LTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDS 631
                + ++ G +       E   +    W+     + K S  V K      LIP       
Sbjct: 12707 SWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGK------LIP----GQE 12756

Query: 632   GLYTV-------VLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDE 684
              ++ V       +   L   ++   F   V   P  P    + +     +   W+    +
Sbjct: 12757 YIFRVRAENRFGISEPLTSPKMVAQFPFGV---PSEPKNARVTKVNKDCIFVAWDRPDSD 12813

Query: 685   AQDVPLHYAVFTRSSAHGPWHEAADR-IHTNRFTLLGILPGHEYHFRVVAKNELGASKPS 743
                  + Y +  +      W +A D  + +  +   G++ G EY FR+ A N+ G+S PS
Sbjct: 12814 GGSPIIGYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPS 12873

Query: 744   DTSQ 747
               ++
Sbjct: 12874 KPTE 12877



 Score =  141 bits (355), Expect = 3e-33
 Identities = 145/623 (23%), Positives = 250/623 (40%), Gaps = 81/623 (13%)

Query: 163   IAPD--VTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGD 220
             +APD  +  +LR  LVV+AG  + + +P +     +  W KD   +       A ++  +
Sbjct: 14467 MAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINL----KNRANIENTE 14522

Query: 221   GYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCL 280
              +T L +P   R D G++ +T+ +  G     + ++V+D P P    +   D  +  V L
Sbjct: 14523 SFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLN-LRPTDITKDSVTL 14581

Query: 281   RWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVT 340
              W  P  +GG  +  Y+VE+R+A R ++           T+    +  G +Y FRV A  
Sbjct: 14582 HWDLPLIDGGSRITNYIVEKREATRKSY-STATTKCHKCTYKVTGLSEGCEYFFRVMAEN 14640

Query: 341   SEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERR 400
               G GE  E+ E + A EA P  P +  I+  +   ++L W  P+  G + I GY+IE +
Sbjct: 14641 EYGIGEPTETTEPVKASEA-PSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQ 14699

Query: 401   KKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMR 460
             +KGS+ WT +    V      V ++ +G +Y F+V AV  +G   P      +     M 
Sbjct: 14700 RKGSDQWTHIT--TVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTML 14757

Query: 461   PPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTT 520
             P   +R +                         Q  V+     +    +P      P  T
Sbjct: 14758 PELDLRGIY------------------------QKLVIAKAGDNIKVEIPVLGRPKPTVT 14793

Query: 521   YTAKGLRPGEGYFVRVTAVNEGGQSQPSALD----TLVQAMPVTVCPKFLVDSSTKDLLT 576
             +     + G+    +   VN    +  + L+        + P  +  + +V     D++T
Sbjct: 14794 W-----KKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIV-GEVGDVIT 14847

Query: 577   VKVGD---TVRVPVSFEAMPMPEVTWLKD------GLPLPKRSVTVTKDGLTQLLIPVAG 627
             ++V D       P+ F+ +    VT+  D      G+P+    V + +   T  +     
Sbjct: 14848 IQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWV----E 14903

Query: 628   LSDSGLYTVVLRTLQGKEVAHSFRIR-----------VAAC---------PQAPGPIHLQ 667
             L+ + + T    T     + + FR++            +AC         P  PG   + 
Sbjct: 14904 LATTVIRTTYKATRLTTGLEYQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTPQVT 14963

Query: 668   ENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADR-IHTNRFTLLGILPGH 725
                  ++T  W EP  D    + L Y V  +      W   +   +  N F   G+  G 
Sbjct: 14964 AVTKDSMTISWHEPLSDGGSPI-LGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGI 15022

Query: 726   EYHFRVVAKNELGASKPSDTSQP 748
              Y FRV+A+N  G SKPS  S+P
Sbjct: 15023 AYEFRVIAENMAGKSKPSKPSEP 15045



 Score =  139 bits (350), Expect = 1e-32
 Identities = 155/649 (23%), Positives = 258/649 (39%), Gaps = 68/649 (10%)

Query: 246  GGSVQAELTLQVIDKPDPPQGPMEVQ--DCHRAGVCLRWRPPRDNGGRTVECYVVERRQA 303
            G  V+ +  ++   K D P  P+ V   D +R GV L W PP  +GG  +  YV+E R  
Sbjct: 6868 GEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDK 6927

Query: 304  GRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKA 363
                W       A+  + T   V  G++Y+FRVRA    G G+   +   +   + + + 
Sbjct: 6928 TSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIER- 6986

Query: 364  PSAPAILSASSQ---GITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRW 420
            PS P  L++S Q    + L W  P   G + ILGY+IER ++G + W   N + VPE  +
Sbjct: 6987 PSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTY 7046

Query: 421  TVADVRQGCQYEFRVTAVAPSGPGEP----GP-PSDAVFARDPMRPPGLVRNLQVTDRSN 475
             V  + +G +Y +RV+A   +G  +P    GP  +D  F    M        L+V   + 
Sbjct: 7047 KVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNP 7106

Query: 476  TSITLSWAGPDTQEGDEAQGY---VVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGE-- 530
             +I +    P T       GY       C  D +      V    ++ Y    + P E  
Sbjct: 7107 ITILV----PST-------GYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERS 7155

Query: 531  GYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFE 590
               +    +    ++    +D  V A P          S+ K+L   K GD  +  V   
Sbjct: 7156 DKGIYTLKLENRVKTISGEIDVNVIARP----------SAPKEL---KFGDITKDSVHLT 7202

Query: 591  AMP------MPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSG--LYTVVLRTLQ 642
              P       P   ++ +   + +++ T   D +T L   V  L      L+ V  R   
Sbjct: 7203 WEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKC 7262

Query: 643  GK-EVAHSFR----IRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTR 697
            G  E A+          A  P  P  +  ++    ++   W+P  ++       Y V   
Sbjct: 7263 GPGEPAYVDEPVNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERC 7322

Query: 698  SSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDR 757
                  W    + +   +  + G+  G  Y +RV A N  GASKPS  ++          
Sbjct: 7323 PRGSDKWVACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEE--------- 7373

Query: 758  FTVKAPCYRE-PDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEG 816
              ++A   +E P++    + L GL    +  G +  +   V G P P +TW K D  L+ 
Sbjct: 7374 --IQAVDTQEAPEIFLDVKLLAGLT---VKAGTKIELPATVTGKPEPKITWTKADMILKQ 7428

Query: 817  NPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
            +  +   ++    ++TI      D+G Y   A N  G+A +   + V++
Sbjct: 7429 DKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLD 7477



 Score =  137 bits (344), Expect = 6e-32
 Identities = 86/292 (29%), Positives = 146/292 (50%), Gaps = 9/292 (3%)

Query: 171   LREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSA 230
             LR+ + ++A   + + +P +     +  W +D     G S  +A ++    YT L + + 
Sbjct: 15561 LRKVVTIRACCTLRLFVPIKGRPAPEVKWARDH----GESLDKASIESTSSYTLLIVGNV 15616

Query: 231   GRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGG 290
              R D G+Y +T+ +  GS  A + ++V+D P PPQ  ++V++  +  V L W PP  +GG
Sbjct: 15617 NRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQD-LKVKEVTKTSVTLTWDPPLLDGG 15675

Query: 291   RTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALES 350
               ++ Y+VE+R++ R  +  V       T++    ++ G  Y FRV A    G G   E+
Sbjct: 15676 SKIKNYIVEKRESTRKAYSTVA-TNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAET 15734

Query: 351   EEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAV 410
              E + A E  P  P    ++  +   ++L+W  P   G + ILGY++E + KGS+ W   
Sbjct: 15735 AESVKASER-PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATC 15793

Query: 411   NDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP 462
                 V E   T+  + QG +Y FRV+A    G  +P   S  V A+D + PP
Sbjct: 15794 ATVKVTEA--TITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPP 15843



 Score =  136 bits (343), Expect = 7e-32
 Identities = 176/818 (21%), Positives = 304/818 (37%), Gaps = 84/818 (10%)

Query: 82    MEVQPGEAATLSCTLTSDLGPG-TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAG 140
             + V+ G    L  T+     P  +W KDG  L   +G+       + +L +  V    +G
Sbjct: 13000 LTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSG 13059

Query: 141   RYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWR 200
              YT  A +           S TI   V +K   P  VK  K    +       P++    
Sbjct: 13060 DYTITAENSSG------SKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLE---- 13109

Query: 201   KDGAEVVG--------SSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAE 252
               G+E+          S    AQV      T   +         Q+ +   ++ G     
Sbjct: 13110 DGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPV 13169

Query: 253   LTLQVIDKP--DPPQ--GPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTW 308
              T   I K   DPP    P  + +  +  + + W+PP D+GG  +  Y++E+R+     W
Sbjct: 13170 FTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNW 13229

Query: 309   LKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA--PEALPKAPSA 366
              KV   P    T     ++ G +Y FRV A+   G G+  ++ +   A  P+  P  P+ 
Sbjct: 13230 TKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGPPAF 13289

Query: 367   PAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVN-DQPVPERRWTVADV 425
             P +   +   ++L+W  P   G + I+GYL+E ++  S+ W   N  Q + + R+ V  +
Sbjct: 13290 PKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGL 13349

Query: 426   RQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP----------------GLVRNLQ 469
              +  QY+FRV AV   G  +P    D  + +D + PP                G+   L 
Sbjct: 13350 MEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTMRLY 13409

Query: 470   VTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPG 529
             V  +      ++W+ P+    D      +++ S+D   +L C      V  Y A      
Sbjct: 13410 VPVKGRPPPKITWSKPNVNLRDRIG---LDIKSTDFDTFLRCE----NVNKYDA------ 13456

Query: 530   EGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSF 589
              G ++ +T  N  G+ + + +      + V   P   V+ + K++       T   P+  
Sbjct: 13457 -GKYI-LTLENSCGKKEYTIV------VKVLDTPGPPVNVTVKEISKDSAYVTWEPPIID 13508

Query: 590   EAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHS 649
                P+      K        S   T+   T   +       S  + V      G      
Sbjct: 13509 GGSPIINYVVQKRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGE 13568

Query: 650   FRIRVAACPQAPGPI---HLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHE 706
              R  V A  Q PGP+    ++     + +  W+    +     + Y V    +    W  
Sbjct: 13569 TRDAVKA-SQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVV-DFLTEENKWQR 13626

Query: 707   AADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYR 766
                 + + +++   +  G EY FRV A+NE G   PS+ +          R  V AP   
Sbjct: 13627 VMKSL-SLQYSAKDLTEGKEYTFRVSAENENGEGTPSEITVV-------ARDDVVAP--- 13675

Query: 767   EPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLL 826
             + DL   P        +L  +     +   ++G P P V+W K +  L  +  V      
Sbjct: 13676 DLDLKGLPDL-----CYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSA 13730

Query: 827   GVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVI 864
                +L +      D+G+Y    +N  G    T ++ V+
Sbjct: 13731 VNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVV 13768



 Score =  136 bits (342), Expect = 1e-31
 Identities = 143/638 (22%), Positives = 250/638 (39%), Gaps = 55/638 (8%)

Query: 250   QAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWL 309
             + E    +   P  P  P  V    R  + + W  P  +GG  V  Y +E +      W 
Sbjct: 10001 EPETARNLFSVPGAPDKPT-VSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWK 10059

Query: 310   KVGEAPADSTTFTDAH----VEPGRKYTFRVRAVTSEGAGEA-LESEEILVAPEALPKAP 364
             +V   P  + T   ++    +  G  Y FRV A+ + G G A L S+         P  P
Sbjct: 10060 RVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPGP 10119

Query: 365   SAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVAD 424
               P +   +     L W+ P   G + + GY++E +++G   W    D+ V   +  V  
Sbjct: 10120 PFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTG 10179

Query: 425   VRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAG 484
             +++G  Y+FRV AV  +G GEPG  +D +  +D +  P L  +  V DR      +  AG
Sbjct: 10180 LKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDR-----IVVHAG 10234

Query: 485   PDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGL-----RPGEGYFVRVTAV 539
                +      G      + +  +       T+  T  ++  +     R  +G +  + A 
Sbjct: 10235 GVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGVY-SLLAK 10293

Query: 540   NEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKD---LLTVKVGDTVRVPVS---FEAMP 593
             NE G+ + + +  ++  +P  V   FL  + T +   L      D    P++    E   
Sbjct: 10294 NEAGERKKTIIVDVLD-VPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRE 10352

Query: 594   MPEVTWLKDGLPLPKRSVTVTKDGLTQ---LLIPVAGLSDSGLYTVVLRTLQGKEVAHSF 650
                  W      + +++ TV   GL Q       +A  +  G+   V       E + + 
Sbjct: 10353 SDRRAWTPVTYTVTRQNATV--QGLIQGKAYFFRIAAENSIGMGPFV-------ETSEAL 10403

Query: 651   RIRVA-ACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAA- 708
              IR     P+ P  + ++E    TVT  W P   +     ++Y + +R      +H+   
Sbjct: 10404 VIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTN 10463

Query: 709   DRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREP 768
             D + + ++T+ G+  G  Y +RV A N +G  KPS  ++P          T K       
Sbjct: 10464 DNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKP---------ITCK------- 10507

Query: 769   DLSQKPRFLVGLRSHL-LPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLG 827
             D    P   +  R  L +  G    ++    G P+P V+WFK++  +  +   +      
Sbjct: 10508 DELAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPA 10567

Query: 828   VCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
               +L        DSG+Y  V EN+ G       + V++
Sbjct: 10568 TLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVD 10605



 Score =  136 bits (342), Expect = 1e-31
 Identities = 109/404 (26%), Positives = 170/404 (42%), Gaps = 14/404 (3%)

Query: 343   GAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKK 402
             G GE  +S  + V     P A     +   S   +TL W  P   G + I+ Y+IE+R  
Sbjct: 21044 GVGEP-KSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDA 21102

Query: 403   GSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP 462
                TW+ V+ +      + + D+ +   + FRV A    G GEP   ++ V A +   P 
Sbjct: 21103 TKRTWSVVSHK-CSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAP- 21160

Query: 463   GLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYT 522
               +R+L + D + TS+ LSW  PD   G     YVVE        W   H G        
Sbjct: 21161 --IRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTW--SHAGISKTCEIE 21216

Query: 523   AKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDT 582
                L+       RV A NE G S P  +   +    + + P+  +       +TV++G  
Sbjct: 21217 VSQLKEQSVLEFRVFAKNEKGLSDPVTIGP-ITVKELIITPEVDLSDIPGAQVTVRIGHN 21275

Query: 583   VRVPVSFEAMPMPEVTWLKDGLPLPKRS---VTVTKDGLTQLLIPVAGLSDSGLYTVVLR 639
             V + + ++  P P ++WLKDGLPL +      + T++ +T L I  A     G YTV+L 
Sbjct: 21276 VHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKIT-LSIKNAKKEHGGKYTVILD 21334

Query: 640   TLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRS 698
                 + +A    +     P  P GPI   E    +V   W+   D        Y++  R 
Sbjct: 21335 NAVCR-IAVPITVITLGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRE 21393

Query: 699   SAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKP 742
             ++   W      +    F +  ++   EY FRV A+N  G S+P
Sbjct: 21394 TSQTNWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQP 21437



 Score =  134 bits (337), Expect = 4e-31
 Identities = 99/381 (25%), Positives = 159/381 (41%), Gaps = 10/381 (2%)

Query: 369   ILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQG 428
             + + + +  T++W  P   G + I  +++E RK     W+ V       +R   A++   
Sbjct: 11705 VTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVT--KRLIKANLLAN 11762

Query: 429   CQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQ 488
              +Y FRV A    G G        + A +P+  PG   NL + D+  T + L W  PD  
Sbjct: 11763 NEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYD 11822

Query: 489   EGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPS 548
              G     Y VE     S  W   H G++  T Y        + Y  RV   NEGG+S   
Sbjct: 11823 GGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDWV 11882

Query: 549   ALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKD----GL 604
               + +V    +    K ++D     +LTVK GDT+R+       P PEV W KD     L
Sbjct: 11883 KTEEVVVKEDL---QKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDL 11939

Query: 605   PLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPI 664
                 R    T+   ++  +  A  SD G Y V      G  VA++  + V   P     +
Sbjct: 11940 TRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYA-TVNVLDKPGPVRNL 11998

Query: 665   HLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPG 724
              + +      T  W+P  D+      +Y +    +    W   +  + T   T+  ++ G
Sbjct: 11999 KIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIEG 12058

Query: 725   HEYHFRVVAKNELGASKPSDT 745
             +EY FRV A+N++G   P+++
Sbjct: 12059 NEYIFRVRAENKIGTGPPTES 12079



 Score =  134 bits (336), Expect = 5e-31
 Identities = 194/810 (23%), Positives = 310/810 (38%), Gaps = 107/810 (13%)

Query: 105   WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTF----VAGDQQSEATLTVQDS 160
             W  DG ++ T +    + D     L I +      G Y       AG +     LTV D 
Sbjct: 11239 WTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDV 11298

Query: 161   P----------TIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSS 210
             P           + P+      +P     G PVI      +++  +   RKD   VV S 
Sbjct: 11299 PGPPTGPINILDVTPEHMTISWQPPKDDGGSPVI------NYIVEKQDTRKDTWGVVSS- 11351

Query: 211   DREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSE-----GGSVQAELTL--QVIDKPDP 263
                     G   T+L +P   +K C +Y   +R+E     G  + +  T+       P P
Sbjct: 11352 --------GSSKTKLKIPHL-QKGC-EYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSP 11401

Query: 264   PQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTD 323
             P  P+ V D       + W  P+ +GG  +  Y +ERR+     W++V + P     F  
Sbjct: 11402 PGKPV-VTDITENAATVSWTLPKSDGGSPITGYYMERREV-TGKWVRVNKTPIADLKFRV 11459

Query: 324   AHVEPGRKYTFRVRAVTSEGAGEALESEEILVA--PEALPKAPSAPAILSASSQGITLTW 381
               +  G  Y FRV A    G  +   S + + A  P   P  P  P +   S +   L W
Sbjct: 11460 TGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKPPGPPINPKLKDKSRETADLVW 11519

Query: 382   TAPRGPGSAHILGYLIERRKKGSNTWTAVN-DQPVPERRWTVADVRQGCQYEFRVTAVAP 440
             T P   G + ILGY++E +K G+  W  +N D+ + +  + V  + +G +Y FR+ A   
Sbjct: 11520 TKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANI 11579

Query: 441   SGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWA-----------GPDTQE 489
              G GEP   +++V A+D + PP +   L VT R   ++ +               PD   
Sbjct: 11580 VGEGEPRELAESVIAKDILHPPEV--ELDVTCRDVITVRVGQTIRILARVKGRPEPDITW 11637

Query: 490   GDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSA 549
               E +  V E    D +Q LP       V     + +R   G ++ ++A N  G +Q SA
Sbjct: 11638 TKEGKVLVREK-RVDLIQDLP------RVELQIKEAVRADHGKYI-ISAKNSSGHAQGSA 11689

Query: 550   L-DTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVT-WLKDGLPLP 607
             + + L +  P   C    V + TK+  T+   + +    S       E+T ++ +     
Sbjct: 11690 IVNVLDRPGP---CQNLKVTNVTKENCTISWENPLDNGGS-------EITNFIVEYRKPN 11739

Query: 608   KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLR--------TLQGKEVAHSFRIRVAACPQ 659
             ++  ++    +T+ LI    L+++  Y  V          T++ K       I     P 
Sbjct: 11740 QKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVGPTIETK--TPILAINPIDRPG 11797

Query: 660   APGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEA-ADRIHTNRFTL 718
              P  +H+ +     V  +W     +     L Y V  R      W       I    + +
Sbjct: 11798 EPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMV 11857

Query: 719   LGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLV 778
                +    Y FRV  KNE G S        W    + +   VK       DL QKP   +
Sbjct: 11858 DRCVENQIYEFRVQTKNEGGES-------DWV---KTEEVVVK------EDL-QKPVLDL 11900

Query: 779   GLRSHL-LPQGCECCMSCAVQGSPRPHVTWFKND--RSLEGNPAVYSTDLLGVCSLTIPS 835
              L   L +  G    +   V+G P P V W K+     L  +P V           ++  
Sbjct: 11901 KLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTK 11960

Query: 836   VSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
                 D G+Y   A NT G  V+ AT+ V++
Sbjct: 11961 AKRSDGGKYVVTATNTAGSFVAYATVNVLD 11990



 Score =  129 bits (325), Expect = 9e-30
 Identities = 167/698 (23%), Positives = 261/698 (37%), Gaps = 106/698 (15%)

Query: 104   TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTF----VAGDQQSEATLTVQD 159
             +W K    L T   V  +   +  +L +   Q + AG+YT     VAG ++   ++ V  
Sbjct: 13710 SWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVVG 13769

Query: 160   SPTIAP---DVTEKLREPLVVKAGKP------VIVKIPFQSHLPIQAAWRKDGAEVVGSS 210
              P I        E   E + +K   P       I     +    +   W    + V  ++
Sbjct: 13770 KPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTT 13829

Query: 211   DREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEV 270
              R  ++  G  YT     SA  K    Y V    EG   +  +     D PD P  P  +
Sbjct: 13830 FRVTRLHEGMEYT--FRVSAENK----YGV---GEGLKSEPIVARHPFDVPDAPP-PPNI 13879

Query: 271   QDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGR 330
              D     V L W  P+  GG  +  Y +E ++     W +  + P     F    +  G 
Sbjct: 13880 VDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGL 13939

Query: 331   KYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSA 390
             +Y FRV A+   G G+     E +VA + +   P  P +++ +   +TL WT P+  G  
Sbjct: 13940 EYEFRVMAINLAGVGKPSLPSEPVVALDPI-DPPGKPEVINITRNSVTLIWTEPKYDGGH 13998

Query: 391   HILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGP-GEPGPP 449
              + GY++E+R   S +W   N   VPE  +TV D+ +G +YEFR+ A   +G    P   
Sbjct: 13999 KLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSES 14058

Query: 450   SDAVFARDPMRPPGLVRNLQVTD----RSNTSITL-------------SW--AGPDTQEG 490
             ++ +  +D    P +V +  + D    ++  +I L             SW  AG D +  
Sbjct: 14059 TETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPS 14118

Query: 491   DEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSAL 550
             D     + ++ S+ +   L     T           R   G +  +TA N  G       
Sbjct: 14119 D-----ITQITSTPTSSMLTIKYAT-----------RKDAGEYT-ITATNPFG------- 14154

Query: 551   DTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTW---LKDGLPLP 607
              T V+ + VTV             L V  G    V +S  +     +TW   L+DG   P
Sbjct: 14155 -TKVEHVKVTV-------------LDVP-GPPGPVEISNVSAEKATLTWTPPLEDG-GSP 14198

Query: 608   KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEV---------------AHSFRI 652
              +S  + K   ++LL  V          V  + +QG E                  S  +
Sbjct: 14199 IKSYILEKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQSEPV 14258

Query: 653   RVAACPQAPGPIHLQE--NV-PGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAAD 709
             ++      PGP    E  NV   T T  W+   D+       Y V  R      W  A  
Sbjct: 14259 KMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIK 14318

Query: 710   R-IHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS 746
               +   R  + G+  G  Y FRV A+N  G   PS+ S
Sbjct: 14319 TPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEAS 14356



 Score =  129 bits (323), Expect = 2e-29
 Identities = 157/660 (23%), Positives = 251/660 (38%), Gaps = 72/660 (10%)

Query: 237   QYSVTLRSEGGSVQAELTLQVIDKPDP--PQGPMEVQDCHRAGVCLRWRPPRDNGGRTVE 294
             +Y V   +  G  +   + + +   DP  P G  EV +  R  V L+W  P  +GG  + 
Sbjct: 19353 EYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKIT 19412

Query: 295   CYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTS-EGAGEALESE-E 352
              Y+VERR+     WLK        T F    +   ++Y FRV A  + +   E  ES   
Sbjct: 19413 GYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGP 19472

Query: 353   ILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGY---LIERRKKGSNTWTA 409
             I+V  +  P       ++    + + +         +A I G    +I   K G      
Sbjct: 19473 IIVKDDVEPPR----VMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEER 19528

Query: 410   VNDQPVPERRWTVADV-----RQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGL 464
                + +     T+  V     R   QY   +  VA       G  S AV  +   +P   
Sbjct: 19529 ARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVA-------GTRSVAVNCKVLDKPGPP 19581

Query: 465   VRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAK 524
                L++   +    +LSW  P    G +   Y+VE   +  L W  C  G + +T+    
Sbjct: 19582 AGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICE-GELQMTSCKVT 19640

Query: 525   GLRPGEGYFVRVTAVNEGGQSQP------SALDTLVQAMPVTVCPKFLVDSSTKDLLTV- 577
              L  G  Y  RVT VN+ G  +P       ALD      P T      + S TK+ +T+ 
Sbjct: 19641 KLLKGNEYIFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPT---SLEITSVTKESMTLC 19697

Query: 578   -----KVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSG 632
                    G +       E      + W++           V K  +  L +   GL +  
Sbjct: 19698 WSRPESDGGSEISGYIIERREKNSLRWVR-----------VNKKPVYDLRVKSTGLREGC 19746

Query: 633   LYT--VVLRTLQGKEVAHSFRIRVAA-----CPQAPGPIHLQENVPGTVTAEWEPSPDEA 685
              Y   V      G  +       + A      P  P    + ++   T+T  W     + 
Sbjct: 19747 EYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDG 19806

Query: 686   QDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
                   Y V  + S    W  +   +    +T+ G+  G EY FRV + N++GAS PSD+
Sbjct: 19807 GAPITGYTVEYKKSDDTDWKTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDS 19866

Query: 746   SQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHV 805
             S P  I ++R+    + P +   D+  + R     ++ ++  G    M+   +G P P+V
Sbjct: 19867 SDPQ-IAKERE----EEPLF---DIDSEMR-----KTLIVKAGASFTMTVPFRGRPVPNV 19913

Query: 806   TWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
              W K D  L     V +TD     SLTI + +  DSG+Y    +N L  A  T  + V++
Sbjct: 19914 LWSKPDTDLRTRAYVDTTD--SRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLD 19971



 Score =  128 bits (321), Expect = 3e-29
 Identities = 142/604 (23%), Positives = 235/604 (38%), Gaps = 88/604 (14%)

Query: 183   VIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTL 242
             +I  +PF      +  W+K+  +    +  +A++D+    ++L + +A  +D G YS+T+
Sbjct: 10936 IIKGVPFP-----KVTWKKEDRD----APTKARIDVTPVGSKLEIRNAAHEDGGIYSLTV 10986

Query: 243   RSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQ 302
              +  GS    + + V+DKP PP+  +EV +  +    L W+ P D+GG  +  YVVERR 
Sbjct: 10987 ENPAGSKTVSVKVLVLDKPGPPRD-LEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRD 11045

Query: 303   AGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEAL-- 360
                + W  +       + F   H+  G +Y FRV A    G G  +E+ + + A + L  
Sbjct: 11046 VASAQWSPLSATSKKKSHFAK-HLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHP 11104

Query: 361   PKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRW 420
             P  P     +      ++L W  P   G + I GYL+E +++G+  W  +  + V     
Sbjct: 11105 PGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDW--IKFKTVTNLEC 11162

Query: 421   TVADVRQGCQYEFRVTAVAPSGPGEPG------------PPSD----------AVFARDP 458
              V  ++QG  Y FRV A    G G P             PPS            V A   
Sbjct: 11163 VVTGLQQGKTYRFRVKAENIVGLGLPDTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTT 11222

Query: 459   MRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPV 518
             +R P ++R + V        T  W   D  E    + Y VE  +  S+            
Sbjct: 11223 VRFPAIIRGVPVP-------TAKWT-TDGSEIKTDEHYTVETDNFSSV------------ 11262

Query: 519   TTYTAKG-LRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTV 577
                T K  LR   G + ++T  N  G    +   T++        P  ++D + + +   
Sbjct: 11263 --LTIKNCLRRDTGEY-QITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHM--- 11316

Query: 578   KVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVV 637
                 T+      +    P + ++ +     K +  V   G ++  + +  L     Y   
Sbjct: 11317 ----TISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFR 11372

Query: 638   LRTLQGKEVA-----------HSFRIRVAACPQAPGPIHLQENVPGTVTAEWE-PSPDEA 685
             +R      V            H F     + P  PG   + +      T  W  P  D  
Sbjct: 11373 VRAENKIGVGPPLDSTPTVAKHKF-----SPPSPPGKPVVTDITENAATVSWTLPKSDGG 11427

Query: 686   QDVPLHYAVFTRSSAHGPWHEA-ADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSD 744
               +  +Y    R    G W       I   +F + G+  G+ Y FRV A+N  G SKPS 
Sbjct: 11428 SPITGYY--MERREVTGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSP 11485

Query: 745   TSQP 748
             +S P
Sbjct: 11486 SSDP 11489



 Score =  121 bits (304), Expect = 2e-27
 Identities = 151/635 (23%), Positives = 240/635 (37%), Gaps = 61/635 (9%)

Query: 253   LTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVG 312
             + +  I  P  PQ P  V D  R  V L W  P D GG  V  Y++E ++  +  W K  
Sbjct: 23720 VAMDPIAPPGKPQNP-RVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCN 23778

Query: 313   EAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESE------EILVAPEALPKAPSA 366
               P     +T  H+  G +Y FRV A  + G GE  E        E+L  P+        
Sbjct: 23779 TTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQ 23838

Query: 367   PAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVR 426
               I     QG  +  T P       I  +  E +        A ++    E     AD  
Sbjct: 23839 EGIFVR--QGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHT-ELVIKEADRG 23895

Query: 427   QGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPD 486
                 Y+     V  +  G+            P  P G    L+  D    S+ +SW  P 
Sbjct: 23896 DSGTYDL----VLENKCGKKAVYIKVRVIGSPNSPEG---PLEYDDIQVRSVRVSWRPPA 23948

Query: 487   TQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQ 546
                G +  GY++E        W       V  T+   KGL+    Y  RV+A N+ G S+
Sbjct: 23949 DDGGADILGYILERREVPKAAWYTID-SRVRGTSLVVKGLKENVEYHFRVSAENQFGISK 24007

Query: 547   PSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFE-AMPMPEVTWLKDGLP 605
             P     L    PVT  PK  ++         +V D  +  VS   + P  +      G  
Sbjct: 24008 P-----LKSEEPVT--PKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYY 24060

Query: 606   LPKRSVTV------TKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVA---A 656
             + ++  +        K  +T  +  V GL     Y    R +   +V  S     +    
Sbjct: 24061 IERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQ--FRIIAQNDVGLSETSPASEPVV 24118

Query: 657   C------PQAPGPIHLQENVPGTVTAEWE-PSPDEAQDVPLHYAVFTRSSAHGPWHEA-A 708
             C      P  PG + +      +VT +WE P  D  +++ L Y V  R S    W ++  
Sbjct: 24119 CKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEI-LGYWVEYRQSGDSAWKKSNK 24177

Query: 709   DRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREP 768
             +RI   +FT+ G+L   EY FRV A+NE G S+P           +R   ++K     + 
Sbjct: 24178 ERIKDKQFTIGGLLEATEYEFRVFAENETGLSRP-----------RRTAMSIKT----KL 24222

Query: 769   DLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGV 828
                + P     ++      G    +SC + G P P + W++  + L  +     +     
Sbjct: 24223 TSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRT 24282

Query: 829   CSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
              +LT+ +   +D G Y  +A N +G+  +++ L++
Sbjct: 24283 HTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLL 24317



 Score =  120 bits (300), Expect = 7e-27
 Identities = 101/335 (30%), Positives = 145/335 (43%), Gaps = 30/335 (8%)

Query: 147  GDQQSEATLTVQDSPTIAPDVTEK----------LREPLVVKAGKPVIVKIPFQSHLPIQ 196
            G+ Q       Q+ P +  DV+ K          LR P VV  G+PV  K+         
Sbjct: 8783 GETQPVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVV-TGRPVPTKV--------- 8832

Query: 197  AAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQ 256
              W K+  E+    DR    ++G   + L +  A RKD G+Y +T  +  GS  A   ++
Sbjct: 8833 --WTKEEGEL--DKDRVVIDNVGTK-SELIIKDALRKDHGRYVITATNSCGSKFAAARVE 8887

Query: 257  VIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPA 316
            V D P P      V   +R    L W  P D+GG  +  +++ER+ A   TW +  E   
Sbjct: 8888 VFDVPGPVLDLKPVVT-NRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETER 8946

Query: 317  DSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEIL-VAPEALPKAPSAPAILSASSQ 375
                 T   +  G++Y FRV A    G G  +E   IL V P   P +P        +  
Sbjct: 8947 SKCDITG--LLEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKS 9004

Query: 376  GITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRV 435
             ITL W  PR  G + I GY+IE+R+     +  VN +  P   + V ++ +   YEFRV
Sbjct: 9005 TITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRV 9064

Query: 436  TAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQV 470
             AV   G  EP  P + V   D + PP +   L V
Sbjct: 9065 KAVNEIGESEPSLPLNVVIQDDEV-PPTIKLRLSV 9098



 Score =  120 bits (300), Expect = 7e-27
 Identities = 173/828 (20%), Positives = 294/828 (35%), Gaps = 106/828 (12%)

Query: 82    MEVQPGEAATLSCT--LTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQA 139
             + ++ G+   L+    L   L   +W K G  +   D            L I +     A
Sbjct: 14083 LTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDA 14142

Query: 140   GRYTFVA----GDQQSEATLTVQDSP---------TIAPDVTEKLREPLVVKAGKPVIVK 186
             G YT  A    G +     +TV D P          ++ +       P +   G P+   
Sbjct: 14143 GEYTITATNPFGTKVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSY 14202

Query: 187   IPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEG 246
             I  +     +  W     ++   S R     L  G   +   SA         V    +G
Sbjct: 14203 I-LEKRETSRLLWTVVSEDI--QSCRHVATKLIQGNEYIFRVSA---------VNHYGKG 14250

Query: 247   GSVQAELTLQVIDK---PDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQA 303
               VQ+E  ++++D+   P PP+ P EV +  +    + W+ P D+GG  +  Y VERR+ 
Sbjct: 14251 EPVQSE-PVKMVDRFGPPGPPEKP-EVSNVTKNTATVSWKRPVDDGGSEITGYHVERREK 14308

Query: 304   GRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEAL--P 361
                 W++  + P          ++ G  Y FRV A    G G   E+ + ++  +A   P
Sbjct: 14309 KSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPP 14368

Query: 362   KAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTA-VNDQPVPERRW 420
               PS P +   + +  +L W  P   G   I GY++E +K G   W        +   ++
Sbjct: 14369 GPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQF 14428

Query: 421   TVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP---------------GLV 465
              V D++   +Y FR++A+  +G GEP    D       M P                GL 
Sbjct: 14429 VVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRAGLS 14488

Query: 466   RNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLP-CH---VGTVPVTTY 521
               + V  +   +  ++W   +    + A    +E   S +L  +P C+    G   +T  
Sbjct: 14489 IRIFVPIKGRPAPEVTWTKDNINLKNRAN---IENTESFTLLIIPECNRYDTGKFVMTIE 14545

Query: 522   TAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTK--DLLTVKV 579
                G + G   FV V  ++  G         ++   P  +      DS T   DL  +  
Sbjct: 14546 NPAGKKSG---FVNVRVLDTPGP--------VLNLRPTDITK----DSVTLHWDLPLIDG 14590

Query: 580   GDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLR 639
             G  +               ++ +     ++S +       +    V GLS+   Y   + 
Sbjct: 14591 GSRI-------------TNYIVEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVM 14637

Query: 640   TLQ----GKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVF 695
                    G+    +  ++ +  P  P  +++ +    TV+  W     +       Y + 
Sbjct: 14638 AENEYGIGEPTETTEPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIE 14697

Query: 696   TRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQR 755
              +      W      +      +  +  G EY F+V+A N  G S P + S+P  +  Q 
Sbjct: 14698 AQRKGSDQWTHITT-VKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRE-SRPVIVKEQT 14755

Query: 756   DRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLE 815
                        E DL    + LV     +   G    +   V G P+P VTW K D+ L+
Sbjct: 14756 --------MLPELDLRGIYQKLV-----IAKAGDNIKVEIPVLGRPKPTVTWKKGDQILK 14802

Query: 816   GNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
                 V          L I      DSG Y   A N +G+     T+ V
Sbjct: 14803 QTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQV 14850



 Score =  119 bits (298), Expect = 1e-26
 Identities = 74/292 (25%), Positives = 131/292 (44%), Gaps = 7/292 (2%)

Query: 166   DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
             ++ + L++ + ++AG  + + +      P    W K G ++       A +D  + Y+ L
Sbjct: 23142 ELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLAS----RAIIDTTESYSLL 23197

Query: 226   CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPP 285
              +    R D G+Y++   ++ G   A + ++V D P P    ++V++  R  V + W  P
Sbjct: 23198 IVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPS-VKVKEVSRDSVTITWEIP 23256

Query: 286   RDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAG 345
               +GG  V  Y+VE+R+A    + K        T +  + +  G  Y FRV      G G
Sbjct: 23257 TIDGGAPVNNYIVEKREAAMRAF-KTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIG 23315

Query: 346   EALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSN 405
             E  E+ + ++  E +P  P+   ++  +   +TL W  P   G + + GY++E  K G+ 
Sbjct: 23316 EPCETSDAVLVSE-VPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTE 23374

Query: 406   TWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARD 457
              W  V          TV  + +G QY FR+ A    G  EP     AV  +D
Sbjct: 23375 RWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQD 23426



 Score =  119 bits (297), Expect = 2e-26
 Identities = 118/502 (23%), Positives = 205/502 (40%), Gaps = 27/502 (5%)

Query: 75   FSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHV 134
            F + L D  V   + A  SC L+ +     W+++G ++       F++DG +H L I   
Sbjct: 6520 FVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDC 6579

Query: 135  QGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPL-VVKAGKPVIVKIPFQSHL 193
            +      Y     D++S A L V++ P       E +R P  +++A    +V +   +  
Sbjct: 6580 RLDDECEYACGVEDRKSRARLFVEEIP------VEIIRPPQDILEAPGADVVFLAELNKD 6633

Query: 194  PIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAEL 253
             ++  W ++   VV   D+   +  G  + RL +     +D G+Y    + +    +A+L
Sbjct: 6634 KVEVQWLRNNMVVV-QGDKHQMMSEGKIH-RLQICDIKPRDQGEYRFIAKDK--EARAKL 6689

Query: 254  TLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGE 313
             L    K       + V      G  L    P D   +    +  E       T     +
Sbjct: 6690 ELAAAPKIKTADQDLVVD----VGKPLTMVVPYDAYPKAEAEWFKENEPLSTKTI----D 6741

Query: 314  APADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSAS 373
              A+ T+F     + G K  +++      G  E   + +++  P      P     ++ +
Sbjct: 6742 TTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVP-----GPVRNLEVTET 6796

Query: 374  SQG-ITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQ-GCQY 431
              G ++L W  P   G + I+GY++ERR     TW    D+      +TV  +++ G +Y
Sbjct: 6797 FDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDR-AESCEFTVTGLQKGGVEY 6855

Query: 432  EFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGD 491
             FRV+A    G GEP    + V AR     PG   N+ +TD +   ++L+W  P+   G 
Sbjct: 6856 LFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGA 6915

Query: 492  EAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALD 551
            E   YV+EL    S++W           + T   +  G+ Y  RV A N  G  +PSA  
Sbjct: 6916 EITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAAT 6975

Query: 552  TLVQAMPVTVCPKFLVDSSTKD 573
              V+       P   V+ ++ D
Sbjct: 6976 PFVKVADPIERPSPPVNLTSSD 6997



 Score =  118 bits (296), Expect = 2e-26
 Identities = 143/634 (22%), Positives = 246/634 (38%), Gaps = 71/634 (11%)

Query: 261   PDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTT 320
             P PP  P EV    +  + + W  P  +GG  +  Y +E+R      W KV +     T 
Sbjct: 20761 PGPPGIP-EVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTR 20819

Query: 321   FTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEAL--PKAPSAPAILSASSQGIT 378
                  +     Y +RV AV + G G   E  E   A + +  P  P+   I  ++   IT
Sbjct: 20820 QKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSIT 20879

Query: 379   LTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQ-PVPERRWTVADVRQGCQYEFRVTA 437
             L W+ P   G + + GY++E R+     WT V+ +  V    + V++++ G  Y FRV+A
Sbjct: 20880 LGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSA 20939

Query: 438   VAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSI------------------T 479
             V  +G GEP   ++ V A+D +  P +  +L V  R++                     T
Sbjct: 20940 VNCAGQGEPIEMNEPVQAKDILEAPEI--DLDVALRTSVIAKAGEDVQVLIPFKGRPPPT 20997

Query: 480   LSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAV 539
             ++W   +   G +A+ Y +E   S SL        T+P  T      R   G ++ +T  
Sbjct: 20998 VTWRKDEKNLGSDAR-YSIENTDSSSLL-------TIPQVT------RNDTGKYI-LTIE 21042

Query: 540   NEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTW 599
             N  G+ + S +   V   P   C K  V   ++  +T+ + D   +         P + +
Sbjct: 21043 NGVGEPKSSTVSVKVLDTPAA-CQKLQVKHVSRGTVTL-LWDPPLIDGG-----SPIINY 21095

Query: 600   LKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVA------HSFRIR 653
             + +     KR+ +V     +     +  LS+   +    R L   E+        +  ++
Sbjct: 21096 VIEKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPF--FFRVLAENEIGIGEPCETTEPVK 21153

Query: 654   VAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHT 713
              A  P     + ++++   +V   W     +   V   Y V  +      W  A     T
Sbjct: 21154 AAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGIS-KT 21212

Query: 714   NRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYR-EPDLSQ 772
                 +  +       FRV AKNE G S P                TVK      E DLS 
Sbjct: 21213 CEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGP----------ITVKELIITPEVDLSD 21262

Query: 773   KPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLT 832
              P   V +R      G    +    +G P+P ++W K+   L+ +  V  +      +L+
Sbjct: 21263 IPGAQVTVRI-----GHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLS 21317

Query: 833   IPSVSPKDSGEYKAVAENTLGQAVSTATLIVIEP 866
             I +   +  G+Y  + +N + +     T+I + P
Sbjct: 21318 IKNAKKEHGGKYTVILDNAVCRIAVPITVITLGP 21351



 Score =  117 bits (292), Expect = 6e-26
 Identities = 187/808 (23%), Positives = 304/808 (37%), Gaps = 97/808 (12%)

Query: 104   TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVA----GDQQSEATLTVQD 159
             TW K+G  L  +  V   QD     L I        G+Y   A    G  Q  A + V D
Sbjct: 11636 TWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLD 11695

Query: 160   SPTIAPD--VTEKLREPLVVKAGKPV------IVKIPFQSHLPIQAAWRKDGAEVVGSSD 211
              P    +  VT   +E   +    P+      I     +   P Q  W    ++V     
Sbjct: 11696 RPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLI 11755

Query: 212   REAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAE---LTLQVIDKPDPPQGPM 268
             +   +   + Y R+C  +                G +++ +   L +  ID+P  P+  +
Sbjct: 11756 KANLLANNEYYFRVCAENKV------------GVGPTIETKTPILAINPIDRPGEPEN-L 11802

Query: 269   EVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEP 328
              + D  +  V L+WR P  +GG     Y VERR  G   W +V +     T +       
Sbjct: 11803 HIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVE 11862

Query: 329   GRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPG 388
              + Y FRV+     G  + +++EE++V  E L K      +L     G+ LT  A    G
Sbjct: 11863 NQIYEFRVQTKNEGGESDWVKTEEVVVK-EDLQKP-----VLDLKLSGV-LTVKA----G 11911

Query: 389   SAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGP 448
                 L   +  +      WT   D     R   V    +    +F +T    S  G+   
Sbjct: 11912 DTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVV 11971

Query: 449   PSD-------AVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELC 501
              +        A    + +  PG VRNL++ D S+   T+ W  P+   G E Q Y++E C
Sbjct: 11972 TATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKC 12031

Query: 502   SSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTV 561
              +  + W   +  TV     T   L  G  Y  RV A N+ G   P+      ++ PV  
Sbjct: 12032 ETKRMVW-STYSATVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPT------ESKPVIA 12084

Query: 562   CPKF---------LVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVT 612
               K+          V   +K+ +TV     V  P  ++        +L+       R V 
Sbjct: 12085 KTKYDKPGRPDPPEVTKVSKEEMTV-----VWNPPEYDGGKSITGYFLEKKEKHSTRWVP 12139

Query: 613   VTKDGLTQLLIPVAGLSDSGLYTVVLRT---LQGKEVAHSFRIRVAACP-QAPGP---IH 665
             V K  + +  + V  L     Y   ++    +   E +   R  VA  P + PGP     
Sbjct: 12140 VNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFR 12199

Query: 666   LQENVPGTVTAEWEPSPDEAQDVPLHYAVFTR-----SSAHGPWHE--AADRIHTNRFTL 718
             + +    ++T  W     +     + Y V  R     +S    W    AA ++    FT+
Sbjct: 12200 VVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTV 12259

Query: 719   LGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLV 778
               +    EY FRV A+N++G  +P++  +       + +  ++ P   E DL    R LV
Sbjct: 12260 TSLDENQEYEFRVCAQNQVGIGRPAELKEAI-----KPKEILEPP---EIDLDASMRKLV 12311

Query: 779   GLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCS-LTIPSVS 837
              +R+     GC   +   V+G P P VTW K    ++        DL+   + L IP+ +
Sbjct: 12312 IVRA-----GCPIRLFAIVRGRPAPKVTWRK--VGIDNVVRKGQVDLVDTMAFLVIPNST 12364

Query: 838   PKDSGEYKAVAENTLGQAVSTATLIVIE 865
               DSG+Y     N  G+      + V++
Sbjct: 12365 RDDSGKYSLTLVNPAGEKAVFVNVRVLD 12392



 Score =  115 bits (288), Expect = 2e-25
 Identities = 135/516 (26%), Positives = 209/516 (40%), Gaps = 57/516 (11%)

Query: 261  PDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTT 320
            PDPP+  ++ +D     + L W PP+++GG  ++ Y+VER   G   W+  GE P   T 
Sbjct: 7283 PDPPEN-VKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGE-PVAETK 7340

Query: 321  FTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLT 380
                 +E G+ Y +RV+A+  +GA +     E + A +       AP I         LT
Sbjct: 7341 MEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVD----TQEAPEIFLDVKLLAGLT 7396

Query: 381  WTAPRGPGSAHILGYLIERRKKGSNTWT----------AVNDQPVPERRW-TVADVRQGC 429
              A    G+   L   +  + +   TWT           +  + VP++   T+ D ++  
Sbjct: 7397 VKA----GTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSD 7452

Query: 430  QYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQE 489
               + + AV   G       + AV   + +  PG      +TD +N S  L+W  P    
Sbjct: 7453 TGTYIIEAVNVCG------RATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDG 7506

Query: 490  GDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSA 549
            G +   YVVE  ++DS  W      TV  T + A  L P + Y  RV A N  G  +P  
Sbjct: 7507 GSKITNYVVERRATDSEVWHKLS-STVKDTNFKATKLIPNKEYIFRVAAENMYGVGEP-- 7563

Query: 550  LDTLVQAMPVTVCPKF--------LVDSS-TKDLLTVKVGDTVRVPVSFEAMPMPEVTWL 600
                VQA P+T   +F        L  S  TKD +T+    T   P      P+    W+
Sbjct: 7564 ----VQASPITAKYQFDPPGPPTRLEPSDITKDAVTL----TWCEPDDDGGSPITGY-WV 7614

Query: 601  KDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLY--TVVLRTLQG-----KEVAHSFRIR 653
            +   P   + V   K  +      V GL++   Y   V+   L G     K         
Sbjct: 7615 ERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKD 7674

Query: 654  VAACPQAPGPIHLQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIH 712
                P  PG   +++    +V   W +P  D    +   Y +    +    W   A+ + 
Sbjct: 7675 PIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIE-SYVIEMLKTGTDEWVRVAEGVP 7733

Query: 713  TNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
            T +  L G++ G EY FRV A N+ G S+PS+ S P
Sbjct: 7734 TTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDP 7769



 Score =  113 bits (282), Expect = 9e-25
 Identities = 154/665 (23%), Positives = 253/665 (38%), Gaps = 113/665 (16%)

Query: 251   AELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLK 310
             ++ TL V   P  P G  +  D  R  + L+W PP  +GG  +  Y +E+RQ G   W++
Sbjct: 21541 SKFTLAV--SPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVGYSIEKRQ-GNERWVR 21597

Query: 311   VGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAIL 370
                       +T   + PG +Y FR+ A  + G           ++P +           
Sbjct: 21598 CNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGT----------ISPPS----------- 21636

Query: 371   SASSQGITLTWTAPRGP----GSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVR 426
                S GI +T      P    G  +  G +I +  +       V  +PVP   W     +
Sbjct: 21637 --QSSGIIMTRDENVPPIVEFGPEYFDGLII-KSGESLRIKALVQGRPVPRVTW----FK 21689

Query: 427   QGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMR-------------------------- 460
              G + E R+        G     S ++F RD  R                          
Sbjct: 21690 DGVEIEKRMNMEITDVLG-----STSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQ 21744

Query: 461   --PPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPV 518
               P  +V  ++ T+ +   +TL W  P          Y++E   +  L W          
Sbjct: 21745 DTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIE-DKCEA 21803

Query: 519   TTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTV--CPKFLVDSS-TKDLL 575
              +YTA  L  G  Y  RV+AVN+ G  +P   D +V  +  TV   P     S+ T + +
Sbjct: 21804 QSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTVPDAPGIPEPSNITGNSI 21863

Query: 576   TV------KVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLS 629
             T+        G +       E        W+K           ++K  +++    V GL+
Sbjct: 21864 TLTWARPESDGGSEIQQYILERREKKSTRWVK----------VISKRPISETRFKVTGLT 21913

Query: 630   DSGLYTVVLRTLQGKEVAHSFRI-RVAACPQA---PGP---IHLQENVPGTVTAEW-EPS 681
             +   Y   +       V  +  I R+  C +    PGP   + + +    TV+ EW +P 
Sbjct: 21914 EGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPV 21973

Query: 682   PDEAQDVPLHYAVFTRSSAHGPWHEA-ADRIHTNRFTLLGILPGHEYHFRVVAKNELGAS 740
              D   ++ + Y +    +  G WH+  A+     R+T+  +  G EY FRV A N  GA 
Sbjct: 21974 FDGGMEI-IGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAIN--GAG 22030

Query: 741   KPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGS 800
             K  D+ +     +  DR T        P+L     F    ++H++  G    +  A QG 
Sbjct: 22031 K-GDSCEVTGTIKAVDRLTA-------PELDIDANFK---QTHVVRAGASIRLFIAYQGR 22079

Query: 801   PRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTAT 860
             P P   W K D +L     +++TD     +LT+ + +  D+G+Y    EN  G    T T
Sbjct: 22080 PTPTAVWSKPDSNLSLRADIHTTD--SFSTLTVENCNRNDAGKYTLTVENNSGSKSITFT 22137

Query: 861   LIVIE 865
             + V++
Sbjct: 22138 VKVLD 22142



 Score =  111 bits (278), Expect = 3e-24
 Identities = 160/634 (25%), Positives = 242/634 (38%), Gaps = 90/634 (14%)

Query: 259   DKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADS 318
             + P PP   + + D  ++ V L W  P+ +GG  +  YV+E ++ G   W  +       
Sbjct: 14658 EAPSPPDS-LNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHI--TTVKG 14714

Query: 319   TTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEA-LPKAPSAPAILSASSQGI 377
                   ++  G +YTF+V AV S G     ES  ++V  +  LP+       L    Q +
Sbjct: 14715 LECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELD-----LRGIYQKL 14769

Query: 378   TLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTA 437
              +            +LG     R K + TW   +      +R                  
Sbjct: 14770 VIAKAGDNIKVEIPVLG-----RPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECV 14824

Query: 438   VAPSGP---------GEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQ 488
              + SGP         GE G          P  P G ++  +V   S+  +T SW  P+  
Sbjct: 14825 RSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEV---SSDFVTFSWDPPEND 14881

Query: 489   EGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPS 548
              G     YVVE+  +DS  W+     TV  TTY A  L  G  Y  RV A N  G     
Sbjct: 14882 GGVPISNYVVEMRQTDSTTWVELAT-TVIRTTYKATRLTTGLEYQFRVKAQNRYGVGPGI 14940

Query: 549   ALDTLVQAMPVTV-----CPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDG 603
                 +V   P  V      P+  V + TKD +T+   +    P+S    P+     L   
Sbjct: 14941 TSACIVANYPFKVPGPPGTPQ--VTAVTKDSMTISWHE----PLSDGGSPI-----LGYH 14989

Query: 604   LPLPKRS----VTVTKDGLTQLLIPVAGLSDSGLYT--VVLRTLQGKEVAHSFRIRVAAC 657
             +   +R+     TV+K  +   +   +GL+D   Y   V+   + GK         + A 
Sbjct: 14990 VERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLAL 15049

Query: 658   -----PQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAA-DRI 711
                  P  P P+++  +   TVT +W             Y V  R   +G W +A    I
Sbjct: 15050 DPIDPPGKPVPLNITRH---TVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNI 15106

Query: 712   HTNRFTLLGILPGHEYHFRVVAKNELGA-SKPSDTSQPWCIPRQRDRFTVKAPCYREPDL 770
               N FT+ G+     Y FRV+AKN  GA S PS+ S         D  T +       D 
Sbjct: 15107 LENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPS---------DAITCR-------DD 15150

Query: 771   SQKPRFLVGLR---SHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP------AVY 821
              + P+  V ++   + +L  G    +   V G P P + W K+ + LEG        A +
Sbjct: 15151 VEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADF 15210

Query: 822   STDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQA 855
             ST+L+   S      + +DSG Y   A N  G A
Sbjct: 15211 STNLVNKDS------TRRDSGAYTLTATNPGGFA 15238



 Score =  110 bits (276), Expect = 4e-24
 Identities = 188/795 (23%), Positives = 286/795 (35%), Gaps = 129/795 (16%)

Query: 115   QDGVIFKQDGLVHSLFITHVQGTQAGRYTFV----AGDQQSEATLTVQDSPT-------- 162
             +D  I        SL + +V    +G+YT      +G + +  T+ V D+P+        
Sbjct: 16679 RDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVT 16738

Query: 163   -IAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREA----QVD 217
              I  D      EP ++  G  +   I     +  + A RK  A VV +  + +    Q+ 
Sbjct: 16739 EITKDSVSITWEPPLLDGGSKIKNYI-----VEKREATRKSYAAVVTNCHKNSWKIDQLQ 16793

Query: 218   LGDGYTRLCLPSAGRKDCGQYSVTLRSEGG---SVQAELTLQVIDKPDPPQGPMEVQDCH 274
              G  Y               + VT  +E G     Q    ++V + P PP G + V D  
Sbjct: 16794 EGCSY--------------YFRVTAENEYGIGLPAQTADPIKVAEVPQPP-GKITVDDVT 16838

Query: 275   RAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTF 334
             R  V L W  P  +GG  +  Y+VE +      W +     +     T  ++  G +Y F
Sbjct: 16839 RNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVIT--NLTQGEEYLF 16896

Query: 335   RVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQ-GITLTWTAPRGPGSAHIL 393
             RV AV  +G  +       +VA + + +    PA  S S Q G  L    P         
Sbjct: 16897 RVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVP--------- 16947

Query: 394   GYLIERRKKGSNTWTAVNDQPVPERRWTVAD-------------VRQGCQYEFRVTAVAP 440
                I  R K + TWT          R  V D                G QY   V  V  
Sbjct: 16948 ---ISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVV- 17003

Query: 441   SGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVEL 500
                G+     + V    P  P G V+     D S  SITLSW  P    G +   Y+V+ 
Sbjct: 17004 ---GQKTASIEIVTLDKPDPPKGPVK---FDDVSAESITLSWNPPLYTGGCQITNYIVQK 17057

Query: 501   CSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVT 560
               + +  W      TV  TT     L+ G  Y  R+ A N  GQS     D +V   P  
Sbjct: 17058 RDTTTTVW-DVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYK 17116

Query: 561   V-----CPKFLVDSSTKDLLTVKVGDTVR------VPVSFEAMPMPEVTWLKDGLPLPKR 609
                    P     + +KD + ++  + V       +    E      + W K        
Sbjct: 17117 EPGPPGTP--FATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTK-------- 17166

Query: 610   SVTVTKDGLTQLLIPVAGLSDSGLY--TVVLRTLQG-KEVAHSFRIRVAACP----QAPG 662
                V K  +         L +   Y   V    + G  + + +    VA  P      P 
Sbjct: 17167 ---VNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPE 17223

Query: 663   PIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAA-DRIHTNRFTLLGI 721
             PI ++ N    +T +W     +   +   Y V  R    G W +A+   +   +FT+ G+
Sbjct: 17224 PIMVKRN---EITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGL 17280

Query: 722   LPGHEYHFRVVAKNELGA-SKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGL 780
                  Y FRV+AKN  GA SKPSD++ P          T K      P +S  P+F   +
Sbjct: 17281 TEDQRYEFRVIAKNAAGAISKPSDSTGP---------ITAKDE-VELPRISMDPKFRDTI 17330

Query: 781   RSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP--AVYSTDLLGVCSLTIPSVSP 838
                ++  G    +   V G P P + W + D+ +E +    + +TD   +  L +     
Sbjct: 17331 ---VVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKAL--LIVKDAIR 17385

Query: 839   KDSGEYKAVAENTLG 853
              D G+Y   A N  G
Sbjct: 17386 IDGGQYILRASNVAG 17400



 Score =  108 bits (269), Expect = 3e-23
 Identities = 184/807 (22%), Positives = 303/807 (37%), Gaps = 106/807 (13%)

Query: 104   TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFV----AGDQQSEATLTVQD 159
             TW K  V L  + G+  K       L   +V    AG+Y        G ++    + V D
Sbjct: 13421 TWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLD 13480

Query: 160   SPTIAPDVTEK---------LREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSS 210
             +P    +VT K           EP ++  G P+I  +  Q     + +W     E   +S
Sbjct: 13481 TPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYV-VQKRDAERKSWSTVTTECSKTS 13539

Query: 211   DREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGP--- 267
              R A ++ G  Y               + V   +E G      T   +     P GP   
Sbjct: 13540 FRVANLEEGKSYF--------------FRVFAENEYGIGDPGETRDAVKASQTP-GPVVD 13584

Query: 268   MEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVE 327
             ++V+   ++   + W+ P  +GG  +  YVV+      + W +V ++   S  ++   + 
Sbjct: 13585 LKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVD-FLTEENKWQRVMKSL--SLQYSAKDLT 13641

Query: 328   PGRKYTFRVRAVTSEGAGEALE----SEEILVAPEALPKAPSAPAILSASSQGITLTWTA 383
              G++YTFRV A    G G   E    + + +VAP+   K    P +   + +        
Sbjct: 13642 EGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLK--GLPDLCYLAKENSNFRLKI 13699

Query: 384   PRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGP 443
             P     A  + +        ++T  +V    V      V D ++    ++ +T    +G 
Sbjct: 13700 PIKGKPAPSVSWKKGEDPLATDTRVSVESSAV-NTTLIVYDCQKSDAGKYTITLKNVAGT 13758

Query: 444   GEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSS 503
              E G  S  V  + P  P G ++  +VT     ++TL WA P    G E   Y++E   S
Sbjct: 13759 KE-GTISIKVVGK-PGIPTGPIKFDEVTAE---AMTLKWAPPKDDGGSEITNYILEKRDS 13813

Query: 504   DSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTV-- 561
              + +W+ C    V  TT+    L  G  Y  RV+A N+ G  +    + +V   P  V  
Sbjct: 13814 VNNKWVTC-ASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPD 13872

Query: 562   --CPKFLVDSSTKDLLTV-----KVGDTVRVPVSFEAMPMPEVTWLK-DGLPLPKRSVTV 613
                P  +VD     +        K G +       E      + W + +  P+  R   V
Sbjct: 13873 APPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKV 13932

Query: 614   TKDGLTQ--------LLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIH 665
             T  GLT+        + I +AG+    L +  +  L   +            P  P  I+
Sbjct: 13933 T--GLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDP-----------PGKPEVIN 13979

Query: 666   LQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTN----RFTLLG 720
             +  N   +VT  W EP  D    +   Y V  R      W +A    H N     FT+  
Sbjct: 13980 ITRN---SVTLIWTEPKYDGGHKL-TGYIVEKRDLPSKSWMKAN---HVNVPECAFTVTD 14032

Query: 721   ILPGHEYHFRVVAKNELGA-SKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVG 779
             ++ G +Y FR+ AKN  GA S PS++++      +          Y  P +   P    G
Sbjct: 14033 LVEGGKYEFRIRAKNTAGAISAPSESTETIICKDE----------YEAPTIVLDPTIKDG 14082

Query: 780   LRSHLLPQGCECCMSC-AVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSP 838
             L    +  G    ++  ++ G P P  +W K  + +  +     T       LTI   + 
Sbjct: 14083 L---TIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATR 14139

Query: 839   KDSGEYKAVAENTLGQAVSTATLIVIE 865
             KD+GEY   A N  G  V    + V++
Sbjct: 14140 KDAGEYTITATNPFGTKVEHVKVTVLD 14166



 Score =  107 bits (267), Expect = 5e-23
 Identities = 149/645 (23%), Positives = 251/645 (38%), Gaps = 86/645 (13%)

Query: 258   IDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPAD 317
             +D  DPP  P EV +  R  V L W  P+ +GG  +  Y+VE+R     +W+K       
Sbjct: 13966 LDPIDPPGKP-EVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVP 14024

Query: 318   STTFTDAHVEPGRKYTFRVRAVTSEGAGEA-LESEEILVAPEALPKAPSAPAIL--SASS 374
                FT   +  G KY FR+RA  + GA  A  ES E ++  +       AP I+      
Sbjct: 14025 ECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEY----EAPTIVLDPTIK 14080

Query: 375   QGITLTWTAPRGPGSAHILGYLIERR---KKGSNTW----TAVNDQPVPERRWTVADVRQ 427
              G+T+         +  ILG  + +    K G +      T +   P      T+    +
Sbjct: 14081 DGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSML-TIKYATR 14139

Query: 428   GCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDT 487
                 E+ +TA  P G          V   D   PPG V   ++++ S    TL+W  P  
Sbjct: 14140 KDAGEYTITATNPFGTKVEHVK---VTVLDVPGPPGPV---EISNVSAEKATLTWTPPLE 14193

Query: 488   QEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQP 547
               G   + Y++E   +  L W       +    + A  L  G  Y  RV+AVN  G+ +P
Sbjct: 14194 DGGSPIKSYILEKRETSRLLWTVVSED-IQSCRHVATKLIQGNEYIFRVSAVNHYGKGEP 14252

Query: 548   SALDTLVQAMPVTVCPKF---------LVDSSTKDLLTVKV------GDTVRVPVSFEAM 592
                   VQ+ PV +  +F          V + TK+  TV        G +       E  
Sbjct: 14253 ------VQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERR 14306

Query: 593   PMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYT--VVLRTLQG----KEV 646
                 + W++             K  ++ L   V GL +   Y   V      G     E 
Sbjct: 14307 EKKSLRWVR-----------AIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEA 14355

Query: 647   AHSFRIRVAACPQAPGPI---HLQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHG 702
             + S  ++ AA P  PGP    H+ +    + +  W +P  D   ++   Y V  +     
Sbjct: 14356 SDSVLMKDAAYP--PGPPSNPHVTDTTKKSASLAWGKPHYDGGLEIT-GYVVEHQKVGDE 14412

Query: 703   PWHE--AADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTV 760
              W +      +   +F +  +    +Y+FR+ A N+ G  +P+       + R+      
Sbjct: 14413 AWIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREM----- 14467

Query: 761   KAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAV 820
              AP +   +L  + R     R+ ++  G    +   ++G P P VTW K++ +L+    +
Sbjct: 14468 -APDF---ELDAELR-----RTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANI 14518

Query: 821   YSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
              +T+   +  L IP  +  D+G++    EN  G+      + V++
Sbjct: 14519 ENTESFTL--LIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLD 14561



 Score =  107 bits (267), Expect = 5e-23
 Identities = 142/642 (22%), Positives = 238/642 (37%), Gaps = 78/642 (12%)

Query: 254   TLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGE 313
             +++  ++P PP G + + D  R  V L W  P  +GG  +  Y+VE +  G   W     
Sbjct: 15737 SVKASERPLPP-GKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATCAT 15795

Query: 314   APADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESE-----EILVAPEALPKAPSAPA 368
                   T T   +  G +Y+FRV A   +G  +  +       + LV P A     +   
Sbjct: 15796 VKVTEATITG--LIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFT 15853

Query: 369   ILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQG 428
             +L+     + + +     P        +  ++    N  +  N+        ++  ++  
Sbjct: 15854 VLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENN--------SLLTIKDA 15905

Query: 429   CQYEFRVTAVA-PSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDT 487
             C+ +     V   +  GE     + +    P  P G V+  +VT     SITLSW  P  
Sbjct: 15906 CREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTA---DSITLSWGPPKY 15962

Query: 488   QEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQP 547
               G     Y+VE   + +  W      TV  TT  A  L+ G  Y  R+ A N  G+S  
Sbjct: 15963 DGGSSINNYIVEKRDTSTTTWQIVSA-TVARTTIKACRLKTGCEYQFRIAAENRYGKSTY 16021

Query: 548   SALDTLVQAMPVTV-----CPKFLVDSSTKDLLTVKVGDTVR------VPVSFEAMPMPE 596
                +  V   P  V      P  +V  S++D + V+  + +       +    E      
Sbjct: 16022 LNSEPTVAQYPFKVPGPPGTP--VVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNS 16079

Query: 597   VTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAA 656
             + W+K           + K  + Q      GL +   Y    R      V      +V+ 
Sbjct: 16080 ILWVK-----------LNKTPIPQTKFKTTGLEEGVEYE--FRVSAENIVGIGKPSKVSE 16126

Query: 657   C---------PQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEA 707
             C         P  P  I +  N   +VT +W+    +       Y V  +    G W +A
Sbjct: 16127 CYVARDPCDPPGRPEAIIVTRN---SVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKA 16183

Query: 708   A-DRIHTNRFTLLGILPGHEYHFRVVAKNELGA-SKPSDTSQPWCIPRQRDRFTVKAPCY 765
             +   I    F + G++  H Y FRV+A+N  G  S+PS+++       + D         
Sbjct: 16184 SFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVD--------- 16234

Query: 766   REPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP--AVYST 823
               P +S  P++   +  H    G    +   + G P P + W K D+ L       + ST
Sbjct: 16235 -PPRISMDPKYKDTIVVHA---GESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKST 16290

Query: 824   DLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
             D     SL++      DSG Y   A+N  G+   T  + V++
Sbjct: 16291 DF--ATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLD 16330



 Score =  106 bits (264), Expect = 1e-22
 Identities = 186/816 (22%), Positives = 293/816 (35%), Gaps = 93/816 (11%)

Query: 104  TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTI 163
            +W KDG ++   D +  K D +   L +       AG YT    ++   AT ++      
Sbjct: 8114 SWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIG 8173

Query: 164  APDVTEKLREPLVVKAGKPVIVKIP-FQSHLPI--QAAWRKDGAEVVGSSDREAQVDLGD 220
             P   + ++   + K+   +  + P F    PI      R++       + R   + +  
Sbjct: 8174 LPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERRE-------AGRRTYIPVMS 8226

Query: 221  GYTRLCLPSAGRKDCGQYSVTLRS---EGGSVQAELTLQVI--DKPDPPQGP--MEVQDC 273
            G  +L          G+Y   +++    GG    EL   VI  D   PP  P  +EV + 
Sbjct: 8227 GENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNP 8286

Query: 274  HRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYT 333
                + + W+PP  +GG  +  Y++E+   G   W +  E      T+T   +E G++Y 
Sbjct: 8287 TAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQ 8346

Query: 334  FRVRAVTSEGAGE------ALESEEILVAPEALPKAP-----SAPAILSASSQGI---TL 379
            FRVRA  + G  E        ++ + + AP+ + +            L AS  G    T+
Sbjct: 8347 FRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYPTI 8406

Query: 380  TWTAPRG---PGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVT 436
            TW        P         + RR+KG          P+ +R       +   Q   R +
Sbjct: 8407 TWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDS 8466

Query: 437  AVAPSGPGEPGPPSDAVFARDP-----MRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGD 491
                 G       +D   A+ P     +  PG   N    D   TS+   W  P    G 
Sbjct: 8467 LRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGS 8526

Query: 492  EAQGYVVEL--CSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSA 549
            E   Y +E    +    +W+     T+    Y+   L  G+ Y  RV A N  G   P  
Sbjct: 8527 EIINYTLEKKDKTKPDSEWIVV-TSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCV 8585

Query: 550  LDTLVQAMPV---TVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPL 606
               LV   P        K +V+  T + + VK  +           P+        G  L
Sbjct: 8586 SKPLVAKDPFGPPDAPDKPIVEDVTSNSMLVKWNEP-----KDNGSPIL-------GYWL 8633

Query: 607  PKRSVT------VTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQA 660
             KR V       V K  L  L   V GL +    T V R    +  A   +    + P+ 
Sbjct: 8634 EKREVNSTHWSRVNKSLLNALKANVDGLLEG--LTYVFRVC-AENAAGPGKFSPPSDPKT 8690

Query: 661  -------PGP--IHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADR- 710
                   PGP    + +    T+  EWEP         + Y V  +      W    ++ 
Sbjct: 8691 AHDPISPPGPPIPRVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKM 8750

Query: 711  IHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDL 770
            I   ++T+  I  G +Y  RV A N  G   P +T QP  +   ++      P   E D+
Sbjct: 8751 IKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGET-QPVTVAEPQE------PPAVELDV 8803

Query: 771  SQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCS 830
            S K     G++   +  G    +   V G P P   W K +  L+ +  V   D +G  S
Sbjct: 8804 SVKG----GIQ---IMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVV--IDNVGTKS 8854

Query: 831  -LTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
             L I     KD G Y   A N+ G   + A + V +
Sbjct: 8855 ELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFD 8890



 Score =  103 bits (256), Expect = 9e-22
 Identities = 176/829 (21%), Positives = 298/829 (35%), Gaps = 139/829 (16%)

Query: 107   KDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPD 166
             KDGV    +D  +   +     + I   + +  G+Y+  A ++  + T   +      P 
Sbjct: 9550  KDGVHDIPEDAQLETAENS-SVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPG 9608

Query: 167   VTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLC 226
               + L+   + +    +  K+P             DG + +     E +   G  +T++ 
Sbjct: 9609  PPKDLKVSDITRGSCRLSWKMPDD-----------DGGDRIKGYVIEKRTIDGKAWTKV- 9656

Query: 227   LPSAGRKDCG-------------QYSVTLRSEGG--------SVQAELTLQVIDKPDPPQ 265
                    DCG             QY   +R+E          ++Q       I  PDPP 
Sbjct: 9657  -----NPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPPI 9711

Query: 266   GPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVE-----RRQAGRSTWLKVGEAPADSTT 320
               +++    +  V L W+PP+++GG  V  Y+VE          +  W +  +   +   
Sbjct: 9712  -KLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQ 9770

Query: 321   FTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAI----------- 369
             FT   +  G +Y FRV+AV + G  +   +    V P    +    P+I           
Sbjct: 9771  FTVEDLVEGGEYEFRVKAVNAAGVSKPSAT----VGPCDCQRPDMPPSIDLKEFMEVEEG 9826

Query: 370   ----LSASSQGI---TLTW--TAPRGPGSAHILGYLIERRKKG-SNTWTAVNDQPVPERR 419
                 + A  +G+   TLTW    P+ P +   + Y     K    +T T V    +P+ R
Sbjct: 9827  TNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLV----IPQSR 9882

Query: 420   ------WTVADVRQ--GCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVT 471
                   +T+  V        E R+  +     G PGPP               V  ++  
Sbjct: 9883  RSDTGLYTITAVNNLGTASKEMRLNVL-----GRPGPP---------------VGPIKFE 9922

Query: 472   DRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVT-TYTAKGLRPGE 530
               S   +TLSW  P    G +   YV+E   ++   W+  HV + P   TYT   L  G 
Sbjct: 9923  SVSADQMTLSWFPPKDDGGSKITNYVIEKREANRKTWV--HVSSEPKECTYTIPKLLEGH 9980

Query: 531   GYFVRVTAVNEGGQSQP--SALDTLVQAMPVTVCP-KFLVDSSTKDLLTVKVGDTVRVPV 587
              Y  R+ A N+ G  +P  S  +T      V   P K  V S T++ +TV   +      
Sbjct: 9981  EYVFRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEP----- 10035

Query: 588   SFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVA----GLSDSGLYTVVLRTLQG 643
              ++        WL+      KR   V +D +  + + V+    GL +   Y   +  +  
Sbjct: 10036 EYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINA 10095

Query: 644   KEVAHSF------RIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTR 697
               V  +         R    P  P    + +    +   EW P   +       Y V  +
Sbjct: 10096 AGVGPASLPSDPATARDPIAPPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYK 10155

Query: 698   SSAHGPWHEAADR-IHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRD 756
                   W +  D+ +   +  + G+  G  Y FRV A N  G  +P + +    +   +D
Sbjct: 10156 EEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTD---VIEMKD 10212

Query: 757   RFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEG 816
             R          PDL         +  H    G    +   V G P P VTW  N+R+L  
Sbjct: 10213 RLV-------SPDLQLDASVRDRIVVHA---GGVIRIIAYVSGKPPPTVTWNMNERTLPQ 10262

Query: 817   NPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
                + +T +    S+ I +      G Y  +A+N  G+   T  + V++
Sbjct: 10263 EATIETTAISS--SMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLD 10309



 Score =  102 bits (255), Expect = 1e-21
 Identities = 154/678 (22%), Positives = 257/678 (37%), Gaps = 84/678 (12%)

Query: 228   PSAGRKDCGQYSV---TLRSEGGSVQAELTLQVIDK-PDPPQGPMEVQDCHRAGVCLRWR 283
             P AG  +  +YS     L   G S  ++ T  V  + P  P G  EV D  ++ V L W 
Sbjct: 12847 PCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIWA 12906

Query: 284   PPRDNGGRTVECYVVERRQAGRSTWLKVGEAPAD--STTFTDAHVEPGRKYTFRVRAVTS 341
              P+ +GG  +  Y VE  +     W++   AP       +T   +E   +Y FR  A T+
Sbjct: 12907 RPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTA 12966

Query: 342   EGAGEALE-SEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERR 400
                    E S+ + +  E +P     P I  + +    LT  A    G+   L   +  +
Sbjct: 12967 VNISPPSEPSDPVTILAENVP-----PRIDLSVAMKSLLTVKA----GTNVCLDATVFGK 13017

Query: 401   KKGSNTWTAVNDQPVPERRWTVADVRQGCQYE-----------FRVTAVAPSGPGEPGPP 449
                + +W        P     +A  R  C  E           + +TA   SG       
Sbjct: 13018 PMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGS------ 13071

Query: 450   SDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWL 509
               A      +  PG   ++++    +    LSW  P    G E   Y+V+   +    W 
Sbjct: 13072 KSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWA 13131

Query: 510   PCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTV---CPKFL 566
                  TVP+T+ + + L  G  Y  R+ A N+ G   P   +  +   P      C   +
Sbjct: 13132 QVSA-TVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDPPV 13190

Query: 567   VDSSTKDLLTVK---VGDTVRVPVS---FEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQ 620
             + + TKD +TV      D    P++    E      V W K           V +  + +
Sbjct: 13191 ISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTK-----------VNRKPIIE 13239

Query: 621   LLIPVAGLSDSGLY----TVVLRTLQGKEVAHSFRIRVAACPQ-APGPI---HLQENVPG 672
               +   GL +   Y    T + +   GK  + + +   A  PQ  PGP     + +    
Sbjct: 13240 RTLKATGLQEGTEYEFRVTAINKAGPGKP-SDASKAAYARDPQYPPGPPAFPKVYDTTRS 13298

Query: 673   TVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEA--ADRIHTNRFTLLGILPGHEYHF 729
             +V+  W +P+ D    + + Y V  + +    W        +   RF + G++   +Y F
Sbjct: 13299 SVSLSWGKPAYDGGSPI-IGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLMEDTQYQF 13357

Query: 730   RVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGC 789
             RV A N++G S PSD      +P +     +  P   E D   +       ++ +L  G 
Sbjct: 13358 RVYAVNKIGYSDPSD------VPDKHYPKDILIPPEGELDADLR-------KTLILRAGV 13404

Query: 790   ECCMSCAVQGSPRPHVTWFKNDRSLEGNPA--VYSTDLLGVCSLTIPSVSPKDSGEYKAV 847
                +   V+G P P +TW K + +L       + STD      L   +V+  D+G+Y   
Sbjct: 13405 TMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDF--DTFLRCENVNKYDAGKYILT 13462

Query: 848   AENTLGQAVSTATLIVIE 865
              EN+ G+   T  + V++
Sbjct: 13463 LENSCGKKEYTIVVKVLD 13480



 Score =  102 bits (253), Expect = 2e-21
 Identities = 167/782 (21%), Positives = 280/782 (35%), Gaps = 102/782 (13%)

Query: 128   SLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKI 187
             SL I +     +G+YT    +  S A+LT+       P     +    V K    +   +
Sbjct: 19936 SLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDV 19995

Query: 188   PFQSHLPIQAAWRKDGAEVVGS-------SDREAQVDLGDGYTRLCLPSAGRKDCGQYSV 240
             P             DG   V +       + ++A V + +   RL       ++   Y  
Sbjct: 19996 P-----------ENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYF 20044

Query: 241   TLRSE---GGSVQAELT--LQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVEC 295
              +  E   G  + AE    +++ +KP PP+  + V    +  V L W  P  +GG  +  
Sbjct: 20045 RVSGENEFGVGIPAETKEGVKITEKPSPPE-KLGVTSISKDSVSLTWLKPEHDGGSRIVH 20103

Query: 296   YVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALES----- 350
             YVVE  + G+  W+K   A A ST    + +    +Y FRV A    G  +  E      
Sbjct: 20104 YVVEALEKGQKNWVKC--AVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVL 20161

Query: 351   -EEILVAPEA-LPKAPSAPAILSASSQ-GITLTWTAPRGPGSAHILGYLIERRKKGSNTW 407
              +E L  PE  +   PS    + A S   + +  +    P        +  +     NT 
Sbjct: 20162 IKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTE 20221

Query: 408   TAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGE----------PGPPSDAVFARD 457
                 +  +  +    AD  +     + +TA   SG  +          PGPP+  V    
Sbjct: 20222 ITAENLTINLKESVTADAGR-----YEITAANSSGTTKAFINIVVLDRPGPPTGPVV--- 20273

Query: 458   PMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVP 517
                         ++D +  S+TL W  P    G +   Y++    + +  W      TV 
Sbjct: 20274 ------------ISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSA-TVA 20320

Query: 518   VTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVC---PKFLVDSSTKDL 574
              T      L  GE Y  R+ A N  G S       +   +P T         V + T++ 
Sbjct: 20321 RTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPPSTPWVTNVTRES 20380

Query: 575   LTV------KVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGL 628
             +TV        G +  V    E      + W K      K  +  T   +T +    AGL
Sbjct: 20381 ITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKAN----KLVIRTTHFKVTTIS---AGL 20433

Query: 629   SDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDV 688
                           GK    S  +      + P  + + +    +V+  W+    +    
Sbjct: 20434 IYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSK 20493

Query: 689   PLHYAVFTRSSAHGPWHEAA-DRIHTNRFTLLGILPGHEYHFRVVAKNELGA-SKPSDTS 746
                Y V  R    G W +A+   +   +F + G+    +Y FRV A+N +G+ S PS+  
Sbjct: 20494 ITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVV 20553

Query: 747   QP-WCIPRQRDRFTVKAPCYREP--DLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRP 803
              P  CI             Y  P  DL  +   +V  R+     G    +   + G P P
Sbjct: 20554 GPITCIDS-----------YGGPVIDLPLEYTEVVKYRA-----GTSVKLRAGISGKPAP 20597

Query: 804   HVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
              + W+K+D+ L+ N  V   +   + S+ I      +SG Y+    N +G A +T  + +
Sbjct: 20598 TIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQI 20657

Query: 864   IE 865
             ++
Sbjct: 20658 LD 20659



 Score =  101 bits (252), Expect = 3e-21
 Identities = 191/808 (23%), Positives = 287/808 (35%), Gaps = 99/808 (12%)

Query: 104   TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTV----QD 159
             TW K G+ L ++   I         L +  V    AG+YT  A +Q  + + TV     D
Sbjct: 23174 TWSKQGIDLASR--AIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYD 23231

Query: 160   SPTIAPDVTEK--LREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGS---SDREA 214
             +P   P V  K   R+ + +    P I                 DG   V +     REA
Sbjct: 23232 TPGPCPSVKVKEVSRDSVTITWEIPTI-----------------DGGAPVNNYIVEKREA 23274

Query: 215   QVDLGDGYTRLCLPS----AGRKDCGQYSVTLRSE-----GGSVQAELTLQVIDKPDPPQ 265
              +      T  C  +    +G  +   Y   +  E     G   +    + V + P  P 
Sbjct: 23275 AMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVP- 23333

Query: 266   GPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAH 325
               +EV D  ++ V L W  P  +GG  +  YV+E  +AG   W+KV          T   
Sbjct: 23334 AKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTS 23393

Query: 326   VEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPR 385
             +  G +Y FR+RA   +G  E  E+    V  + L   P+    LS   Q    T   P 
Sbjct: 23394 LNEGEQYLFRIRAQNEKGVSEPRET-VTAVTVQDLRVLPTID--LSTMPQ---KTIHVPA 23447

Query: 386   GPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSG--- 442
             G     ++   I  R   + +W     +     R TV    +  +   R T +  +G   
Sbjct: 23448 GRPVELVIP--IAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYT 23505

Query: 443   ------PGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGY 496
                    G        +    P  P G ++   + +   TSIT+SW  P+   G    GY
Sbjct: 23506 LELKNVTGTTSETIKVIILDKPGPPTGPIK---IDEIDATSITISWEPPELDGGAPLSGY 23562

Query: 497   VVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGG-----QSQPSALD 551
             VVE   +    WLP    +V  +T+    L  G  Y  RV A N  G     QS+     
Sbjct: 23563 VVEQRDAHRPGWLPVS-ESVTRSTFKFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIECR 23621

Query: 552   TLVQAM-PVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEV---TWLKDGLPLP 607
             + ++   P      F V      L      D     V+   +   EV    W++    + 
Sbjct: 23622 SSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVR----VN 23677

Query: 608   KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQ 667
             K  VT+T+   T L     GL      T +     GK    S  I VA  P AP      
Sbjct: 23678 KVPVTMTRYRSTGL---TEGLEYEHRVTAINARGSGKPSRPSKPI-VAMDPIAPPGKPQN 23733

Query: 668   ENVPGT----VTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEA-ADRIHTNRFTLLGIL 722
               V  T    V+  W    DE       Y +  +      W +          +TL  + 
Sbjct: 23734 PRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREYTLTHLP 23793

Query: 723   PGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYRE-PDLSQKPRFLVGLR 781
              G EY FRV+A N  G  +P++              TVK     E PD     R+  G+ 
Sbjct: 23794 QGAEYRFRVLACNAGGPGEPAEVPG-----------TVKVTEMLEYPDYELDERYQEGI- 23841

Query: 782   SHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDS 841
                + QG    ++  ++G P P   W K  + +     + +++      L I      DS
Sbjct: 23842 --FVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSET--HTELVIKEADRGDS 23897

Query: 842   GEYKAVAENTLG-QAVSTATLIVIEPST 868
             G Y  V EN  G +AV     ++  P++
Sbjct: 23898 GTYDLVLENKCGKKAVYIKVRVIGSPNS 23925



 Score =  100 bits (248), Expect = 8e-21
 Identities = 149/651 (22%), Positives = 247/651 (37%), Gaps = 79/651 (12%)

Query: 246   GGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGR 305
             G  V+    ++  + P PP G + + D  +    L W  P  +GG  V  YVVE +  G 
Sbjct: 17893 GVPVETVDAVKAAEPPSPP-GKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGT 17951

Query: 306   STWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGA------GEALESEEILVAPEA 359
               W  V E+   +   T   +  G++Y FRV+A   +G       G  + ++++ + P  
Sbjct: 17952 EKWSIVAESKVCNAVVTG--LSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSL 18009

Query: 360   LPKAP-SAPAILSASSQGITLTWTAPRGPGSAHIL-GYLIERRKKGSNTWTAVNDQPVPE 417
               K P +  +I +     I +       P  + +  G  +++  + +   TA +      
Sbjct: 18010 --KLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATS------ 18061

Query: 418   RRWTVADVRQGCQYEF-RVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNT 476
                TV  +++G + +F + T  A +  G        +    P  P G VR  +V   S  
Sbjct: 18062 ---TVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEV---SAD 18115

Query: 477   SITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHV--GTVPVTTYTAKGLRPGEGYFV 534
              + +SW  P    G +   Y+VE   + +  W   H+   TV  TT     L+ G  Y  
Sbjct: 18116 FVVISWEPPAYTGGCQISNYIVEKRDTTTTTW---HMVSATVARTTIKITKLKTGTEYQF 18172

Query: 535   RVTAVNEGGQSQPSALDTLVQAMPVTVC----PKFLVDSSTKDLLT-----VKVGDTVRV 585
             R+ A N  G+S P     ++   P          F+   S   +L      V  G T  +
Sbjct: 18173 RIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKII 18232

Query: 586   PVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGL---YTVVLRTLQ 642
                 E      + W+K    L K  +  TK   T L        D GL   + V    + 
Sbjct: 18233 GYHLEQKEKNSILWVK----LNKTPIQDTKFKTTGL--------DEGLEYEFKVSAENIV 18280

Query: 643   G----KEVAHSFRIRVAACPQA-PGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTR 697
             G     +V+  F  R    P   P  I +  N    VT +W+    +       Y V  +
Sbjct: 18281 GIGKPSKVSECFVARDPCDPPGRPEAIVITRN---NVTLKWKKPAYDGGSKITGYIVEKK 18337

Query: 698   SSAHGPWHEAA-DRIHTNRFTLLGILPGHEYHFRVVAKNELGA-SKPSDTSQPWCIPRQR 755
                 G W +A+   +    FT+ G++    Y FRV+A+N  G  S+PSD+S       + 
Sbjct: 18338 DLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEI 18397

Query: 756   DRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLE 815
             D           P+ S  P++   +  H    G    +   ++G P P V W K+ + LE
Sbjct: 18398 DA----------PNASLDPKYKDVIVVHA---GETFVLEADIRGKPIPDVVWSKDGKELE 18444

Query: 816   GNPA-VYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
                A +     +   +L +      D G+Y     N  G      T+ V++
Sbjct: 18445 ETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLD 18495



 Score = 99.8 bits (247), Expect = 1e-20
 Identities = 144/687 (20%), Positives = 255/687 (37%), Gaps = 87/687 (12%)

Query: 105   WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTV------Q 158
             W KDG  L     V       V SL I        G Y     +     T+ +      +
Sbjct: 19123 WRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDR 19182

Query: 159   DSPTIAPDVTEKLREPLVVKAGKP------VIVKIPFQSHLPIQAAWRKDGAEVVGSSDR 212
               P     + E   + + +    P       I     +        W      V  +S +
Sbjct: 19183 PGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSIK 19242

Query: 213   EAQVDLGDGYT-RLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQ 271
               ++  G  Y  R+C  +       +Y  +  SE  +V AE        P  P G  +V 
Sbjct: 19243 IVRLTTGSEYQFRVCAEN-------RYGKSSYSESSAVVAEYPF----SPPGPPGTPKVV 19291

Query: 272   DCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRK 331
                ++ + + W+ P ++GG  V  Y +E ++     W K  +     T    + ++ G  
Sbjct: 19292 HATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLM 19351

Query: 332   YTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAH 391
             Y +RV A    G G+  +S E + A +     P  P + + + + ++L W+ P   G A 
Sbjct: 19352 YEYRVYAENIAGIGKCSKSCEPVPARDPC-DPPGQPEVTNITRKSVSLKWSKPHYDGGAK 19410

Query: 392   ILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTA-VAPSGPGEPGPPS 450
             I GY++ERR+     W   N   + E  + V ++ +  +YEFRV A  A     EP   +
Sbjct: 19411 ITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSEST 19470

Query: 451   DAVFARDPMRPPGLVRNLQVTD----------RSNTSI------TLSWAGPDTQEGDEAQ 494
               +  +D + PP ++ +++  D          + N  I       +SWA    +  + A+
Sbjct: 19471 GPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERAR 19530

Query: 495   GYVVELCSSDSLQWLPCHVGTVPVTTYTAKG-LRPGEGYFVRVTAVNEGGQSQPSALDTL 553
                 E+ S+D+             T  T K  +R   G +V +T  N  G ++  A++  
Sbjct: 19531 ---TEIISTDN------------HTLLTVKDCIRRDTGQYV-LTLKNVAG-TRSVAVNCK 19573

Query: 554   VQAMPVTVCPKFLVDSSTKDLLTVKVG---DTVRVPVSFEAMPMPEVTWL-----KDGLP 605
             V   P        ++  T +  ++  G   +     + +  +   E + L     +  L 
Sbjct: 19574 VLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQ 19633

Query: 606   LPKRSVTVTKDGLTQLLIPVAGLSDSG----LYTVVLRTLQGKEVAHSFRIRVAACPQAP 661
             +    VT    G  + +  V G++  G    L +V ++ L    V           P  P
Sbjct: 19634 MTSCKVTKLLKG-NEYIFRVTGVNKYGVGEPLESVAIKALDPFTV-----------PSPP 19681

Query: 662   GPIHLQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADR-IHTNRFTLL 719
               + +      ++T  W  P  D   ++   Y +  R      W     + ++  R    
Sbjct: 19682 TSLEITSVTKESMTLCWSRPESDGGSEIS-GYIIERREKNSLRWVRVNKKPVYDLRVKST 19740

Query: 720   GILPGHEYHFRVVAKNELGASKPSDTS 746
             G+  G EY +RV A+N  G S PS+TS
Sbjct: 19741 GLREGCEYEYRVYAENAAGLSLPSETS 19767



 Score = 99.4 bits (246), Expect = 1e-20
 Identities = 86/303 (28%), Positives = 136/303 (44%), Gaps = 23/303 (7%)

Query: 74    HFSQGLADMEVQPGEAATLSCTLTSDLGP-GTWFKDGVKLTTQDGVIFKQD---GLVHSL 129
             HF + L ++ V+    ATL C +T    P   W++ G ++   DG+ ++     G  H L
Sbjct: 24624 HFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIA-DGLKYRIQEFKGGYHQL 24682

Query: 130   FITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKA--------GK 181
              I  V    A  Y   A +Q      +V  + ++  +V  K+  P  ++         G+
Sbjct: 24683 IIASVTDDDATVYQVRATNQGG----SVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGE 24738

Query: 182   PVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPS-AGRKDCGQYSV 240
              V +KIPF         W+K G +++  ++   QV +   +T L  P+   RKD G Y V
Sbjct: 24739 VVSIKIPFSGKPDPVITWQK-GQDLI-DNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVV 24796

Query: 241   TLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVER 300
               ++  G  Q  + L V D PDPP+G ++V D  R  V L W  P  +GG  +  Y+VE+
Sbjct: 24797 CAKNRFGIDQKTVELDVADVPDPPRG-VKVSDVSRDSVNLTWTEPASDGGSKITNYIVEK 24855

Query: 301   RQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEAL 360
                    WL+VG+  A  T +T  ++     Y FRV A    G  +  E  E  +  E  
Sbjct: 24856 CATTAERWLRVGQ--ARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDK 24913

Query: 361   PKA 363
              +A
Sbjct: 24914 TRA 24916



 Score = 98.6 bits (244), Expect = 2e-20
 Identities = 93/395 (23%), Positives = 157/395 (39%), Gaps = 28/395 (7%)

Query: 84    VQPGEAATLSCTLTSDLGPG-TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRY 142
             +Q GE   +   +     P  +W KDG  L     V  ++      L I        G+Y
Sbjct: 18018 IQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKY 18077

Query: 143   TFVAGDQQSEAT------LTVQDSPTIAPDVTEKLREPLVVKAGKP-------VIVKIPF 189
             T  A +    AT      +  +  P + P   +++    VV + +P        I     
Sbjct: 18078 TVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIV 18137

Query: 190   QSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYT-RLCLPSAGRKDCGQYSVTLRSEGGS 248
             +        W    A V  ++ +  ++  G  Y  R+   +   K     S  L S+   
Sbjct: 18138 EKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGK-----SAPLDSKAVI 18192

Query: 249   VQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTW 308
             VQ         +P PP  P  V    +  + ++W  P ++GG  +  Y +E+++     W
Sbjct: 18193 VQ-----YPFKEPGPPGTPF-VTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILW 18246

Query: 309   LKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPA 368
             +K+ + P   T F    ++ G +Y F+V A    G G+  +  E  VA +     P  P 
Sbjct: 18247 VKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPC-DPPGRPE 18305

Query: 369   ILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQG 428
              +  +   +TL W  P   G + I GY++E++      W   +   V E  +TV+ + + 
Sbjct: 18306 AIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVED 18365

Query: 429   CQYEFRVTAVAPSGP-GEPGPPSDAVFARDPMRPP 462
              +YEFRV A   +G   EP   S A+ ARD +  P
Sbjct: 18366 QRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAP 18400



 Score = 95.5 bits (236), Expect = 2e-19
 Identities = 148/634 (23%), Positives = 251/634 (39%), Gaps = 62/634 (9%)

Query: 259   DKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADS 318
             ++P PP+  ++V D  ++   L W  P  +GG  +  Y++E RQ G   W++ G      
Sbjct: 22239 EQPAPPRR-LDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHTK--Q 22295

Query: 319   TTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGIT 378
              TFT   +    +Y FRV+A    G  E  E+   ++  E  P+      +   ++Q IT
Sbjct: 22296 LTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKE--PQIEPTADLTGITNQLIT 22353

Query: 379   LTWTAP-------RGPGSAHILGYLIERRKKGSN--TWTAVNDQPVPERRWTVADVRQGC 429
                 +P        G  +  +   L E R K ++  + T   D+       TV D  +G 
Sbjct: 22354 CKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTT----LTVKDSMRGD 22409

Query: 430   QYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQE 489
                + +T          G  + +V      RP  +   ++V+  S  S  LSW  P    
Sbjct: 22410 SGRYFLTL-----ENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGG 22464

Query: 490   GDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSA 549
             G E   Y+VE   S +  W   +  +V  T      L     Y  RV++ N  G S+P  
Sbjct: 22465 GTEITNYIVEKRESGTTAWQLVN-SSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE 22523

Query: 550   LDTLVQA---MPVTVCPKFLVDSSTKDLLTVKV------GDTVRVPVSFEAMPMPEVTWL 600
                ++     +P +   +  V   + + ++++       G +  +    E      + W+
Sbjct: 22524 SAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWV 22583

Query: 601   KDG-LPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACP- 658
             K+  +P  + +  VT  GL + L       +    T  L      + + + R  +A  P 
Sbjct: 22584 KENKVPCLECNYKVT--GLVEGL-------EYQFRTYALNAAGVSKASEASRPIMAQNPV 22634

Query: 659   QAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAH---GPWHEAADRIHT-N 714
              APG   + +    TV+  W     +     + Y +  +  +    G W +    I + N
Sbjct: 22635 DAPGRPEVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDN 22694

Query: 715   RFTLLGILPGHEYHFRVVAKNELGA-SKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQK 773
              FT+  +  G  Y FRV+AKN  G  SK S+++ P      RD +   AP   E D ++ 
Sbjct: 22695 FFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTC---RDEY---APPKAELD-ARL 22747

Query: 774   PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTI 833
                LV +R+     G +  +  AV G P P + W K D+ L+    V         +  I
Sbjct: 22748 HGDLVTIRA-----GSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVI 22802

Query: 834   PSVSPKDSGEYKAVAENTLG-QAVSTATLIVIEP 866
                   DSG+Y    +N  G +AVS    ++  P
Sbjct: 22803 KFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSP 22836



 Score = 94.0 bits (232), Expect = 5e-19
 Identities = 147/632 (23%), Positives = 240/632 (37%), Gaps = 61/632 (9%)

Query: 259   DKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADS 318
             D  DPP  P  +    R  + L+W  P  +GG  +  Y+VE+R      W+K        
Sbjct: 17214 DPCDPPGTPEPIM-VKRNEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIE 17272

Query: 319   TTFTDAHVEPGRKYTFRVRAVTSEGA-GEALESEEILVAPEA--LPKAPSAPAILSAS-- 373
             T FT + +   ++Y FRV A  + GA  +  +S   + A +   LP+    P        
Sbjct: 17273 TQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVV 17332

Query: 374   SQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVR-QGCQYE 432
             + G T    A         + +L   ++   +    + +            +R  G QY 
Sbjct: 17333 NAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYI 17392

Query: 433   FRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDE 492
              R + VA    G    P +      P  P G V   QVT  ++   +L+W+ P    G +
Sbjct: 17393 LRASNVA----GSKSFPVNVKVLDRPGPPEGPV---QVTGVTSEKCSLTWSPPLQDGGSD 17445

Query: 493   AQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDT 552
                YVVE   +  L W       V  +    K L  G  Y  R+ AVN+ G  +P     
Sbjct: 17446 ISHYVVEKRETSRLAWTVVASEVVTNSLKVTK-LLEGNEYVFRIMAVNKYGVGEPLESAP 17504

Query: 553   LVQAMPVTVC--PKFL-VDSSTKDLLTV------KVGDTVRVPVSFEAMPMPEVTWLKDG 603
             ++   P  +   PK L V +  KD +TV        G +  +    E      + W+K  
Sbjct: 17505 VLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIK-- 17562

Query: 604   LPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYT--VVLRTLQGKEVAHSFRIRVAACPQA- 660
                        K  +T L + V GL++   Y   V      G        +   AC    
Sbjct: 17563 ---------CNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVF 17613

Query: 661   -PGP---IHLQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADR--IHT 713
              PGP    H+ +    ++T  W +P  D   ++ L Y V    +    W     +  +  
Sbjct: 17614 KPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEI-LGYVVEICKADEEEWQIVTPQTGLRV 17672

Query: 714   NRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQK 773
              RF +  +    EY  RV A N++G  +   TS P  + +  D+  ++AP   E DL  +
Sbjct: 17673 TRFEISKLTEHQEYKIRVCALNKVGLGEA--TSVPGTV-KPEDK--LEAP---ELDLDSE 17724

Query: 774   PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTI 833
              R  + +R+     G    +    +G P P +TW + +   E    V     +    L+I
Sbjct: 17725 LRKGIVVRA-----GGSARIHIPFKGRPTPEITWSREEG--EFTDKVQIEKGVNYTQLSI 17777

Query: 834   PSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
              +    D+G+Y    EN+ G   +  T+ V++
Sbjct: 17778 DNCDRNDAGKYILKLENSSGSKSAFVTVKVLD 17809



 Score = 94.0 bits (232), Expect = 5e-19
 Identities = 146/640 (22%), Positives = 231/640 (36%), Gaps = 76/640 (11%)

Query: 259   DKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADS 318
             D  DPP  P E     R  V L+W+ P  +GG  +  Y+VE++      W+K        
Sbjct: 18296 DPCDPPGRP-EAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLE 18354

Query: 319   TTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGIT 378
             T FT + +   ++Y FRV  +    AG   E  +   A  A  +  +  A L    + + 
Sbjct: 18355 TEFTVSGLVEDQRYEFRV--IARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVI 18412

Query: 379   LTWTAPRGPGSAHILGYLI------ERRKKGSNTWTAVNDQPVPERRWTVAD--VR-QGC 429
             +          A I G  I      +  K+   T   +  +   ++   V    +R  G 
Sbjct: 18413 VVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGG 18472

Query: 430   QYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQE 489
             QY  +++ V     G    P        P  P G    L+VT  +     L+W  P    
Sbjct: 18473 QYILKLSNVG----GTKSIPITVKVLDRPGPPEG---PLKVTGVTAEKCYLAWNPPLQDG 18525

Query: 490   GDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSA 549
             G     Y++E   +  L W       V    Y    L PG  Y  RV AVN+ G  +P  
Sbjct: 18526 GANISHYIIEKRETSRLSWTQVST-EVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEP-- 18582

Query: 550   LDTLVQAMPVTVCPKFL---------VDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWL 600
                 +++ PVT C  +          V + TKD + V             A P+ +    
Sbjct: 18583 ----LESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTW-----------ARPVDDGGTE 18627

Query: 601   KDGLPLPKRS------VTVTKDGLTQLLIPVAGLSDSGLYT--VVLRTLQGKEVAHSFRI 652
              +G  L KR           K  LT L + V GL++   Y   V      G        +
Sbjct: 18628 IEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSV 18687

Query: 653   RVAAC-----PQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEA 707
                AC     P  P    + +    +V+  W     +       Y V  + +A   W   
Sbjct: 18688 FYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTC 18747

Query: 708   ADR--IHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCY 765
                  +   +FT+  +    EY+FR+ A N  G  +P+  + P  +  Q     ++ P  
Sbjct: 18748 TPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPA--TLPGSVVAQE---RIEPP-- 18800

Query: 766   REPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDL 825
              E +L    R +V LR+    +     +   ++G P P V W K +  L     +  T  
Sbjct: 18801 -EIELDADLRKVVVLRASATLR-----LFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSS 18854

Query: 826   LGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
               +  L I +V+  DSG Y    EN  G   +   + V++
Sbjct: 18855 FTM--LVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLD 18892



 Score = 87.0 bits (214), Expect = 7e-17
 Identities = 146/659 (22%), Positives = 230/659 (34%), Gaps = 113/659 (17%)

Query: 258   IDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPAD 317
             +D  DPP  P+ + +  R  V L+W  P   GG  +  Y+VE+R      WLK   +   
Sbjct: 15049 LDPIDPPGKPVPL-NITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNIL 15107

Query: 318   STTFTDAHVEPGRKYTFRVRAVTSEGA-------GEALESEEILVAPE----------AL 360
                FT + +     Y FRV A  + GA        +A+   + + AP+           +
Sbjct: 15108 ENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVI 15167

Query: 361   PKAPSA-----------PAILSASSQGITLTWTAPRGPGSAHILGYLIE----RRKKGSN 405
              KA  A           P  +  S  G  L  TA      A     L+     RR  G+ 
Sbjct: 15168 LKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAY 15227

Query: 406   TWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLV 465
             T TA N     +  + V  + +                  PGPP                
Sbjct: 15228 TLTATNPGGFAKHIFNVKVLDR------------------PGPPEGP------------- 15256

Query: 466   RNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKG 525
               L VT+ ++    LSW  P    G +   Y+V+   +  L W       V VT      
Sbjct: 15257 --LAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNV-ASEVQVTKLKVTK 15313

Query: 526   LRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVC--PKFL-VDSSTKDLLTV----- 577
             L  G  Y  RV AVN+ G  +P   + ++   P      PK   V + TKD + V     
Sbjct: 15314 LLKGNEYIFRVMAVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHP 15373

Query: 578   -KVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYT- 635
                G +  +    E        W+K             K  LT L   V+GL++   Y  
Sbjct: 15374 DSDGGSEIINYIVERRDKAGQRWIK-----------CNKKTLTDLRYKVSGLTEGHEYEF 15422

Query: 636   -VVLRTLQGKEVAHSFRIRVAAC-----PQAPGPIHLQENVPGTVTAEW-EPSPDEAQDV 688
              ++     G            AC     P  PG   + +    +++  W +P  D   ++
Sbjct: 15423 RIMAENAAGISAPSPTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEI 15482

Query: 689   PLHYAVFTRSSAHGPWHEAADR--IHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS 746
                Y V         W        +    +T+ G+    EY  R+ A N  G  +P+   
Sbjct: 15483 T-GYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVP 15541

Query: 747   QPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVT 806
                  P+  DR         E +L    R +V +R+      C   +   ++G P P V 
Sbjct: 15542 GT---PKAEDRMLPP-----EIELDADLRKVVTIRAC-----CTLRLFVPIKGRPAPEVK 15588

Query: 807   WFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
             W ++        ++ ST    +  L + +V+  DSG+Y    EN+ G   +   + V++
Sbjct: 15589 WARDHGESLDKASIESTSSYTL--LIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLD 15645



 Score = 86.3 bits (212), Expect = 1e-16
 Identities = 145/654 (22%), Positives = 246/654 (37%), Gaps = 78/654 (11%)

Query: 258  IDKPDPPQGPMEVQDCHR--AGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAP 315
            +D   PP  P  +    R  + + L W+ PR NGG  ++ Y++E+R+  +  + +V +  
Sbjct: 8984 VDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRL 9043

Query: 316  ADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQ 375
              +T+F   +++  + Y FRV+AV   G  E      +++  + +P  P+    LS    
Sbjct: 9044 CPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVP--PTIKLRLSVRGD 9101

Query: 376  GITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADV-RQGCQYEFR 434
             I +    P     A + G  + + +   N    V ++P    + T  +V R   + E  
Sbjct: 9102 TIKVKAGEPVHI-PADVTGLPMPKIEWSKNE--TVIEKPTDALQITKEEVSRSEAKTELS 9158

Query: 435  VTAVAPSGPGEPGPPSD----AVFAR------DPMRPPGLVRNLQVTDRSNTSITLSWAG 484
            +        G     +     +VF        D   PP   RNL VTD    S  L+W  
Sbjct: 9159 IPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPP---RNLAVTDIKAESCYLTWDA 9215

Query: 485  PDTQEGDEAQGYVVEL--CSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEG 542
            P    G E   YV++    S    +W      T     Y    L P   Y  RV AVN+ 
Sbjct: 9216 PLDNGGSEITHYVIDKRDASRKKAEWEEV-TNTAVEKRYGIWKLIPNGQYEFRVRAVNKY 9274

Query: 543  GQSQPSALDTLVQAMPVTVC-----PKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEV 597
            G S     D +V   P  +      PK L  + TK  + V    +   P+     P+   
Sbjct: 9275 GISDECKSDKVVIQDPYRLPGPPGKPKVL--ARTKGSMLV----SWTPPLDNGGSPITGY 9328

Query: 598  TWLK---DGLPLPKR--SVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEV---AHS 649
             WL+   +G P   R     +TK GL  +   V  L +   Y      +    +   +  
Sbjct: 9329 -WLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEP 9387

Query: 650  FRIRVAACPQ-APGPI---HLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPW- 704
                VA  P   PGP     +++    +++  W+P   +       Y V  +      W 
Sbjct: 9388 SDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWK 9447

Query: 705  --HEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKA 762
              +E    I T    +  +    +Y FRV A NE G S+PSDT             T + 
Sbjct: 9448 RVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDT-------------TGEI 9494

Query: 763  PCYREPDLSQKPRFLVGLRSH---LLPQGCECCMSCAVQGSPRPHVTWFKNDRSL----E 815
            P     D+ ++P   + + +    +   G +  +   ++G P P  +W  + ++     +
Sbjct: 9495 PA---TDIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKD 9551

Query: 816  GNPAVYSTDLLGVCS----LTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
            G   +     L        + IP      +G+Y   A+N  GQ  +   + V++
Sbjct: 9552 GVHDIPEDAQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMD 9605



 Score = 84.7 bits (208), Expect = 3e-16
 Identities = 149/655 (22%), Positives = 232/655 (35%), Gaps = 88/655 (13%)

Query: 250   QAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWL 309
             +A +  + I  P+ P+  +EV++  +  V L W PP+ +GG  +  YV+E R  G   + 
Sbjct: 10401 EALVIREPITVPERPED-LEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFH 10459

Query: 310   KVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAI 369
             KV      S  +T   ++ G  Y +RV AV   G G+     + +   + L    + P +
Sbjct: 10460 KVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDEL----APPTL 10515

Query: 370   LSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGC 429
                    +T+        G A  L      + K   +W       + + R  +       
Sbjct: 10516 HLDFRDKLTIR------VGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATL 10569

Query: 430   QYEFRVTAVAPSGPG----EPGPPSDAVFARDPM--RPPGLVRNLQVTDRSNTSITLSWA 483
               E      + SG      E    S   F +  +  RP   V  +   + +   + +SW 
Sbjct: 10570 ALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWK 10629

Query: 484   GPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGG 543
              P    G +   Y++E        W+P    +   T   +K L  G+ Y  R+ A N  G
Sbjct: 10630 PPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSK-LLEGKDYIFRIHAENLYG 10688

Query: 544   QSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPE-VTWLKD 602
              S P                  LV  S K     +V D    P+  E       VTW K 
Sbjct: 10689 ISDP------------------LVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKP 10730

Query: 603   ---GLPLP-----------KRSVTVTKDGL---TQLLIPVAGLSDSGLYTVVLRTLQGKE 645
                G P+            KR   VTKD +   T+  +P   L +   Y    R     E
Sbjct: 10731 HDGGKPITNYILEKRETMSKRWARVTKDPIHPYTKFRVP--DLLEGCQYE--FRVSAENE 10786

Query: 646   VAHS---------FRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFT 696
             +            F     A P  P      +    +V   W+P   +     L Y V  
Sbjct: 10787 IGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEY 10846

Query: 697   RSSAHGPWHEA---ADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPR 753
             +      W  A    +     ++ + G+  G  Y FRV+A N  G S P+   +P  +  
Sbjct: 10847 QKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLV-- 10904

Query: 754   QRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRS 813
              +DR          P+L          R   +  G    +S  ++G P P VTW K DR 
Sbjct: 10905 -KDRL-------EPPELILDANMA---REQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRD 10953

Query: 814   LEGNPAVYSTDLLGVCS-LTIPSVSPKDSGEYKAVAENTLG-QAVSTATLIVIEP 866
                 P     D+  V S L I + + +D G Y    EN  G + VS   L++ +P
Sbjct: 10954 A---PTKARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKP 11005



 Score = 84.3 bits (207), Expect = 4e-16
 Identities = 179/804 (22%), Positives = 285/804 (35%), Gaps = 104/804 (12%)

Query: 79   LADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQ 138
            L D+E    ++ T  C +        W K+G ++   + V ++ D   H L I       
Sbjct: 6435 LKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPD 6494

Query: 139  AGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAA 198
             G Y   AG  +S A L + ++PT   +  E L +  V +    V     F   L  + A
Sbjct: 6495 EGEYIVTAGQDKSVAELLIIEAPT---EFVEHLEDQTVTEFDDAV-----FSCQLSREKA 6546

Query: 199  ---WRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTL 255
               W ++G E+     ++ + +      RL +      D  +Y+  +  E    +A L +
Sbjct: 6547 NVKWYRNGREI--KEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGV--EDRKSRARLFV 6602

Query: 256  QVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRD---NGGRTVECYVVERRQAGRSTWLKVG 312
            + I        P+E+            RPP+D     G  V       +      WL+  
Sbjct: 6603 EEI--------PVEI-----------IRPPQDILEAPGADVVFLAELNKDKVEVQWLRNN 6643

Query: 313  EAPADSTTFTDAH--VEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAIL 370
                      D H  +  G+ +  ++  +     GE     +   A   L  A +AP I 
Sbjct: 6644 MVVVQG----DKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELA-AAPKIK 6698

Query: 371  SASSQ-----GITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADV 425
            +A        G  LT   P          +  E     + T     D    +  + + + 
Sbjct: 6699 TADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKT----IDTTAEQTSFRILEA 6754

Query: 426  RQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGP 485
            ++G +  +++      G  E             +  PG VRNL+VT+  +  ++L+W  P
Sbjct: 6755 KKGDKGRYKIVLQNKHGKAE------GFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEP 6808

Query: 486  DTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGL-RPGEGYFVRVTAVNEGGQ 544
             T  G +  GYVVE        W+           +T  GL + G  Y  RV+A N  G 
Sbjct: 6809 LTDGGSKIIGYVVERRDIKRKTWV-LATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGT 6867

Query: 545  SQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPE-------- 596
             +P   D      PV    K+ V       L V + D  R  VS    P PE        
Sbjct: 6868 GEPVETDN-----PVEARSKYDVPGPP---LNVTITDVNRFGVSLTWEP-PEYDGGAEIT 6918

Query: 597  --VTWLKDGLPLP-KRSVTVTKDGLTQLLIPVA-GLSDSGLYTVVLRTLQGKEVAHSFRI 652
              V  L+D   +    ++TV  + L+  +  V  G   S       R   GK  A +  +
Sbjct: 6919 NYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFV 6978

Query: 653  RVAACPQAPGP---IHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAAD 709
            +VA   + P P   +   +    +V  +WEP   +     L Y +         W     
Sbjct: 6979 KVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNM 7038

Query: 710  RIHTN-RFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREP 768
            ++     + + G+  G++Y +RV A+N+ G S PS+   P                + EP
Sbjct: 7039 KLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGP----------LTADDAFVEP 7088

Query: 769  --DLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLL 826
              DLS    F  GL   ++P      +     G PRP  TW   D+ LE    V    L 
Sbjct: 7089 TMDLS---AFKDGLEV-IVPNPITILVPST--GYPRPTATWCFGDKVLETGDRVKMKTLS 7142

Query: 827  GVCSLTIPSVSPKDSGEYKAVAEN 850
                L I      D G Y    EN
Sbjct: 7143 AYAELVISPSERSDKGIYTLKLEN 7166



 Score = 84.0 bits (206), Expect = 6e-16
 Identities = 57/214 (26%), Positives = 94/214 (43%), Gaps = 17/214 (7%)

Query: 652   IRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRI 711
             I+VA  PQ PG I + +    +V+  W     +     + Y V  ++     W E A R+
Sbjct: 16820 IKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECA-RV 16878

Query: 712   HTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLS 771
              + +  +  +  G EY FRVVA NE G S P   + P           V      EPD+ 
Sbjct: 16879 KSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVP----------IVAKDLVIEPDV- 16927

Query: 772   QKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSL 831
              KP F     S+ +  G +  +   + G P+P +TW K+   L+    +  TD L + +L
Sbjct: 16928 -KPAF----SSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTL 16982

Query: 832   TIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
             +I      D G+Y     N +GQ  ++  ++ ++
Sbjct: 16983 SIKETHKDDGGQYGITVANVVGQKTASIEIVTLD 17016



 Score = 82.8 bits (203), Expect = 1e-15
 Identities = 142/640 (22%), Positives = 236/640 (36%), Gaps = 77/640 (12%)

Query: 259   DKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADS 318
             D  DPP  P E     R  V L+W+ P  +GG  +  Y+VE+++     W+K        
Sbjct: 16132 DPCDPPGRP-EAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASFTNIID 16190

Query: 319   TTFTDAHVEPGRKYTFRVRAVTSEGA-GEALESEEILVAPEALPKAPSAPAILSASSQGI 377
             T F    +    +Y FRV A  + G   E  ES   + A + +                 
Sbjct: 16191 THFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDP--------------- 16235

Query: 378   TLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVAD--VRQGCQYEFRV 435
                   PR          ++    +       +  +P+P  +W   D  +    + E + 
Sbjct: 16236 ------PRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKS 16289

Query: 436   TAVAPSGPGEPGPPSDA----VFARDPMRPPGLVRNLQVTDRSNT-------------SI 478
             T  A S   +     D+    + A++      +  N++V DR                  
Sbjct: 16290 TDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGVTAEKC 16349

Query: 479   TLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTA 538
             TL+W  P    G +   Y+VE   +  L W         ++    K L  G  Y  R+ A
Sbjct: 16350 TLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTK-LLEGNEYTFRIMA 16408

Query: 539   VNEGGQSQPSALDTLVQAMPVTV--CPKFL-VDSSTKDLLTVKVGDTVRVPVSFEAMPMP 595
             VN+ G  +P   + +V   P  V   PK   V + TKD + V V +        E +   
Sbjct: 16409 VNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIV-VWERPASDGGSEILGYV 16467

Query: 596   EVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYT--VVLRTLQGKEVAHSFRIR 653
                  K+G+    R     K  + +L + V GL ++  Y   V      G          
Sbjct: 16468 LEKRDKEGI----RWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAY 16523

Query: 654   VAACPQA--PGPIHLQENVPGT---VTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEA 707
               AC     PGP +  + +  T   V   W +P  D   ++   Y V     + G W   
Sbjct: 16524 QKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQ-GYIVEKCDVSVGEWTMC 16582

Query: 708   ADRIHTNRFTLL--GILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCY 765
                   N+  +    +L  HEY+FR+ A N+ G  + +D   P  +  +     ++AP  
Sbjct: 16583 TPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEK-----LEAP-- 16635

Query: 766   REPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDL 825
              + DL  + R ++ +R+     G    +   ++G P P V W K D  +     +  T  
Sbjct: 16636 -DIDLDLELRKIINIRA-----GGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTS- 16688

Query: 826   LGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
                 SL + +V+  DSG+Y    EN+ G   +  T+ V++
Sbjct: 16689 -SFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLD 16727



 Score = 70.9 bits (172), Expect = 5e-12
 Identities = 170/833 (20%), Positives = 311/833 (37%), Gaps = 156/833 (18%)

Query: 75   FSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHV 134
            F + + D++V   + A   C ++       W KD  +L   D +  +++  VH L I   
Sbjct: 3014 FRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPST 3073

Query: 135  QGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQ-SHL 193
            + + AG+YT VAG   S A L V+        + ++++   V++  + V   + F+ +  
Sbjct: 3074 RMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQ---VIEKQRAV---VEFEVNED 3127

Query: 194  PIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAEL 253
             + A W KDG E+        +  +     R+ +    + D G+Y+       G  ++ +
Sbjct: 3128 DVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFV----AGRNRSSV 3183

Query: 254  TLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVE-CYVVERRQAGRSTWLKVG 312
            TL V + P+PPQ   E+Q            P     G+    C V+  R   + +W K  
Sbjct: 3184 TLYV-NAPEPPQVLQELQ------------PVTVQSGKPARFCAVISGRPQPKISWYK-- 3228

Query: 313  EAPADSTTFTDAHVEPGRKYTFRV------------------RAVTSEGAGEALESEEIL 354
            E    ST F    +  G++YT  +                    V +  A  ++E  E++
Sbjct: 3229 EEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVV 3288

Query: 355  VAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSN---TWTAVN 411
               + +P  P  PAI++     +T      R            + R  G++   +W + +
Sbjct: 3289 SPDQEMPVYP--PAIITPLQDTVTSEGQPAR-----------FQCRVSGTDLKVSWYSKD 3335

Query: 412  DQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGP----PSDAVFARDPMRPPGLVRN 467
             +  P R + +       Q E     +A + P + G      S+AV          L   
Sbjct: 3336 KKIKPSRFFRMTQFEDTYQLE-----IAEAYPEDEGTYTFVASNAV--GQVSSTANLSLE 3388

Query: 468  LQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLR 527
            +Q  DR +       +G D +E  ++Q       + +  +     + +   ++Y  + ++
Sbjct: 3389 VQALDRQS-------SGKDVRESAKSQAVADSSFTKEESKISQKEIKSFQGSSYEYE-VQ 3440

Query: 528  PGEGYFVRVTAVNEGGQSQPSAL---DTLVQAMPVTVCPKFLVDSSTKDL---------L 575
              E   V  ++++     Q + L    +L Q    T   K     ST +          +
Sbjct: 3441 VFES--VSQSSIHTAASVQDTQLCHTASLSQIAESTELSKECAKESTGEAPKIFLHLQDV 3498

Query: 576  TVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPK-RSVTVTKDGLTQLL-IPVAGLSDSGL 633
            TVK GDT +     +     +VTW  +G  + +   +  +++G  Q L I    L D GL
Sbjct: 3499 TVKCGDTAQFLCVLKDDSFIDVTWTHEGAKIEESERLKQSQNGNIQFLTICNVQLVDQGL 3558

Query: 634  YTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYA 693
            Y+ ++    G+    S  + V   P++     +++ +   +  E+  S   A++  LH A
Sbjct: 3559 YSCIVHNDCGERTT-SAVLSVEGAPESILHERIEQEIEMEM-KEFSSSFLSAEEEGLHSA 3616

Query: 694  VFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPR 753
                                                      EL  SK ++T +      
Sbjct: 3617 ------------------------------------------ELQLSKINETLE------ 3628

Query: 754  QRDRFTVKAPCYREPDLSQK----PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFK 809
                   ++P Y     S+K    P F+  + +  +  G    +S  V G P+P + WF 
Sbjct: 3629 ----LLSESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFF 3684

Query: 810  NDRSLEGNPAVYSTDLLG-VCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATL 861
            N   L  + A Y     G   SL I     +D GEY  +A N  G+ + +A L
Sbjct: 3685 NGVLLTPS-ADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYL 3736



 Score = 67.8 bits (164), Expect = 4e-11
 Identities = 53/214 (24%), Positives = 86/214 (40%), Gaps = 17/214 (7%)

Query: 652   IRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRI 711
             ++V+  P  PG + L +    T T +WE    +       Y V  ++     W     ++
Sbjct: 18985 VKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKW-STCTQV 19043

Query: 712   HTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLS 771
              T   T+ G+  G EY FRV A NE G S P     P  I R               D+ 
Sbjct: 19044 KTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVP-VIAR---------------DIE 19087

Query: 772   QKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSL 831
              KP   +   +  +    +  +    +G P+  V W K+ ++L+    V  +    V SL
Sbjct: 19088 IKPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSL 19147

Query: 832   TIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
             +I   S +D G Y+    N+ G      T+IV++
Sbjct: 19148 SIKEASKEDVGTYELCVSNSAGSITVPITIIVLD 19181



 Score = 61.6 bits (148), Expect = 3e-09
 Identities = 73/304 (24%), Positives = 120/304 (39%), Gaps = 57/304 (18%)

Query: 593  PMPEVTWLKDGLPLP---KRSVTVTKD-GLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAH 648
            P P V W K G+PL    +  V+  K  G  +L+I +    D+G YT+V+R   G+  A 
Sbjct: 1063 PKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSAS 1122

Query: 649  S-------------------FRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVP 689
            +                   ++ +V A  Q P    + E  PG V +E+E   ++ Q   
Sbjct: 1123 ASLLEEADYELLMKSQQEMLYQTQVTAFVQEP---KVGETAPGFVYSEYEKEYEKEQ--A 1177

Query: 690  LHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPW 749
            L      + +     +      H + F    I    E  +R++ K  L      D  +  
Sbjct: 1178 LIRKKMAKDTVVVRTYVEDQEFHISSFEERLI---KEIEYRII-KTTLEELLEEDGEEKM 1233

Query: 750  CIPRQRDRFTVKAPCYREPDLSQKPRFLVG----LRSHLLPQGCECCMSCAVQGSPRPHV 805
             +                 D+S+      G    ++++ + +G      C + G P P +
Sbjct: 1234 AV-----------------DISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKI 1276

Query: 806  TWFKNDRSLEGNPAVYSTDLL--GVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
             W+K+ + ++     Y  D L  G  SL IP V P+D G Y A A N  G A+ +  L V
Sbjct: 1277 AWYKDGKRIKHGER-YQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYV 1335

Query: 864  IEPS 867
             EP+
Sbjct: 1336 -EPA 1338



 Score = 61.6 bits (148), Expect = 3e-09
 Identities = 36/103 (34%), Positives = 54/103 (52%), Gaps = 4/103 (3%)

Query: 769   DLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGV 828
             +LS  P F+   RS  + +G     +C + G P P + WFKN+  +  +  V  +    V
Sbjct: 26824 ELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNV 26883

Query: 829   CSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVI----EPS 867
              SL I + S  DSG+Y   A+N  GQ  +TA+L+V+    EPS
Sbjct: 26884 YSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPS 26926



 Score = 59.7 bits (143), Expect = 1e-08
 Identities = 42/139 (30%), Positives = 66/139 (47%), Gaps = 5/139 (3%)

Query: 79   LADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQ 138
            L D+ V  GE AT  C L+ +  P  W+  G KL   D V+ + +G VH+L +  V+   
Sbjct: 5897 LKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLED 5956

Query: 139  AGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAA 198
            AG     A D ++ A L V++ P    + T+ L E   V+ G   +++    S    +  
Sbjct: 5957 AGEVQLTAKDFKTHANLFVKEPPV---EFTKPL-EDQTVEEGATAVLECEV-SRENAKVK 6011

Query: 199  WRKDGAEVVGSSDREAQVD 217
            W K+G E++ S   E   D
Sbjct: 6012 WFKNGTEILKSKKYEIVAD 6030



 Score = 59.3 bits (142), Expect = 1e-08
 Identities = 53/213 (24%), Positives = 87/213 (40%), Gaps = 17/213 (7%)

Query: 658   PQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAA-DRIHTNRF 716
             P APG   +      +    W+P   +      +Y +  R      W     + I    F
Sbjct: 24520 PGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVF 24579

Query: 717   TLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRF 776
             ++  ++ G EY FRV  +N  G S+ S+ S+P  I  + D   ++AP ++E         
Sbjct: 24580 SVKNLIEGLEYEFRVKCENLGGESEWSEISEP--ITPKSD-VPIQAPHFKEE-------- 24628

Query: 777   LVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLL--GVCSLTIP 834
                LR+  +       + C V G P+P V W++  + +  +   Y       G   L I 
Sbjct: 24629 ---LRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIA 24685

Query: 835   SVSPKDSGEYKAVAENTLGQAVSTATLIVIEPS 867
             SV+  D+  Y+  A N  G    TA+L V  P+
Sbjct: 24686 SVTDDDATVYQVRATNQGGSVSGTASLEVEVPA 24718



 Score = 58.5 bits (140), Expect = 3e-08
 Identities = 53/190 (27%), Positives = 81/190 (42%), Gaps = 12/190 (6%)

Query: 75   FSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHV 134
            F   L D  V+ GE AT  C L+ +     WFK+  KL T   V+   +G  H L +  V
Sbjct: 5271 FMSPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEV 5330

Query: 135  QGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLP 194
                  +      +  S A L V ++    P  T KL +   V+  + + +K      +P
Sbjct: 5331 TLDDISQIKAQVKELSSTAQLKVLEAD---PYFTVKLHDKTAVEKDE-ITLKCEVSKDVP 5386

Query: 195  IQAAWRKDGAEVVGSSDREAQVDLGDGYTR-LCLPSAGRKDCGQYSVTLRSE--GGSVQA 251
            ++  W KDG E+V S     +    DG  R L +  A  KD G+Y     ++    +V  
Sbjct: 5387 VK--WFKDGEEIVPSPKYSIK---ADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTV 5441

Query: 252  ELTLQVIDKP 261
            E  L  ++KP
Sbjct: 5442 EARLIKVEKP 5451



 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 33/94 (35%), Positives = 45/94 (47%)

Query: 770   LSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVC 829
             L   PR  + +RSH +P G        VQ  P   V W+ N   L+ +  ++ T+  GV 
Sbjct: 26065 LDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVL 26124

Query: 830   SLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
             +L I      DSG Y+AV  N  G+A   ATL V
Sbjct: 26125 TLEILDCHTDDSGTYRAVCTNYKGEASDYATLDV 26158



 Score = 55.8 bits (133), Expect = 2e-07
 Identities = 33/95 (34%), Positives = 50/95 (52%), Gaps = 2/95 (2%)

Query: 771 SQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGN--PAVYSTDLLGV 828
           +Q P F   L+S ++ +G        + G P P V+WF++ + +  +  P V  +   G 
Sbjct: 3   TQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR 62

Query: 829 CSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
             LTIP+V+  +SG Y   A N  GQA STA L+V
Sbjct: 63  AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLV 97



 Score = 55.5 bits (132), Expect = 2e-07
 Identities = 55/211 (26%), Positives = 81/211 (38%), Gaps = 14/211 (6%)

Query: 42   IYGERRDATRSSTSRYKPGTGSFSKDAQGPMGHFSQGLADMEVQP----GEAATLSCTLT 97
            I  ERR     S     P    F+   +     F + + D+ +      G +A   C ++
Sbjct: 4779 IEAERRKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIILTESEFVGSSAIFECLVS 4838

Query: 98   SDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVA----GDQQSEA 153
                  TW KDG  +       F  DG    L I  VQ + AG YT V      ++ S A
Sbjct: 4839 PSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTA 4898

Query: 154  TLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDRE 213
             L V++ P       + L E + V  G+P+ +         +   WRKDG  VV    R 
Sbjct: 4899 KLVVEELPV---RFVKTLEEEVTVVKGQPLYLSCELNKERDV--VWRKDGKIVVEKPGRI 4953

Query: 214  AQVDLGDGYTRLCLPSAGRKDCGQYSVTLRS 244
                +G     L +  A   D G Y+VT+ +
Sbjct: 4954 VPGVIG-LMRALTINDADDTDAGTYTVTVEN 4983



 Score = 52.8 bits (125), Expect = 1e-06
 Identities = 80/327 (24%), Positives = 120/327 (36%), Gaps = 46/327 (14%)

Query: 580  GDTVRVPVSFEAMPMPEVTWLKDGLPLPK---RSVTVTKDGLTQLLIPVAGLSDSGLYTV 636
            G T R  +     PMPE  W  DG  +       V + +DG   L+I  A  SDSG +TV
Sbjct: 1425 GQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTV 1484

Query: 637  VLRTLQGKEVAHSFRIRVAACPQAPGPIHLQE----------NVPGTVTAEWEPSPD--- 683
            V +   G+  + S  + V A      P+ +++           +   V A   P+PD   
Sbjct: 1485 VAQNRAGRS-SISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVW 1543

Query: 684  -EAQDVPLHYAVFTRSSAHGPWHEAADRIHTN------RFTLLGILPGHEYHFRVVAKNE 736
             +  D+ + +  + +    G   EAA +I +        +T   I        R     E
Sbjct: 1544 LKNSDIIVPHK-YPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVE 1602

Query: 737  LGASKPSDTSQPWCIPRQRDRFTVKAPCYREP------------------DLSQKPRFLV 778
            +  ++P +  +   IPR   R    A    EP                  +  QKP F  
Sbjct: 1603 VEFAEP-EPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKK 1661

Query: 779  GLRSHLLPQGCECCMSCAVQ--GSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSV 836
             L S  L +       C +   G P   V W  + + LE    +   +  G CSL     
Sbjct: 1662 KLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVA 1721

Query: 837  SPKDSGEYKAVAENTLGQAVSTATLIV 863
              +DSG     A N  G   ++ATLIV
Sbjct: 1722 YSRDSGIITCRATNKYGTDHTSATLIV 1748



 Score = 52.4 bits (124), Expect = 2e-06
 Identities = 35/133 (26%), Positives = 62/133 (46%), Gaps = 7/133 (5%)

Query: 74   HFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITH 133
            H ++ + ++EV   + A+  C ++    P  W K+GV++   +       G +H L I +
Sbjct: 2837 HITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMN 2896

Query: 134  VQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHL 193
                 +  YTFV G+ Q  ATLTV  +P +   +T  L++  +    K  I      ++ 
Sbjct: 2897 TSTEDSAEYTFVCGNDQVSATLTV--TPIM---ITSMLKD--INAEEKDTITFEVTVNYE 2949

Query: 194  PIQAAWRKDGAEV 206
             I   W K+G E+
Sbjct: 2950 GISYKWLKNGVEI 2962



 Score = 51.2 bits (121), Expect = 4e-06
 Identities = 46/171 (26%), Positives = 78/171 (45%), Gaps = 10/171 (5%)

Query: 79   LADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQ 138
            L D+  +  +  T   T+  +     W K+GV++ + D    +   L HSL I +V    
Sbjct: 2929 LKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGD 2988

Query: 139  AGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAA 198
            A  YTFVAG   S ATL V+       +  + +++  V++  + +      +  + +Q  
Sbjct: 2989 AADYTFVAGKATSTATLYVEARHI---EFRKHIKDIKVLEKKRAMFECEVSEPDITVQ-- 3043

Query: 199  WRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSV 249
            W KD  E +  +DR  ++       RL +PS    D G+Y+V     GG+V
Sbjct: 3044 WMKDDQE-LQITDR-IKIQKEKYVHRLLIPSTRMSDAGKYTVV---AGGNV 3089



 Score = 50.1 bits (118), Expect = 9e-06
 Identities = 44/196 (22%), Positives = 84/196 (42%), Gaps = 9/196 (4%)

Query: 69   QGPMGHFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHS 128
            +G +  F + L D+EV    +  L C ++ +   G W+ + V+L +             +
Sbjct: 2217 EGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQN 2276

Query: 129  LFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAG-KPVIVKI 187
            L +  V     G Y+FV   +++   L ++  P     + + L +  V +     + VK+
Sbjct: 2277 LTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIA---ILQGLSDQKVCEGDIVQLEVKV 2333

Query: 188  PFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGG 247
              +S   ++  W KDG E V  SDR   + +      L +    ++D G YS T+ + G 
Sbjct: 2334 SLES---VEGVWMKDGQE-VQPSDR-VHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGL 2388

Query: 248  SVQAELTLQVIDKPDP 263
            S    +++  +D   P
Sbjct: 2389 STSGRVSVYSVDVITP 2404



 Score = 49.3 bits (116), Expect = 2e-05
 Identities = 49/195 (25%), Positives = 75/195 (38%), Gaps = 13/195 (6%)

Query: 75    FSQGLADMEVQPGEAATLSCTLTSDLGPG-TWFKDGVKLTTQDG---VIFKQDGLVHSLF 130
             F+  L +     GE      T+T    P  TW+K G K+   D      F+ D  ++ L 
Sbjct: 25387 FTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLT 25446

Query: 131   ITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKA--------GKP 182
             I  V       YT VA ++  E +   + + T+ P  T+    P+  +         G+ 
Sbjct: 25447 INSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQS 25506

Query: 183   VIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTL 242
             V  +I      P    W KDG  +    + E  +  G  Y  L +     +D G Y VT 
Sbjct: 25507 VCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEI-IHEGLDYYALHIRDTLPEDTGYYRVTA 25565

Query: 243   RSEGGSVQAELTLQV 257
              +  GS   +  LQV
Sbjct: 25566 TNTAGSTSCQAHLQV 25580



 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 28/90 (31%), Positives = 47/90 (52%)

Query: 774 PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTI 833
           P F+  L+S  + QG +  +   V G P P V ++++   ++ +     +    + SL I
Sbjct: 104 PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLI 163

Query: 834 PSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
               P+DSG Y   A N++G+A STA L+V
Sbjct: 164 AEAYPEDSGTYSVNATNSVGRATSTAELLV 193



 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 1/94 (1%)

Query: 774 PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTI 833
           P  + GL++  + +G    + C + G P P VTW++ D  +E +     T   G+  L I
Sbjct: 897 PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMI 956

Query: 834 PSVSPKDSGEYKAVAENTLGQAVSTATLIVIEPS 867
                +DSG +   A N  G  VST+  + ++ S
Sbjct: 957 REAFAEDSGRFTCSAVNEAG-TVSTSCYLAVQVS 989



 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 46/166 (27%), Positives = 73/166 (43%), Gaps = 9/166 (5%)

Query: 75   FSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHV 134
            F   L D+  +  E+A  +  L+ D     WFK+  +L T   V  + +G  HS+    +
Sbjct: 5626 FLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDL 5685

Query: 135  QGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLP 194
                  +    A    SEA LTV +     P  T KL++   V+  + ++     ++  P
Sbjct: 5686 SIDDTSQIRVEAMGMSSEAKLTVLEGD---PYFTGKLQDYTGVEKDEVILQCEISKADAP 5742

Query: 195  IQAAWRKDGAEVVGSSDREAQVDLGDGYTR-LCLPSAGRKDCGQYS 239
            ++  W KDG E+  S +    V   DG  R L L  A + D GQY+
Sbjct: 5743 VK--WFKDGKEIKPSKN---AVIKADGKKRMLILKKALKSDIGQYT 5783



 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 51/215 (23%), Positives = 93/215 (43%), Gaps = 27/215 (12%)

Query: 658   PQAPGPIHLQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTN-- 714
             P  P    + +    +++  W +P  D   D+ + Y +  +      W+    R+HTN  
Sbjct: 23037 PGPPSAPRVVDTTKHSISLAWTKPMYDGGTDI-VGYVLEMQEKDTDQWY----RVHTNAT 23091

Query: 715   ----RFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDL 770
                  FT+  +  G +Y FRV A N  G S+ S++      P +R    ++ P   + +L
Sbjct: 23092 IRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAE-IEPVER----IEIP---DLEL 23143

Query: 771   SQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCS 830
             +   +  V +R+     G    +  +V G P P +TW K    L     + +T+   +  
Sbjct: 23144 ADDLKKTVTIRA-----GASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSL-- 23196

Query: 831   LTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
             L +  V+  D+G+Y   AEN  G+  +T  + V +
Sbjct: 23197 LIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYD 23231



 Score = 48.1 bits (113), Expect = 3e-05
 Identities = 61/279 (21%), Positives = 101/279 (36%), Gaps = 54/279 (19%)

Query: 593  PMPEVTWLKDGLPLP---KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHS 649
            P+P++ W KDG  +    +  +   +DG   L IPV    D G+YT     ++G  +  S
Sbjct: 1272 PLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAIC-S 1330

Query: 650  FRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAAD 709
             ++ V        P ++    P +      P                RS +  P   +  
Sbjct: 1331 GKLYVEPAAPLGAPTYIPTLEPVSRIRSLSP----------------RSVSRSPIRMSPA 1374

Query: 710  RIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPD 769
            R+   R +                        P+  S     P +R   T ++   R   
Sbjct: 1375 RMSPARMS------------------------PARMSPARMSPGRRLEETDESQLER--- 1407

Query: 770  LSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGN---PAVYSTDLL 826
               KP F++   S    +G        V G P P   WF + + +  +     V   D  
Sbjct: 1408 -LYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKED-- 1464

Query: 827  GVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
            G  SL I   +P DSGE+  VA+N  G++ S + ++ +E
Sbjct: 1465 GTQSLIIVPATPSDSGEWTVVAQNRAGRS-SISVILTVE 1502



 Score = 47.0 bits (110), Expect = 8e-05
 Identities = 33/98 (33%), Positives = 45/98 (45%), Gaps = 5/98 (5%)

Query: 774  PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDL---LGVCS 830
            P FL  L+     QG        V G P P VTWFK ++ L    +VY T +    G  +
Sbjct: 3767 PHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQL--CTSVYYTIIHNPNGSGT 3824

Query: 831  LTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIEPST 868
              +     +DSG Y   AEN LG++   A L+V+   T
Sbjct: 3825 FIVNDPQREDSGLYICKAENMLGESTCAAELLVLLEDT 3862



 Score = 46.2 bits (108), Expect = 1e-04
 Identities = 63/289 (21%), Positives = 96/289 (33%), Gaps = 25/289 (8%)

Query: 577   VKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVT--VTKDGLTQLLIPVAGLSDSGLY 634
             V  G   R  ++ ++ P  EV W  +G+ L + S        G+  L I      DSG Y
Sbjct: 26080 VPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTY 26139

Query: 635   TVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAV 694
               V    +G+   ++                  E VP +V  E   +  EA  V   +  
Sbjct: 26140 RAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRT--EAYAVS-SFKK 26196

Query: 695   FTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQ 754
              +   A     E   ++   R +L           +  A  E    + S T         
Sbjct: 26197 TSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTT--------- 26247

Query: 755   RDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSL 814
                        R+   +   R L   RS  + +G     SC   G P P VTW +  + L
Sbjct: 26248 -----------RKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVL 26296

Query: 815   EGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
               +     T      +  I SV   D G Y  V EN+ G+  +  TL +
Sbjct: 26297 STSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTI 26345



 Score = 45.4 bits (106), Expect = 2e-04
 Identities = 46/187 (24%), Positives = 71/187 (37%), Gaps = 13/187 (6%)

Query: 24   EPPGHLGSRRSGKDGRL---DIYGERRDATRSSTSRYKPGTGSFSKDAQGPMGHFSQGLA 80
            EP   +  R  GK   L   D+  E     + +   +K     F K+   P   F++ L 
Sbjct: 5931 EPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKE---PPVEFTKPLE 5987

Query: 81   DMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAG 140
            D  V+ G  A L C ++ +     WFK+G ++          DG V  L I         
Sbjct: 5988 DQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIK 6047

Query: 141  RYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQ-SHLPIQAAW 199
             YT  A D ++   L V       P   E LR    ++  +  + +   + S    +  W
Sbjct: 6048 TYTCDAKDFKTSCNLNV------VPPHVEFLRPLTDLQVREKEMARFECELSRENAKVKW 6101

Query: 200  RKDGAEV 206
             KDGAE+
Sbjct: 6102 FKDGAEI 6108



 Score = 45.1 bits (105), Expect = 3e-04
 Identities = 48/216 (22%), Positives = 77/216 (35%), Gaps = 32/216 (14%)

Query: 658   PQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADR------I 711
             P  P  + + E    + T  W P   +       Y    R        + ADR      +
Sbjct: 12494 PDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREE-----EQPADRWTEYSVV 12548

Query: 712   HTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLS 771
                   + G+  G +Y FRV A+N +G S P +                    Y   +  
Sbjct: 12549 KDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAE----------------GVYEAKEQL 12592

Query: 772   QKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSL--EGNPAVYSTDLLGVC 829
               P+ L+      +  G +  +   V G P P   W K +  +    + AV+  D   + 
Sbjct: 12593 LPPKILMP-EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSI- 12650

Query: 830   SLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
              L I  V+ KDSG Y   AEN+ G       ++V++
Sbjct: 12651 -LIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMD 12685



 Score = 44.7 bits (104), Expect = 4e-04
 Identities = 52/219 (23%), Positives = 94/219 (42%), Gaps = 17/219 (7%)

Query: 162 TIAPDVTEKLREPLVVKAGKPVIVKIPFQSHL---PI-QAAWRKDGAEVVGSSDREAQVD 217
           T AP  T+ L+  +V++          F++H+   P+ + +W +DG  +  S+    Q+ 
Sbjct: 3   TQAPTFTQPLQSVVVLEGSTAT-----FEAHISGFPVPEVSWFRDGQVISTSTLPGVQIS 57

Query: 218 LGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPD--PPQGPMEVQDCH- 274
             DG  +L +P+  + + G+YS  L++  GS QA  T +++ K +  PP     +Q    
Sbjct: 58  FSDGRAKLTIPAVTKANSGRYS--LKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTV 115

Query: 275 RAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTF 334
           R G  +R +         V  +  +  +   S   ++ +   D  +   A   P    T+
Sbjct: 116 RQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQ-EGDLYSLLIAEAYPEDSGTY 174

Query: 335 RVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSAS 373
            V A  S   G A  + E+LV  E    A     I+S +
Sbjct: 175 SVNATNS--VGRATSTAELLVQGEEEVPAKKTKTIVSTA 211



 Score = 44.7 bits (104), Expect = 4e-04
 Identities = 48/201 (23%), Positives = 76/201 (37%), Gaps = 24/201 (11%)

Query: 71   PMGHFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLF 130
            P   F + L D++V+  E A   C L+ +     WFKDG ++           G V  L 
Sbjct: 6067 PHVEFLRPLTDLQVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILV 6126

Query: 131  ITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAP------DVTEKLREPLVVKAGKPVI 184
            I          Y+      ++   LTV +   +        +V+E     LV +  KP  
Sbjct: 6127 INKCLLDDEAEYSCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKP-- 6184

Query: 185  VKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTR-LCLPSAGRKDCGQYSVTL- 242
                       +  W K   E++ +   E    L +G  R L + +A  +D G Y+  L 
Sbjct: 6185 ---------GAEVIWYKGDEEIIETGRYEI---LTEGRKRILVIQNAHLEDAGNYNCRLP 6232

Query: 243  --RSEGGSVQAELTLQVIDKP 261
              R++G     EL  + I KP
Sbjct: 6233 SSRTDGKVKVHELAAEFISKP 6253



 Score = 44.3 bits (103), Expect = 5e-04
 Identities = 44/191 (23%), Positives = 77/191 (40%), Gaps = 11/191 (5%)

Query: 73   GHFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFIT 132
            G  S+ L D  V   + A   C + +    G W +DG  L   + +  + DG    L I 
Sbjct: 2574 GAISKPLTDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIA 2633

Query: 133  HVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVI-VKIPFQS 191
              +    G YT+     ++ A L V+     A  + + L+   V +    V  V++   +
Sbjct: 2634 ATKLDDIGEYTYKVATSKTSAKLKVE-----AVKIKKTLKNLTVTETQDAVFTVELTHPN 2688

Query: 192  HLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQA 251
               +Q  W K+G  VV  S+ +  + +      L + +    D   Y   L   G S + 
Sbjct: 2689 VKGVQ--WIKNG--VVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARL 2744

Query: 252  EL-TLQVIDKP 261
             + T+++I KP
Sbjct: 2745 HVETVKIIKKP 2755



 Score = 44.3 bits (103), Expect = 5e-04
 Identities = 74/306 (24%), Positives = 122/306 (39%), Gaps = 47/306 (15%)

Query: 572  KDLLTVKVGDTVRVPVSFEAMPMPEVT--WLKDG--LPLPKRSVTVTKDGLTQLLIPVAG 627
            K +  +KV +  R     E    P++T  W+KD   L +  R     +  + +LLIP   
Sbjct: 3016 KHIKDIKVLEKKRAMFECEVSE-PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTR 3074

Query: 628  LSDSGLYTVVL--RTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEA 685
            +SD+G YTVV        K       +R+ +  +    I  Q  V      E+E + D  
Sbjct: 3075 MSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAV-----VEFEVNED-- 3127

Query: 686  QDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHF-RVVAKNELGASKPSD 744
             DV  H            W++  D I  N      +   H+Y   R + +  +  ++ SD
Sbjct: 3128 -DVDAH------------WYK--DGIEIN----FQVQERHKYVVERRIHRMFISETRQSD 3168

Query: 745  TSQ-PWCIPRQRDRFT--VKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSP 801
              +  +   R R   T  V AP        + P+ L  L+   +  G        + G P
Sbjct: 3169 AGEYTFVAGRNRSSVTLYVNAP--------EPPQVLQELQPVTVQSGKPARFCAVISGRP 3220

Query: 802  RPHVTWFKNDRSLE-GNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTAT 860
            +P ++W+K ++ L  G    +  D      L I +  P+D+  Y   A+N  G A ++A+
Sbjct: 3221 QPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAF-PEDAAVYTCEAKNDYGVATTSAS 3279

Query: 861  LIVIEP 866
            L V  P
Sbjct: 3280 LSVEVP 3285



 Score = 44.3 bits (103), Expect = 5e-04
 Identities = 30/97 (30%), Positives = 44/97 (45%), Gaps = 3/97 (3%)

Query: 770   LSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLE--GNPAVYSTDL-L 826
             L + P F + L +     G        +   P PHVTW+K+ + ++   N   Y+ +   
Sbjct: 25381 LERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDK 25440

Query: 827   GVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
             G+  LTI SV+  D  EY  VA N  G+    A L V
Sbjct: 25441 GLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 25477



 Score = 43.9 bits (102), Expect = 6e-04
 Identities = 28/95 (29%), Positives = 42/95 (44%), Gaps = 5/95 (5%)

Query: 772  QKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVY---STDLLGV 828
            + P+    ++S  + QG +      V G P P   W+KN   +E +  +Y     D   V
Sbjct: 2030 EAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPED--NV 2087

Query: 829  CSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
            C L I  V+ +DS      A N  G+  S A L+V
Sbjct: 2088 CELVIRDVTAEDSASIMVKAINIAGETSSHAFLLV 2122



 Score = 43.5 bits (101), Expect = 8e-04
 Identities = 28/91 (30%), Positives = 39/91 (42%), Gaps = 2/91 (2%)

Query: 774  PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEG--NPAVYSTDLLGVCSL 831
            P F+       L +G      C V G+P+PHV W K+   L       V      G C L
Sbjct: 1036 PYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKL 1095

Query: 832  TIPSVSPKDSGEYKAVAENTLGQAVSTATLI 862
             I      D+GEY  V  N  G+  ++A+L+
Sbjct: 1096 VISMTFADDAGEYTIVVRNKHGETSASASLL 1126



 Score = 42.0 bits (97), Expect = 0.002
 Identities = 81/402 (20%), Positives = 144/402 (35%), Gaps = 33/402 (8%)

Query: 477   SITLSWAGPDTQEGDEAQGYVVELCSS-DSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVR 535
             S  +SW  P    G     YVVE C + +  +W       + VTT     L    GY+ R
Sbjct: 24434 SAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVS-SAISVTTCRIVNLTENAGYYFR 24492

Query: 536   VTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRV---PVSFEAM 592
             V+A N  G S P  + ++V    +   P     +  K  +T    D+  V   P + +  
Sbjct: 24493 VSAQNTFGISDPLEVSSVV----IIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGG 24548

Query: 593   PMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRI 652
                   +L+       + ++VT + + + +  V  L +   Y   ++       +    I
Sbjct: 24549 AKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEI 24608

Query: 653   RVAACPQAPGPI---HLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAAD 709
                  P++  PI   H +E +   +   ++ +      V  H     +      W+    
Sbjct: 24609 SEPITPKSDVPIQAPHFKEELRN-LNVRYQSNATLVCKVTGHPKPIVK------WYRQGK 24661

Query: 710   RIHTN--RFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYRE 767
              I  +  ++ +     G  YH  ++A      S   D +  + +       +V      E
Sbjct: 24662 EIIADGLKYRIQEFKGG--YHQLIIA------SVTDDDATVYQVRATNQGGSVSGTASLE 24713

Query: 768   PDLSQK---PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTD 824
              ++  K   P+ L G+ +    +G    +     G P P +TW K    ++ N       
Sbjct: 24714 VEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIV 24773

Query: 825   LLGVCSLTIPS-VSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
                  SL  P+ V  KD+G Y   A+N  G    T  L V +
Sbjct: 24774 TRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVAD 24815



 Score = 41.6 bits (96), Expect = 0.003
 Identities = 21/86 (24%), Positives = 36/86 (41%)

Query: 74   HFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITH 133
            +F+  L D      +   L C ++    P  WFKDG ++      + K DG    L +  
Sbjct: 5714 YFTGKLQDYTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKK 5773

Query: 134  VQGTQAGRYTFVAGDQQSEATLTVQD 159
               +  G+YT   G  ++   L ++D
Sbjct: 5774 ALKSDIGQYTCDCGTDKTSGKLDIED 5799



 Score = 41.6 bits (96), Expect = 0.003
 Identities = 69/281 (24%), Positives = 108/281 (38%), Gaps = 72/281 (25%)

Query: 575   LTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPL---PKRSVTVTKDGLTQLLIPVAGLSDS 631
             +TV  G++ R     +  P+P VTWL+ G  L    +  VT TK   T  +  V   SD 
Sbjct: 26265 MTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQA-SDE 26323

Query: 632   GLYTVVLRTLQGKEVAH-SFRIRVAACPQ--APGPIHLQENVPGTVTAEWEPSPDEAQDV 688
             G Y+VV+   +GK+ A  +  I+ A   +     P  ++   P   + E   SP   +  
Sbjct: 26324 GNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSP 26383

Query: 689   PLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
                                               P H    + V+  E   +KP+ T + 
Sbjct: 26384 E---------------------------------PSHP---KAVSPTE---TKPTPTEKV 26404

Query: 749   WCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGS--PRPHVT 806
               +P       V AP    P ++Q   FL    S  + +     ++C V+ S      VT
Sbjct: 26405 QHLP-------VSAP----PKITQ---FLKAEASKEIAK-----LTCVVESSVLRAKEVT 26445

Query: 807   WFKNDRSLEGNPAV---YSTDLLGVCSLTIPSVSPKDSGEY 844
             W+K+ + L+ N      YS D  G   L I +++  D GEY
Sbjct: 26446 WYKDGKKLKENGHFQFHYSAD--GTYELKINNLTESDQGEY 26484



 Score = 40.8 bits (94), Expect = 0.005
 Identities = 31/117 (26%), Positives = 48/117 (41%), Gaps = 6/117 (5%)

Query: 77   QGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQG 136
            QGL+D +V  G+   L   ++ +   G W KDG ++   D V    D   H L I  +  
Sbjct: 2314 QGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTK 2373

Query: 137  TQAGRYTFV--AGDQQSEATLTVQDSPTIAP----DVTEKLREPLVVKAGKPVIVKI 187
              AG Y+F   A    +   ++V     I P    +V E  +  L  K   P +  +
Sbjct: 2374 EDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSV 2430



 Score = 40.8 bits (94), Expect = 0.005
 Identities = 36/178 (20%), Positives = 73/178 (41%), Gaps = 11/178 (6%)

Query: 81   DMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAG 140
            D+            +++ D  P  WF   V++   D      +  VH L + ++  + AG
Sbjct: 2757 DVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAG 2816

Query: 141  RYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWR 200
             YT V G  + +A L V+        +T+ ++  + V   K    +    SH  + + W 
Sbjct: 2817 EYTAVVGQLECKAKLFVE-----TLHITKTMKN-IEVPETKTASFECEV-SHFNVPSMWL 2869

Query: 201  KDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVI 258
            K+G E+      + ++ +     +L + +   +D  +Y+    ++   V A LT+  I
Sbjct: 2870 KNGVEI--EMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGND--QVSATLTVTPI 2923



 Score = 40.8 bits (94), Expect = 0.005
 Identities = 31/97 (31%), Positives = 45/97 (46%), Gaps = 3/97 (3%)

Query: 53   STSRYKPGTGSFSKDAQGPMGHFSQGLADMEVQPGEAATLSCTLTSDLGPGT-WFKDGVK 111
            S S   P      K+  GP+  F + +++ ++  G+ ATLS T+     P   WF +GV 
Sbjct: 3631 SESPVYPTKFDSEKEGTGPI--FIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVL 3688

Query: 112  LTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGD 148
            LT      F  DG  HSL I   +    G YT +A +
Sbjct: 3689 LTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASN 3725



 Score = 40.4 bits (93), Expect = 0.007
 Identities = 26/75 (34%), Positives = 33/75 (44%), Gaps = 5/75 (6%)

Query: 576   TVKVGDTVRVPVSFEAMPMPEVTWLKDGLPL-----PKRSVTVTKDGLTQLLIPVAGLSD 630
             T  VG+ VR  V+    P P VTW K G  +      K+    +  GL QL I      D
Sbjct: 25395 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDD 25454

Query: 631   SGLYTVVLRTLQGKE 645
                YTVV R   G++
Sbjct: 25455 DAEYTVVARNKYGED 25469



 Score = 39.7 bits (91), Expect = 0.012
 Identities = 27/102 (26%), Positives = 48/102 (47%), Gaps = 5/102 (4%)

Query: 65   SKDAQGPMGHFSQGLADMEVQPGEAATLSCTLTSD-LGPGTWFKDGVKLTTQDGVIFKQD 123
            +K++ G        L D+ V+ G+ A   C L  D     TW  +G K+   + +   Q+
Sbjct: 3481 AKESTGEAPKIFLHLQDVTVKCGDTAQFLCVLKDDSFIDVTWTHEGAKIEESERLKQSQN 3540

Query: 124  GLVHSLFITHVQGTQAGRYTFV----AGDQQSEATLTVQDSP 161
            G +  L I +VQ    G Y+ +     G++ + A L+V+ +P
Sbjct: 3541 GNIQFLTICNVQLVDQGLYSCIVHNDCGERTTSAVLSVEGAP 3582



 Score = 39.3 bits (90), Expect = 0.016
 Identities = 23/73 (31%), Positives = 29/73 (39%)

Query: 794  SCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLG 853
            +C +Q +P     WFK  R +  +          + SL I      D GEY   A N  G
Sbjct: 4549 TCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYG 4608

Query: 854  QAVSTATLIVIEP 866
                TATL V  P
Sbjct: 4609 SVSCTATLTVTVP 4621



 Score = 38.9 bits (89), Expect = 0.021
 Identities = 58/212 (27%), Positives = 86/212 (40%), Gaps = 18/212 (8%)

Query: 53   STSRYKPGTGSFSKDAQGPMGHFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKL 112
            +T + +   G   K+  GPM H    L D   + G+   L+ ++T+      +F++  KL
Sbjct: 4418 ATVKIQEAEGGLIKE-DGPMIHTP--LVDTVSEEGDIVHLTTSITNAKEVNWYFEN--KL 4472

Query: 113  TTQDGVIFK--QDGLVHSLFITHVQGTQ-AGRYTFVA----GDQQSEATLTVQDSPTIAP 165
               D   FK  QD   ++L I  V      G Y   A    G   + A LTV      AP
Sbjct: 4473 VPSDEK-FKCLQDQNTYTLVIDKVNTEDHQGEYVCEALNDSGKTATSAKLTVVKRA--AP 4529

Query: 166  DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
             +  K+ EPL V  G         QS   ++  W K G E+  S   +  +      + L
Sbjct: 4530 VIKRKI-EPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESD--KCSIRSSKYISSL 4586

Query: 226  CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQV 257
             +      DCG+Y+    +E GSV    TL V
Sbjct: 4587 EILRTQVVDCGEYTCKASNEYGSVSCTATLTV 4618



 Score = 38.9 bits (89), Expect = 0.021
 Identities = 28/96 (29%), Positives = 41/96 (42%), Gaps = 1/96 (1%)

Query: 769   DLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAV-YSTDLLG 827
             D + +P F   L +    +G   C    V G P P + W K+ + L   P +    + L 
Sbjct: 25485 DSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLD 25544

Query: 828   VCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
               +L I    P+D+G Y+  A NT G     A L V
Sbjct: 25545 YYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 25580



 Score = 38.1 bits (87), Expect = 0.036
 Identities = 27/103 (26%), Positives = 42/103 (40%), Gaps = 4/103 (3%)

Query: 761   KAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAV 820
             KAP   EP +S KP  + GL+   +        +    G PRP   W K+ +++      
Sbjct: 26538 KAP---EP-ISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKY 26593

Query: 821   YSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
               ++  G   L I      DSG Y    +N+ G   S+  L +
Sbjct: 26594 KLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTI 26636



 Score = 37.0 bits (84), Expect = 0.079
 Identities = 26/85 (30%), Positives = 36/85 (42%)

Query: 79   LADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQ 138
            L  +EV  GE A     L+     G W   G  LT        +DG  H L + + Q   
Sbjct: 5452 LYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGM 5511

Query: 139  AGRYTFVAGDQQSEATLTVQDSPTI 163
             G  +F A + +S A L V++ P I
Sbjct: 5512 TGEVSFQAANAKSAANLKVKELPLI 5536



 Score = 37.0 bits (84), Expect = 0.079
 Identities = 27/106 (25%), Positives = 44/106 (41%), Gaps = 4/106 (3%)

Query: 75   FSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHV 134
            F   L+D++V   + A   C ++ +     W K   ++T  D     +DG  HS+ I   
Sbjct: 5537 FITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSA 5596

Query: 135  QGTQAGRYTFVAGDQQSEATLTVQDSP----TIAPDVTEKLREPLV 176
                  +Y F A D+ +   L ++       T   DVT K +E  V
Sbjct: 5597 AFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAV 5642



 Score = 37.0 bits (84), Expect = 0.079
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 2/70 (2%)

Query: 577   VKVGDTVRVPVSFEAMPMPEVTWLKDGLPLP-KRSVTVTKD-GLTQLLIPVAGLSDSGLY 634
             +  G  V         P PE+ W K+ LP+    +V++++   +  L I  A +SDSG Y
Sbjct: 26840 INEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKY 26899

Query: 635   TVVLRTLQGK 644
             T+  +  +G+
Sbjct: 26900 TIKAKNFRGQ 26909



 Score = 36.6 bits (83), Expect = 0.10
 Identities = 33/101 (32%), Positives = 51/101 (50%), Gaps = 8/101 (7%)

Query: 538 AVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEV 597
           A N  GQ+  +A + LV+A   T  P F+    +   +TV+ G  VR+ V    +P P V
Sbjct: 82  ATNGSGQATSTA-ELLVKAE--TAPPNFVQRLQS---MTVRQGSQVRLQVRVTGIPTPVV 135

Query: 598 TWLKDGLPLPKR-SVTVTKDG-LTQLLIPVAGLSDSGLYTV 636
            + +DG  +       ++++G L  LLI  A   DSG Y+V
Sbjct: 136 KFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSV 176



 Score = 36.6 bits (83), Expect = 0.10
 Identities = 23/98 (23%), Positives = 47/98 (47%), Gaps = 3/98 (3%)

Query: 84    VQPGEAATLSCTLTSDLGPGT-WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRY 142
             +  G+    +C ++ +  P   WFK+ + ++    V   +   V+SL I +   + +G+Y
Sbjct: 26840 INEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKY 26899

Query: 143   TFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAG 180
             T  A + + + + T   S  + P V E  RE ++  +G
Sbjct: 26900 TIKAKNFRGQCSATA--SLMVLPLVEEPSREVVLRTSG 26935



 Score = 35.8 bits (81), Expect = 0.18
 Identities = 35/147 (23%), Positives = 58/147 (39%), Gaps = 16/147 (10%)

Query: 720   GILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVG 779
             G+  G  Y FRV A+N +G   P  T     IP +     V       P +    + + G
Sbjct: 11166 GLQQGKTYRFRVKAENIVGLGLPDTT-----IPIECQEKLVP------PSVELDVKLIEG 11214

Query: 780   LRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCS-LTIPSVSP 838
             L   ++  G        ++G P P   W  +   ++ +   Y+ +     S LTI +   
Sbjct: 11215 L---VVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEH-YTVETDNFSSVLTIKNCLR 11270

Query: 839   KDSGEYKAVAENTLGQAVSTATLIVIE 865
             +D+GEY+    N  G       L V++
Sbjct: 11271 RDTGEYQITVSNAAGSKTVAVHLTVLD 11297



 Score = 35.0 bits (79), Expect = 0.30
 Identities = 66/318 (20%), Positives = 113/318 (35%), Gaps = 41/318 (12%)

Query: 541  EGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWL 600
            EG  + P+     ++  P    PK      ++   TV  G      V     P PE  W 
Sbjct: 2010 EGKITIPTFKPDKIELSPSMEAPKIFERIQSQ---TVGQGSDAHFRVRVVGKPDPECEWY 2066

Query: 601  KDGLPLPKRSVTV----TKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAA 656
            K+G+ + +RS  +     +D + +L+I      DS    V    + G+  +H+F +    
Sbjct: 2067 KNGVKI-ERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLL---- 2121

Query: 657  CPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSS-AHGPWHEAADRIHTNR 715
                     +Q     T T E +    + +D    +   T        W++    +H   
Sbjct: 2122 ---------VQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHE-- 2170

Query: 716  FTLLGILPGHEYHFRVVAKNELGASKPSDTSQPW---CIPRQRDRFTVKAPCYREPDLSQ 772
                    G +Y      K    +    DTS      C+  + +     A    E  + +
Sbjct: 2171 --------GDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVE 2222

Query: 773  KPRFLVGLRSHLLPQGCECCMSCAVQGSPRP-HVTWFKNDRSLEGNPAVYSTDLLGVCSL 831
               F+  L+   +P+     + C V  SP      W+ ND  L+ N     T   G  +L
Sbjct: 2223 ---FVKELQDIEVPESYSGELECIV--SPENIEGKWYHNDVELKSNGKYTITSRRGRQNL 2277

Query: 832  TIPSVSPKDSGEYKAVAE 849
            T+  V+ +D GEY  V +
Sbjct: 2278 TVKDVTKEDQGEYSFVID 2295



 Score = 34.7 bits (78), Expect = 0.39
 Identities = 47/225 (20%), Positives = 81/225 (36%), Gaps = 48/225 (21%)

Query: 78   GLADMEVQPGEAATLSCTLTSDLGPG-TWFKDGVKLTTQ-DGVIFKQDGLVHSLFITHVQ 135
            GL ++ V  GE+ TL C ++    P  TW+++  ++ +  D  I  Q G+   L I    
Sbjct: 902  GLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIAR-LMIREAF 960

Query: 136  GTQAGRYTF----VAGDQQSEATLTVQDSPTIAPD---VTEK------------------ 170
               +GR+T      AG   +   L VQ S     +   VTEK                  
Sbjct: 961  AEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTD 1020

Query: 171  ------------------LREPLVVK--AGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSS 210
                              + +P+V K   G  V+       +      W+K G  +    
Sbjct: 1021 TSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGY 1080

Query: 211  DREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTL 255
              +   +   G  +L +      D G+Y++ +R++ G   A  +L
Sbjct: 1081 RYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1125



 Score = 34.7 bits (78), Expect = 0.39
 Identities = 47/213 (22%), Positives = 81/213 (38%), Gaps = 19/213 (8%)

Query: 79   LADMEVQPGEAATLSCTLT-SDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGT 137
            L D+ V  G  A L C ++  D+    W+ +  ++   D V     G    L I     +
Sbjct: 2405 LKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHAS 2464

Query: 138  QAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQA 197
              G Y  + G  ++   L+V+    I       LR+ L     + V+ ++   SH  I  
Sbjct: 2465 DEGPYKLIVGRVETNCNLSVEKIKII-----RGLRD-LTCTETQNVVFEVEL-SHSGIDV 2517

Query: 198  AWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQY---------SVTLRSEGGS 248
             W     E+  SS  + +++      +L + +  + D G+Y         S  L   GG+
Sbjct: 2518 LWNFKDKEIKPSS--KYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGA 2575

Query: 249  VQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLR 281
            +   LT Q + +        EV +    G  LR
Sbjct: 2576 ISKPLTDQTVAESQEAVFECEVANPDSKGEWLR 2608



 Score = 34.7 bits (78), Expect = 0.39
 Identities = 27/104 (25%), Positives = 44/104 (42%), Gaps = 6/104 (5%)

Query: 82   MEVQPGEAATLSCTLTSDLGPGT---WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQ 138
            +EV  G  A  +C + S   P     WFK G ++   D    +    + SL I   Q   
Sbjct: 4538 LEVALGHLAKFTCEIQS--APNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVD 4595

Query: 139  AGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKP 182
             G YT  A ++    + T   + T+ P   +K+R+ L  +  +P
Sbjct: 4596 CGEYTCKASNEYGSVSCTATLTVTV-PGGEKKVRKLLPERKPEP 4638



 Score = 34.7 bits (78), Expect = 0.39
 Identities = 55/236 (23%), Positives = 86/236 (36%), Gaps = 29/236 (12%)

Query: 79   LADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQ 138
            L  +EV   E A     ++ D     W   G  L        K++G +HSL + + +  Q
Sbjct: 5808 LHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQ 5867

Query: 139  AGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLR--EPLVVKAGKPVIVKIPFQSHLPIQ 196
             G   F A + +S A L V+      P V   LR  + + V AG+         S+  I 
Sbjct: 5868 TGGVDFQAANVKSSAHLRVK------PRVIGLLRPLKDVTVTAGETATFDCEL-SYEDIP 5920

Query: 197  AAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQ 256
              W   G + +  SD+      G  +T L L     +D G+  +T +      +    L 
Sbjct: 5921 VEWYLKGKK-LEPSDKVVPRSEGKVHT-LTLRDVKLEDAGEVQLTAK----DFKTHANLF 5974

Query: 257  VIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVG 312
            V + P     P+E Q        +            +EC V   R+  +  W K G
Sbjct: 5975 VKEPPVEFTKPLEDQTVEEGATAV------------LECEV--SRENAKVKWFKNG 6016



 Score = 34.7 bits (78), Expect = 0.39
 Identities = 52/213 (24%), Positives = 82/213 (38%), Gaps = 36/213 (16%)

Query: 648   HSFRIRVAACPQAPGPIHLQENVPGTVTAEWE-PSPDEAQDVP-LHYAVFTRSSAHGPWH 705
             H FRI     P  PG   +       ++  W+ P  D   +V   H     R+S    W 
Sbjct: 21447 HQFRI-----PGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSIL--WQ 21499

Query: 706   EA-ADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPC 764
             +     I    +   G++ G +Y FRV A+N  G S PSD S          +FT+    
Sbjct: 21500 KVNTSPISGREYRATGLVEGLDYQFRVYAENSAGLSSPSDPS----------KFTLAVSP 21549

Query: 765   Y---REPDLSQKPRFLVGLR-SHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAV 820
                   PD     R  + L+ +  L  G    +  +++           N+R +  N   
Sbjct: 21550 VDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVGYSIEKRQ-------GNERWVRCN--- 21599

Query: 821   YSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLG 853
               TD +  C  T+  +SP D  E++ +A N +G
Sbjct: 21600 -FTD-VSECQYTVTGLSPGDRYEFRIIARNAVG 21630



 Score = 34.3 bits (77), Expect = 0.51
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 6/67 (8%)

Query: 575 LTVKVGDTVRVPVSFEAMPMPEVTWLKDG-----LPLPKRSVTVTKDGLTQLLIPVAGLS 629
           + V  G T          P+PEV+W +DG       LP   ++ + DG  +L IP    +
Sbjct: 15  VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFS-DGRAKLTIPAVTKA 73

Query: 630 DSGLYTV 636
           +SG Y++
Sbjct: 74  NSGRYSL 80



 Score = 34.3 bits (77), Expect = 0.51
 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 1/82 (1%)

Query: 772  QKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSL 831
            QKP  ++      + +G      C V G P+P V W+ N + +  +   +     G+  L
Sbjct: 1793 QKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKR-FRVRYDGIHYL 1851

Query: 832  TIPSVSPKDSGEYKAVAENTLG 853
             I      D+GE K  AEN  G
Sbjct: 1852 DIVDCKSYDTGEVKVTAENPEG 1873



 Score = 34.3 bits (77), Expect = 0.51
 Identities = 46/183 (25%), Positives = 75/183 (40%), Gaps = 24/183 (13%)

Query: 105  WFKDGVKLTTQDGVI-FKQDGLVHSLFITHVQGTQAG----RYTFVAGDQQSEATLTVQD 159
            W+K+GVK+   D +  +  +  V  L I  V    +     +   +AG+  S A L VQ 
Sbjct: 2065 WYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQA 2124

Query: 160  SPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLP-IQAAWRKDGAEVVGS------SDR 212
               I    T++L++  VV   K  +     ++  P ++  W KDG EV         SDR
Sbjct: 2125 KQLIT--FTQELQD--VVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDR 2180

Query: 213  EAQ------VDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQG 266
            +        +D  D     C+      +  + +  L  EG  V+    LQ I+ P+   G
Sbjct: 2181 KVHFLSILTIDTSDAEDYSCV--LVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSG 2238

Query: 267  PME 269
             +E
Sbjct: 2239 ELE 2241



 Score = 34.3 bits (77), Expect = 0.51
 Identities = 20/93 (21%), Positives = 38/93 (40%)

Query: 165   PDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTR 224
             P   E L   + +  GK + V   F      +  W   G ++         ++  D  T 
Sbjct: 27023 PPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTT 27082

Query: 225   LCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQV 257
             L +    ++D G Y+++L +E GS  A + + +
Sbjct: 27083 LIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 27115



 Score = 34.3 bits (77), Expect = 0.51
 Identities = 24/77 (31%), Positives = 33/77 (42%), Gaps = 4/77 (5%)

Query: 575   LTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPK----RSVTVTKDGLTQLLIPVAGLSD 630
             +++  G  + V  +F   P PEVTW   G  +      R      D LT L+I      D
Sbjct: 27033 ISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQD 27092

Query: 631   SGLYTVVLRTLQGKEVA 647
              GLYT+ L    G + A
Sbjct: 27093 GGLYTLSLGNEFGSDSA 27109



 Score = 33.9 bits (76), Expect = 0.67
 Identities = 40/189 (21%), Positives = 69/189 (36%), Gaps = 22/189 (11%)

Query: 81   DMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAG 140
            ++E+  GE A   C+++ +  P  W +D   L + D      DG    L +        G
Sbjct: 6255 NLEILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMG 6314

Query: 141  RYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWR 200
             Y  + G  ++ A LT          V EKLR  + +K       ++  Q  +       
Sbjct: 6315 TYVVMVGAARAAAHLT----------VIEKLRIVVPLKD-----TRVKEQQEVVFNCEVN 6359

Query: 201  KDGAEVVGSSDREAQVDLG-------DGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAEL 253
             +GA+     + EA  D         D    L +  A   D   Y+V+L +  G      
Sbjct: 6360 TEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSA 6419

Query: 254  TLQVIDKPD 262
               ++++ D
Sbjct: 6420 ANLIVEEED 6428



 Score = 33.5 bits (75), Expect = 0.88
 Identities = 22/81 (27%), Positives = 35/81 (43%), Gaps = 6/81 (7%)

Query: 785   LPQGCECCMSCAVQGSPRPHVTWFKNDRSL----EGNPAVYSTDLLGVCSLTIPSVSPKD 840
             + +G    ++CA  G P P VTW    R +    +G   + +TD   + +L I  V  +D
Sbjct: 27035 IDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTD--DLTTLIIMDVQKQD 27092

Query: 841   SGEYKAVAENTLGQAVSTATL 861
              G Y     N  G   +T  +
Sbjct: 27093 GGLYTLSLGNEFGSDSATVNI 27113



 Score = 33.1 bits (74), Expect = 1.1
 Identities = 34/169 (20%), Positives = 69/169 (40%), Gaps = 5/169 (2%)

Query: 75   FSQGLADMEVQPGEA-ATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITH 133
            F+Q L D+  +  +  AT  C  +       W+KDG+++   D      D  VH L I  
Sbjct: 2130 FTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILT 2189

Query: 134  VQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHL 193
            +  + A  Y+ V  + ++  T           +  ++L++  V ++    +  I    + 
Sbjct: 2190 IDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPEN- 2248

Query: 194  PIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTL 242
             I+  W  +  E+   S+ +  +    G   L +    ++D G+YS  +
Sbjct: 2249 -IEGKWYHNDVEL--KSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVI 2294



 Score = 32.7 bits (73), Expect = 1.5
 Identities = 33/115 (28%), Positives = 49/115 (42%), Gaps = 10/115 (8%)

Query: 536  VTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMP 595
            V A N  G+S  S + T V+A+   V P F+        + +K G  + + V     P P
Sbjct: 1484 VVAQNRAGRSSISVILT-VEAVEHQVKPMFVEKLKN---VNIKEGSRLEMKVRATGNPNP 1539

Query: 596  EVTWLKDG---LP--LPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKE 645
            ++ WLK+    +P   PK  +  TK G   L I      DS  YT       G++
Sbjct: 1540 DIVWLKNSDIIVPHKYPKIRIEGTK-GEAALKIDSTVSQDSAWYTATAINKAGRD 1593



 Score = 32.3 bits (72), Expect = 2.0
 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 1/86 (1%)

Query: 74  HFSQGLADMEVQPGEAATLSCTLTSDLGPGT-WFKDGVKLTTQDGVIFKQDGLVHSLFIT 132
           +F Q L  M V+ G    L   +T    P   +++DG ++ +       Q+G ++SL I 
Sbjct: 105 NFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIA 164

Query: 133 HVQGTQAGRYTFVAGDQQSEATLTVQ 158
                 +G Y+  A +    AT T +
Sbjct: 165 EAYPEDSGTYSVNATNSVGRATSTAE 190



 Score = 31.6 bits (70), Expect = 3.3
 Identities = 19/59 (32%), Positives = 26/59 (44%)

Query: 805   VTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
             VTW+   R LE +     T   GV  L +  ++  D G Y+    N  G+  S A L V
Sbjct: 25295 VTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFV 25353



 Score = 31.6 bits (70), Expect = 3.3
 Identities = 32/130 (24%), Positives = 54/130 (41%), Gaps = 11/130 (8%)

Query: 535   RVTAVNEGGQSQPSALDTLVQAM-----PVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSF 589
             +V+ ++E  +S     ++ V        P  +  K ++ +  +D  TV      +  V  
Sbjct: 26512 KVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDT-TVSSDSVAKFAVKA 26570

Query: 590   EAMPMPEVTWLKDGLPLP---KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEV 646
                P P   W KDG  +    K  ++  K G   L I     SDSGLYT  ++   G  V
Sbjct: 26571 TGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFF-LEIHKTDTSDSGLYTCTVKNSAG-SV 26628

Query: 647   AHSFRIRVAA 656
             + S ++ + A
Sbjct: 26629 SSSCKLTIKA 26638



 Score = 31.2 bits (69), Expect = 4.3
 Identities = 21/97 (21%), Positives = 42/97 (43%), Gaps = 3/97 (3%)

Query: 161 PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGD 220
           P   P +   L+   V++ G+ V ++     +      W ++  ++  S D   Q+    
Sbjct: 893 PVTPPTLVSGLKNVTVIE-GESVTLECHISGYPSPTVTWYREDYQIESSID--FQITFQS 949

Query: 221 GYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQV 257
           G  RL +  A  +D G+++ +  +E G+V     L V
Sbjct: 950 GIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 986



 Score = 31.2 bits (69), Expect = 4.3
 Identities = 31/153 (20%), Positives = 66/153 (43%), Gaps = 17/153 (11%)

Query: 124  GLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPV 183
            G ++ L + ++     G+YTF AG+  +   LTV         +++ L +  V ++ + V
Sbjct: 2538 GKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGA-----ISKPLTDQTVAESQEAV 2592

Query: 184  IVKIPFQSHL---PIQAAWRKDGAEVVGSSDREAQVDLGDGY-TRLCLPSAGRKDCGQYS 239
                 F+  +     +  W +DG  +  +++  ++    DG+  RL + +    D G+Y+
Sbjct: 2593 -----FECEVANPDSKGEWLRDGKHLPLTNNIRSE---SDGHKRRLIIAATKLDDIGEYT 2644

Query: 240  VTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQD 272
              + +   S + ++    I K        E QD
Sbjct: 2645 YKVATSKTSAKLKVEAVKIKKTLKNLTVTETQD 2677



 Score = 31.2 bits (69), Expect = 4.3
 Identities = 22/100 (22%), Positives = 40/100 (40%), Gaps = 1/100 (1%)

Query: 764  CYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYST 823
            C +E    + P+  + L+   +  G      C ++      VTW      +E +  +  +
Sbjct: 3480 CAKE-STGEAPKIFLHLQDVTVKCGDTAQFLCVLKDDSFIDVTWTHEGAKIEESERLKQS 3538

Query: 824  DLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
                +  LTI +V   D G Y  +  N  G+  ++A L V
Sbjct: 3539 QNGNIQFLTICNVQLVDQGLYSCIVHNDCGERTTSAVLSV 3578



 Score = 31.2 bits (69), Expect = 4.3
 Identities = 39/124 (31%), Positives = 56/124 (45%), Gaps = 15/124 (12%)

Query: 542  GGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEV---T 598
            GG+  P       Q   V +  KF+ +   KD++  +  + V     FE +  P     T
Sbjct: 4791 GGEKPPDEAPFTYQLKAVPL--KFVKE--IKDIILTE-SEFVGSSAIFECLVSPSTAITT 4845

Query: 599  WLKDGLPL---PK-RSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRV 654
            W+KDG  +   PK R +   KD   +L I    LSD+G YT VLR L  KE   + ++ V
Sbjct: 4846 WMKDGSNIRESPKHRFIADGKD--RKLHIIDVQLSDAGEYTCVLR-LGNKEKTSTAKLVV 4902

Query: 655  AACP 658
               P
Sbjct: 4903 EELP 4906



 Score = 30.8 bits (68), Expect = 5.7
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 4/79 (5%)

Query: 559 VTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKR-SVTVT-KD 616
           + V P  LV S  K++ TV  G++V +       P P VTW ++   +       +T + 
Sbjct: 892 IPVTPPTLV-SGLKNV-TVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQS 949

Query: 617 GLTQLLIPVAGLSDSGLYT 635
           G+ +L+I  A   DSG +T
Sbjct: 950 GIARLMIREAFAEDSGRFT 968


>gi|110349713 titin isoform novex-1 [Homo sapiens]
          Length = 27051

 Score =  332 bits (851), Expect = 9e-91
 Identities = 188/609 (30%), Positives = 306/609 (50%), Gaps = 11/609 (1%)

Query: 145   VAGDQQSEATLTVQDS---PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRK 201
             V+  +++   +TVQD    PTI  D++   ++ + V AG+PV + IP     P  A+W  
Sbjct: 23345 VSEPRETVTAVTVQDLRVLPTI--DLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFF 23402

Query: 202   DGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKP 261
              G+++  S      V+      +L +     +D G+Y++ L++  G+    + + ++DKP
Sbjct: 23403 AGSKLRESE--RVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKP 23460

Query: 262   DPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTF 321
              PP GP+++ +     + + W PP  +GG  +  YVVE+R A R  WL V E+   ST F
Sbjct: 23461 GPPTGPIKIDEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRST-F 23519

Query: 322   TDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEA-LPKAPSAPAILSASSQGITLT 380
                 +  G +Y FRV A    G G  L+SE I       +P  P    I   S  G+TLT
Sbjct: 23520 KFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIECRSSIRIPGPPETLQIFDVSRDGMTLT 23579

Query: 381   WTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAP 440
             W  P   G + + GY++ER++  ++ W  VN  PV   R+    + +G +YE RVTA+  
Sbjct: 23580 WYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINA 23639

Query: 441   SGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVEL 500
              G G+P  PS  + A DP+ PPG  +N +VTD + TS++L+W+ P+ + G +  GY++E+
Sbjct: 23640 RGSGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEM 23699

Query: 501   CSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVT 560
                D  +W  C+     +  YT   L  G  Y  RV A N GG  +P+ +   V+   + 
Sbjct: 23700 QKVDQHEWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEML 23759

Query: 561   VCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQ 620
               P + +D   ++ + V+ G  +R+ +  +  P P   W K+G  + KR++  T +  T+
Sbjct: 23760 EYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTE 23819

Query: 621   LLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWE 679
             L+I  A   DSG Y +VL    GK+  +  ++RV   P +P GP+   +    +V   W 
Sbjct: 23820 LVIKEADRGDSGTYDLVLENKCGKKAVY-IKVRVIGSPNSPEGPLEYDDIQVRSVRVSWR 23878

Query: 680   PSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGA 739
             P  D+     L Y +  R      W+    R+      + G+    EYHFRV A+N+ G 
Sbjct: 23879 PPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGI 23938

Query: 740   SKPSDTSQP 748
             SKP  + +P
Sbjct: 23939 SKPLKSEEP 23947



 Score =  295 bits (755), Expect = 1e-79
 Identities = 176/588 (29%), Positives = 283/588 (48%), Gaps = 9/588 (1%)

Query: 166   DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
             D+  +  E +  +AG  V ++            W KD  E+   ++    V+       +
Sbjct: 20501 DLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKEL--QTNALVCVENTTDLASI 20558

Query: 226   CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPP 285
              +  A R + G Y + LR+  GS  A + +Q++DKP PP GP+E +      + L WRPP
Sbjct: 20559 LIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPP 20618

Query: 286   RDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAG 345
              D+GG  +  Y+VE+R+  R  W  V E   +    T   +  G +Y FRVRAV   G G
Sbjct: 20619 ADDGGAKITHYIVEKRETSRVVWSMVSEH-LEECIITTTKIIKGNEYIFRVRAVNKYGIG 20677

Query: 346   EALESEEILVAPEAL--PKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKG 403
             E LES+ + VA  A   P  P  P +   +   +T+ W+ P   G + I GY +E+R K 
Sbjct: 20678 EPLESDSV-VAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKK 20736

Query: 404   SNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPG 463
             S  W  V  + + + R  V  + +   Y++RV AV  +G G    PS+   A DP+ PPG
Sbjct: 20737 SLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPG 20796

Query: 464   LVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHV-GTVPVTTYT 522
                 +++ D + +SITL W+ P    G    GYVVE+   +  +W      G V  T Y 
Sbjct: 20797 PPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYV 20856

Query: 523   AKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDT 582
                L+PG  Y+ RV+AVN  GQ +P  ++  VQA  +   P+  +D + +  +  K G+ 
Sbjct: 20857 VSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGED 20916

Query: 583   VRVPVSFEAMPMPEVTWLKD--GLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRT 640
             V+V + F+  P P VTW KD   L    R      D  + L IP    +D+G Y + +  
Sbjct: 20917 VQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIEN 20976

Query: 641   LQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSA 700
               G+  + +  ++V   P A   + ++    GTVT  W+P   +     ++Y +  R + 
Sbjct: 20977 GVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDAT 21036

Query: 701   HGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
                W   + +  +  F L+ +     + FRV+A+NE+G  +P +T++P
Sbjct: 21037 KRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEP 21084



 Score =  286 bits (733), Expect = 4e-77
 Identities = 183/608 (30%), Positives = 287/608 (47%), Gaps = 13/608 (2%)

Query: 145   VAGDQQSEATLTVQDS---PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSH-LPIQAAWR 200
             V+   +S   + V+D    P +  DV  K R+ +VVKAG+ + +        LP+  +W 
Sbjct: 19396 VSEPSESTGPIIVKDDVEPPRVMMDV--KFRDVIVVKAGEVLKINADIAGRPLPV-ISWA 19452

Query: 201   KDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDK 260
             KDG E+        ++   D +T L +    R+D GQY +TL++  G+    +  +V+DK
Sbjct: 19453 KDGIEI--EERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDK 19510

Query: 261   PDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTT 320
             P PP GP+E+         L W  P+++GG  ++ Y+VE+R+     W  + E     T+
Sbjct: 19511 PGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWT-ICEGELQMTS 19569

Query: 321   FTDAHVEPGRKYTFRVRAVTSEGAGEALESEEI-LVAPEALPKAPSAPAILSASSQGITL 379
                  +  G +Y FRV  V   G GE LES  I  + P  +P  P++  I S + + +TL
Sbjct: 19570 CKVTKLLKGNEYIFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLEITSVTKESMTL 19629

Query: 380   TWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVA 439
              W+ P   G + I GY+IERR+K S  W  VN +PV + R     +R+GC+YE+RV A  
Sbjct: 19630 CWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAEN 19689

Query: 440   PSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVE 499
              +G   P   S  + A DP+  P      ++ D   T+IT++W  P    G    GY VE
Sbjct: 19690 AAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVE 19749

Query: 500   LCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPV 559
                SD   W    + ++  T YT  GL  G  Y  RV +VN+ G S PS       A   
Sbjct: 19750 YKKSDDTDW-KTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKER 19808

Query: 560   TVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLT 619
                P F +DS  +  L VK G +  + V F   P+P V W K    L  R+   T D  T
Sbjct: 19809 EEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRT 19868

Query: 620   QLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWE 679
              L I  A  +DSG YT+ ++ +     + +  ++V   P  P  I +Q+    +    W+
Sbjct: 19869 SLTIENANRNDSGKYTLTIQNVL-SAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWD 19927

Query: 680   PSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGA 739
                ++      +Y +  R ++   W    +  +   + +  +  G  Y+FRV  +NE G 
Sbjct: 19928 VPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGV 19987

Query: 740   SKPSDTSQ 747
               P++T +
Sbjct: 19988 GIPAETKE 19995



 Score =  284 bits (727), Expect = 2e-76
 Identities = 189/655 (28%), Positives = 304/655 (46%), Gaps = 13/655 (1%)

Query: 99    DLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITH--VQGTQAGRYTFVAGDQQSEATLT 156
             DL  G W K     T      F   GLV         +    AG ++  +    +     
Sbjct: 18271 DLPDGRWMK--ASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARD 18328

Query: 157   VQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQV 216
               D+P  + D   K ++ +VV AG+  +++   +        W KDG E+  ++ R  ++
Sbjct: 18329 EIDAPNASLD--PKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAAR-MEI 18385

Query: 217   DLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRA 276
                   T L +    R D GQY + L + GG+    +T++V+D+P PP+GP++V      
Sbjct: 18386 KSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAE 18445

Query: 277   GVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRV 336
                L W PP  +GG  +  Y++E+R+  R +W +V      +  +    + PG +Y FRV
Sbjct: 18446 KCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVS-TEVQALNYKVTKLLPGNEYIFRV 18504

Query: 337   RAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGY 395
              AV   G GE LES  +    P   P  PS P + + +   + +TW  P   G   I GY
Sbjct: 18505 MAVNKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGY 18564

Query: 396   LIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFA 455
             ++E+R K    WT  N + + + R  V  + +G  YEFRV A   +G GEP  PS    A
Sbjct: 18565 ILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRA 18624

Query: 456   RDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGT 515
              D + PPG   N +VTD S +S++L+W+ P    G   +GYVVE+  + + +W  C   T
Sbjct: 18625 CDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPT 18684

Query: 516   -VPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDL 574
              +    +T   L+    Y  R+ A+N  G  +P+ L   V A      P+  +D+  + +
Sbjct: 18685 GLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKV 18744

Query: 575   LTVKVGDTVRVPVSFEAMPMPEVTWLK-DGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGL 633
             + ++   T+R+ V+ +  P PEV W K +G+   +  + VT    T L+I      DSG 
Sbjct: 18745 VVLRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVT-SSFTMLVIDNVTRFDSGR 18803

Query: 634   YTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYA 693
             Y + L    G + A    +RV   P AP  + ++E    +VT  WEP   +      +Y 
Sbjct: 18804 YNLTLENNSGSKTAF-VNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYI 18862

Query: 694   VFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             V  R +    +    +      F +  +  G  Y+FRV+A NE G   P++T++P
Sbjct: 18863 VEKRETTRKAYATITNNCTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEP 18917



 Score =  284 bits (726), Expect = 3e-76
 Identities = 190/641 (29%), Positives = 304/641 (47%), Gaps = 26/641 (4%)

Query: 137   TQAGRYTF-VAGDQQ------SEATLTVQDSPTIAPDVTEKLREPL--VVKAGKPVIVKI 187
             T+   YTF V+ + +      SE T+  +D   +APD+  K    L  + K      +KI
Sbjct: 13574 TEGKEYTFRVSAENENGEGTPSEITVVARDD-VVAPDLDLKGLPDLCYLAKENSNFRLKI 13632

Query: 188   PFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGG 247
             P +       +W+K   E   ++D    V+     T L +    + D G+Y++TL++  G
Sbjct: 13633 PIKGKPAPSVSWKK--GEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAG 13690

Query: 248   SVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRST 307
             + +  ++++V+ KP  P GP++  +     + L+W PP+D+GG  +  Y++E+R +  + 
Sbjct: 13691 TKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNK 13750

Query: 308   WLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA-PEALPKAPSA 366
             W+    A    TTF    +  G +YTFRV A    G GE L+SE I+   P  +P AP  
Sbjct: 13751 WVTCASA-VQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPP 13809

Query: 367   PAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVR 426
             P I+      ++LTWT P+  G + I GY +E +++ S  W   N  P+  R + V  + 
Sbjct: 13810 PNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLT 13869

Query: 427   QGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPD 486
             +G +YEFRV A+  +G G+P  PS+ V A DP+ PPG    + +T     S+TL W  P 
Sbjct: 13870 EGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINIT---RNSVTLIWTEPK 13926

Query: 487   TQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ-S 545
                G +  GY+VE     S  W+  +   VP   +T   L  G  Y  R+ A N  G  S
Sbjct: 13927 YDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAIS 13986

Query: 546   QPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRV-PVSFEAMPMPEVTWLKDGL 604
              PS     +        P  ++D + KD LT+K GDT+ +  +S    P+P+ +W K G 
Sbjct: 13987 APSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGK 14046

Query: 605   PLPKRSVT-VTKDGLTQLL-IPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPG 662
              +    +T +T    + +L I  A   D+G YT+      G +V H  ++ V   P  PG
Sbjct: 14047 DIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEH-VKVTVLDVPGPPG 14105

Query: 663   PIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGIL 722
             P+ +        T  W P  ++       Y +  R ++   W   ++ I + R     ++
Sbjct: 14106 PVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKLI 14165

Query: 723   PGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAP 763
              G+EY FRV A N  G  +P   S+P    +  DRF    P
Sbjct: 14166 QGNEYIFRVSAVNHYGKGEPVQ-SEP---VKMVDRFGPPGP 14202



 Score =  284 bits (726), Expect = 3e-76
 Identities = 173/592 (29%), Positives = 290/592 (48%), Gaps = 10/592 (1%)

Query: 159   DSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDL 218
             ++P I  DV  K ++ +++KAG+   ++       P    W KDG E+ G++  E  + +
Sbjct: 15085 EAPKIKVDV--KFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLE--IKI 15140

Query: 219   GDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGV 278
              D  T L    + R+D G Y++T  + GG  +    ++V+D+P PP+GP+ V +      
Sbjct: 15141 ADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKC 15200

Query: 279   CLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRA 338
              L W PP D+GG  ++ Y+V++R+  R  W  V  +    T      +  G +Y FRV A
Sbjct: 15201 VLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVA-SEVQVTKLKVTKLLKGNEYIFRVMA 15259

Query: 339   VTSEGAGEALESEEIL-VAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLI 397
             V   G GE LESE +L V P   P  P  P + + +   + + W  P   G + I+ Y++
Sbjct: 15260 VNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIV 15319

Query: 398   ERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARD 457
             ERR K    W   N + + + R+ V+ + +G +YEFR+ A   +G   P P S    A D
Sbjct: 15320 ERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACD 15379

Query: 458   PMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQW-LPCHVGTV 516
              +  PG   N +V D S +SI+++W  P    G E  GY+VE+   +  +W +      +
Sbjct: 15380 TVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGL 15439

Query: 517   PVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLT 576
               T+YT  GL   + Y +R+ A+N  G  +P+ +    +A    + P+  +D+  + ++T
Sbjct: 15440 KATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVT 15499

Query: 577   VKVGDTVRVPVSFEAMPMPEVTWLKD-GLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYT 635
             ++   T+R+ V  +  P PEV W +D G  L K S+  T    T L++      DSG Y 
Sbjct: 15500 IRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIEST-SSYTLLIVGNVNRFDSGKYI 15558

Query: 636   VVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVF 695
             + +    G + A    +RV   P  P  + ++E    +VT  W+P   +      +Y V 
Sbjct: 15559 LTVENSSGSKSAF-VNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVE 15617

Query: 696   TRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQ 747
              R S    +   A   H   + +  +  G  Y+FRV+A+NE G   P++T++
Sbjct: 15618 KRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAE 15669



 Score =  281 bits (719), Expect = 2e-75
 Identities = 181/627 (28%), Positives = 302/627 (48%), Gaps = 24/627 (3%)

Query: 138   QAGRYTF----------VAGDQQSEATLTVQD---SPTIAPDVTEKLREPLVVKAGKPVI 184
             + G+Y F          ++   +S  T+  +D   +PTI  D T  +++ L +KAG  ++
Sbjct: 13968 EGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIVLDPT--IKDGLTIKAGDTIV 14025

Query: 185   VKIPFQSHLPI-QAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLR 243
             +        P+ +++W K G ++  S     Q+      + L +  A RKD G+Y++T  
Sbjct: 14026 LNAISILGKPLPKSSWSKAGKDIRPSDI--TQITSTPTSSMLTIKYATRKDAGEYTITAT 14083

Query: 244   SEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQA 303
             +  G+    + + V+D P PP GP+E+ +       L W PP ++GG  ++ Y++E+R+ 
Sbjct: 14084 NPFGTKVEHVKVTVLDVPGPP-GPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRET 14142

Query: 304   GRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEI-LVAPEALPK 362
              R  W  V E    S       +  G +Y FRV AV   G GE ++SE + +V     P 
Sbjct: 14143 SRLLWTVVSE-DIQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQSEPVKMVDRFGPPG 14201

Query: 363   APSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTV 422
              P  P + + +    T++W  P   G + I GY +ERR+K S  W      PV + R  V
Sbjct: 14202 PPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDLRCKV 14261

Query: 423   ADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSW 482
               +++G  YEFRV+A   +G G P   SD+V  +D   PPG   N  VTD +  S +L+W
Sbjct: 14262 TGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSASLAW 14321

Query: 483   AGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGT-VPVTTYTAKGLRPGEGYFVRVTAVNE 541
               P    G E  GYVVE        W+    GT + +T +    L+  E Y  R++A+N+
Sbjct: 14322 GKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAIND 14381

Query: 542   GGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLK 601
              G  +P+ +   V+ +   + P F +D+  +  L V+ G ++R+ V  +  P PEVTW K
Sbjct: 14382 AGVGEPAVIPD-VEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTK 14440

Query: 602   DGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP 661
             D + L  R+     +  T L+IP     D+G + + +    GK+ +    +RV   P   
Sbjct: 14441 DNINLKNRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKK-SGFVNVRVLDTPGPV 14499

Query: 662   GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGI 721
               +   +    +VT  W+    +      +Y V  R +    +  A  + H   + + G+
Sbjct: 14500 LNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTKCHKCTYKVTGL 14559

Query: 722   LPGHEYHFRVVAKNELGASKPSDTSQP 748
               G EY FRV+A+NE G  +P++T++P
Sbjct: 14560 SEGCEYFFRVMAENEYGIGEPTETTEP 14586



 Score =  279 bits (714), Expect = 7e-75
 Identities = 165/576 (28%), Positives = 281/576 (48%), Gaps = 6/576 (1%)

Query: 175   LVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKD 234
             L++K+G+ + +K   Q     +  W KDG E+    + E    LG   T L +  A R  
Sbjct: 21596 LIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGS--TSLFVRDATRDH 21653

Query: 235   CGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVE 294
              G Y+V  ++  GS +AE+ ++V D P    GP+   +     + L W  P ++G   + 
Sbjct: 21654 RGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPIT 21713

Query: 295   CYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEIL 354
              Y++E+R+  R  W  + E   ++ ++T   +  G +Y FRV AV   G G  L+S+ ++
Sbjct: 21714 HYIIEKRETSRLAWALI-EDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVV 21772

Query: 355   VAPE-ALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAV-ND 412
                +  +P AP  P   + +   ITLTW  P   G + I  Y++ERR+K S  W  V + 
Sbjct: 21773 AQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISK 21832

Query: 413   QPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTD 472
             +P+ E R+ V  + +G +YEF V A   +G G     S  +  R+P+ PPG    ++VTD
Sbjct: 21833 RPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTD 21892

Query: 473   RSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGY 532
              S T+++L W+ P    G E  GY++E+C +D   W   +      T YT   L+ GE Y
Sbjct: 21893 TSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEY 21952

Query: 533   FVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAM 592
               RV+A+N  G+     +   ++A+     P+  +D++ K    V+ G ++R+ ++++  
Sbjct: 21953 KFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGR 22012

Query: 593   PMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRI 652
             P P   W K    L  R+   T D  + L +     +D+G YT+ +    G + + +F +
Sbjct: 22013 PTPTAVWSKPDSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSK-SITFTV 22071

Query: 653   RVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIH 712
             +V   P  PGPI  ++   G+ T  W+    +      HY V  R ++   W   +++  
Sbjct: 22072 KVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISEKCT 22131

Query: 713   TNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
                F +  +  G  Y+FRV A NE G  +P +  +P
Sbjct: 22132 RQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEP 22167



 Score =  277 bits (708), Expect = 3e-74
 Identities = 194/673 (28%), Positives = 302/673 (44%), Gaps = 19/673 (2%)

Query: 81   DMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAG 140
            D+   PG        L  D     W ++ + +   D      +G +H L I  ++    G
Sbjct: 6548 DILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQG 6607

Query: 141  RYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWR 200
             Y F+A D+++ A L +  +P I     +   + LVV  GKP+ + +P+ ++   +A W 
Sbjct: 6608 EYRFIAKDKEARAKLELAAAPKI-----KTADQDLVVDVGKPLTMVVPYDAYPKAEAEWF 6662

Query: 201  KDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDK 260
            K+   +   +     +D     T   +  A + D G+Y + L+++ G  +  + L+VID 
Sbjct: 6663 KENEPLSTKT-----IDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDV 6717

Query: 261  PDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTT 320
            P P +  +EV +     V L W  P  +GG  +  YVVERR   R TW+   +  A+S  
Sbjct: 6718 PGPVRN-LEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDR-AESCE 6775

Query: 321  FTDAHVEPGR-KYTFRVRAVTSEGAGEALESEEILVAPEA--LPKAPSAPAILSASSQGI 377
            FT   ++ G  +Y FRV A    G GE +E++  + A     +P  P    I   +  G+
Sbjct: 6776 FTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGV 6835

Query: 378  TLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTA 437
            +LTW  P   G A I  Y+IE R K S  W         +   TV DV +G +Y FRV A
Sbjct: 6836 SLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRA 6895

Query: 438  VAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYV 497
                G G+P   +  V   DP+  P    NL  +D++ +S+ L W  P    G    GY+
Sbjct: 6896 QNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYI 6955

Query: 498  VELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAM 557
            +E C      W+ C++  VP  TY   GL  G  Y  RV+A N+ G S PS +   + A 
Sbjct: 6956 IERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTAD 7015

Query: 558  PVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWL--KDGLPLPKRSVTVTK 615
               V P   + S+ KD L V V + + + V     P P  TW      L    R    T 
Sbjct: 7016 DAFVEPTMDL-SAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTL 7074

Query: 616  DGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVT 675
                +L+I  +  SD G+YT+ L   + K ++    + V A P AP  +   +    +V 
Sbjct: 7075 SAYAELVISPSERSDKGIYTLKLEN-RVKTISGEIDVNVIARPSAPKELKFGDITKDSVH 7133

Query: 676  AEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKN 735
              WEP  D+       Y V  R  +   W +  D +    FT+  ++ G EY F+V A+N
Sbjct: 7134 LTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARN 7193

Query: 736  ELGASKPSDTSQP 748
            + G  +P+   +P
Sbjct: 7194 KCGPGEPAYVDEP 7206



 Score =  266 bits (679), Expect = 8e-71
 Identities = 174/592 (29%), Positives = 269/592 (45%), Gaps = 11/592 (1%)

Query: 165   PDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTR 224
             P +  KL   L VKAG  + ++   +     + AW KD      +     ++D     ++
Sbjct: 11829 PVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSK 11888

Query: 225   LCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRP 284
               L  A R D G+Y VT  +  GS  A  T+ V+DKP P +  +++ D       + W P
Sbjct: 11889 FSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRN-LKIVDVSSDRCTVCWDP 11947

Query: 285   PRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGA 344
             P D+GG  ++ Y++E+ +  R  W           T     +E G +Y FRVRA    G 
Sbjct: 11948 PEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIE-GNEYIFRVRAENKIGT 12006

Query: 345   GEALESEEILVAPEA-LPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKG 403
             G   ES+ ++   +   P  P  P +   S + +T+ W  P   G   I GY +E+++K 
Sbjct: 12007 GPPTESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKH 12066

Query: 404   SNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPG 463
             S  W  VN   +PERR  V ++    +Y+FRV A    G GEP  PS  V A+DP+ PPG
Sbjct: 12067 STRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPG 12126

Query: 464   LVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVEL-----CSSDSLQWLPCHVGTVPV 518
                N +V D +  SITL W  P    G    GYVVE+      +S    W  C+     V
Sbjct: 12127 PPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLV 12186

Query: 519   -TTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTV 577
                +T   L   + Y  RV A N+ G  +P+ L   ++   +   P+  +D+S + L+ V
Sbjct: 12187 RKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVIV 12246

Query: 578   KVGDTVRVPVSFEAMPMPEVTWLKDGLP-LPKRSVTVTKDGLTQLLIPVAGLSDSGLYTV 636
             + G  +R+       P P+VTW K G+  + ++      D +  L+IP +   DSG Y++
Sbjct: 12247 RAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSL 12306

Query: 637   VLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFT 696
              L    G E A    +RV   P     + + +    +    W P  ++      HY V  
Sbjct: 12307 TLVNPAG-EKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEK 12365

Query: 697   RSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             R +    W      +    F +  ++PG+EY+FRV A NE G   P+D  +P
Sbjct: 12366 READRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKP 12417



 Score =  266 bits (679), Expect = 8e-71
 Identities = 184/657 (28%), Positives = 293/657 (44%), Gaps = 18/657 (2%)

Query: 99    DLGPGTWFKDGVKLTTQDGVIFKQDGLV--HSLFITHVQGTQAGRYTFVAGDQQSEATLT 156
             +L  G W K     T      F+  GLV  H      +    AG ++      +S   +T
Sbjct: 16107 ELPEGRWMK--ASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFS---EPSESTGAIT 16161

Query: 157   VQDS---PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDRE 213
              +D    P I+ D   K ++ +VV AG+   V             W K   E+  S+   
Sbjct: 16162 ARDEVDPPRISMD--PKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL--SNTAR 16217

Query: 214   AQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDC 273
              ++   D  T L +  A R D G Y +  ++  G     + ++V+D+P PP+GP+ +   
Sbjct: 16218 LEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGV 16277

Query: 274   HRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYT 333
                   L W+PP  +GG  +  Y+VERR+  R  W  V +A   + +     +  G +YT
Sbjct: 16278 TAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVV-DANVQTLSCKVTKLLEGNEYT 16336

Query: 334   FRVRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHI 392
             FR+ AV   G GE LESE ++   P  +P AP AP + + +   + + W  P   G + I
Sbjct: 16337 FRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEI 16396

Query: 393   LGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDA 452
             LGY++E+R K    WT  + + + E R  V  + +   YEFRV+A   +G  EP PPS  
Sbjct: 16397 LGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAY 16456

Query: 453   VFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCH 512
               A DP+  PG   N +V D + +S+ LSW+ P    G E QGY+VE C     +W  C 
Sbjct: 16457 QKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCT 16516

Query: 513   VGT-VPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSST 571
               T +  T    + L     Y  R+ A+N+ G  + + +   +        P   +D   
Sbjct: 16517 PPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLEL 16576

Query: 572   KDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDS 631
             + ++ ++ G ++R+ V  +  P PEV W K    +   ++       T L++      DS
Sbjct: 16577 RKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTSLVLDNVNRYDS 16636

Query: 632   GLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLH 691
             G YT+ L    G + A    +RV   P  P  + + E    +V+  WEP   +      +
Sbjct: 16637 GKYTLTLENSSGTKSAF-VTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKN 16695

Query: 692   YAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             Y V  R +    +       H N + +  +  G  Y+FRV A+NE G   P+ T+ P
Sbjct: 16696 YIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADP 16752



 Score =  264 bits (674), Expect = 3e-70
 Identities = 169/584 (28%), Positives = 277/584 (47%), Gaps = 9/584 (1%)

Query: 166   DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
             D++  ++  L VKAG  V +            +W+KDG  +  +     ++ +      L
Sbjct: 12924 DLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEG--IKMAMQRNLCTL 12981

Query: 226   CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPP 285
              L S  RKD G Y++T  +  GS  A + L+V+DKP PP   +++   +     L W PP
Sbjct: 12982 ELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPAS-VKINKMYSDRAMLSWEPP 13040

Query: 286   RDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAG 345
              ++GG  +  Y+V++R+  R  W +V      ++   +  +E G +Y FR+ A    G G
Sbjct: 13041 LEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIE-GHEYQFRICAENKYGVG 13099

Query: 346   EALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGS 404
             + + +E  +   P   P     P I + +   +T++W  P   G + I GYL+E+R+  +
Sbjct: 13100 DPVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQA 13159

Query: 405   NTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGL 464
               WT VN +P+ ER      +++G +YEFRVTA+  +GPG+P   S A +ARDP  PPG 
Sbjct: 13160 VNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGP 13219

Query: 465   VRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHV-GTVPVTTYTA 523
                 +V D + +S++LSW  P    G    GY+VE+  +DS  W+ C++   +  T +  
Sbjct: 13220 PAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEV 13279

Query: 524   KGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTV 583
              GL     Y  RV AVN+ G S PS +        + + P+  +D+  +  L ++ G T+
Sbjct: 13280 TGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTM 13339

Query: 584   RVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTK--DGLTQLLIPVAGLSDSGLYTVVLRTL 641
             R+ V  +  P P++TW K  + L  R     K  D  T L        D+G Y + L   
Sbjct: 13340 RLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENS 13399

Query: 642   QGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAH 701
              GK+  ++  ++V   P  P  + ++E    +    WEP   +     ++Y V  R +  
Sbjct: 13400 CGKK-EYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAER 13458

Query: 702   GPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
               W           F +  +  G  Y FRV A+NE G   P +T
Sbjct: 13459 KSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGET 13502



 Score =  263 bits (673), Expect = 4e-70
 Identities = 167/589 (28%), Positives = 274/589 (46%), Gaps = 11/589 (1%)

Query: 165   PDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTR 224
             P +    R+ L ++ G+   +   +      + +W KD A+V+   D    +        
Sbjct: 10446 PTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVL--EDDRTHIKTTPATLA 10503

Query: 225   LCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRP 284
             L    A R D G+Y V + +  GS +    + V+D+P PP GP+   +  +  + + W+P
Sbjct: 10504 LEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKP 10563

Query: 285   PRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGA 344
             P D+GG  +  Y++E+++ G+  W+ V  A A +T      +E G+ Y FR+ A    G 
Sbjct: 10564 PLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLE-GKDYIFRIHAENLYGI 10622

Query: 345   GEALESEEILVAPE-ALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKG 403
              + L S+ +       +P AP  P +   +     +TW  P   G   I  Y++E+R+  
Sbjct: 10623 SDPLVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKPHDGGKP-ITNYILEKRETM 10681

Query: 404   SNTWTAVNDQPV-PERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP 462
             S  W  V   P+ P  ++ V D+ +GCQYEFRV+A    G G+P PPS  VFA+DP+  P
Sbjct: 10682 SKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKP 10741

Query: 463   GLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCH--VGTVPVTT 520
                 N +  D +  S+ L+W  P    G +  GY+VE       +W   +    + P T 
Sbjct: 10742 SPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETK 10801

Query: 521   YTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVG 580
             Y   GLR G+ Y  RV AVN  G+S P+ +   V        P+ ++D++      +KVG
Sbjct: 10802 YKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVG 10861

Query: 581   DTVRVPVSFEAMPMPEVTWLKDGLPLP-KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLR 639
             DT+R+    + +P P+VTW K+    P K  + VT  G ++L I  A   D G+Y++ + 
Sbjct: 10862 DTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVG-SKLEIRNAAHEDGGIYSLTVE 10920

Query: 640   TLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSS 699
                G +   S ++ V   P  P  + + E    +    W+   D+   V  +Y V  R  
Sbjct: 10921 NPAGSKTV-SVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDV 10979

Query: 700   AHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             A   W   +            +  G++Y FRV A+N+ G     +T +P
Sbjct: 10980 ASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKP 11028



 Score =  263 bits (672), Expect = 5e-70
 Identities = 187/652 (28%), Positives = 297/652 (45%), Gaps = 30/652 (4%)

Query: 114   TQDGVIFKQDGLVHSLFITHVQGTQAGR-YTF------VAGDQQSEATLTVQDSPTIAPD 166
             TQD + FK    +  +    V G Q G+ Y F      + G    + T+ ++    + P 
Sbjct: 11081 TQDWIKFKTVTNLECV----VTGLQQGKTYRFRVKAENIVGLGLPDTTIPIECQEKLVPP 11136

Query: 167   VTE---KLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYT 223
               E   KL E LVVKAG  V      +      A W  DG+E+   +D    V+  +  +
Sbjct: 11137 SVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEI--KTDEHYTVETDNFSS 11194

Query: 224   RLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWR 283
              L + +  R+D G+Y +T+ +  GS    + L V+D P PP GP+ + D     + + W+
Sbjct: 11195 VLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTISWQ 11254

Query: 284   PPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEG 343
             PP+D+GG  V  Y+VE++   + TW  V    +  T     H++ G +Y FRVRA    G
Sbjct: 11255 PPKDDGGSPVINYIVEKQDTRKDTWGVVSSG-SSKTKLKIPHLQKGCEYVFRVRAENKIG 11313

Query: 344   AGEALESEEILVAPE-ALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKK 402
              G  L+S   +   + + P  P  P +   +    T++WT P+  G + I GY +ERR+ 
Sbjct: 11314 VGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREV 11373

Query: 403   GSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP 462
              +  W  VN  P+ + ++ V  + +G  YEFRV A   +G  +P P SD + A  P++PP
Sbjct: 11374 -TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKPP 11432

Query: 463   GLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVG-TVPVTTY 521
             G   N ++ D+S  +  L W  P +  G    GYVVE     + QW   +    +    +
Sbjct: 11433 GPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAF 11492

Query: 522   TAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGD 581
                GL  G  Y  R+ A N  G+ +P  L   V A  +   P+  +D + +D++TV+VG 
Sbjct: 11493 RVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQ 11552

Query: 582   TVRVPVSFEAMPMPEVTWLKDG--LPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLR 639
             T+R+    +  P P++TW K+G  L   KR   +      +L I  A  +D G Y +  +
Sbjct: 11553 TIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAK 11612

Query: 640   TLQGKEVAHSFRIRVAACPQAPGP---IHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFT 696
                G    H+    +      PGP   + +        T  WE   D       ++ V  
Sbjct: 11613 NSSG----HAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEY 11668

Query: 697   RSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             R      W   A  + T R     +L  +EY+FRV A+N++G     +T  P
Sbjct: 11669 RKPNQKGWSIVASDV-TKRLIKANLLANNEYYFRVCAENKVGVGPTIETKTP 11719



 Score =  259 bits (661), Expect = 1e-68
 Identities = 166/575 (28%), Positives = 261/575 (45%), Gaps = 12/575 (2%)

Query: 173   EPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGR 232
             E + +KAGK + ++            W+K   EVV SS     V   D  + L +    R
Sbjct: 12534 EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSS--HLAVHKADSSSILIIKDVTR 12591

Query: 233   KDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRT 292
             KD G YS+T  +  G+   ++ + V+D P PPQ P ++ D       L W  P ++GG  
Sbjct: 12592 KDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHIPLEDGGSN 12651

Query: 293   VECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEE 352
             +  Y+VE+    R  W+    A    T+     + PG++Y FRVRA    G  E L S +
Sbjct: 12652 ITNYIVEKCDVSRGDWV-TALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPLTSPK 12710

Query: 353   ILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVN 411
             ++   P  +P  P    +   +   I + W  P   G + I+GYLIER+++ S  W   N
Sbjct: 12711 MVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVKAN 12770

Query: 412   DQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVT 471
             D  V    +  A + +G +Y FR+ A+  +G   P  P++ V AR P+ PPG     +V 
Sbjct: 12771 DTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPG---KPEVI 12827

Query: 472   DRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVG--TVPVTTYTAKGLRPG 529
             D + ++++L WA P    G +  GY VE C     +W+ C+     +P   YTA GL   
Sbjct: 12828 DVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEEK 12887

Query: 530   EGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSF 589
               Y  R  A      S PS     V  +   V P+  +  + K LLTVK G  V +  + 
Sbjct: 12888 AQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCLDATV 12947

Query: 590   EAMPMPEVTWLKDGLPL-PKRSVTVT-KDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVA 647
                PMP V+W KDG  L P   + +  +  L  L +      DSG YT+      G + A
Sbjct: 12948 FGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSA 13007

Query: 648   HSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEA 707
              + +++V   P  P  + + +         WEP  ++      +Y V  R ++   W + 
Sbjct: 13008 -TIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQV 13066

Query: 708   ADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKP 742
             +  +     ++  ++ GHEY FR+ A+N+ G   P
Sbjct: 13067 SATVPITSCSVEKLIEGHEYQFRICAENKYGVGDP 13101



 Score =  258 bits (658), Expect = 2e-68
 Identities = 170/617 (27%), Positives = 289/617 (46%), Gaps = 36/617 (5%)

Query: 173  EPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDR----EAQVDLGDGYTRLCLP 228
            + + VKAG+PV +          +  W K+   +   +D     + +V   +  T L +P
Sbjct: 9034 DTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIP 9093

Query: 229  SAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDN 288
             A R+D G Y+VT  +  GSV   + ++V D+P PP+  + V D       L W  P DN
Sbjct: 9094 KAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRN-LAVTDIKAESCYLTWDAPLDN 9152

Query: 289  GGRTVECYVVERRQAGR--STWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGE 346
            GG  +  YV+++R A R  + W +V     +   +    + P  +Y FRVRAV   G  +
Sbjct: 9153 GGSEITHYVIDKRDASRKKAEWEEVTNTAVEKR-YGIWKLIPNGQYEFRVRAVNKYGISD 9211

Query: 347  ALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSN 405
              +S+++++  P  LP  P  P +L+ +   + ++WT P   G + I GY +E+R++GS 
Sbjct: 9212 ECKSDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSP 9271

Query: 406  TWTAVNDQPVPER-----RWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMR 460
             W+ V+  P+ +       + V  + +G +Y+FR  A+  +G G P  PSD   A DP+ 
Sbjct: 9272 YWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIF 9331

Query: 461  PPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTT 520
            PPG     +V D++ +SI+L W  P    G   +GY+VE+    +  W   +     +TT
Sbjct: 9332 PPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITT 9391

Query: 521  --YTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVK 578
                   L+    Y  RV AVNE G+S+PS     + A  +   P+  +D   +D L  K
Sbjct: 9392 CECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCK 9451

Query: 579  VGDTVRVPVSFEAMPMPEVTW---------LKDGL-PLPKRSVTVTKDGLTQLLIPVAGL 628
             G  +R+P   +  P P+ +W         +KDG+  +P+ +   T +  + ++IP    
Sbjct: 9452 AGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKR 9511

Query: 629  SDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDV 688
            S +G Y++  +   G++ A+  R++V   P  P  + + +   G+    W+   D+  D 
Sbjct: 9512 SHTGKYSITAKNKAGQKTANC-RVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDR 9570

Query: 689  PLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
               Y +  R+     W +      +  F +  +L   +Y FRV A+N  G   P +T Q 
Sbjct: 9571 IKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQ- 9629

Query: 749  WCIPRQRDRFTVKAPCY 765
                    R T + P Y
Sbjct: 9630 --------RTTARDPIY 9638



 Score =  257 bits (656), Expect = 4e-68
 Identities = 167/606 (27%), Positives = 278/606 (45%), Gaps = 11/606 (1%)

Query: 145   VAGDQQSEATLTVQDS---PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRK 201
             ++    S   +T +D    P I+ D   K R+ +VV AG+   ++            W +
Sbjct: 17232 ISKPSDSTGPITAKDEVELPRISMD--PKFRDTIVVNAGETFRLEADVHGKPLPTIEWLR 17289

Query: 202   DGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKP 261
                E+  S+    ++   D    L +  A R D GQY +   +  GS    + ++V+D+P
Sbjct: 17290 GDKEIEESA--RCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRP 17347

Query: 262   DPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTF 321
              PP+GP++V         L W PP  +GG  +  YVVE+R+  R  W  V      ++  
Sbjct: 17348 GPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLK 17407

Query: 322   TDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLT 380
                 +E G +Y FR+ AV   G GE LES  +L+  P  LP  P +  + + +   +T+ 
Sbjct: 17408 VTKLLE-GNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVC 17466

Query: 381   WTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAP 440
             W  P   G + I+GY++E+R +    W   N + + + R  V  + +  +YEFRV+A   
Sbjct: 17467 WNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENA 17526

Query: 441   SGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVEL 500
             +G GEP P +    A DP+  PG   N  + D +  SITL+W  P    G E  GYVVE+
Sbjct: 17527 AGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEI 17586

Query: 501   CSSDSLQWLPCHVGT-VPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPV 559
             C +D  +W      T + VT +    L   + Y +RV A+N+ G  + +++   V+    
Sbjct: 17587 CKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDK 17646

Query: 560   TVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLT 619
                P+  +DS  +  + V+ G + R+ + F+  P PE+TW ++      +         T
Sbjct: 17647 LEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTDKVQIEKGVNYT 17706

Query: 620   QLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWE 679
             QL I     +D+G Y + L    G + A    ++V   P  P  + ++E    +    WE
Sbjct: 17707 QLSIDNCDRNDAGKYILKLENSSGSKSAF-VTVKVLDTPGPPQNLAVKEVRKDSAFLVWE 17765

Query: 680   PSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGA 739
             P   +      +Y +  R S    +   + +     F +  +  G  Y+FRV+A+NE G 
Sbjct: 17766 PPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGV 17825

Query: 740   SKPSDT 745
               P +T
Sbjct: 17826 GVPVET 17831



 Score =  256 bits (655), Expect = 5e-68
 Identities = 185/660 (28%), Positives = 300/660 (45%), Gaps = 39/660 (5%)

Query: 101   GPGTWFKDGVKLTTQDGV--IFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQ 158
             G  TW   G+  T +  V  + +Q  L   +F  + +G           D  +   +TV+
Sbjct: 21133 GEQTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLS---------DPVTIGPITVK 21183

Query: 159   DSPTIAP--DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDG-----AEVVGSSD 211
             +   I P  D+++     + V+ G  V +++P++       +W KDG     +E V  S 
Sbjct: 21184 EL-IITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSK 21242

Query: 212   REAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQ 271
              E ++ L        + +A ++  G+Y+V L +    +   +T+  +  P  P+GP+   
Sbjct: 21243 TENKITLS-------IKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKGPIRFD 21295

Query: 272   DCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRK 331
             +     V L W  P DNGG  + CY +E+R+  ++ W  V  + A  TTF   ++    +
Sbjct: 21296 EIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCSSVA-RTTFKVPNLVKDAE 21354

Query: 332   YTFRVRAVTSEGAGEALESEEILVAPE-ALPKAPSAPAILSASSQGITLTWTAPRGPGSA 390
             Y FRVRA    G  + L S  I+   +  +P  P  P I + +S G++LTW AP   G +
Sbjct: 21355 YQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGS 21414

Query: 391   HILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPS 450
              + G+ +E++++ S  W  VN  P+  R +    + +G  Y+FRV A   +G   P  PS
Sbjct: 21415 EVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGLSSPSDPS 21474

Query: 451   DAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLP 510
                 A  P+ PPG    + VT     +ITL W  P    G +  GY +E    +  +W+ 
Sbjct: 21475 KFTLAVSPVDPPGTPDYIDVT---RETITLKWNPPLRDGGSKIVGYSIEKRQGNE-RWVR 21530

Query: 511   CHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ-SQPSALDTLVQAMPVTVCPKFLVDS 569
             C+   V    YT  GL PG+ Y  R+ A N  G  S PS    ++      V P      
Sbjct: 21531 CNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGP 21590

Query: 570   STKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKD--GLTQLLIPVAG 627
                D L +K G+++R+    +  P+P VTW KDG+ + KR      D  G T L +  A 
Sbjct: 21591 EYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDAT 21650

Query: 628   LSDSGLYTVVLRTLQGKEVAHSFRIRVAACP-QAPGPIHLQENVPGTVTAEWEPSPDEAQ 686
                 G+YTV  +   G   A   +++V   P +  GPI    N+ G     W  +P    
Sbjct: 21651 RDHRGVYTVEAKNASGSAKA-EIKVKVQDTPGKVVGPIRF-TNITGEKMTLWWDAPLNDG 21708

Query: 687   DVPL-HYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
               P+ HY +  R ++   W    D+     +T + ++ G+EY FRV A N+ G  +P D+
Sbjct: 21709 CAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDS 21768



 Score =  254 bits (650), Expect = 2e-67
 Identities = 170/576 (29%), Positives = 260/576 (45%), Gaps = 12/576 (2%)

Query: 175   LVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKD 234
             ++ KAG  + V+IP          W+K G +++  + R    +     T L +    R D
Sbjct: 14703 VIAKAGDNIKVEIPVLGRPKPTVTWKK-GDQILKQTQR-VNFETTATSTILNINECVRSD 14760

Query: 235   CGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVE 294
              G Y +T R+  G V   +T+QV D P PP GP++  +     V   W PP ++GG  + 
Sbjct: 14761 SGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPIS 14820

Query: 295   CYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEIL 354
              YVVE RQ   +TW+++       TT+    +  G +Y FRV+A    G G  + S  I+
Sbjct: 14821 NYVVEMRQTDSTTWVELATTVI-RTTYKATRLTTGLEYQFRVKAQNRYGVGPGITSACIV 14879

Query: 355   VA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQ 413
                P  +P  P  P + + +   +T++W  P   G + ILGY +ER+++    W  V+  
Sbjct: 14880 ANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKA 14939

Query: 414   PVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDR 473
              VP   +  + +  G  YEFRV A   +G  +P  PS+ + A DP+ PPG    L +T  
Sbjct: 14940 LVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNIT-- 14997

Query: 474   SNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYF 533
                ++TL WA P+   G +   Y+VE     + +WL  +   +    +T  GL     Y 
Sbjct: 14998 -RHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYE 15056

Query: 534   VRVTAVNEGGQ-SQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAM 592
              RV A N  G  S PS     +        PK  VD   KD + +K G+  R+       
Sbjct: 15057 FRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGR 15116

Query: 593   PMPEVTWLKDGLPLPKRSVTVTK--DGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSF 650
             P P + W KDG  L   +    K  D  T L+   +   DSG YT+   T  G    H F
Sbjct: 15117 PPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLT-ATNPGGFAKHIF 15175

Query: 651   RIRVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAAD 709
              ++V   P  P GP+ + E         W P  D+      HY V  R ++   W   A 
Sbjct: 15176 NVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVAS 15235

Query: 710   RIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
              +   +  +  +L G+EY FRV+A N+ G  +P ++
Sbjct: 15236 EVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLES 15271



 Score =  254 bits (650), Expect = 2e-67
 Identities = 189/666 (28%), Positives = 307/666 (46%), Gaps = 37/666 (5%)

Query: 98    SDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTF------VAG--DQ 149
             S++G G W K    + + +             F T    ++   Y F       AG   +
Sbjct: 22609 SEVGDGRWLKCNYTIVSDN-------------FFTVTALSEGDTYEFRVLAKNAAGVISK 22655

Query: 150   QSEATLTVQDSPTIAPDVTE---KLREPLV-VKAGKPVIVKIPFQSHLPIQAAWRKDGAE 205
              SE+T  V      AP   E   +L   LV ++AG  +++          +  W K G +
Sbjct: 22656 GSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTK-GDK 22714

Query: 206   VVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQ 265
              +   ++ +    G   T + +    R D G+Y++T+++  G+    + ++V+D P P  
Sbjct: 22715 ELDLCEKVSLQYTGKRATAV-IKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPC- 22772

Query: 266   GPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKV-GEAPADSTTFTDA 324
             G + V    +    L W  P+++GG  +  Y+VERR+  R  W+ V GE P  S   T  
Sbjct: 22773 GKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYVVT-- 22830

Query: 325   HVEPGRKYTFRVRAVTSEGAGEALESEEILVAPE-ALPKAPSAPAILSASSQGITLTWTA 383
              +    +Y FRVRAV   G G  +ESE I+      +P  P  P  +    + I + WT 
Sbjct: 22831 RLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTK 22890

Query: 384   PRGPGSAHILGYLIERRKKGSNTWTAVN-DQPVPERRWTVADVRQGCQYEFRVTAVAPSG 442
             P   G   I  YL+++R+K S  WT VN D  V + R  V  + +GC Y+FRVTAV  +G
Sbjct: 22891 PESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAG 22950

Query: 443   PGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCS 502
               EP   S+ +  R+P   PG     +V D +  SI+L+W  P    G +  GYV+E+  
Sbjct: 22951 NSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQE 23010

Query: 503   SDSLQWLPCHV-GTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTV 561
              D+ QW   H   T+  T +T   L+ G+ Y  RV AVN  G S+ S     ++ +    
Sbjct: 23011 KDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIE 23070

Query: 562   CPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQL 621
              P   +    K  +T++ G ++R+ VS    P P +TW K G+ L  R++  T +  + L
Sbjct: 23071 IPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSLL 23130

Query: 622   LIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWE-P 680
             ++      D+G YT+      GK+ A +  ++V   P     + ++E    +VT  WE P
Sbjct: 23131 IVDKVNRYDAGKYTIEAENQSGKKSA-TVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIP 23189

Query: 681   SPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGAS 740
             + D    V  +Y V  R +A   +     +     + + G++ G  Y+FRV+ +N  G  
Sbjct: 23190 TIDGGAPVN-NYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIG 23248

Query: 741   KPSDTS 746
             +P +TS
Sbjct: 23249 EPCETS 23254



 Score =  251 bits (640), Expect = 3e-66
 Identities = 182/661 (27%), Positives = 289/661 (43%), Gaps = 30/661 (4%)

Query: 126   VHSLFITHVQGTQAGRYTF------VAGDQQSEATLTVQDS--PTIAPDVTEKLREPLVV 177
             V  L  T     + G Y F       AG  +  AT+   D   P + P +   L+E + V
Sbjct: 9699  VEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQRPDMPPSID--LKEFMEV 9756

Query: 178   KAGKPV-----IVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGR 232
             + G  V     I  +PF +    +A  +K   +     D      + D    L +P + R
Sbjct: 9757  EEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRR 9816

Query: 233   KDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRT 292
              D G Y++T  +  G+   E+ L V+ +P PP GP++ +      + L W PP+D+GG  
Sbjct: 9817  SDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSK 9876

Query: 293   VECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESE- 351
             +  YV+E+R+A R TW+ V   P +  T+T   +  G +Y FR+ A    G GE L+SE 
Sbjct: 9877  ITNYVIEKREANRKTWVHVSSEPKE-CTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEP 9935

Query: 352   EILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVN 411
             E      ++P AP  P + S +   +T+ W  P   G + + GY +E +   S  W  VN
Sbjct: 9936  ETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVN 9995

Query: 412   DQPVPER----RWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRN 467
               P+        + V  + +G  Y+FRV A+  +G G    PSD   ARDP+ PPG    
Sbjct: 9996  RDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPG-PPF 10054

Query: 468   LQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLR 527
              +VTD + +S  L W+ P    G +  GY+VE       +W       V  T     GL+
Sbjct: 10055 PKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTGLK 10114

Query: 528   PGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPV 587
              G  Y  RV AVN  G  +P  +  +++     V P   +D+S +D + V  G  +R+  
Sbjct: 10115 EGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRIIA 10174

Query: 588   SFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVA 647
                  P P VTW  +   LP+ +   T    + ++I     S  G+Y+++ +   G E  
Sbjct: 10175 YVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAG-ERK 10233

Query: 648   HSFRIRVAACPQAPGPIHLQENVPG-TVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHE 706
              +  + V   P   G   L  N+   +    W    D+      +Y +  R S    W  
Sbjct: 10234 KTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTP 10293

Query: 707   AADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS------QPWCIPRQRDRFTV 760
                 +     T+ G++ G  Y FR+ A+N +G     +TS      +P  +P + +   V
Sbjct: 10294 VTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPERPEDLEV 10353

Query: 761   K 761
             K
Sbjct: 10354 K 10354



 Score =  250 bits (639), Expect = 3e-66
 Identities = 163/600 (27%), Positives = 269/600 (44%), Gaps = 17/600 (2%)

Query: 163   IAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGY 222
             + P   + L     V AG+ + V +PF         W KD   +  ++   A+    +  
Sbjct: 15773 VIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAEST--ENN 15830

Query: 223   TRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRW 282
             + L +  A R+D G Y V L +  G     L + V+DKP PP GP+++ +     + L W
Sbjct: 15831 SLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTADSITLSW 15890

Query: 283   RPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSE 342
              PP+ +GG ++  Y+VE+R    +TW ++  A    TT     ++ G +Y FR+ A    
Sbjct: 15891 GPPKYDGGSSINNYIVEKRDTSTTTW-QIVSATVARTTIKACRLKTGCEYQFRIAAENRY 15949

Query: 343   GAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRK 401
             G    L SE  +   P  +P  P  P +  +S   + + W  P   G + ++GY +ER++
Sbjct: 15950 GKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKE 16009

Query: 402   KGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRP 461
             + S  W  +N  P+P+ ++    + +G +YEFRV+A    G G+P   S+   ARDP  P
Sbjct: 16010 RNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDP 16069

Query: 462   PGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTY 521
             PG    + VT     S+TL W  P    G +  GY+VE       +W+      +  T +
Sbjct: 16070 PGRPEAIIVT---RNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASFTNIIDTHF 16126

Query: 522   TAKGLRPGEGYFVRVTAVNEGGQ-SQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVG 580
                GL     Y  RV A N  G  S+PS     + A      P+  +D   KD + V  G
Sbjct: 16127 EVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVVHAG 16186

Query: 581   DTVRVPVSFEAMPMPEVTWLKDGLPLPK--RSVTVTKDGLTQLLIPVAGLSDSGLYTVVL 638
             ++ +V       P+P + W+K    L    R    + D  T L +  A   DSG Y +  
Sbjct: 16187 ESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKA 16246

Query: 639   RTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTR 697
             + + G E + +  ++V   P  P GP+ +        T  W+P   +     ++Y V  R
Sbjct: 16247 KNVAG-ERSVTVNVKVLDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERR 16305

Query: 698   SSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT-----SQPWCIP 752
              ++   W      + T    +  +L G+EY FR++A N+ G  +P ++       P+ +P
Sbjct: 16306 ETSRLVWTVVDANVQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVP 16365



 Score =  249 bits (635), Expect = 1e-65
 Identities = 176/633 (27%), Positives = 288/633 (45%), Gaps = 32/633 (5%)

Query: 131   ITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVT--EKLREPL---VVKAGKPVIV 185
             +T +   Q  ++   A +++ ++   V   P IA D+T    L+ P     ++AG+ + +
Sbjct: 17900 VTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKI 17959

Query: 186   KIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSE 245
             +IP         +W KDG  +  ++     V+     T L +    + D G+Y+VT  + 
Sbjct: 17960 EIPVIGRPRPNISWVKDGEPLKQTT--RVNVEETATSTVLHIKEGNKDDFGKYTVTATNS 18017

Query: 246   GGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGR 305
              G+    L++ V++KP PP GP+   +     V + W PP   GG  +  Y+VE+R    
Sbjct: 18018 AGTATENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTT 18077

Query: 306   STWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA-PEALPKAP 364
             +TW  V    A  TT     ++ G +Y FR+ A    G    L+S+ ++V  P   P  P
Sbjct: 18078 TTWHMVSATVA-RTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPGPP 18136

Query: 365   SAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVAD 424
               P + S S   + + W  P   G   I+GY +E+++K S  W  +N  P+ + ++    
Sbjct: 18137 GTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTG 18196

Query: 425   VRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAG 484
             + +G +YEF+V+A    G G+P   S+   ARDP  PPG    + +T     ++TL W  
Sbjct: 18197 LDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVIT---RNNVTLKWKK 18253

Query: 485   PDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ 544
             P    G +  GY+VE       +W+      V  T +T  GL   + Y  RV A N  G 
Sbjct: 18254 PAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGN 18313

Query: 545   -SQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDG 603
              S+PS     + A      P   +D   KD++ V  G+T  +       P+P+V W KDG
Sbjct: 18314 FSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDG 18373

Query: 604   LPLPKRSV------TVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAAC 657
               L + +       T+ K   T L++     +D G Y + L  + G +   S  I V   
Sbjct: 18374 KELEETAARMEIKSTIQK---TTLVVKDCIRTDGGQYILKLSNVGGTK---SIPITVKVL 18427

Query: 658   PQAPGPIHLQENVPGTVTAE-----WEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIH 712
              + PGP      V G VTAE     W P   +      HY +  R ++   W + +  + 
Sbjct: 18428 DR-PGPPEGPLKVTG-VTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQ 18485

Query: 713   TNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
                + +  +LPG+EY FRV+A N+ G  +P ++
Sbjct: 18486 ALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLES 18518



 Score =  246 bits (627), Expect = 9e-65
 Identities = 164/614 (26%), Positives = 286/614 (46%), Gaps = 24/614 (3%)

Query: 161   PTIAPDVTEKLREPLV-----VKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQ 215
             P IA D+  K    L      VKA + + + +PF+        WRKDG  +  ++     
Sbjct: 19013 PVIARDIEIKPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETT--RVN 19070

Query: 216   VDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHR 275
             V      T L +  A ++D G Y + + +  GS+   +T+ V+D+P PP GP+ + +   
Sbjct: 19071 VSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPP-GPIRIDEVSC 19129

Query: 276   AGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFR 335
               + + W PP  +GG  +  Y+VE+++   +TW  V +A A  T+     +  G +Y FR
Sbjct: 19130 DSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVA-RTSIKIVRLTTGSEYQFR 19188

Query: 336   VRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILG 394
             V A    G     ES  ++   P + P  P  P ++ A+   + +TW  P   G + ++G
Sbjct: 19189 VCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIG 19248

Query: 395   YLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVF 454
             Y +E +++ S  W+  N   + + +  V+ + +G  YE+RV A   +G G+     + V 
Sbjct: 19249 YHLEYKERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVP 19308

Query: 455   ARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVG 514
             ARDP  PPG     +VT+ +  S++L W+ P    G +  GY+VE       +WL C+  
Sbjct: 19309 ARDPCDPPG---QPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYT 19365

Query: 515   TVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ-SQPSALDTLVQAMPVTVCPKFLVDSSTKD 573
              +  T +    L   + Y  RV A N     S+PS     +        P+ ++D   +D
Sbjct: 19366 NIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRD 19425

Query: 574   LLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVT--VTKDGLTQLLIPVAGLSDS 631
             ++ VK G+ +++       P+P ++W KDG+ + +R+ T  ++ D  T L +      D+
Sbjct: 19426 VIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDT 19485

Query: 632   GLYTVVLRTLQG-KEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEW-EPSPDEAQDVP 689
             G Y + L+ + G + VA + ++     P A GP+ +        +  W  P  D   D+ 
Sbjct: 19486 GQYVLTLKNVAGTRSVAVNCKVLDKPGPPA-GPLEINGLTAEKCSLSWGRPQEDGGADID 19544

Query: 690   LHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPW 749
              +Y V  R ++H  W      +      +  +L G+EY FRV   N+ G  +P ++    
Sbjct: 19545 -YYIVEKRETSHLAWTICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLES---- 19599

Query: 750   CIPRQRDRFTVKAP 763
                +  D FTV +P
Sbjct: 19600 VAIKALDPFTVPSP 19613



 Score =  244 bits (624), Expect = 2e-64
 Identities = 172/644 (26%), Positives = 276/644 (42%), Gaps = 35/644 (5%)

Query: 148   DQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVV 207
             D +S A   V     I PDV         V+ G+ + +++P          W KDG  + 
Sbjct: 16841 DPRSLAVPIVAKDLVIEPDVKPAFSS-YSVQVGQDLKIEVPISGRPKPTITWTKDGLPL- 16898

Query: 208   GSSDREAQVDLGDGY--TRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQ 265
                 +  ++++ D    T L +    + D GQY +T+ +  G   A + +  +DKPDPP+
Sbjct: 16899 ---KQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPK 16955

Query: 266   GPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAH 325
             GP++  D     + L W PP   GG  +  Y+V++R    + W  V  A    TT     
Sbjct: 16956 GPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVW-DVVSATVARTTLKVTK 17014

Query: 326   VEPGRKYTFRVRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAP 384
             ++ G +Y FR+ A    G   ALES+ I+   P   P  P  P   + S   + + W  P
Sbjct: 17015 LKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEP 17074

Query: 385   RGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPG 444
                G + ++GY +ER+++ S  WT VN   + + ++   ++ +G +YEFRV A    G G
Sbjct: 17075 VNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVG 17134

Query: 445   EPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSD 504
             +    S+   ARDP  PPG    + V       ITL W  P    G    GY+VE     
Sbjct: 17135 KASKNSECYVARDPCDPPGTPEPIMV---KRNEITLQWTKPVYDGGSMITGYIVEKRDLP 17191

Query: 505   SLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ-SQPSALDTLVQAMPVTVCP 563
               +W+      V  T +T  GL   + Y  RV A N  G  S+PS     + A      P
Sbjct: 17192 DGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELP 17251

Query: 564   KFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPK--RSVTVTKDGLTQL 621
             +  +D   +D + V  G+T R+       P+P + WL+    + +  R      D    L
Sbjct: 17252 RISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALL 17311

Query: 622   LIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWEP 680
             ++  A   D G Y +    + G + +    ++V   P  P GP+ +        +  W P
Sbjct: 17312 IVKDAIRIDGGQYILRASNVAGSK-SFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSP 17370

Query: 681   SPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGAS 740
                +      HY V  R ++   W   A  + TN   +  +L G+EY FR++A N+ G  
Sbjct: 17371 PLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVG 17430

Query: 741   KPSDTS-----QPWCIPR----------QRDRFTVKAPCYREPD 769
             +P +++      P+ +P            +D  TV   C+  PD
Sbjct: 17431 EPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTV---CWNRPD 17471



 Score =  235 bits (600), Expect = 1e-61
 Identities = 155/574 (27%), Positives = 257/574 (44%), Gaps = 12/574 (2%)

Query: 177   VKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCG 236
             V+AG  + V IP       +    +DG  +  +     ++   +    + L  +   D G
Sbjct: 20116 VRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAEN--LTINLKESVTADAG 20173

Query: 237   QYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECY 296
             +Y +T  +  G+ +A + + V+D+P PP GP+ + D     V L+W PP+ +GG  V  Y
Sbjct: 20174 RYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNY 20233

Query: 297   VVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA 356
             ++ +R+   + W +V    A  T      +  G +Y FR++A    G  + ++S  + V 
Sbjct: 20234 ILLKRETSTAVWTEVSATVA-RTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVK 20292

Query: 357   -PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPV 415
              P   P  PS P + + + + IT+ W  P   G + ++GY +E + + S  W   N   +
Sbjct: 20293 LPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVI 20352

Query: 416   PERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSN 475
                 + V  +  G  YEFRV A   +G G+P  PS+ V A D   PP   RN+++TD S 
Sbjct: 20353 RTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPP---RNVRITDISK 20409

Query: 476   TSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVR 535
              S++LSW  P    G +  GY+VE       +W       V  T +   GL     Y  R
Sbjct: 20410 NSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFR 20469

Query: 536   VTAVNE-GGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPM 594
             V A N  G  S PS +   +  +     P   +     +++  + G +V++       P 
Sbjct: 20470 VFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPA 20529

Query: 595   PEVTWLKDGLPLPKRSVTVTKD--GLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRI 652
             P + W KD   L   ++   ++   L  +LI  A   +SG Y + LR   G   A + R+
Sbjct: 20530 PTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASA-TIRV 20588

Query: 653   RVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRI 711
             ++   P  P GPI  +      +T  W P  D+      HY V  R ++   W   ++ +
Sbjct: 20589 QILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHL 20648

Query: 712   HTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
                  T   I+ G+EY FRV A N+ G  +P ++
Sbjct: 20649 EECIITTTKIIKGNEYIFRVRAVNKYGIGEPLES 20682



 Score =  225 bits (574), Expect = 1e-58
 Identities = 172/598 (28%), Positives = 266/598 (44%), Gaps = 43/598 (7%)

Query: 157  VQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQV 216
            ++D   I P+  +K   PLV +    V  + PF   LP+      D ++           
Sbjct: 8342 IKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFV--LPLTQRLSIDNSK----------- 8388

Query: 217  DLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRA 276
                G ++L +  + R D G Y + + ++ G  +A  T+ V+D P PP      +D  + 
Sbjct: 8389 ---KGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPIN-FVFEDIRKT 8444

Query: 277  GVCLRWRPPRDNGGRTVECYVVERRQAGR--STWLKVGEAPADSTTFTDAHVEPGRKYTF 334
             V  +W PP D+GG  +  Y +E++   +  S W+ V              +E G++Y F
Sbjct: 8445 SVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIE-GKEYLF 8503

Query: 335  RVRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHIL 393
            RVRA    G G    S+ ++   P   P AP  P +   +S  + + W  P+  GS  IL
Sbjct: 8504 RVRAENRFGPGPPCVSKPLVAKDPFGPPDAPDKPIVEDVTSNSMLVKWNEPKDNGSP-IL 8562

Query: 394  GYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAV 453
            GY +E+R+  S  W+ VN   +   +  V  + +G  Y FRV A   +GPG+  PPSD  
Sbjct: 8563 GYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPK 8622

Query: 454  FARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHV 513
             A DP+ PPG     +VTD S+T+I L W  P    G E  GY V+     + +W  C  
Sbjct: 8623 TAHDPISPPGPPIP-RVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTE 8681

Query: 514  GTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVC-----PKFLVD 568
              + V  YT K +R G  Y +RV+AVN  G+  P       +  PVTV      P   +D
Sbjct: 8682 KMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPG------ETQPVTVAEPQEPPAVELD 8735

Query: 569  SSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGL-TQLLIPVAG 627
             S K  + +  G T+R+P      P+P   W K+   L K  V +   G  ++L+I  A 
Sbjct: 8736 VSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSELIIKDAL 8795

Query: 628  LSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPI-HLQENVPG--TVTAEWEPSPDE 684
              D G Y +      G + A + R+ V      PGP+  L+  V         W    D+
Sbjct: 8796 RKDHGRYVITATNSCGSKFA-AARVEVF---DVPGPVLDLKPVVTNRKMCLLNWSDPEDD 8851

Query: 685  AQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKP 742
                   + +  + +    W +  +    ++  + G+L G EY FRV+AKN+ G   P
Sbjct: 8852 GGSEITGFIIERKDAKMHTWRQPIE-TERSKCDITGLLEGQEYKFRVIAKNKFGCGPP 8908



 Score =  219 bits (559), Expect = 7e-57
 Identities = 163/614 (26%), Positives = 274/614 (44%), Gaps = 23/614 (3%)

Query: 161   PTIAP--DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDL 218
             P I P  D+T    + +  KAG P  + +P       +  W+ +   +   +DR +    
Sbjct: 22269 PQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLK-ETDRVSITTT 22327

Query: 219   GDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGV 278
              D  T L +  + R D G+Y +TL +  G     +T+ VI +P P  GP+EV        
Sbjct: 22328 KDR-TTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESC 22386

Query: 279   CLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRA 338
              L W  P+D GG  +  Y+VE+R++G + W  V  +    T     H+    +Y+FRV +
Sbjct: 22387 VLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSS-VKRTQIKVTHLTKYMEYSFRVSS 22445

Query: 339   VTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLI 397
                 G  + LES  I+   P   P AP+ P +   S+  +++ W  P   G + I+GY +
Sbjct: 22446 ENRFGVSKPLESAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWV 22505

Query: 398   ERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARD 457
             E++++ +  W   N  P  E  + V  + +G +Y+FR  A+  +G  +    S  + A++
Sbjct: 22506 EKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQN 22565

Query: 458   PMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVE---LCSSDSLQWLPCHVG 514
             P+  PG     +VTD + ++++L W+ P    G +  GY++E   +      +WL C+  
Sbjct: 22566 PVDAPG---RPEVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYT 22622

Query: 515   TVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ-SQPSALDTLVQAMPVTVCPKFLVDSSTK- 572
              V    +T   L  G+ Y  RV A N  G  S+ S     V        PK  +D+    
Sbjct: 22623 IVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHG 22682

Query: 573   DLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPL---PKRSVTVTKDGLTQLLIPVAGLS 629
             DL+T++ G  + +  +    P P++ W K    L    K S+  T    T  +I     S
Sbjct: 22683 DLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRAT-AVIKFCDRS 22741

Query: 630   DSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVP 689
             DSG YT+ ++   G + A S  ++V   P   G + +        T  W    ++     
Sbjct: 22742 DSGKYTLTVKNASGTK-AVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEI 22800

Query: 690   LHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPW 749
              HY V  R ++   W        T  + +  ++  +EY FRV A N+ G   P + S+P 
Sbjct: 22801 THYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVE-SEPI 22859

Query: 750   CIPRQRDRFTVKAP 763
                  R+ FT+ +P
Sbjct: 22860 V---ARNSFTIPSP 22870



 Score =  213 bits (543), Expect = 5e-55
 Identities = 165/619 (26%), Positives = 276/619 (44%), Gaps = 48/619 (7%)

Query: 165  PDVTEKLREPLVVK--------AGKPVIVKIPFQSHLPIQAAWRK---DGAEVVGS---- 209
            P    K  EP+++K         GKP +  +   S   ++  W K   DG   + S    
Sbjct: 7593 PGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTS---VRLNWTKPEHDGGAKIESYVIE 7649

Query: 210  -----SDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAE--------LTLQ 256
                 +D   +V  G   T+  LP  G  +  +YS  +R+   + ++E        L  +
Sbjct: 7650 MLKTGTDEWVRVAEGVPTTQHLLP--GLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCRE 7707

Query: 257  VIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPA 316
             +  P PP+  +EV +  +    L+W  P  +GG  +  Y+VE+R   R  W  V     
Sbjct: 7708 KLYPPSPPRW-LEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVK 7766

Query: 317  DSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEAL--PKAPSAPAILSASS 374
            D T  T   +  G  Y FRV A  + G  +  E E+ ++A +    P  P A A++  + 
Sbjct: 7767 D-TKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTK 7825

Query: 375  QGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFR 434
            + + L W  P+  G   I  Y+IE++++    W        P+  + V DV +G + +F+
Sbjct: 7826 RHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQ 7885

Query: 435  VTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQ 494
            V A   +G G P  P++ +   DP  PP    +L VTD     I ++W  P+   G    
Sbjct: 7886 VRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPII 7945

Query: 495  GYVVELCSSDSLQWLPCHVGTVPVTTYTAK---GLRPGEGYFVRVTAVNEGGQSQPSALD 551
            GY VE+C   + +W+   V + P+     K   G+ P + Y +RV AVN  G S+PS + 
Sbjct: 7946 GYHVEMCPVGTEKWM--RVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEIS 8003

Query: 552  TLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRS- 610
              V A      P   +D  T D++ ++ G+ + +PV F A+P+P V+W KDG  +     
Sbjct: 8004 ENVVAKDPDCKP--TIDLETHDIIVIE-GEKLSIPVPFRAVPVPTVSWHKDGKEVKASDR 8060

Query: 611  VTVTKDGLT-QLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQEN 669
            +T+  D ++  L +P +  +D+G+YT+ L    G   A S  ++V   P     I   + 
Sbjct: 8061 LTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATA-SINVKVIGLPGPCKDIKASDI 8119

Query: 670  VPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHF 729
               +    WEP   +     LHY +  R +    +       +   +T+  ++P  EY F
Sbjct: 8120 TKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFF 8179

Query: 730  RVVAKNELGASKPSDTSQP 748
            RV A N++G  +  +   P
Sbjct: 8180 RVKAVNKVGGGEYIELKNP 8198



 Score =  213 bits (542), Expect = 6e-55
 Identities = 140/514 (27%), Positives = 236/514 (45%), Gaps = 13/514 (2%)

Query: 166   DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
             ++ E+ +E + V+ G  + + IP +        W K+G ++     + A +   + +T L
Sbjct: 23765 ELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDI----SKRAMIATSETHTEL 23820

Query: 226   CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPP 285
              +  A R D G Y + L ++ G     + ++VI  P+ P+GP+E  D     V + WRPP
Sbjct: 23821 VIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPP 23880

Query: 286   RDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAG 345
              D+GG  +  Y++ERR+  ++ W  + ++    T+     ++   +Y FRV A    G  
Sbjct: 23881 ADDGGADILGYILERREVPKAAWYTI-DSRVRGTSLVVKGLKENVEYHFRVSAENQFGIS 23939

Query: 346   EALESEEILVAPEAL--PKAPS-APAILSASSQGITLTWTAPRGPGSAHILGYLIERRKK 402
             + L+SEE +     L  P+ PS  P +L  +   ++L+W+ P+  G + + GY IER++ 
Sbjct: 23940 KPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKET 23999

Query: 403   GSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP 462
              ++ W   N   +    +TV  +    +Y+FR+ A    G  E  P S+ V  +DP   P
Sbjct: 24000 STDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKP 24059

Query: 463   GLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYT 522
                  L++   S  S+TL W  P+   G E  GY VE   S    W   +   +    +T
Sbjct: 24060 SQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFT 24119

Query: 523   AKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDT 582
               GL     Y  RV A NE G S+P      ++   +T      +    KD +T K+G+ 
Sbjct: 24120 IGGLLEATEYEFRVFAENETGLSRPRRTAMSIKT-KLTSGEAPGIRKEMKD-VTTKLGEA 24177

Query: 583   VRVPVSFEAMPMPEVTWLKDGLPL-PKRSVTVTKDGLTQ-LLIPVAGLSDSGLYTVVLRT 640
              ++       P+P++ W + G  L   R   ++ DG T  L +      D G+YT +   
Sbjct: 24178 AQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATN 24237

Query: 641   LQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTV 674
               G EV  S ++ + A PQ      L+E   G V
Sbjct: 24238 EVG-EVETSSKLLLQATPQFHPGYPLKEKYYGAV 24270



 Score =  203 bits (517), Expect = 5e-52
 Identities = 159/606 (26%), Positives = 257/606 (42%), Gaps = 32/606 (5%)

Query: 158  QDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVD 217
            Q++P I  DV  KL   L VKAG  + +          +  W K  A+++   D+   ++
Sbjct: 7313 QEAPEIFLDV--KLLAGLTVKAGTKIELPATVTGKPEPKITWTK--ADMILKQDKRITIE 7368

Query: 218  LGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAG 277
                 + + +  + R D G Y +   +  G   A + + V+DKP PP    ++ D     
Sbjct: 7369 NVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAA-FDITDVTNES 7427

Query: 278  VCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVR 337
              L W PPRD+GG  +  YVVERR      W K+     D T F    + P ++Y FRV 
Sbjct: 7428 CLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKD-TNFKATKLIPNKEYIFRVA 7486

Query: 338  AVTSEGAGEALESEEILVAPEALPKAPSAPAILSASS---QGITLTWTAPRGPGSAHILG 394
            A    G GE +++  I    +  P  P  P  L  S      +TLTW  P   G + I G
Sbjct: 7487 AENMYGVGEPVQASPITAKYQFDPPGP--PTRLEPSDITKDAVTLTWCEPDDDGGSPITG 7544

Query: 395  YLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVF 454
            Y +ER    ++ W   N  PV +  + V  +    +Y FRV A   +GPG+P   ++ + 
Sbjct: 7545 YWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPIL 7604

Query: 455  ARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVG 514
             +DP+ PP       V D   TS+ L+W  P+   G + + YV+E+  + + +W+    G
Sbjct: 7605 IKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEG 7664

Query: 515  TVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDL 574
             VP T +   GL  G+ Y  RV AVN+ G+S+PS       + PV    K    S  + L
Sbjct: 7665 -VPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSE-----PSDPVLCREKLYPPSPPRWL 7718

Query: 575  LTVKVGDT---VRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDS 631
              + +      ++  V  +    P   ++ +   + ++        +      V  L++ 
Sbjct: 7719 EVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEG 7778

Query: 632  GLYTVVLRTLQGKEVAHSFRIRVAACPQA------PGPIHLQENVPGT---VTAEWEPSP 682
             LY  V R      +  S    +     A      PGP +    V  T   V  +WEP  
Sbjct: 7779 SLY--VFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPK 7836

Query: 683  DEAQDVPLHYAVFTRSSAHGPWHEAADRIHTN-RFTLLGILPGHEYHFRVVAKNELGASK 741
            ++       Y +  +      W +A      +  F +  ++ G E  F+V A+NE G   
Sbjct: 7837 NDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGH 7896

Query: 742  PSDTSQ 747
            PS+ ++
Sbjct: 7897 PSEPTE 7902



 Score =  199 bits (506), Expect = 9e-51
 Identities = 178/707 (25%), Positives = 304/707 (42%), Gaps = 53/707 (7%)

Query: 79    LADMEVQPGEAATLSCTLTSDLGPGT-WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGT 137
             + D+  + GEAA LSC +     P   W++ G +L          DG  H+L +   +  
Sbjct: 24167 MKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQE 24226

Query: 138   QAGRYTFVA----GDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHL 193
               G YT +A    G+ ++ + L +Q +P   P     L+E      G  + + + +    
Sbjct: 24227 DEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYP--LKEKYYGAVGSTLRLHVMYIGR- 24283

Query: 194   PIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKD-CGQYSVTLRSEGGSVQAE 252
             P+ A     G +++ +S+    ++  + YT L + +  RK   G+Y V L +  G+V A 
Sbjct: 24284 PVPAMTWFHGQKLLQNSEN-ITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAI 24342

Query: 253   LTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVG 312
             L +++ DKPD P GP+ ++   +    + W+PP D+GG  +  YVVE+ +A      ++ 
Sbjct: 24343 LDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLV 24402

Query: 313   EAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILV--APEALPKAPSAPAIL 370
              +    TT    ++     Y FRV A  + G  + LE   +++  +P   P AP  P I 
Sbjct: 24403 SSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTIT 24462

Query: 371   SASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQ 430
             + +     + W  P   G A I  Y +E+R+K  N W +V  + + E  ++V ++ +G +
Sbjct: 24463 AVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLE 24522

Query: 431   YEFRVTAVAPSGPGEPGPPSDAVFARD--PMRPPGL---VRNLQVTDRSNTSITLSWAGP 485
             YEFRV      G  E    S+ +  +   P++ P     +RNL V  +SN ++     G 
Sbjct: 24523 YEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGH 24582

Query: 486   DT------QEGDE--AQG--YVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVR 535
                     ++G E  A G  Y ++       Q +   V     T Y             +
Sbjct: 24583 PKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVY-------------Q 24629

Query: 536   VTAVNEGGQSQPSALDTLVQAMPVTV-CPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPM 594
             V A N+GG    +A  +L   +P  +  PK L        L    G+ V + + F   P 
Sbjct: 24630 VRATNQGGSVSGTA--SLEVEVPAKIHLPKTLEGMGAVHALR---GEVVSIKIPFSGKPD 24684

Query: 595   PEVTWLK--DGLPLPKRSVTVTKDGLTQLLIP-VAGLSDSGLYTVVLRTLQGKEVAHSFR 651
             P +TW K  D +        +     T L+ P      D+G Y V  +   G +   +  
Sbjct: 24685 PVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGID-QKTVE 24743

Query: 652   IRVAACPQAPGPIHLQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADR 710
             + VA  P  P  + + +    +V   W EP+ D    +  +Y V   ++    W      
Sbjct: 24744 LDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKI-TNYIVEKCATTAERWLRVGQA 24802

Query: 711   IHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDR 757
               T R+T++ +     Y FRV+A+N+ G SKPS+ S+P      + R
Sbjct: 24803 RET-RYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTR 24848



 Score =  179 bits (453), Expect = 1e-44
 Identities = 119/400 (29%), Positives = 180/400 (45%), Gaps = 7/400 (1%)

Query: 350  SEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTA 409
            S EI V   A P AP        +   + LTW  P   G + + GY++E+R+    TWT 
Sbjct: 7105 SGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTK 7164

Query: 410  VNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQ 469
            V D  V +  +TV D+ QG +Y F+V A    GPGEP    + V    P   P    N++
Sbjct: 7165 VMDF-VTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVK 7223

Query: 470  VTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPG 529
              DR+  SI L+W  P    G   +GY+VE C   S +W+ C    V  T     GL  G
Sbjct: 7224 WRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACG-EPVAETKMEVTGLEEG 7282

Query: 530  EGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSF 589
            + Y  RV A+N  G S+PS     +QA+     P+  +D      LTVK G  + +P + 
Sbjct: 7283 KWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATV 7342

Query: 590  EAMPMPEVTWLKDGLPLPKRSVTVTKDGL---TQLLIPVAGLSDSGLYTVVLRTLQGKEV 646
               P P++TW K  + L K+   +T + +   + + I  +  SD+G Y +    + G+  
Sbjct: 7343 TGKPEPKITWTKADMIL-KQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRAT 7401

Query: 647  AHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHE 706
            A    + V   P  P    + +    +    W P  D+      +Y V  R++    WH+
Sbjct: 7402 A-VVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHK 7460

Query: 707  AADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS 746
             +  +    F    ++P  EY FRV A+N  G  +P   S
Sbjct: 7461 LSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQAS 7500



 Score =  168 bits (426), Expect = 2e-41
 Identities = 155/598 (25%), Positives = 246/598 (41%), Gaps = 56/598 (9%)

Query: 180   GKPVIVKIPFQSHLPIQAAWRK---DGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCG 236
             G P   K+   S   +  AW K   DG   V     E +    D +T  C P  G +   
Sbjct: 18632 GPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTT-CTPPTGLQG-K 18689

Query: 237   QYSVT--------------LRSEGGSVQAELTLQVI--DKPDPPQGPMEVQDCHRAGVCL 280
             Q++VT              + SEG    A L   V+  ++ +PP+  +E+    R  V L
Sbjct: 18690 QFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPE--IELDADLRKVVVL 18747

Query: 281   RWRPPRDNGGRTVECYV-VERRQAGRSTWLKVGEAPAD------STTFTDAHVEPGRKYT 333
             R          T+  +V ++ R      W K      D      +++FT   ++   ++ 
Sbjct: 18748 R-------ASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTMLVIDNVTRFD 18800

Query: 334   ---FRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSA 390
                + +    + G+  A  +  +L +P A    P    I       +TL+W  P   G A
Sbjct: 18801 SGRYNLTLENNSGSKTAFVNVRVLDSPSA----PVNLTIREVKKDSVTLSWEPPLIDGGA 18856

Query: 391   HILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPS 450
              I  Y++E+R+     +  + +    +  + + ++++GC Y FRV A    G G P   +
Sbjct: 18857 KITNYIVEKRETTRKAYATITNN-CTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETT 18915

Query: 451   DAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLP 510
             + V   +P  PPG V  + VT     + T+ W  P++  G +  GYVVE+ +  S +W  
Sbjct: 18916 EPVKVSEPPLPPGRVTLVDVT---RNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWST 18972

Query: 511   CHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSS 570
             C    V     T  GL  GE Y  RV AVNE G+S P  L   V A  + + P   +   
Sbjct: 18973 C--TQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFH 19030

Query: 571   TKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPK--RSVTVTKDGLTQLLIPVAGL 628
             T     VK  + +++ V F+  P   V W KDG  L +  R    +   +T L I  A  
Sbjct: 19031 T---FNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASK 19087

Query: 629   SDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDV 688
              D G Y + +    G  +     I V   P  PGPI + E    ++T  W P   +    
Sbjct: 19088 EDVGTYELCVSNSAG-SITVPITIIVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQ 19146

Query: 689   PLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS 746
               +Y V  + +    WH  +  +      ++ +  G EY FRV A+N  G S  S++S
Sbjct: 19147 ISNYIVEKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESS 19204



 Score =  166 bits (421), Expect = 7e-41
 Identities = 120/400 (30%), Positives = 179/400 (44%), Gaps = 18/400 (4%)

Query: 361   PKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRW 420
             P  P    +   +   +TLTW  P   G + I  Y++E+R+     ++ V      +  W
Sbjct: 15580 PGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATN-CHKTSW 15638

Query: 421   TVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITL 480
              V  +++GC Y FRV A    G G P   +++V A +   PPG +  + VT     S++L
Sbjct: 15639 KVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITLMDVT---RNSVSL 15695

Query: 481   SWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVN 540
             SW  P+   G    GY+VE+ +  S +W  C   TV VT  T  GL  GE Y  RV+A N
Sbjct: 15696 SWEKPEHDGGSRILGYIVEMQTKGSDKWATC--ATVKVTEATITGLIQGEEYSFRVSAQN 15753

Query: 541   EGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWL 600
             E G S P  L   V A  + + P F +  +T    TV  G+ ++V V F   P P VTW 
Sbjct: 15754 EKGISDPRQLSVPVIAKDLVIPPAFKLLFNT---FTVLAGEDLKVDVPFIGRPTPAVTWH 15810

Query: 601   KDGLPLPK--RSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACP 658
             KD +PL +  R    + +  + L I  A   D G Y V L    G E   +  + V   P
Sbjct: 15811 KDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAG-EAIETLNVIVLDKP 15869

Query: 659   QAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFT 717
               P GP+ + E    ++T  W P   +      +Y V  R ++   W   +  +      
Sbjct: 15870 GPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIK 15929

Query: 718   LLGILPGHEYHFRVVAKNELGA-----SKPSDTSQPWCIP 752
                +  G EY FR+ A+N  G      S+P+    P+ +P
Sbjct: 15930 ACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVP 15969



 Score =  160 bits (404), Expect = 6e-39
 Identities = 152/602 (25%), Positives = 240/602 (39%), Gaps = 42/602 (6%)

Query: 170   KLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKD----GAEVVGSSDREAQVDLGDG---- 221
             K REP V   G P +VK+   S   +   W K     G E++G      + DLGD     
Sbjct: 21874 KCREP-VNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVN 21932

Query: 222   --------YTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEV--Q 271
                     YT   L +         ++    +G S +   T++ +D+   P+  ++   +
Sbjct: 21933 AEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFK 21992

Query: 272   DCH--RAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADST-TFTDAHVEP 328
               H  RAG  +R        GR     V  +  +  S    +    + ST T  + +   
Sbjct: 21993 QTHVVRAGASIRLFIAYQ--GRPTPTAVWSKPDSNLSLRADIHTTDSFSTLTVENCNRND 22050

Query: 329   GRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQG-ITLTWTAPRGP 387
               KYT  V    + G+     + ++L  P      P  P      ++G  TL W AP   
Sbjct: 22051 AGKYTLTVE--NNSGSKSITFTVKVLDTP-----GPPGPITFKDVTRGSATLMWDAPLLD 22103

Query: 388   GSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPG 447
             G A I  Y++E+R+    +W  ++++    + + V D+ +G  Y FRV+AV   G GEP 
Sbjct: 22104 GGARIHHYVVEKREASRRSWQVISEK-CTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPY 22162

Query: 448   PPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQ 507
                + + A +   PP   R L V D S +S  L+W  PD   G    GY++E+    S  
Sbjct: 22163 EMPEPIVATEQPAPP---RRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDF 22219

Query: 508   WLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLV 567
             W+    G     T+T + L     Y  RV A N+ G S+P    + V      + P   +
Sbjct: 22220 WV--EAGHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADL 22277

Query: 568   DSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKR---SVTVTKDGLTQLLIP 624
                T  L+T K G    + V     P P+VTW  + + L +    S+T TKD  T L + 
Sbjct: 22278 TGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKD-RTTLTVK 22336

Query: 625   VAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDE 684
              +   DSG Y + L    G +      + +       GPI +      +    W    D 
Sbjct: 22337 DSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDG 22396

Query: 685   AQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSD 744
                   +Y V  R S    W      +   +  +  +    EY FRV ++N  G SKP +
Sbjct: 22397 GGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE 22456

Query: 745   TS 746
             ++
Sbjct: 22457 SA 22458



 Score =  158 bits (399), Expect = 2e-38
 Identities = 187/767 (24%), Positives = 303/767 (39%), Gaps = 57/767 (7%)

Query: 103   GTWFKDGVK--LTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDS 160
             G W K   +  + T+  V   Q G  +   ++ + G   G    V G  ++   LT  + 
Sbjct: 21926 GDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPEL 21985

Query: 161   PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGD 220
                  D+    ++  VV+AG  + + I +Q      A W K  + +       A +   D
Sbjct: 21986 -----DIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNL----SLRADIHTTD 22036

Query: 221   GYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCL 280
              ++ L + +  R D G+Y++T+ +  GS     T++V+D P PP GP+  +D  R    L
Sbjct: 22037 SFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPP-GPITFKDVTRGSATL 22095

Query: 281   RWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVT 340
              W  P  +GG  +  YVVE+R+A R +W  + E       F    +  G  Y FRV AV 
Sbjct: 22096 MWDAPLLDGGARIHHYVVEKREASRRSWQVISE-KCTRQIFKVNDLAEGVPYYFRVSAVN 22154

Query: 341   SEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERR 400
               G GE  E  E +VA E  P  P    ++  S     L W  P   G + I GYL+E R
Sbjct: 22155 EYGVGEPYEMPEPIVATEQ-PAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMR 22213

Query: 401   KKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMR 460
             +KGS+ W  V      +  +TV  + +  +YEFRV A   +G  EP     +V  ++P  
Sbjct: 22214 QKGSDFW--VEAGHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQI 22271

Query: 461   PPGLVRNLQVTDRSNTSITLSWAGPDTQE----GDEAQGYVVELCSSDSLQWLPCHVGTV 516
              P       +T  +N  IT     P T +    G  A     +L      +     + T 
Sbjct: 22272 EP----TADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTT 22327

Query: 517   -PVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLL 575
                TT T K    G+     +T  N  G  +  ++  +V   P  V     V S + +  
Sbjct: 22328 KDRTTLTVKDSMRGDSGRYFLTLENTAG-VKTFSVTVVVIGRPGPVTGPIEVSSVSAESC 22386

Query: 576   TVKVGD------TVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLS 629
              +  G+      T       E        W      + +  + VT   LT+ +     +S
Sbjct: 22387 VLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTH--LTKYMEYSFRVS 22444

Query: 630   DSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVP 689
                 +  V + L+   +         + P  P   H+  N    ++  WE    +     
Sbjct: 22445 SENRFG-VSKPLESAPIIAEHPFVPPSAPTRPEVYHVSAN---AMSIRWEEPYHDGGSKI 22500

Query: 690   LHYAVFTRSSAHGPW--HEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQ 747
             + Y V  +      W        +  N + + G++ G EY FR  A N  G SK S+ S+
Sbjct: 22501 IGYWVEKKERNTILWVKENKVPCLECN-YKVTGLVEGLEYQFRTYALNAAGVSKASEASR 22559

Query: 748   PWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGL-RSHLLPQGCECCMSCAVQGSPRPHVT 806
             P  I  Q     V AP    P+++   R  V L  S     G    +   ++  P   V+
Sbjct: 22560 P--IMAQN---PVDAP--GRPEVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKP---VS 22609

Query: 807   WFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLG 853
                + R L+ N  + S +       T+ ++S  D+ E++ +A+N  G
Sbjct: 22610 EVGDGRWLKCNYTIVSDNF-----FTVTALSEGDTYEFRVLAKNAAG 22651



 Score =  157 bits (397), Expect = 4e-38
 Identities = 114/426 (26%), Positives = 187/426 (43%), Gaps = 14/426 (3%)

Query: 318   STTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGI 377
             +++FT   ++   +Y      +T E +    +S  + V     P  P    +   +   +
Sbjct: 16620 TSSFTSLVLDNVNRYDSGKYTLTLENSS-GTKSAFVTVRVLDTPSPPVNLKVTEITKDSV 16678

Query: 378   TLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTA 437
             ++TW  P   G + I  Y++E+R+    ++ AV      +  W +  +++GC Y FRVTA
Sbjct: 16679 SITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTN-CHKNSWKIDQLQEGCSYYFRVTA 16737

Query: 438   VAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYV 497
                 G G P   +D +   +  +PPG    + V D +  S++LSW  P+   G +   Y+
Sbjct: 16738 ENEYGIGLPAQTADPIKVAEVPQPPG---KITVDDVTRNSVSLSWTKPEHDGGSKIIQYI 16794

Query: 498   VELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAM 557
             VE+ +  S +W  C    V         L  GE Y  RV AVNE G+S P +L   + A 
Sbjct: 16795 VEMQAKHSEKWSEC--ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAK 16852

Query: 558   PVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRS-VTVTKD 616
              + + P      S+    +V+VG  +++ V     P P +TW KDGLPL + + + VT  
Sbjct: 16853 DLVIEPDVKPAFSS---YSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDS 16909

Query: 617   -GLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTV 674
               LT L I      D G Y + +  + G++ A S  I     P  P GP+   +    ++
Sbjct: 16910 LDLTTLSIKETHKDDGGQYGITVANVVGQKTA-SIEIVTLDKPDPPKGPVKFDDVSAESI 16968

Query: 675   TAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAK 734
             T  W P          +Y V  R +    W   +  +      +  +  G EY FR+ A+
Sbjct: 16969 TLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFAE 17028

Query: 735   NELGAS 740
             N  G S
Sbjct: 17029 NRYGQS 17034



 Score =  155 bits (393), Expect = 1e-37
 Identities = 118/417 (28%), Positives = 184/417 (44%), Gaps = 44/417 (10%)

Query: 379  LTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAV 438
            LTW  P   G   IL Y++ERR+ G  T+  V      +  WTV D+    +Y FRV AV
Sbjct: 8126 LTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGE-NKLSWTVKDLIPNGEYFFRVKAV 8184

Query: 439  APSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVV 498
               G GE     + V A+DP +PP    +++V + +  ++T++W  P    G +  GY++
Sbjct: 8185 NKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYII 8244

Query: 499  ELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMP 558
            E  +    +W  C+   VP+ TYTAKGL  G+ Y  RV A N  G S+PS      +A+ 
Sbjct: 8245 EKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVD 8304

Query: 559  VTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDG--------------- 603
                PK ++ +S    L VK GD + +  S    P P +TW+KD                
Sbjct: 8305 PIDAPKVILRTS----LEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPL 8360

Query: 604  ---------------LPLPKR-SVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVA 647
                           LPL +R S+  +K G +QL +  +   D GLY + +    G   A
Sbjct: 8361 VRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKA 8420

Query: 648  HSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAV--FTRSSAHGPWH 705
                + V   P  P     ++    +V  +WEP  D+     ++Y +    ++     W 
Sbjct: 8421 -PCTVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWI 8479

Query: 706  EAADRIHTNRFTLLGILPGHEYHFRVVAKNELG-----ASKPSDTSQPWCIPRQRDR 757
                 +   ++++  ++ G EY FRV A+N  G      SKP     P+  P   D+
Sbjct: 8480 VVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDPFGPPDAPDK 8536



 Score =  155 bits (391), Expect = 2e-37
 Identities = 119/424 (28%), Positives = 186/424 (43%), Gaps = 39/424 (9%)

Query: 379  LTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERR--WTVADVRQGCQYEFRVT 436
            L W+ P   G + I G++IER+    +TW     QP+   R    +  + +G +Y+FRV 
Sbjct: 8843 LNWSDPEDDGGSEITGFIIERKDAKMHTWR----QPIETERSKCDITGLLEGQEYKFRVI 8898

Query: 437  AVAPSGPGEP---GPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEA 493
            A    G G P   GP    + A DP+ PP     L  T+R+ ++ITL W  P +  G   
Sbjct: 8899 AKNKFGCGPPVEIGP----ILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPI 8954

Query: 494  QGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPS-ALDT 552
            QGY++E    D   +   +    P T++  + L   + Y  RV AVNE G+S+PS  L+ 
Sbjct: 8955 QGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNV 9014

Query: 553  LVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLK---------DG 603
            ++Q   V    K  + S   D + VK G+ V +P     +PMP++ W K         D 
Sbjct: 9015 VIQDDEVPPTIKLRL-SVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDA 9073

Query: 604  LPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGP 663
            L + K  V+   +  T+L IP A   D G YTV      G  V  +  + V   P  P  
Sbjct: 9074 LQITKEEVS-RSEAKTELSIPKAVREDKGTYTVTASNRLG-SVFRNVHVEVYDRPSPPRN 9131

Query: 664  IHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAH--GPWHEAADRIHTNRFTLLGI 721
            + + +    +    W+   D       HY +  R ++     W E  +     R+ +  +
Sbjct: 9132 LAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKRYGIWKL 9191

Query: 722  LPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLR 781
            +P  +Y FRV A N+ G S             + D+  ++ P YR P    KP+ L   +
Sbjct: 9192 IPNGQYEFRVRAVNKYGISDEC----------KSDKVVIQDP-YRLPGPPGKPKVLARTK 9240

Query: 782  SHLL 785
              +L
Sbjct: 9241 GSML 9244



 Score =  152 bits (385), Expect = 1e-36
 Identities = 95/326 (29%), Positives = 165/326 (50%), Gaps = 7/326 (2%)

Query: 157  VQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQV 216
            V   P   P +  +  + +V++ G+ + + +PF++      +W KDG EV  S     + 
Sbjct: 8007 VAKDPDCKPTIDLETHDIIVIE-GEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKN 8065

Query: 217  DLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRA 276
            D    +  L +P + R D G Y++TL ++ GS  A + ++VI  P P +  ++  D  ++
Sbjct: 8066 DHISAH--LEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKD-IKASDITKS 8122

Query: 277  GVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRV 336
               L W PP  +GG  +  YV+ERR+AGR T++ V     +  ++T   + P  +Y FRV
Sbjct: 8123 SCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGE-NKLSWTVKDLIPNGEYFFRV 8181

Query: 337  RAVTSEGAGEALESEEILVA--PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILG 394
            +AV   G GE +E +  ++A  P+  P  P    + + +++ +T+TW  P   G + I+G
Sbjct: 8182 KAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMG 8241

Query: 395  YLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVF 454
            Y+IE+  KG   W   N+  VP   +T   + +G +Y+FRV A   +G  EP   +    
Sbjct: 8242 YIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTK 8301

Query: 455  ARDPMRPPGLVRNLQVTDRSNTSITL 480
            A DP+  P ++    +  +    I L
Sbjct: 8302 AVDPIDAPKVILRTSLEVKRGDEIAL 8327



 Score =  152 bits (384), Expect = 1e-36
 Identities = 117/462 (25%), Positives = 188/462 (40%), Gaps = 33/462 (7%)

Query: 318   STTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGI 377
             S T  +A+     KYT  ++ V S        S  ++V     P  P+   +   + +  
Sbjct: 19869 SLTIENANRNDSGKYTLTIQNVLSAA------SLTLVVKVLDTPGPPTNITVQDVTKESA 19922

Query: 378   TLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTA 437
              L+W  P   G A +  Y IE+R+     W +V +       + V ++++G  Y FRV+ 
Sbjct: 19923 VLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNN-CNRLSYKVTNLQEGAIYYFRVSG 19981

Query: 438   VAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYV 497
                 G G P    + V   +   PP     L VT  S  S++L+W  P+   G     YV
Sbjct: 19982 ENEFGVGIPAETKEGVKITEKPSPP---EKLGVTSISKDSVSLTWLKPEHDGGSRIVHYV 20038

Query: 498   VELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAM 557
             VE        W+ C V     T +   GLR    YF RV A N+ G S P  L   V   
Sbjct: 20039 VEALEKGQKNWVKCAVAKS--THHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIK 20096

Query: 558   PVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLP---KRSVTVT 614
                  P+  + +     + V+ G  ++V +     P+P+VT  +DG+PL    + +  +T
Sbjct: 20097 EQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEIT 20156

Query: 615   KDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGT 673
              + LT + +  +  +D+G Y +      G   A    I V   P  P GP+ + +    +
Sbjct: 20157 AENLT-INLKESVTADAGRYEITAANSSGTTKAF-INIVVLDRPGPPTGPVVISDITEES 20214

Query: 674   VTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVA 733
             VT +WEP   +      +Y +  R ++   W E +  +      ++ +  G EY FR+ A
Sbjct: 20215 VTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKA 20274

Query: 734   KNELGAS---------------KPSDTSQPWCIPRQRDRFTV 760
             +N  G S                P   S PW     R+  TV
Sbjct: 20275 ENRFGISDHIDSACVTVKLPYTTPGPPSTPWVTNVTRESITV 20316



 Score =  150 bits (379), Expect = 5e-36
 Identities = 119/443 (26%), Positives = 184/443 (41%), Gaps = 32/443 (7%)

Query: 321   FTD-AHVEPGRKYT--------------FRVRAVTSEGAGEALESEEILVAPEALPKAPS 365
             FTD   +E G  YT              + ++   S G+  A  + ++L  P      P 
Sbjct: 17693 FTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGP----PQ 17748

Query: 366   APAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADV 425
               A+         L W  P   G A +  Y+I++R+     +  V+ +   +  + V ++
Sbjct: 17749 NLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSK-CSKTSFKVENL 17807

Query: 426   RQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGP 485
              +G  Y FRV A    G G P    DAV A +P  PPG V    +TD S TS +L W  P
Sbjct: 17808 TEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVT---LTDVSQTSASLMWEKP 17864

Query: 486   DTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQS 545
             +   G    GYVVE+    + +W    V    V      GL  G+ Y  RV A NE G+S
Sbjct: 17865 EHDGGSRVLGYVVEMQPKGTEKW--SIVAESKVCNAVVTGLSSGQEYQFRVKAYNEKGKS 17922

Query: 546   QPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLP 605
              P  L   V A  +T+ P   +  +T    +++ G+ +++ +     P P ++W+KDG P
Sbjct: 17923 DPRVLGVPVIAKDLTIQPSLKLPFNT---YSIQAGEDLKIEIPVIGRPRPNISWVKDGEP 17979

Query: 606   LPKRSVTVTKDGLTQLLIPV--AGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-G 662
             L + +    ++  T  ++ +      D G YTV      G     +  + V   P  P G
Sbjct: 17980 LKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAG-TATENLSVIVLEKPGPPVG 18038

Query: 663   PIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGIL 722
             P+   E     V   WEP          +Y V  R +    WH  +  +      +  + 
Sbjct: 18039 PVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLK 18098

Query: 723   PGHEYHFRVVAKNELGASKPSDT 745
              G EY FR+ A+N  G S P D+
Sbjct: 18099 TGTEYQFRIFAENRYGKSAPLDS 18121



 Score =  150 bits (378), Expect = 6e-36
 Identities = 161/612 (26%), Positives = 252/612 (41%), Gaps = 64/612 (10%)

Query: 180   GKPVIVKIPFQSHLPIQAAWRKD----GAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDC 235
             G P   K+   +   +  +W K     G+ ++G      + D  D + R  LP   +K  
Sbjct: 13218 GPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRAD-SDNWVRCNLPQNLQKT- 13275

Query: 236   GQYSVTLRSEGGSVQAELTLQVIDK---------PD---------PPQGPMEVQDCHRAG 277
              ++ VT   E    Q +  +  ++K         PD         PP+G ++     R  
Sbjct: 13276 -RFEVTGLME--DTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDAD--LRKT 13330

Query: 278   VCLRWRPPRDNGGRTVECYV-VERRQAGRSTWLKVGEAPAD-------STTF-TDAHVEP 328
             + LR        G T+  YV V+ R   + TW K      D       ST F T    E 
Sbjct: 13331 LILR-------AGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCEN 13383

Query: 329   GRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPG 388
               KY      +T E +    E   I+V     P  P    +   S     +TW  P   G
Sbjct: 13384 VNKYDAGKYILTLENSCGKKEYT-IVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDG 13442

Query: 389   SAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGP 448
              + I+ Y++++R     +W+ V  +   +  + VA++ +G  Y FRV A    G G+PG 
Sbjct: 13443 GSPIINYVVQKRDAERKSWSTVTTE-CSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGE 13501

Query: 449   PSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQW 508
               DAV A    + PG V +L+V   S +S ++ W  P +  G    GYVV+  + ++ +W
Sbjct: 13502 TRDAVKAS---QTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTEEN-KW 13557

Query: 509   LPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVD 568
                 V       Y+AK L  G+ Y  RV+A NE G+  PS  +  V A    V P   + 
Sbjct: 13558 Q--RVMKSLSLQYSAKDLTEGKEYTFRVSAENENGEGTPS--EITVVARDDVVAPDLDLK 13613

Query: 569   SSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRS-VTVTKDGL-TQLLIPVA 626
                      K     R+ +  +  P P V+W K   PL   + V+V    + T L++   
Sbjct: 13614 GLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDC 13673

Query: 627   GLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEA 685
               SD+G YT+ L+ + G +   +  I+V   P  P GPI   E     +T +W P  D+ 
Sbjct: 13674 QKSDAGKYTITLKNVAGTKEG-TISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDG 13732

Query: 686   QDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGA-----S 740
                  +Y +  R S +  W   A  +    F +  +  G EY FRV A+N+ G      S
Sbjct: 13733 GSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKS 13792

Query: 741   KPSDTSQPWCIP 752
             +P     P+ +P
Sbjct: 13793 EPIVARHPFDVP 13804



 Score =  149 bits (375), Expect = 1e-35
 Identities = 106/394 (26%), Positives = 172/394 (43%), Gaps = 10/394 (2%)

Query: 349   ESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWT 408
             +S  +LV     P    +  +   S   +T+TW  P   G A +  Y++E+R+     + 
Sbjct: 23154 KSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREAAMRAFK 23213

Query: 409   AVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNL 468
              V  +   +  + ++ + +G  Y FRV      G GEP   SDAV   +    P     L
Sbjct: 23214 TVTTK-CSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPA---KL 23269

Query: 469   QVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRP 528
             +V D + +++TL+W  P    G    GYV+E C + + +W+        V  +T   L  
Sbjct: 23270 EVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNE 23329

Query: 529   GEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVS 588
             GE Y  R+ A NE G S+P    T V    + V P   + +  +  + V  G  V + + 
Sbjct: 23330 GEQYLFRIRAQNEKGVSEPRETVTAVTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIP 23389

Query: 589   FEAMPMPEVTWLKDGLPL--PKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEV 646
                 P P  +W   G  L   +R    T   + +L I    + D+G YT+ L+ + G   
Sbjct: 23390 IAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTG-TT 23448

Query: 647   AHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGP-W 704
             + + ++ +   P  P GPI + E    ++T  WEP P+     PL   V  +  AH P W
Sbjct: 23449 SETIKVIILDKPGPPTGPIKIDEIDATSITISWEP-PELDGGAPLSGYVVEQRDAHRPGW 23507

Query: 705   HEAADRIHTNRFTLLGILPGHEYHFRVVAKNELG 738
                ++ +  + F    +  G+EY FRV A N  G
Sbjct: 23508 LPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFG 23541



 Score =  147 bits (372), Expect = 3e-35
 Identities = 95/325 (29%), Positives = 157/325 (48%), Gaps = 14/325 (4%)

Query: 140   GRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAW 199
             G  T V G  + E  L   ++P +  D+  +LR+ +VV+AG    + IPF+     +  W
Sbjct: 17632 GEATSVPGTVKPEDKL---EAPEL--DLDSELRKGIVVRAGGSARIHIPFKGRPTPEITW 17686

Query: 200   RKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVID 259
              ++  E       + Q++ G  YT+L + +  R D G+Y + L +  GS  A +T++V+D
Sbjct: 17687 SREEGEFTD----KVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLD 17742

Query: 260   KPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADST 319
              P PPQ  + V++  +    L W PP  +GG  V+ YV+++R++ R  +  V  +    T
Sbjct: 17743 TPGPPQN-LAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVS-SKCSKT 17800

Query: 320   TFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITL 379
             +F   ++  G  Y FRV A    G G  +E+ + + A E  P  P    +   S    +L
Sbjct: 17801 SFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEP-PSPPGKVTLTDVSQTSASL 17859

Query: 380   TWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVA 439
              W  P   G + +LGY++E + KG+  W+ V +  V      V  +  G +Y+FRV A  
Sbjct: 17860 MWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNA--VVTGLSSGQEYQFRVKAYN 17917

Query: 440   PSGPGEPGPPSDAVFARDPMRPPGL 464
               G  +P      V A+D    P L
Sbjct: 17918 EKGKSDPRVLGVPVIAKDLTIQPSL 17942



 Score =  147 bits (371), Expect = 4e-35
 Identities = 123/458 (26%), Positives = 183/458 (39%), Gaps = 38/458 (8%)

Query: 330  RKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGS 389
            R +T +        AG+   +  + V    +P  P    +   +     L+W  P   G 
Sbjct: 9511 RSHTGKYSITAKNKAGQKTANCRVKVMD--VPGPPKDLKVSDITRGSCRLSWKMPDDDGG 9568

Query: 390  AHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPP 449
              I GY+IE+R      WT VN        + V D+    QY FRV A    G G P   
Sbjct: 9569 DRIKGYVIEKRTIDGKAWTKVNPD-CGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVET 9627

Query: 450  SDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSL--- 506
                 ARDP+ PP     L++   +  ++ LSW  P    G     Y+VE  + D     
Sbjct: 9628 IQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTK 9687

Query: 507  --QWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSA----LDTLVQAMPVT 560
               W  C+   V    +T + L  G  Y  RV AVN  G S+PSA     D     MP +
Sbjct: 9688 KEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQRPDMPPS 9747

Query: 561  VCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTV------- 613
            +          K+ + V+ G  V +    + +P P +TW K     P     V       
Sbjct: 9748 I--------DLKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVN 9799

Query: 614  --TKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENV 670
                D    L+IP +  SD+GLYT+      G   +   R+ V   P  P GPI  +   
Sbjct: 9800 KLVVDDTCTLVIPQSRRSDTGLYTITAVNNLG-TASKEMRLNVLGRPGPPVGPIKFESVS 9858

Query: 671  PGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFR 730
               +T  W P  D+      +Y +  R +    W   +       +T+  +L GHEY FR
Sbjct: 9859 ADQMTLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPKLLEGHEYVFR 9918

Query: 731  VVAKNELGASKPSDTSQP------WCIPRQRDRFTVKA 762
            ++A+N+ G  +P D S+P      + +P   D+ TV +
Sbjct: 9919 IMAQNKYGIGEPLD-SEPETARNLFSVPGAPDKPTVSS 9955



 Score =  147 bits (370), Expect = 5e-35
 Identities = 147/617 (23%), Positives = 256/617 (41%), Gaps = 64/617 (10%)

Query: 163   IAPDVT--EKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGD 220
             ++PD+     +R+ +VV AG  + +        P    W  +   +     +EA ++   
Sbjct: 10148 VSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTL----PQEATIETTA 10203

Query: 221   GYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCL 280
               + + + +  R   G YS+  ++E G  +  + + V+D P P   P    +       L
Sbjct: 10204 ISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKL 10263

Query: 281   RWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVT 340
              W  P D+GG  +  YV+E+R++ R  W  V              ++ G+ Y FR+ A  
Sbjct: 10264 TWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNATVQGLIQ-GKAYFFRIAAEN 10322

Query: 341   SEGAGEALESEEILVA--PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIE 398
             S G G  +E+ E LV   P  +P+ P    +   +   +TLTW  P+  G + I+ Y++E
Sbjct: 10323 SIGMGPFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLE 10382

Query: 399   RRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDP 458
              R  G+  +  V +  +  R++TV  +++G  YE+RV+AV   G G+P   +  +  +D 
Sbjct: 10383 SRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDE 10442

Query: 459   MRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPV 518
             + PP L  +L   D+    +  ++A      G            +D L+    H+ T P 
Sbjct: 10443 LAPPTL--HLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPA 10500

Query: 519   T--TYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLT 576
             T      K  R   G +  V   + G +     ++ + +  P      F  D  TKD + 
Sbjct: 10501 TLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSF--DEVTKDYMV 10558

Query: 577   V---------------------KVGDTVRVPV-SFEAMPMPEVTWLKDGLPLPKRSVTVT 614
             +                     +VG  V +PV S  A    +V+ L +G           
Sbjct: 10559 ISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEG----------- 10607

Query: 615   KDGLTQLLIP-VAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGT 673
             KD + ++    + G+SD     +V  +++ K+     R RV   P AP    + E    +
Sbjct: 10608 KDYIFRIHAENLYGISD----PLVSDSMKAKD-----RFRV---PDAPDQPIVTEVTKDS 10655

Query: 674   VTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAA-DRIHT-NRFTLLGILPGHEYHFRV 731
                 W    D  + +  +Y +  R +    W     D IH   +F +  +L G +Y FRV
Sbjct: 10656 ALVTWNKPHDGGKPI-TNYILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRV 10714

Query: 732   VAKNELGASKPSDTSQP 748
              A+NE+G   PS  S+P
Sbjct: 10715 SAENEIGIGDPSPPSKP 10731



 Score =  145 bits (365), Expect = 2e-34
 Identities = 114/379 (30%), Positives = 172/379 (45%), Gaps = 16/379 (4%)

Query: 373   SSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYE 432
             +   +TL W  P   G + I  Y++E+R+    +++    +   +  + V  + +GC+Y 
Sbjct: 14508 TKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTK-CHKCTYKVTGLSEGCEYF 14566

Query: 433   FRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDE 492
             FRV A    G GEP   ++ V A +   PP    +L + D + ++++L+W  P    G +
Sbjct: 14567 FRVMAENEYGIGEPTETTEPVKASEAPSPPD---SLNIMDITKSTVSLAWPKPKHDGGSK 14623

Query: 493   AQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDT 552
               GYV+E     S QW   H+ TV       + L  GE Y  +V AVN  G+S P     
Sbjct: 14624 ITGYVIEAQRKGSDQW--THITTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRP 14681

Query: 553   LVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVT 612
             ++     T+ P+  +    + L+  K GD ++V +     P P VTW K G  + K++  
Sbjct: 14682 VI-VKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTW-KKGDQILKQTQR 14739

Query: 613   V---TKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQE 668
             V   T    T L I     SDSG Y +  R + G EV     I+V   P  P GPI   E
Sbjct: 14740 VNFETTATSTILNINECVRSDSGPYPLTARNIVG-EVGDVITIQVHDIPGPPTGPIKFDE 14798

Query: 669   NVPGTVTAEWEPSPDEAQDVPL-HYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEY 727
                  VT  W+P P+    VP+ +Y V  R +    W E A  +    +    +  G EY
Sbjct: 14799 VSSDFVTFSWDP-PENDGGVPISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGLEY 14857

Query: 728   HFRVVAKNELGASKPSDTS 746
              FRV A+N  G   P  TS
Sbjct: 14858 QFRVKAQNRYGVG-PGITS 14875



 Score =  143 bits (361), Expect = 6e-34
 Identities = 179/800 (22%), Positives = 302/800 (37%), Gaps = 91/800 (11%)

Query: 104   TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVA----GDQQSEATLTVQD 159
             TWFKDGV++  +  +         SLF+        G YT  A    G  ++E  + VQD
Sbjct: 21619 TWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQD 21678

Query: 160   SP--TIAP-DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQV 216
             +P   + P   T    E + +    P+       +H  I+       A  +     EAQ 
Sbjct: 21679 TPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQ- 21737

Query: 217   DLGDGYTRLCLPSAGRKD-----CGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQ 271
                  YT + L +            ++ V    +   V A++   V D P  P    E  
Sbjct: 21738 ----SYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTVPDAPGIP----EPS 21789

Query: 272   DCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKV-GEAPADSTTFTDAHVEPGR 330
             +     + L W  P  +GG  ++ Y++ERR+   + W+KV  + P   T F    +  G 
Sbjct: 21790 NITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGN 21849

Query: 331   KYTFRVRAVTSEGAGEALESEEILVAPEAL--PKAPSAPAILSASSQGITLTWTAPRGPG 388
             +Y F V A  + G G A     ++   E +  P  P+   +   S   ++L W+ P   G
Sbjct: 21850 EYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDG 21909

Query: 389   SAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGP 448
                I+GY+IE  K     W  VN +   + R+TV D++ G +Y+FRV+A+  +G G+   
Sbjct: 21910 GMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCE 21969

Query: 449   PSDAVFARDPMRPPGLV--RNLQVTD--RSNTSI------------TLSWAGPDTQEGDE 492
              +  + A D +  P L    N + T   R+  SI            T  W+ PD+     
Sbjct: 21970 VTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLR 22029

Query: 493   AQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDT 552
             A  +  +  S+ +++   C+       T T +     +     V  ++  G   P     
Sbjct: 22030 ADIHTTDSFSTLTVE--NCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPITFKD 22087

Query: 553   LVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVT 612
             + +     +    L+D   +              +    +   E +         +RS  
Sbjct: 22088 VTRGSATLMWDAPLLDGGAR--------------IHHYVVEKREAS---------RRSWQ 22124

Query: 613   VTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFR----IRVAACPQAPGPIHLQE 668
             V  +  T+ +  V  L++   Y   +  +    V   +     I     P  P  + + +
Sbjct: 22125 VISEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPAPPRRLDVVD 22184

Query: 669   NVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNR--FTLLGILPGHE 726
                 +    W     +       Y +  R      W EA    HT +  FT+  ++   E
Sbjct: 22185 TSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAG---HTKQLTFTVERLVEKTE 22241

Query: 727   YHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLP 786
             Y FRV AKN+ G S+P            R+ F+  +   +EP + +    L G+ + L+ 
Sbjct: 22242 YEFRVKAKNDAGYSEP------------REAFS--SVIIKEPQI-EPTADLTGITNQLIT 22286

Query: 787   --QGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEY 844
                G    +   + G P P VTW   +  L+    V  T      +LT+      DSG Y
Sbjct: 22287 CKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRY 22346

Query: 845   KAVAENTLGQAVSTATLIVI 864
                 ENT G    + T++VI
Sbjct: 22347 FLTLENTAGVKTFSVTVVVI 22366



 Score =  141 bits (355), Expect = 3e-33
 Identities = 109/406 (26%), Positives = 168/406 (41%), Gaps = 10/406 (2%)

Query: 344   AGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKG 403
             AG    S ++LV  +  P  P    +         LTW  P   G + I  Y++ERR   
Sbjct: 10923 AGSKTVSVKVLVLDK--PGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVA 10980

Query: 404   SNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPG 463
             S  W+ ++     +  +    + +G QY FRV A    G G        + A DP+ PPG
Sbjct: 10981 SAQWSPLSATSKKKSHFA-KHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPG 11039

Query: 464   LVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTA 523
               ++L   D   T ++L W  PD   G    GY+VE     +  W+     TV       
Sbjct: 11040 PPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWI--KFKTVTNLECVV 11097

Query: 524   KGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTV 583
              GL+ G+ Y  RV A N  G   P      ++     V P   +D    + L VK G TV
Sbjct: 11098 TGLQQGKTYRFRVKAENIVGLGLPDT-TIPIECQEKLVPPSVELDVKLIEGLVVKAGTTV 11156

Query: 584   RVPVSFEAMPMPEVTWLKDGLPL-PKRSVTVTKDGLTQLL-IPVAGLSDSGLYTVVLRTL 641
             R P     +P+P   W  DG  +      TV  D  + +L I      D+G Y + +   
Sbjct: 11157 RFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNA 11216

Query: 642   QGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSA 700
              G +   +  + V   P  P GPI++ +  P  +T  W+P  D+     ++Y V  + + 
Sbjct: 11217 AGSKTV-AVHLTVLDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTR 11275

Query: 701   HGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS 746
                W   +      +  +  +  G EY FRV A+N++G   P D++
Sbjct: 11276 KDTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENKIGVGPPLDST 11321



 Score =  141 bits (355), Expect = 3e-33
 Identities = 142/604 (23%), Positives = 248/604 (41%), Gaps = 50/604 (8%)

Query: 166   DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
             D+   +R+ ++V+AG P+ +    +     +  WRK G + V    R+ QVDL D    L
Sbjct: 12235 DLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVV---RKGQVDLVDTMAFL 12291

Query: 226   CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPP 285
              +P++ R D G+YS+TL +  G     + ++V+D P P    ++V D  +    + W PP
Sbjct: 12292 VIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSD-LKVSDVTKTSCHVSWAPP 12350

Query: 286   RDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAG 345
              ++GG  V  Y+VE+R+A R TW  V       T+F   ++ PG +Y FRV AV   G G
Sbjct: 12351 ENDGGSQVTHYIVEKREADRKTWSTV-TPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPG 12409

Query: 346   EALESEEILVAPEAL--PKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERR--K 401
                +  + ++A + L  P  P    +   +    TL W  P   G A I GY+   R  +
Sbjct: 12410 VPTDVPKPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEE 12469

Query: 402   KGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRP 461
             + ++ WT  +   V +    V  +++G +Y+FRV A    G   P        A++ + P
Sbjct: 12470 QPADRWTEYS--VVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLP 12527

Query: 462   PGLVRNLQVTDRSNTSITLS---WAGP-DTQEGDEAQGYVVELCSSDSLQWLPCHVGTVP 517
             P ++   Q+T ++   + +    +  P  T +  + +  VV      +   L  H     
Sbjct: 12528 PKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVV------TSSHLAVHKADSS 12581

Query: 518   VTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDL--- 574
                      R   GY+  +TA N  G +    +  +V   P    P F +     D    
Sbjct: 12582 SILIIKDVTRKDSGYY-SLTAENSSG-TDTQKIKVVVMDAPGPPQPPFDISDIDADACSL 12639

Query: 575   ---LTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDS 631
                + ++ G +       E   +    W+     + K S  V K      LIP       
Sbjct: 12640 SWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGK------LIP----GQE 12689

Query: 632   GLYTV-------VLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDE 684
              ++ V       +   L   ++   F   V   P  P    + +     +   W+    +
Sbjct: 12690 YIFRVRAENRFGISEPLTSPKMVAQFPFGV---PSEPKNARVTKVNKDCIFVAWDRPDSD 12746

Query: 685   AQDVPLHYAVFTRSSAHGPWHEAADR-IHTNRFTLLGILPGHEYHFRVVAKNELGASKPS 743
                  + Y +  +      W +A D  + +  +   G++ G EY FR+ A N+ G+S PS
Sbjct: 12747 GGSPIIGYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPS 12806

Query: 744   DTSQ 747
               ++
Sbjct: 12807 KPTE 12810



 Score =  141 bits (355), Expect = 3e-33
 Identities = 145/623 (23%), Positives = 250/623 (40%), Gaps = 81/623 (13%)

Query: 163   IAPD--VTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGD 220
             +APD  +  +LR  LVV+AG  + + +P +     +  W KD   +       A ++  +
Sbjct: 14400 MAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINL----KNRANIENTE 14455

Query: 221   GYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCL 280
              +T L +P   R D G++ +T+ +  G     + ++V+D P P    +   D  +  V L
Sbjct: 14456 SFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLN-LRPTDITKDSVTL 14514

Query: 281   RWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVT 340
              W  P  +GG  +  Y+VE+R+A R ++           T+    +  G +Y FRV A  
Sbjct: 14515 HWDLPLIDGGSRITNYIVEKREATRKSY-STATTKCHKCTYKVTGLSEGCEYFFRVMAEN 14573

Query: 341   SEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERR 400
               G GE  E+ E + A EA P  P +  I+  +   ++L W  P+  G + I GY+IE +
Sbjct: 14574 EYGIGEPTETTEPVKASEA-PSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQ 14632

Query: 401   KKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMR 460
             +KGS+ WT +    V      V ++ +G +Y F+V AV  +G   P      +     M 
Sbjct: 14633 RKGSDQWTHIT--TVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTML 14690

Query: 461   PPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTT 520
             P   +R +                         Q  V+     +    +P      P  T
Sbjct: 14691 PELDLRGIY------------------------QKLVIAKAGDNIKVEIPVLGRPKPTVT 14726

Query: 521   YTAKGLRPGEGYFVRVTAVNEGGQSQPSALD----TLVQAMPVTVCPKFLVDSSTKDLLT 576
             +     + G+    +   VN    +  + L+        + P  +  + +V     D++T
Sbjct: 14727 W-----KKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIV-GEVGDVIT 14780

Query: 577   VKVGD---TVRVPVSFEAMPMPEVTWLKD------GLPLPKRSVTVTKDGLTQLLIPVAG 627
             ++V D       P+ F+ +    VT+  D      G+P+    V + +   T  +     
Sbjct: 14781 IQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWV----E 14836

Query: 628   LSDSGLYTVVLRTLQGKEVAHSFRIR-----------VAAC---------PQAPGPIHLQ 667
             L+ + + T    T     + + FR++            +AC         P  PG   + 
Sbjct: 14837 LATTVIRTTYKATRLTTGLEYQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTPQVT 14896

Query: 668   ENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADR-IHTNRFTLLGILPGH 725
                  ++T  W EP  D    + L Y V  +      W   +   +  N F   G+  G 
Sbjct: 14897 AVTKDSMTISWHEPLSDGGSPI-LGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGI 14955

Query: 726   EYHFRVVAKNELGASKPSDTSQP 748
              Y FRV+A+N  G SKPS  S+P
Sbjct: 14956 AYEFRVIAENMAGKSKPSKPSEP 14978



 Score =  139 bits (350), Expect = 1e-32
 Identities = 155/649 (23%), Positives = 258/649 (39%), Gaps = 68/649 (10%)

Query: 246  GGSVQAELTLQVIDKPDPPQGPMEVQ--DCHRAGVCLRWRPPRDNGGRTVECYVVERRQA 303
            G  V+ +  ++   K D P  P+ V   D +R GV L W PP  +GG  +  YV+E R  
Sbjct: 6801 GEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDK 6860

Query: 304  GRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKA 363
                W       A+  + T   V  G++Y+FRVRA    G G+   +   +   + + + 
Sbjct: 6861 TSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIER- 6919

Query: 364  PSAPAILSASSQ---GITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRW 420
            PS P  L++S Q    + L W  P   G + ILGY+IER ++G + W   N + VPE  +
Sbjct: 6920 PSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTY 6979

Query: 421  TVADVRQGCQYEFRVTAVAPSGPGEP----GP-PSDAVFARDPMRPPGLVRNLQVTDRSN 475
             V  + +G +Y +RV+A   +G  +P    GP  +D  F    M        L+V   + 
Sbjct: 6980 KVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNP 7039

Query: 476  TSITLSWAGPDTQEGDEAQGY---VVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGE-- 530
             +I +    P T       GY       C  D +      V    ++ Y    + P E  
Sbjct: 7040 ITILV----PST-------GYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERS 7088

Query: 531  GYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFE 590
               +    +    ++    +D  V A P          S+ K+L   K GD  +  V   
Sbjct: 7089 DKGIYTLKLENRVKTISGEIDVNVIARP----------SAPKEL---KFGDITKDSVHLT 7135

Query: 591  AMP------MPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSG--LYTVVLRTLQ 642
              P       P   ++ +   + +++ T   D +T L   V  L      L+ V  R   
Sbjct: 7136 WEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKC 7195

Query: 643  GK-EVAHSFR----IRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTR 697
            G  E A+          A  P  P  +  ++    ++   W+P  ++       Y V   
Sbjct: 7196 GPGEPAYVDEPVNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERC 7255

Query: 698  SSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDR 757
                  W    + +   +  + G+  G  Y +RV A N  GASKPS  ++          
Sbjct: 7256 PRGSDKWVACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEE--------- 7306

Query: 758  FTVKAPCYRE-PDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEG 816
              ++A   +E P++    + L GL    +  G +  +   V G P P +TW K D  L+ 
Sbjct: 7307 --IQAVDTQEAPEIFLDVKLLAGLT---VKAGTKIELPATVTGKPEPKITWTKADMILKQ 7361

Query: 817  NPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
            +  +   ++    ++TI      D+G Y   A N  G+A +   + V++
Sbjct: 7362 DKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLD 7410



 Score =  137 bits (344), Expect = 6e-32
 Identities = 86/292 (29%), Positives = 146/292 (50%), Gaps = 9/292 (3%)

Query: 171   LREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSA 230
             LR+ + ++A   + + +P +     +  W +D     G S  +A ++    YT L + + 
Sbjct: 15494 LRKVVTIRACCTLRLFVPIKGRPAPEVKWARDH----GESLDKASIESTSSYTLLIVGNV 15549

Query: 231   GRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGG 290
              R D G+Y +T+ +  GS  A + ++V+D P PPQ  ++V++  +  V L W PP  +GG
Sbjct: 15550 NRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQD-LKVKEVTKTSVTLTWDPPLLDGG 15608

Query: 291   RTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALES 350
               ++ Y+VE+R++ R  +  V       T++    ++ G  Y FRV A    G G   E+
Sbjct: 15609 SKIKNYIVEKRESTRKAYSTVA-TNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAET 15667

Query: 351   EEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAV 410
              E + A E  P  P    ++  +   ++L+W  P   G + ILGY++E + KGS+ W   
Sbjct: 15668 AESVKASER-PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATC 15726

Query: 411   NDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP 462
                 V E   T+  + QG +Y FRV+A    G  +P   S  V A+D + PP
Sbjct: 15727 ATVKVTEA--TITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPP 15776



 Score =  136 bits (343), Expect = 7e-32
 Identities = 176/818 (21%), Positives = 304/818 (37%), Gaps = 84/818 (10%)

Query: 82    MEVQPGEAATLSCTLTSDLGPG-TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAG 140
             + V+ G    L  T+     P  +W KDG  L   +G+       + +L +  V    +G
Sbjct: 12933 LTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSG 12992

Query: 141   RYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWR 200
              YT  A +           S TI   V +K   P  VK  K    +       P++    
Sbjct: 12993 DYTITAENSSG------SKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLE---- 13042

Query: 201   KDGAEVVG--------SSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAE 252
               G+E+          S    AQV      T   +         Q+ +   ++ G     
Sbjct: 13043 DGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPV 13102

Query: 253   LTLQVIDKP--DPPQ--GPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTW 308
              T   I K   DPP    P  + +  +  + + W+PP D+GG  +  Y++E+R+     W
Sbjct: 13103 FTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNW 13162

Query: 309   LKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA--PEALPKAPSA 366
              KV   P    T     ++ G +Y FRV A+   G G+  ++ +   A  P+  P  P+ 
Sbjct: 13163 TKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGPPAF 13222

Query: 367   PAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVN-DQPVPERRWTVADV 425
             P +   +   ++L+W  P   G + I+GYL+E ++  S+ W   N  Q + + R+ V  +
Sbjct: 13223 PKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGL 13282

Query: 426   RQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP----------------GLVRNLQ 469
              +  QY+FRV AV   G  +P    D  + +D + PP                G+   L 
Sbjct: 13283 MEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTMRLY 13342

Query: 470   VTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPG 529
             V  +      ++W+ P+    D      +++ S+D   +L C      V  Y A      
Sbjct: 13343 VPVKGRPPPKITWSKPNVNLRDRIG---LDIKSTDFDTFLRCE----NVNKYDA------ 13389

Query: 530   EGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSF 589
              G ++ +T  N  G+ + + +      + V   P   V+ + K++       T   P+  
Sbjct: 13390 -GKYI-LTLENSCGKKEYTIV------VKVLDTPGPPVNVTVKEISKDSAYVTWEPPIID 13441

Query: 590   EAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHS 649
                P+      K        S   T+   T   +       S  + V      G      
Sbjct: 13442 GGSPIINYVVQKRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGE 13501

Query: 650   FRIRVAACPQAPGPI---HLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHE 706
              R  V A  Q PGP+    ++     + +  W+    +     + Y V    +    W  
Sbjct: 13502 TRDAVKA-SQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVV-DFLTEENKWQR 13559

Query: 707   AADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYR 766
                 + + +++   +  G EY FRV A+NE G   PS+ +          R  V AP   
Sbjct: 13560 VMKSL-SLQYSAKDLTEGKEYTFRVSAENENGEGTPSEITVV-------ARDDVVAP--- 13608

Query: 767   EPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLL 826
             + DL   P        +L  +     +   ++G P P V+W K +  L  +  V      
Sbjct: 13609 DLDLKGLPDL-----CYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSA 13663

Query: 827   GVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVI 864
                +L +      D+G+Y    +N  G    T ++ V+
Sbjct: 13664 VNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVV 13701



 Score =  136 bits (342), Expect = 1e-31
 Identities = 143/638 (22%), Positives = 250/638 (39%), Gaps = 55/638 (8%)

Query: 250   QAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWL 309
             + E    +   P  P  P  V    R  + + W  P  +GG  V  Y +E +      W 
Sbjct: 9934  EPETARNLFSVPGAPDKPT-VSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWK 9992

Query: 310   KVGEAPADSTTFTDAH----VEPGRKYTFRVRAVTSEGAGEA-LESEEILVAPEALPKAP 364
             +V   P  + T   ++    +  G  Y FRV A+ + G G A L S+         P  P
Sbjct: 9993  RVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPGP 10052

Query: 365   SAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVAD 424
               P +   +     L W+ P   G + + GY++E +++G   W    D+ V   +  V  
Sbjct: 10053 PFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTG 10112

Query: 425   VRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAG 484
             +++G  Y+FRV AV  +G GEPG  +D +  +D +  P L  +  V DR      +  AG
Sbjct: 10113 LKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDR-----IVVHAG 10167

Query: 485   PDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGL-----RPGEGYFVRVTAV 539
                +      G      + +  +       T+  T  ++  +     R  +G +  + A 
Sbjct: 10168 GVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGVY-SLLAK 10226

Query: 540   NEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKD---LLTVKVGDTVRVPVS---FEAMP 593
             NE G+ + + +  ++  +P  V   FL  + T +   L      D    P++    E   
Sbjct: 10227 NEAGERKKTIIVDVLD-VPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRE 10285

Query: 594   MPEVTWLKDGLPLPKRSVTVTKDGLTQ---LLIPVAGLSDSGLYTVVLRTLQGKEVAHSF 650
                  W      + +++ TV   GL Q       +A  +  G+   V       E + + 
Sbjct: 10286 SDRRAWTPVTYTVTRQNATV--QGLIQGKAYFFRIAAENSIGMGPFV-------ETSEAL 10336

Query: 651   RIRVA-ACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAA- 708
              IR     P+ P  + ++E    TVT  W P   +     ++Y + +R      +H+   
Sbjct: 10337 VIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTN 10396

Query: 709   DRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREP 768
             D + + ++T+ G+  G  Y +RV A N +G  KPS  ++P          T K       
Sbjct: 10397 DNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKP---------ITCK------- 10440

Query: 769   DLSQKPRFLVGLRSHL-LPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLG 827
             D    P   +  R  L +  G    ++    G P+P V+WFK++  +  +   +      
Sbjct: 10441 DELAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPA 10500

Query: 828   VCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
               +L        DSG+Y  V EN+ G       + V++
Sbjct: 10501 TLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVD 10538



 Score =  136 bits (342), Expect = 1e-31
 Identities = 109/404 (26%), Positives = 170/404 (42%), Gaps = 14/404 (3%)

Query: 343   GAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKK 402
             G GE  +S  + V     P A     +   S   +TL W  P   G + I+ Y+IE+R  
Sbjct: 20977 GVGEP-KSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDA 21035

Query: 403   GSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP 462
                TW+ V+ +      + + D+ +   + FRV A    G GEP   ++ V A +   P 
Sbjct: 21036 TKRTWSVVSHK-CSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAP- 21093

Query: 463   GLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYT 522
               +R+L + D + TS+ LSW  PD   G     YVVE        W   H G        
Sbjct: 21094 --IRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTW--SHAGISKTCEIE 21149

Query: 523   AKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDT 582
                L+       RV A NE G S P  +   +    + + P+  +       +TV++G  
Sbjct: 21150 VSQLKEQSVLEFRVFAKNEKGLSDPVTIGP-ITVKELIITPEVDLSDIPGAQVTVRIGHN 21208

Query: 583   VRVPVSFEAMPMPEVTWLKDGLPLPKRS---VTVTKDGLTQLLIPVAGLSDSGLYTVVLR 639
             V + + ++  P P ++WLKDGLPL +      + T++ +T L I  A     G YTV+L 
Sbjct: 21209 VHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKIT-LSIKNAKKEHGGKYTVILD 21267

Query: 640   TLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRS 698
                 + +A    +     P  P GPI   E    +V   W+   D        Y++  R 
Sbjct: 21268 NAVCR-IAVPITVITLGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRE 21326

Query: 699   SAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKP 742
             ++   W      +    F +  ++   EY FRV A+N  G S+P
Sbjct: 21327 TSQTNWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQP 21370



 Score =  134 bits (337), Expect = 4e-31
 Identities = 99/381 (25%), Positives = 159/381 (41%), Gaps = 10/381 (2%)

Query: 369   ILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQG 428
             + + + +  T++W  P   G + I  +++E RK     W+ V       +R   A++   
Sbjct: 11638 VTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVT--KRLIKANLLAN 11695

Query: 429   CQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQ 488
              +Y FRV A    G G        + A +P+  PG   NL + D+  T + L W  PD  
Sbjct: 11696 NEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYD 11755

Query: 489   EGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPS 548
              G     Y VE     S  W   H G++  T Y        + Y  RV   NEGG+S   
Sbjct: 11756 GGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDWV 11815

Query: 549   ALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKD----GL 604
               + +V    +    K ++D     +LTVK GDT+R+       P PEV W KD     L
Sbjct: 11816 KTEEVVVKEDL---QKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDL 11872

Query: 605   PLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPI 664
                 R    T+   ++  +  A  SD G Y V      G  VA++  + V   P     +
Sbjct: 11873 TRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYA-TVNVLDKPGPVRNL 11931

Query: 665   HLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPG 724
              + +      T  W+P  D+      +Y +    +    W   +  + T   T+  ++ G
Sbjct: 11932 KIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIEG 11991

Query: 725   HEYHFRVVAKNELGASKPSDT 745
             +EY FRV A+N++G   P+++
Sbjct: 11992 NEYIFRVRAENKIGTGPPTES 12012



 Score =  134 bits (336), Expect = 5e-31
 Identities = 194/810 (23%), Positives = 310/810 (38%), Gaps = 107/810 (13%)

Query: 105   WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTF----VAGDQQSEATLTVQDS 160
             W  DG ++ T +    + D     L I +      G Y       AG +     LTV D 
Sbjct: 11172 WTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDV 11231

Query: 161   P----------TIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSS 210
             P           + P+      +P     G PVI      +++  +   RKD   VV S 
Sbjct: 11232 PGPPTGPINILDVTPEHMTISWQPPKDDGGSPVI------NYIVEKQDTRKDTWGVVSS- 11284

Query: 211   DREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSE-----GGSVQAELTL--QVIDKPDP 263
                     G   T+L +P   +K C +Y   +R+E     G  + +  T+       P P
Sbjct: 11285 --------GSSKTKLKIPHL-QKGC-EYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSP 11334

Query: 264   PQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTD 323
             P  P+ V D       + W  P+ +GG  +  Y +ERR+     W++V + P     F  
Sbjct: 11335 PGKPV-VTDITENAATVSWTLPKSDGGSPITGYYMERREV-TGKWVRVNKTPIADLKFRV 11392

Query: 324   AHVEPGRKYTFRVRAVTSEGAGEALESEEILVA--PEALPKAPSAPAILSASSQGITLTW 381
               +  G  Y FRV A    G  +   S + + A  P   P  P  P +   S +   L W
Sbjct: 11393 TGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKPPGPPINPKLKDKSRETADLVW 11452

Query: 382   TAPRGPGSAHILGYLIERRKKGSNTWTAVN-DQPVPERRWTVADVRQGCQYEFRVTAVAP 440
             T P   G + ILGY++E +K G+  W  +N D+ + +  + V  + +G +Y FR+ A   
Sbjct: 11453 TKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANI 11512

Query: 441   SGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWA-----------GPDTQE 489
              G GEP   +++V A+D + PP +   L VT R   ++ +               PD   
Sbjct: 11513 VGEGEPRELAESVIAKDILHPPEV--ELDVTCRDVITVRVGQTIRILARVKGRPEPDITW 11570

Query: 490   GDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSA 549
               E +  V E    D +Q LP       V     + +R   G ++ ++A N  G +Q SA
Sbjct: 11571 TKEGKVLVREK-RVDLIQDLP------RVELQIKEAVRADHGKYI-ISAKNSSGHAQGSA 11622

Query: 550   L-DTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVT-WLKDGLPLP 607
             + + L +  P   C    V + TK+  T+   + +    S       E+T ++ +     
Sbjct: 11623 IVNVLDRPGP---CQNLKVTNVTKENCTISWENPLDNGGS-------EITNFIVEYRKPN 11672

Query: 608   KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLR--------TLQGKEVAHSFRIRVAACPQ 659
             ++  ++    +T+ LI    L+++  Y  V          T++ K       I     P 
Sbjct: 11673 QKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVGPTIETK--TPILAINPIDRPG 11730

Query: 660   APGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEA-ADRIHTNRFTL 718
              P  +H+ +     V  +W     +     L Y V  R      W       I    + +
Sbjct: 11731 EPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMV 11790

Query: 719   LGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLV 778
                +    Y FRV  KNE G S        W    + +   VK       DL QKP   +
Sbjct: 11791 DRCVENQIYEFRVQTKNEGGES-------DWV---KTEEVVVK------EDL-QKPVLDL 11833

Query: 779   GLRSHL-LPQGCECCMSCAVQGSPRPHVTWFKND--RSLEGNPAVYSTDLLGVCSLTIPS 835
              L   L +  G    +   V+G P P V W K+     L  +P V           ++  
Sbjct: 11834 KLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTK 11893

Query: 836   VSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
                 D G+Y   A NT G  V+ AT+ V++
Sbjct: 11894 AKRSDGGKYVVTATNTAGSFVAYATVNVLD 11923



 Score =  129 bits (325), Expect = 9e-30
 Identities = 167/698 (23%), Positives = 261/698 (37%), Gaps = 106/698 (15%)

Query: 104   TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTF----VAGDQQSEATLTVQD 159
             +W K    L T   V  +   +  +L +   Q + AG+YT     VAG ++   ++ V  
Sbjct: 13643 SWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVVG 13702

Query: 160   SPTIAP---DVTEKLREPLVVKAGKP------VIVKIPFQSHLPIQAAWRKDGAEVVGSS 210
              P I        E   E + +K   P       I     +    +   W    + V  ++
Sbjct: 13703 KPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTT 13762

Query: 211   DREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEV 270
              R  ++  G  YT     SA  K    Y V    EG   +  +     D PD P  P  +
Sbjct: 13763 FRVTRLHEGMEYT--FRVSAENK----YGV---GEGLKSEPIVARHPFDVPDAPP-PPNI 13812

Query: 271   QDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGR 330
              D     V L W  P+  GG  +  Y +E ++     W +  + P     F    +  G 
Sbjct: 13813 VDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGL 13872

Query: 331   KYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSA 390
             +Y FRV A+   G G+     E +VA + +   P  P +++ +   +TL WT P+  G  
Sbjct: 13873 EYEFRVMAINLAGVGKPSLPSEPVVALDPI-DPPGKPEVINITRNSVTLIWTEPKYDGGH 13931

Query: 391   HILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGP-GEPGPP 449
              + GY++E+R   S +W   N   VPE  +TV D+ +G +YEFR+ A   +G    P   
Sbjct: 13932 KLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSES 13991

Query: 450   SDAVFARDPMRPPGLVRNLQVTD----RSNTSITL-------------SW--AGPDTQEG 490
             ++ +  +D    P +V +  + D    ++  +I L             SW  AG D +  
Sbjct: 13992 TETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPS 14051

Query: 491   DEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSAL 550
             D     + ++ S+ +   L     T           R   G +  +TA N  G       
Sbjct: 14052 D-----ITQITSTPTSSMLTIKYAT-----------RKDAGEYT-ITATNPFG------- 14087

Query: 551   DTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTW---LKDGLPLP 607
              T V+ + VTV             L V  G    V +S  +     +TW   L+DG   P
Sbjct: 14088 -TKVEHVKVTV-------------LDVP-GPPGPVEISNVSAEKATLTWTPPLEDG-GSP 14131

Query: 608   KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEV---------------AHSFRI 652
              +S  + K   ++LL  V          V  + +QG E                  S  +
Sbjct: 14132 IKSYILEKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQSEPV 14191

Query: 653   RVAACPQAPGPIHLQE--NV-PGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAAD 709
             ++      PGP    E  NV   T T  W+   D+       Y V  R      W  A  
Sbjct: 14192 KMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIK 14251

Query: 710   R-IHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS 746
               +   R  + G+  G  Y FRV A+N  G   PS+ S
Sbjct: 14252 TPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEAS 14289



 Score =  129 bits (323), Expect = 2e-29
 Identities = 157/660 (23%), Positives = 251/660 (38%), Gaps = 72/660 (10%)

Query: 237   QYSVTLRSEGGSVQAELTLQVIDKPDP--PQGPMEVQDCHRAGVCLRWRPPRDNGGRTVE 294
             +Y V   +  G  +   + + +   DP  P G  EV +  R  V L+W  P  +GG  + 
Sbjct: 19286 EYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKIT 19345

Query: 295   CYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTS-EGAGEALESE-E 352
              Y+VERR+     WLK        T F    +   ++Y FRV A  + +   E  ES   
Sbjct: 19346 GYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGP 19405

Query: 353   ILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGY---LIERRKKGSNTWTA 409
             I+V  +  P       ++    + + +         +A I G    +I   K G      
Sbjct: 19406 IIVKDDVEPPR----VMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEER 19461

Query: 410   VNDQPVPERRWTVADV-----RQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGL 464
                + +     T+  V     R   QY   +  VA       G  S AV  +   +P   
Sbjct: 19462 ARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVA-------GTRSVAVNCKVLDKPGPP 19514

Query: 465   VRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAK 524
                L++   +    +LSW  P    G +   Y+VE   +  L W  C  G + +T+    
Sbjct: 19515 AGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICE-GELQMTSCKVT 19573

Query: 525   GLRPGEGYFVRVTAVNEGGQSQP------SALDTLVQAMPVTVCPKFLVDSSTKDLLTV- 577
              L  G  Y  RVT VN+ G  +P       ALD      P T      + S TK+ +T+ 
Sbjct: 19574 KLLKGNEYIFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPT---SLEITSVTKESMTLC 19630

Query: 578   -----KVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSG 632
                    G +       E      + W++           V K  +  L +   GL +  
Sbjct: 19631 WSRPESDGGSEISGYIIERREKNSLRWVR-----------VNKKPVYDLRVKSTGLREGC 19679

Query: 633   LYT--VVLRTLQGKEVAHSFRIRVAA-----CPQAPGPIHLQENVPGTVTAEWEPSPDEA 685
              Y   V      G  +       + A      P  P    + ++   T+T  W     + 
Sbjct: 19680 EYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDG 19739

Query: 686   QDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
                   Y V  + S    W  +   +    +T+ G+  G EY FRV + N++GAS PSD+
Sbjct: 19740 GAPITGYTVEYKKSDDTDWKTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDS 19799

Query: 746   SQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHV 805
             S P  I ++R+    + P +   D+  + R     ++ ++  G    M+   +G P P+V
Sbjct: 19800 SDPQ-IAKERE----EEPLF---DIDSEMR-----KTLIVKAGASFTMTVPFRGRPVPNV 19846

Query: 806   TWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
              W K D  L     V +TD     SLTI + +  DSG+Y    +N L  A  T  + V++
Sbjct: 19847 LWSKPDTDLRTRAYVDTTD--SRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLD 19904



 Score =  128 bits (321), Expect = 3e-29
 Identities = 142/604 (23%), Positives = 235/604 (38%), Gaps = 88/604 (14%)

Query: 183   VIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTL 242
             +I  +PF      +  W+K+  +    +  +A++D+    ++L + +A  +D G YS+T+
Sbjct: 10869 IIKGVPFP-----KVTWKKEDRD----APTKARIDVTPVGSKLEIRNAAHEDGGIYSLTV 10919

Query: 243   RSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQ 302
              +  GS    + + V+DKP PP+  +EV +  +    L W+ P D+GG  +  YVVERR 
Sbjct: 10920 ENPAGSKTVSVKVLVLDKPGPPRD-LEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRD 10978

Query: 303   AGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEAL-- 360
                + W  +       + F   H+  G +Y FRV A    G G  +E+ + + A + L  
Sbjct: 10979 VASAQWSPLSATSKKKSHFAK-HLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHP 11037

Query: 361   PKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRW 420
             P  P     +      ++L W  P   G + I GYL+E +++G+  W  +  + V     
Sbjct: 11038 PGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDW--IKFKTVTNLEC 11095

Query: 421   TVADVRQGCQYEFRVTAVAPSGPGEPG------------PPSD----------AVFARDP 458
              V  ++QG  Y FRV A    G G P             PPS            V A   
Sbjct: 11096 VVTGLQQGKTYRFRVKAENIVGLGLPDTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTT 11155

Query: 459   MRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPV 518
             +R P ++R + V        T  W   D  E    + Y VE  +  S+            
Sbjct: 11156 VRFPAIIRGVPVP-------TAKWT-TDGSEIKTDEHYTVETDNFSSV------------ 11195

Query: 519   TTYTAKG-LRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTV 577
                T K  LR   G + ++T  N  G    +   T++        P  ++D + + +   
Sbjct: 11196 --LTIKNCLRRDTGEY-QITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHM--- 11249

Query: 578   KVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVV 637
                 T+      +    P + ++ +     K +  V   G ++  + +  L     Y   
Sbjct: 11250 ----TISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFR 11305

Query: 638   LRTLQGKEVA-----------HSFRIRVAACPQAPGPIHLQENVPGTVTAEWE-PSPDEA 685
             +R      V            H F     + P  PG   + +      T  W  P  D  
Sbjct: 11306 VRAENKIGVGPPLDSTPTVAKHKF-----SPPSPPGKPVVTDITENAATVSWTLPKSDGG 11360

Query: 686   QDVPLHYAVFTRSSAHGPWHEA-ADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSD 744
               +  +Y    R    G W       I   +F + G+  G+ Y FRV A+N  G SKPS 
Sbjct: 11361 SPITGYY--MERREVTGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSP 11418

Query: 745   TSQP 748
             +S P
Sbjct: 11419 SSDP 11422



 Score =  121 bits (304), Expect = 2e-27
 Identities = 151/635 (23%), Positives = 240/635 (37%), Gaps = 61/635 (9%)

Query: 253   LTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVG 312
             + +  I  P  PQ P  V D  R  V L W  P D GG  V  Y++E ++  +  W K  
Sbjct: 23653 VAMDPIAPPGKPQNP-RVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCN 23711

Query: 313   EAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESE------EILVAPEALPKAPSA 366
               P     +T  H+  G +Y FRV A  + G GE  E        E+L  P+        
Sbjct: 23712 TTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQ 23771

Query: 367   PAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVR 426
               I     QG  +  T P       I  +  E +        A ++    E     AD  
Sbjct: 23772 EGIFVR--QGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHT-ELVIKEADRG 23828

Query: 427   QGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPD 486
                 Y+     V  +  G+            P  P G    L+  D    S+ +SW  P 
Sbjct: 23829 DSGTYDL----VLENKCGKKAVYIKVRVIGSPNSPEG---PLEYDDIQVRSVRVSWRPPA 23881

Query: 487   TQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQ 546
                G +  GY++E        W       V  T+   KGL+    Y  RV+A N+ G S+
Sbjct: 23882 DDGGADILGYILERREVPKAAWYTID-SRVRGTSLVVKGLKENVEYHFRVSAENQFGISK 23940

Query: 547   PSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFE-AMPMPEVTWLKDGLP 605
             P     L    PVT  PK  ++         +V D  +  VS   + P  +      G  
Sbjct: 23941 P-----LKSEEPVT--PKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYY 23993

Query: 606   LPKRSVTV------TKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVA---A 656
             + ++  +        K  +T  +  V GL     Y    R +   +V  S     +    
Sbjct: 23994 IERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQ--FRIIAQNDVGLSETSPASEPVV 24051

Query: 657   C------PQAPGPIHLQENVPGTVTAEWE-PSPDEAQDVPLHYAVFTRSSAHGPWHEA-A 708
             C      P  PG + +      +VT +WE P  D  +++ L Y V  R S    W ++  
Sbjct: 24052 CKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEI-LGYWVEYRQSGDSAWKKSNK 24110

Query: 709   DRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREP 768
             +RI   +FT+ G+L   EY FRV A+NE G S+P           +R   ++K     + 
Sbjct: 24111 ERIKDKQFTIGGLLEATEYEFRVFAENETGLSRP-----------RRTAMSIKT----KL 24155

Query: 769   DLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGV 828
                + P     ++      G    +SC + G P P + W++  + L  +     +     
Sbjct: 24156 TSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRT 24215

Query: 829   CSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
              +LT+ +   +D G Y  +A N +G+  +++ L++
Sbjct: 24216 HTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLL 24250



 Score =  120 bits (300), Expect = 7e-27
 Identities = 101/335 (30%), Positives = 145/335 (43%), Gaps = 30/335 (8%)

Query: 147  GDQQSEATLTVQDSPTIAPDVTEK----------LREPLVVKAGKPVIVKIPFQSHLPIQ 196
            G+ Q       Q+ P +  DV+ K          LR P VV  G+PV  K+         
Sbjct: 8716 GETQPVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVV-TGRPVPTKV--------- 8765

Query: 197  AAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQ 256
              W K+  E+    DR    ++G   + L +  A RKD G+Y +T  +  GS  A   ++
Sbjct: 8766 --WTKEEGEL--DKDRVVIDNVGTK-SELIIKDALRKDHGRYVITATNSCGSKFAAARVE 8820

Query: 257  VIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPA 316
            V D P P      V   +R    L W  P D+GG  +  +++ER+ A   TW +  E   
Sbjct: 8821 VFDVPGPVLDLKPVVT-NRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETER 8879

Query: 317  DSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEIL-VAPEALPKAPSAPAILSASSQ 375
                 T   +  G++Y FRV A    G G  +E   IL V P   P +P        +  
Sbjct: 8880 SKCDITG--LLEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKS 8937

Query: 376  GITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRV 435
             ITL W  PR  G + I GY+IE+R+     +  VN +  P   + V ++ +   YEFRV
Sbjct: 8938 TITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRV 8997

Query: 436  TAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQV 470
             AV   G  EP  P + V   D + PP +   L V
Sbjct: 8998 KAVNEIGESEPSLPLNVVIQDDEV-PPTIKLRLSV 9031



 Score =  120 bits (300), Expect = 7e-27
 Identities = 173/828 (20%), Positives = 294/828 (35%), Gaps = 106/828 (12%)

Query: 82    MEVQPGEAATLSCT--LTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQA 139
             + ++ G+   L+    L   L   +W K G  +   D            L I +     A
Sbjct: 14016 LTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDA 14075

Query: 140   GRYTFVA----GDQQSEATLTVQDSP---------TIAPDVTEKLREPLVVKAGKPVIVK 186
             G YT  A    G +     +TV D P          ++ +       P +   G P+   
Sbjct: 14076 GEYTITATNPFGTKVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSY 14135

Query: 187   IPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEG 246
             I  +     +  W     ++   S R     L  G   +   SA         V    +G
Sbjct: 14136 I-LEKRETSRLLWTVVSEDI--QSCRHVATKLIQGNEYIFRVSA---------VNHYGKG 14183

Query: 247   GSVQAELTLQVIDK---PDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQA 303
               VQ+E  ++++D+   P PP+ P EV +  +    + W+ P D+GG  +  Y VERR+ 
Sbjct: 14184 EPVQSE-PVKMVDRFGPPGPPEKP-EVSNVTKNTATVSWKRPVDDGGSEITGYHVERREK 14241

Query: 304   GRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEAL--P 361
                 W++  + P          ++ G  Y FRV A    G G   E+ + ++  +A   P
Sbjct: 14242 KSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPP 14301

Query: 362   KAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTA-VNDQPVPERRW 420
               PS P +   + +  +L W  P   G   I GY++E +K G   W        +   ++
Sbjct: 14302 GPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQF 14361

Query: 421   TVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP---------------GLV 465
              V D++   +Y FR++A+  +G GEP    D       M P                GL 
Sbjct: 14362 VVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRAGLS 14421

Query: 466   RNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLP-CH---VGTVPVTTY 521
               + V  +   +  ++W   +    + A    +E   S +L  +P C+    G   +T  
Sbjct: 14422 IRIFVPIKGRPAPEVTWTKDNINLKNRAN---IENTESFTLLIIPECNRYDTGKFVMTIE 14478

Query: 522   TAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTK--DLLTVKV 579
                G + G   FV V  ++  G         ++   P  +      DS T   DL  +  
Sbjct: 14479 NPAGKKSG---FVNVRVLDTPGP--------VLNLRPTDITK----DSVTLHWDLPLIDG 14523

Query: 580   GDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLR 639
             G  +               ++ +     ++S +       +    V GLS+   Y   + 
Sbjct: 14524 GSRI-------------TNYIVEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVM 14570

Query: 640   TLQ----GKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVF 695
                    G+    +  ++ +  P  P  +++ +    TV+  W     +       Y + 
Sbjct: 14571 AENEYGIGEPTETTEPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIE 14630

Query: 696   TRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQR 755
              +      W      +      +  +  G EY F+V+A N  G S P + S+P  +  Q 
Sbjct: 14631 AQRKGSDQWTHITT-VKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRE-SRPVIVKEQT 14688

Query: 756   DRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLE 815
                        E DL    + LV     +   G    +   V G P+P VTW K D+ L+
Sbjct: 14689 --------MLPELDLRGIYQKLV-----IAKAGDNIKVEIPVLGRPKPTVTWKKGDQILK 14735

Query: 816   GNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
                 V          L I      DSG Y   A N +G+     T+ V
Sbjct: 14736 QTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQV 14783



 Score =  119 bits (298), Expect = 1e-26
 Identities = 74/292 (25%), Positives = 131/292 (44%), Gaps = 7/292 (2%)

Query: 166   DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
             ++ + L++ + ++AG  + + +      P    W K G ++       A +D  + Y+ L
Sbjct: 23075 ELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLAS----RAIIDTTESYSLL 23130

Query: 226   CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPP 285
              +    R D G+Y++   ++ G   A + ++V D P P    ++V++  R  V + W  P
Sbjct: 23131 IVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPS-VKVKEVSRDSVTITWEIP 23189

Query: 286   RDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAG 345
               +GG  V  Y+VE+R+A    + K        T +  + +  G  Y FRV      G G
Sbjct: 23190 TIDGGAPVNNYIVEKREAAMRAF-KTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIG 23248

Query: 346   EALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSN 405
             E  E+ + ++  E +P  P+   ++  +   +TL W  P   G + + GY++E  K G+ 
Sbjct: 23249 EPCETSDAVLVSE-VPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTE 23307

Query: 406   TWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARD 457
              W  V          TV  + +G QY FR+ A    G  EP     AV  +D
Sbjct: 23308 RWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQD 23359



 Score =  119 bits (297), Expect = 2e-26
 Identities = 118/502 (23%), Positives = 205/502 (40%), Gaps = 27/502 (5%)

Query: 75   FSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHV 134
            F + L D  V   + A  SC L+ +     W+++G ++       F++DG +H L I   
Sbjct: 6453 FVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDC 6512

Query: 135  QGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPL-VVKAGKPVIVKIPFQSHL 193
            +      Y     D++S A L V++ P       E +R P  +++A    +V +   +  
Sbjct: 6513 RLDDECEYACGVEDRKSRARLFVEEIP------VEIIRPPQDILEAPGADVVFLAELNKD 6566

Query: 194  PIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAEL 253
             ++  W ++   VV   D+   +  G  + RL +     +D G+Y    + +    +A+L
Sbjct: 6567 KVEVQWLRNNMVVV-QGDKHQMMSEGKIH-RLQICDIKPRDQGEYRFIAKDK--EARAKL 6622

Query: 254  TLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGE 313
             L    K       + V      G  L    P D   +    +  E       T     +
Sbjct: 6623 ELAAAPKIKTADQDLVVD----VGKPLTMVVPYDAYPKAEAEWFKENEPLSTKTI----D 6674

Query: 314  APADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSAS 373
              A+ T+F     + G K  +++      G  E   + +++  P      P     ++ +
Sbjct: 6675 TTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVP-----GPVRNLEVTET 6729

Query: 374  SQG-ITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQ-GCQY 431
              G ++L W  P   G + I+GY++ERR     TW    D+      +TV  +++ G +Y
Sbjct: 6730 FDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDR-AESCEFTVTGLQKGGVEY 6788

Query: 432  EFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGD 491
             FRV+A    G GEP    + V AR     PG   N+ +TD +   ++L+W  P+   G 
Sbjct: 6789 LFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGA 6848

Query: 492  EAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALD 551
            E   YV+EL    S++W           + T   +  G+ Y  RV A N  G  +PSA  
Sbjct: 6849 EITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAAT 6908

Query: 552  TLVQAMPVTVCPKFLVDSSTKD 573
              V+       P   V+ ++ D
Sbjct: 6909 PFVKVADPIERPSPPVNLTSSD 6930



 Score =  118 bits (296), Expect = 2e-26
 Identities = 143/634 (22%), Positives = 246/634 (38%), Gaps = 71/634 (11%)

Query: 261   PDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTT 320
             P PP  P EV    +  + + W  P  +GG  +  Y +E+R      W KV +     T 
Sbjct: 20694 PGPPGIP-EVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTR 20752

Query: 321   FTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEAL--PKAPSAPAILSASSQGIT 378
                  +     Y +RV AV + G G   E  E   A + +  P  P+   I  ++   IT
Sbjct: 20753 QKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSIT 20812

Query: 379   LTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQ-PVPERRWTVADVRQGCQYEFRVTA 437
             L W+ P   G + + GY++E R+     WT V+ +  V    + V++++ G  Y FRV+A
Sbjct: 20813 LGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSA 20872

Query: 438   VAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSI------------------T 479
             V  +G GEP   ++ V A+D +  P +  +L V  R++                     T
Sbjct: 20873 VNCAGQGEPIEMNEPVQAKDILEAPEI--DLDVALRTSVIAKAGEDVQVLIPFKGRPPPT 20930

Query: 480   LSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAV 539
             ++W   +   G +A+ Y +E   S SL        T+P  T      R   G ++ +T  
Sbjct: 20931 VTWRKDEKNLGSDAR-YSIENTDSSSLL-------TIPQVT------RNDTGKYI-LTIE 20975

Query: 540   NEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTW 599
             N  G+ + S +   V   P   C K  V   ++  +T+ + D   +         P + +
Sbjct: 20976 NGVGEPKSSTVSVKVLDTPAA-CQKLQVKHVSRGTVTL-LWDPPLIDGG-----SPIINY 21028

Query: 600   LKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVA------HSFRIR 653
             + +     KR+ +V     +     +  LS+   +    R L   E+        +  ++
Sbjct: 21029 VIEKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPF--FFRVLAENEIGIGEPCETTEPVK 21086

Query: 654   VAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHT 713
              A  P     + ++++   +V   W     +   V   Y V  +      W  A     T
Sbjct: 21087 AAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGIS-KT 21145

Query: 714   NRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYR-EPDLSQ 772
                 +  +       FRV AKNE G S P                TVK      E DLS 
Sbjct: 21146 CEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGP----------ITVKELIITPEVDLSD 21195

Query: 773   KPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLT 832
              P   V +R      G    +    +G P+P ++W K+   L+ +  V  +      +L+
Sbjct: 21196 IPGAQVTVRI-----GHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLS 21250

Query: 833   IPSVSPKDSGEYKAVAENTLGQAVSTATLIVIEP 866
             I +   +  G+Y  + +N + +     T+I + P
Sbjct: 21251 IKNAKKEHGGKYTVILDNAVCRIAVPITVITLGP 21284



 Score =  117 bits (292), Expect = 6e-26
 Identities = 187/808 (23%), Positives = 304/808 (37%), Gaps = 97/808 (12%)

Query: 104   TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVA----GDQQSEATLTVQD 159
             TW K+G  L  +  V   QD     L I        G+Y   A    G  Q  A + V D
Sbjct: 11569 TWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLD 11628

Query: 160   SPTIAPD--VTEKLREPLVVKAGKPV------IVKIPFQSHLPIQAAWRKDGAEVVGSSD 211
              P    +  VT   +E   +    P+      I     +   P Q  W    ++V     
Sbjct: 11629 RPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLI 11688

Query: 212   REAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAE---LTLQVIDKPDPPQGPM 268
             +   +   + Y R+C  +                G +++ +   L +  ID+P  P+  +
Sbjct: 11689 KANLLANNEYYFRVCAENKV------------GVGPTIETKTPILAINPIDRPGEPEN-L 11735

Query: 269   EVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEP 328
              + D  +  V L+WR P  +GG     Y VERR  G   W +V +     T +       
Sbjct: 11736 HIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVE 11795

Query: 329   GRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPG 388
              + Y FRV+     G  + +++EE++V  E L K      +L     G+ LT  A    G
Sbjct: 11796 NQIYEFRVQTKNEGGESDWVKTEEVVVK-EDLQKP-----VLDLKLSGV-LTVKA----G 11844

Query: 389   SAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGP 448
                 L   +  +      WT   D     R   V    +    +F +T    S  G+   
Sbjct: 11845 DTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVV 11904

Query: 449   PSD-------AVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELC 501
              +        A    + +  PG VRNL++ D S+   T+ W  P+   G E Q Y++E C
Sbjct: 11905 TATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKC 11964

Query: 502   SSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTV 561
              +  + W   +  TV     T   L  G  Y  RV A N+ G   P+      ++ PV  
Sbjct: 11965 ETKRMVW-STYSATVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPT------ESKPVIA 12017

Query: 562   CPKF---------LVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVT 612
               K+          V   +K+ +TV     V  P  ++        +L+       R V 
Sbjct: 12018 KTKYDKPGRPDPPEVTKVSKEEMTV-----VWNPPEYDGGKSITGYFLEKKEKHSTRWVP 12072

Query: 613   VTKDGLTQLLIPVAGLSDSGLYTVVLRT---LQGKEVAHSFRIRVAACP-QAPGP---IH 665
             V K  + +  + V  L     Y   ++    +   E +   R  VA  P + PGP     
Sbjct: 12073 VNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFR 12132

Query: 666   LQENVPGTVTAEWEPSPDEAQDVPLHYAVFTR-----SSAHGPWHE--AADRIHTNRFTL 718
             + +    ++T  W     +     + Y V  R     +S    W    AA ++    FT+
Sbjct: 12133 VVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTV 12192

Query: 719   LGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLV 778
               +    EY FRV A+N++G  +P++  +       + +  ++ P   E DL    R LV
Sbjct: 12193 TSLDENQEYEFRVCAQNQVGIGRPAELKEAI-----KPKEILEPP---EIDLDASMRKLV 12244

Query: 779   GLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCS-LTIPSVS 837
              +R+     GC   +   V+G P P VTW K    ++        DL+   + L IP+ +
Sbjct: 12245 IVRA-----GCPIRLFAIVRGRPAPKVTWRK--VGIDNVVRKGQVDLVDTMAFLVIPNST 12297

Query: 838   PKDSGEYKAVAENTLGQAVSTATLIVIE 865
               DSG+Y     N  G+      + V++
Sbjct: 12298 RDDSGKYSLTLVNPAGEKAVFVNVRVLD 12325



 Score =  115 bits (288), Expect = 2e-25
 Identities = 135/516 (26%), Positives = 209/516 (40%), Gaps = 57/516 (11%)

Query: 261  PDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTT 320
            PDPP+  ++ +D     + L W PP+++GG  ++ Y+VER   G   W+  GE P   T 
Sbjct: 7216 PDPPEN-VKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGE-PVAETK 7273

Query: 321  FTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLT 380
                 +E G+ Y +RV+A+  +GA +     E + A +       AP I         LT
Sbjct: 7274 MEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVD----TQEAPEIFLDVKLLAGLT 7329

Query: 381  WTAPRGPGSAHILGYLIERRKKGSNTWT----------AVNDQPVPERRW-TVADVRQGC 429
              A    G+   L   +  + +   TWT           +  + VP++   T+ D ++  
Sbjct: 7330 VKA----GTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSD 7385

Query: 430  QYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQE 489
               + + AV   G       + AV   + +  PG      +TD +N S  L+W  P    
Sbjct: 7386 TGTYIIEAVNVCG------RATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDG 7439

Query: 490  GDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSA 549
            G +   YVVE  ++DS  W      TV  T + A  L P + Y  RV A N  G  +P  
Sbjct: 7440 GSKITNYVVERRATDSEVWHKLS-STVKDTNFKATKLIPNKEYIFRVAAENMYGVGEP-- 7496

Query: 550  LDTLVQAMPVTVCPKF--------LVDSS-TKDLLTVKVGDTVRVPVSFEAMPMPEVTWL 600
                VQA P+T   +F        L  S  TKD +T+    T   P      P+    W+
Sbjct: 7497 ----VQASPITAKYQFDPPGPPTRLEPSDITKDAVTL----TWCEPDDDGGSPITGY-WV 7547

Query: 601  KDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLY--TVVLRTLQG-----KEVAHSFRIR 653
            +   P   + V   K  +      V GL++   Y   V+   L G     K         
Sbjct: 7548 ERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKD 7607

Query: 654  VAACPQAPGPIHLQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIH 712
                P  PG   +++    +V   W +P  D    +   Y +    +    W   A+ + 
Sbjct: 7608 PIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIE-SYVIEMLKTGTDEWVRVAEGVP 7666

Query: 713  TNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
            T +  L G++ G EY FRV A N+ G S+PS+ S P
Sbjct: 7667 TTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDP 7702



 Score =  113 bits (282), Expect = 9e-25
 Identities = 154/665 (23%), Positives = 253/665 (38%), Gaps = 113/665 (16%)

Query: 251   AELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLK 310
             ++ TL V   P  P G  +  D  R  + L+W PP  +GG  +  Y +E+RQ G   W++
Sbjct: 21474 SKFTLAV--SPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVGYSIEKRQ-GNERWVR 21530

Query: 311   VGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAIL 370
                       +T   + PG +Y FR+ A  + G           ++P +           
Sbjct: 21531 CNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGT----------ISPPS----------- 21569

Query: 371   SASSQGITLTWTAPRGP----GSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVR 426
                S GI +T      P    G  +  G +I +  +       V  +PVP   W     +
Sbjct: 21570 --QSSGIIMTRDENVPPIVEFGPEYFDGLII-KSGESLRIKALVQGRPVPRVTW----FK 21622

Query: 427   QGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMR-------------------------- 460
              G + E R+        G     S ++F RD  R                          
Sbjct: 21623 DGVEIEKRMNMEITDVLG-----STSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQ 21677

Query: 461   --PPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPV 518
               P  +V  ++ T+ +   +TL W  P          Y++E   +  L W          
Sbjct: 21678 DTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIE-DKCEA 21736

Query: 519   TTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTV--CPKFLVDSS-TKDLL 575
              +YTA  L  G  Y  RV+AVN+ G  +P   D +V  +  TV   P     S+ T + +
Sbjct: 21737 QSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTVPDAPGIPEPSNITGNSI 21796

Query: 576   TV------KVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLS 629
             T+        G +       E        W+K           ++K  +++    V GL+
Sbjct: 21797 TLTWARPESDGGSEIQQYILERREKKSTRWVK----------VISKRPISETRFKVTGLT 21846

Query: 630   DSGLYTVVLRTLQGKEVAHSFRI-RVAACPQA---PGP---IHLQENVPGTVTAEW-EPS 681
             +   Y   +       V  +  I R+  C +    PGP   + + +    TV+ EW +P 
Sbjct: 21847 EGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPV 21906

Query: 682   PDEAQDVPLHYAVFTRSSAHGPWHEA-ADRIHTNRFTLLGILPGHEYHFRVVAKNELGAS 740
              D   ++ + Y +    +  G WH+  A+     R+T+  +  G EY FRV A N  GA 
Sbjct: 21907 FDGGMEI-IGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAIN--GAG 21963

Query: 741   KPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGS 800
             K  D+ +     +  DR T        P+L     F    ++H++  G    +  A QG 
Sbjct: 21964 K-GDSCEVTGTIKAVDRLTA-------PELDIDANFK---QTHVVRAGASIRLFIAYQGR 22012

Query: 801   PRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTAT 860
             P P   W K D +L     +++TD     +LT+ + +  D+G+Y    EN  G    T T
Sbjct: 22013 PTPTAVWSKPDSNLSLRADIHTTD--SFSTLTVENCNRNDAGKYTLTVENNSGSKSITFT 22070

Query: 861   LIVIE 865
             + V++
Sbjct: 22071 VKVLD 22075



 Score =  111 bits (278), Expect = 3e-24
 Identities = 160/634 (25%), Positives = 242/634 (38%), Gaps = 90/634 (14%)

Query: 259   DKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADS 318
             + P PP   + + D  ++ V L W  P+ +GG  +  YV+E ++ G   W  +       
Sbjct: 14591 EAPSPPDS-LNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHI--TTVKG 14647

Query: 319   TTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEA-LPKAPSAPAILSASSQGI 377
                   ++  G +YTF+V AV S G     ES  ++V  +  LP+       L    Q +
Sbjct: 14648 LECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELD-----LRGIYQKL 14702

Query: 378   TLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTA 437
              +            +LG     R K + TW   +      +R                  
Sbjct: 14703 VIAKAGDNIKVEIPVLG-----RPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECV 14757

Query: 438   VAPSGP---------GEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQ 488
              + SGP         GE G          P  P G ++  +V   S+  +T SW  P+  
Sbjct: 14758 RSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEV---SSDFVTFSWDPPEND 14814

Query: 489   EGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPS 548
              G     YVVE+  +DS  W+     TV  TTY A  L  G  Y  RV A N  G     
Sbjct: 14815 GGVPISNYVVEMRQTDSTTWVELAT-TVIRTTYKATRLTTGLEYQFRVKAQNRYGVGPGI 14873

Query: 549   ALDTLVQAMPVTV-----CPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDG 603
                 +V   P  V      P+  V + TKD +T+   +    P+S    P+     L   
Sbjct: 14874 TSACIVANYPFKVPGPPGTPQ--VTAVTKDSMTISWHE----PLSDGGSPI-----LGYH 14922

Query: 604   LPLPKRS----VTVTKDGLTQLLIPVAGLSDSGLYT--VVLRTLQGKEVAHSFRIRVAAC 657
             +   +R+     TV+K  +   +   +GL+D   Y   V+   + GK         + A 
Sbjct: 14923 VERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLAL 14982

Query: 658   -----PQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAA-DRI 711
                  P  P P+++  +   TVT +W             Y V  R   +G W +A    I
Sbjct: 14983 DPIDPPGKPVPLNITRH---TVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNI 15039

Query: 712   HTNRFTLLGILPGHEYHFRVVAKNELGA-SKPSDTSQPWCIPRQRDRFTVKAPCYREPDL 770
               N FT+ G+     Y FRV+AKN  GA S PS+ S         D  T +       D 
Sbjct: 15040 LENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPS---------DAITCR-------DD 15083

Query: 771   SQKPRFLVGLR---SHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP------AVY 821
              + P+  V ++   + +L  G    +   V G P P + W K+ + LEG        A +
Sbjct: 15084 VEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADF 15143

Query: 822   STDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQA 855
             ST+L+   S      + +DSG Y   A N  G A
Sbjct: 15144 STNLVNKDS------TRRDSGAYTLTATNPGGFA 15171



 Score =  110 bits (276), Expect = 4e-24
 Identities = 188/795 (23%), Positives = 286/795 (35%), Gaps = 129/795 (16%)

Query: 115   QDGVIFKQDGLVHSLFITHVQGTQAGRYTFV----AGDQQSEATLTVQDSPT-------- 162
             +D  I        SL + +V    +G+YT      +G + +  T+ V D+P+        
Sbjct: 16612 RDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVT 16671

Query: 163   -IAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREA----QVD 217
              I  D      EP ++  G  +   I     +  + A RK  A VV +  + +    Q+ 
Sbjct: 16672 EITKDSVSITWEPPLLDGGSKIKNYI-----VEKREATRKSYAAVVTNCHKNSWKIDQLQ 16726

Query: 218   LGDGYTRLCLPSAGRKDCGQYSVTLRSEGG---SVQAELTLQVIDKPDPPQGPMEVQDCH 274
              G  Y               + VT  +E G     Q    ++V + P PP G + V D  
Sbjct: 16727 EGCSY--------------YFRVTAENEYGIGLPAQTADPIKVAEVPQPP-GKITVDDVT 16771

Query: 275   RAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTF 334
             R  V L W  P  +GG  +  Y+VE +      W +     +     T  ++  G +Y F
Sbjct: 16772 RNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVIT--NLTQGEEYLF 16829

Query: 335   RVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQ-GITLTWTAPRGPGSAHIL 393
             RV AV  +G  +       +VA + + +    PA  S S Q G  L    P         
Sbjct: 16830 RVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVP--------- 16880

Query: 394   GYLIERRKKGSNTWTAVNDQPVPERRWTVAD-------------VRQGCQYEFRVTAVAP 440
                I  R K + TWT          R  V D                G QY   V  V  
Sbjct: 16881 ---ISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVV- 16936

Query: 441   SGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVEL 500
                G+     + V    P  P G V+     D S  SITLSW  P    G +   Y+V+ 
Sbjct: 16937 ---GQKTASIEIVTLDKPDPPKGPVK---FDDVSAESITLSWNPPLYTGGCQITNYIVQK 16990

Query: 501   CSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVT 560
               + +  W      TV  TT     L+ G  Y  R+ A N  GQS     D +V   P  
Sbjct: 16991 RDTTTTVW-DVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYK 17049

Query: 561   V-----CPKFLVDSSTKDLLTVKVGDTVR------VPVSFEAMPMPEVTWLKDGLPLPKR 609
                    P     + +KD + ++  + V       +    E      + W K        
Sbjct: 17050 EPGPPGTP--FATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTK-------- 17099

Query: 610   SVTVTKDGLTQLLIPVAGLSDSGLY--TVVLRTLQG-KEVAHSFRIRVAACP----QAPG 662
                V K  +         L +   Y   V    + G  + + +    VA  P      P 
Sbjct: 17100 ---VNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPE 17156

Query: 663   PIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAA-DRIHTNRFTLLGI 721
             PI ++ N    +T +W     +   +   Y V  R    G W +A+   +   +FT+ G+
Sbjct: 17157 PIMVKRN---EITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGL 17213

Query: 722   LPGHEYHFRVVAKNELGA-SKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGL 780
                  Y FRV+AKN  GA SKPSD++ P          T K      P +S  P+F   +
Sbjct: 17214 TEDQRYEFRVIAKNAAGAISKPSDSTGP---------ITAKDE-VELPRISMDPKFRDTI 17263

Query: 781   RSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP--AVYSTDLLGVCSLTIPSVSP 838
                ++  G    +   V G P P + W + D+ +E +    + +TD   +  L +     
Sbjct: 17264 ---VVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKAL--LIVKDAIR 17318

Query: 839   KDSGEYKAVAENTLG 853
              D G+Y   A N  G
Sbjct: 17319 IDGGQYILRASNVAG 17333



 Score =  108 bits (269), Expect = 3e-23
 Identities = 184/807 (22%), Positives = 303/807 (37%), Gaps = 106/807 (13%)

Query: 104   TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFV----AGDQQSEATLTVQD 159
             TW K  V L  + G+  K       L   +V    AG+Y        G ++    + V D
Sbjct: 13354 TWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLD 13413

Query: 160   SPTIAPDVTEK---------LREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSS 210
             +P    +VT K           EP ++  G P+I  +  Q     + +W     E   +S
Sbjct: 13414 TPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYV-VQKRDAERKSWSTVTTECSKTS 13472

Query: 211   DREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGP--- 267
              R A ++ G  Y               + V   +E G      T   +     P GP   
Sbjct: 13473 FRVANLEEGKSYF--------------FRVFAENEYGIGDPGETRDAVKASQTP-GPVVD 13517

Query: 268   MEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVE 327
             ++V+   ++   + W+ P  +GG  +  YVV+      + W +V ++   S  ++   + 
Sbjct: 13518 LKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVD-FLTEENKWQRVMKSL--SLQYSAKDLT 13574

Query: 328   PGRKYTFRVRAVTSEGAGEALE----SEEILVAPEALPKAPSAPAILSASSQGITLTWTA 383
              G++YTFRV A    G G   E    + + +VAP+   K    P +   + +        
Sbjct: 13575 EGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLK--GLPDLCYLAKENSNFRLKI 13632

Query: 384   PRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGP 443
             P     A  + +        ++T  +V    V      V D ++    ++ +T    +G 
Sbjct: 13633 PIKGKPAPSVSWKKGEDPLATDTRVSVESSAV-NTTLIVYDCQKSDAGKYTITLKNVAGT 13691

Query: 444   GEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSS 503
              E G  S  V  + P  P G ++  +VT     ++TL WA P    G E   Y++E   S
Sbjct: 13692 KE-GTISIKVVGK-PGIPTGPIKFDEVTAE---AMTLKWAPPKDDGGSEITNYILEKRDS 13746

Query: 504   DSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTV-- 561
              + +W+ C    V  TT+    L  G  Y  RV+A N+ G  +    + +V   P  V  
Sbjct: 13747 VNNKWVTC-ASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPD 13805

Query: 562   --CPKFLVDSSTKDLLTV-----KVGDTVRVPVSFEAMPMPEVTWLK-DGLPLPKRSVTV 613
                P  +VD     +        K G +       E      + W + +  P+  R   V
Sbjct: 13806 APPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKV 13865

Query: 614   TKDGLTQ--------LLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIH 665
             T  GLT+        + I +AG+    L +  +  L   +            P  P  I+
Sbjct: 13866 T--GLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDP-----------PGKPEVIN 13912

Query: 666   LQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTN----RFTLLG 720
             +  N   +VT  W EP  D    +   Y V  R      W +A    H N     FT+  
Sbjct: 13913 ITRN---SVTLIWTEPKYDGGHKL-TGYIVEKRDLPSKSWMKAN---HVNVPECAFTVTD 13965

Query: 721   ILPGHEYHFRVVAKNELGA-SKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVG 779
             ++ G +Y FR+ AKN  GA S PS++++      +          Y  P +   P    G
Sbjct: 13966 LVEGGKYEFRIRAKNTAGAISAPSESTETIICKDE----------YEAPTIVLDPTIKDG 14015

Query: 780   LRSHLLPQGCECCMSC-AVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSP 838
             L    +  G    ++  ++ G P P  +W K  + +  +     T       LTI   + 
Sbjct: 14016 L---TIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATR 14072

Query: 839   KDSGEYKAVAENTLGQAVSTATLIVIE 865
             KD+GEY   A N  G  V    + V++
Sbjct: 14073 KDAGEYTITATNPFGTKVEHVKVTVLD 14099



 Score =  107 bits (267), Expect = 5e-23
 Identities = 149/645 (23%), Positives = 251/645 (38%), Gaps = 86/645 (13%)

Query: 258   IDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPAD 317
             +D  DPP  P EV +  R  V L W  P+ +GG  +  Y+VE+R     +W+K       
Sbjct: 13899 LDPIDPPGKP-EVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVP 13957

Query: 318   STTFTDAHVEPGRKYTFRVRAVTSEGAGEA-LESEEILVAPEALPKAPSAPAIL--SASS 374
                FT   +  G KY FR+RA  + GA  A  ES E ++  +       AP I+      
Sbjct: 13958 ECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEY----EAPTIVLDPTIK 14013

Query: 375   QGITLTWTAPRGPGSAHILGYLIERR---KKGSNTW----TAVNDQPVPERRWTVADVRQ 427
              G+T+         +  ILG  + +    K G +      T +   P      T+    +
Sbjct: 14014 DGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSML-TIKYATR 14072

Query: 428   GCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDT 487
                 E+ +TA  P G          V   D   PPG V   ++++ S    TL+W  P  
Sbjct: 14073 KDAGEYTITATNPFGTKVEHVK---VTVLDVPGPPGPV---EISNVSAEKATLTWTPPLE 14126

Query: 488   QEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQP 547
               G   + Y++E   +  L W       +    + A  L  G  Y  RV+AVN  G+ +P
Sbjct: 14127 DGGSPIKSYILEKRETSRLLWTVVSED-IQSCRHVATKLIQGNEYIFRVSAVNHYGKGEP 14185

Query: 548   SALDTLVQAMPVTVCPKF---------LVDSSTKDLLTVKV------GDTVRVPVSFEAM 592
                   VQ+ PV +  +F          V + TK+  TV        G +       E  
Sbjct: 14186 ------VQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERR 14239

Query: 593   PMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYT--VVLRTLQG----KEV 646
                 + W++             K  ++ L   V GL +   Y   V      G     E 
Sbjct: 14240 EKKSLRWVR-----------AIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEA 14288

Query: 647   AHSFRIRVAACPQAPGPI---HLQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHG 702
             + S  ++ AA P  PGP    H+ +    + +  W +P  D   ++   Y V  +     
Sbjct: 14289 SDSVLMKDAAYP--PGPPSNPHVTDTTKKSASLAWGKPHYDGGLEIT-GYVVEHQKVGDE 14345

Query: 703   PWHE--AADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTV 760
              W +      +   +F +  +    +Y+FR+ A N+ G  +P+       + R+      
Sbjct: 14346 AWIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREM----- 14400

Query: 761   KAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAV 820
              AP +   +L  + R     R+ ++  G    +   ++G P P VTW K++ +L+    +
Sbjct: 14401 -APDF---ELDAELR-----RTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANI 14451

Query: 821   YSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
              +T+   +  L IP  +  D+G++    EN  G+      + V++
Sbjct: 14452 ENTESFTL--LIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLD 14494



 Score =  107 bits (267), Expect = 5e-23
 Identities = 142/642 (22%), Positives = 238/642 (37%), Gaps = 78/642 (12%)

Query: 254   TLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGE 313
             +++  ++P PP G + + D  R  V L W  P  +GG  +  Y+VE +  G   W     
Sbjct: 15670 SVKASERPLPP-GKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATCAT 15728

Query: 314   APADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESE-----EILVAPEALPKAPSAPA 368
                   T T   +  G +Y+FRV A   +G  +  +       + LV P A     +   
Sbjct: 15729 VKVTEATITG--LIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFT 15786

Query: 369   ILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQG 428
             +L+     + + +     P        +  ++    N  +  N+        ++  ++  
Sbjct: 15787 VLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENN--------SLLTIKDA 15838

Query: 429   CQYEFRVTAVA-PSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDT 487
             C+ +     V   +  GE     + +    P  P G V+  +VT     SITLSW  P  
Sbjct: 15839 CREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTA---DSITLSWGPPKY 15895

Query: 488   QEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQP 547
               G     Y+VE   + +  W      TV  TT  A  L+ G  Y  R+ A N  G+S  
Sbjct: 15896 DGGSSINNYIVEKRDTSTTTWQIVSA-TVARTTIKACRLKTGCEYQFRIAAENRYGKSTY 15954

Query: 548   SALDTLVQAMPVTV-----CPKFLVDSSTKDLLTVKVGDTVR------VPVSFEAMPMPE 596
                +  V   P  V      P  +V  S++D + V+  + +       +    E      
Sbjct: 15955 LNSEPTVAQYPFKVPGPPGTP--VVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNS 16012

Query: 597   VTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAA 656
             + W+K           + K  + Q      GL +   Y    R      V      +V+ 
Sbjct: 16013 ILWVK-----------LNKTPIPQTKFKTTGLEEGVEYE--FRVSAENIVGIGKPSKVSE 16059

Query: 657   C---------PQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEA 707
             C         P  P  I +  N   +VT +W+    +       Y V  +    G W +A
Sbjct: 16060 CYVARDPCDPPGRPEAIIVTRN---SVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKA 16116

Query: 708   A-DRIHTNRFTLLGILPGHEYHFRVVAKNELGA-SKPSDTSQPWCIPRQRDRFTVKAPCY 765
             +   I    F + G++  H Y FRV+A+N  G  S+PS+++       + D         
Sbjct: 16117 SFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVD--------- 16167

Query: 766   REPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP--AVYST 823
               P +S  P++   +  H    G    +   + G P P + W K D+ L       + ST
Sbjct: 16168 -PPRISMDPKYKDTIVVHA---GESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKST 16223

Query: 824   DLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
             D     SL++      DSG Y   A+N  G+   T  + V++
Sbjct: 16224 DF--ATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLD 16263



 Score =  106 bits (264), Expect = 1e-22
 Identities = 186/816 (22%), Positives = 293/816 (35%), Gaps = 93/816 (11%)

Query: 104  TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTI 163
            +W KDG ++   D +  K D +   L +       AG YT    ++   AT ++      
Sbjct: 8047 SWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIG 8106

Query: 164  APDVTEKLREPLVVKAGKPVIVKIP-FQSHLPI--QAAWRKDGAEVVGSSDREAQVDLGD 220
             P   + ++   + K+   +  + P F    PI      R++       + R   + +  
Sbjct: 8107 LPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERRE-------AGRRTYIPVMS 8159

Query: 221  GYTRLCLPSAGRKDCGQYSVTLRS---EGGSVQAELTLQVI--DKPDPPQGP--MEVQDC 273
            G  +L          G+Y   +++    GG    EL   VI  D   PP  P  +EV + 
Sbjct: 8160 GENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNP 8219

Query: 274  HRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYT 333
                + + W+PP  +GG  +  Y++E+   G   W +  E      T+T   +E G++Y 
Sbjct: 8220 TAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQ 8279

Query: 334  FRVRAVTSEGAGE------ALESEEILVAPEALPKAP-----SAPAILSASSQGI---TL 379
            FRVRA  + G  E        ++ + + AP+ + +            L AS  G    T+
Sbjct: 8280 FRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYPTI 8339

Query: 380  TWTAPRG---PGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVT 436
            TW        P         + RR+KG          P+ +R       +   Q   R +
Sbjct: 8340 TWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDS 8399

Query: 437  AVAPSGPGEPGPPSDAVFARDP-----MRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGD 491
                 G       +D   A+ P     +  PG   N    D   TS+   W  P    G 
Sbjct: 8400 LRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGS 8459

Query: 492  EAQGYVVEL--CSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSA 549
            E   Y +E    +    +W+     T+    Y+   L  G+ Y  RV A N  G   P  
Sbjct: 8460 EIINYTLEKKDKTKPDSEWIVV-TSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCV 8518

Query: 550  LDTLVQAMPV---TVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPL 606
               LV   P        K +V+  T + + VK  +           P+        G  L
Sbjct: 8519 SKPLVAKDPFGPPDAPDKPIVEDVTSNSMLVKWNEP-----KDNGSPIL-------GYWL 8566

Query: 607  PKRSVT------VTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQA 660
             KR V       V K  L  L   V GL +    T V R    +  A   +    + P+ 
Sbjct: 8567 EKREVNSTHWSRVNKSLLNALKANVDGLLEG--LTYVFRVC-AENAAGPGKFSPPSDPKT 8623

Query: 661  -------PGP--IHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADR- 710
                   PGP    + +    T+  EWEP         + Y V  +      W    ++ 
Sbjct: 8624 AHDPISPPGPPIPRVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKM 8683

Query: 711  IHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDL 770
            I   ++T+  I  G +Y  RV A N  G   P +T QP  +   ++      P   E D+
Sbjct: 8684 IKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGET-QPVTVAEPQE------PPAVELDV 8736

Query: 771  SQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCS 830
            S K     G++   +  G    +   V G P P   W K +  L+ +  V   D +G  S
Sbjct: 8737 SVKG----GIQ---IMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVV--IDNVGTKS 8787

Query: 831  -LTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
             L I     KD G Y   A N+ G   + A + V +
Sbjct: 8788 ELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFD 8823



 Score =  103 bits (256), Expect = 9e-22
 Identities = 176/829 (21%), Positives = 298/829 (35%), Gaps = 139/829 (16%)

Query: 107   KDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPD 166
             KDGV    +D  +   +     + I   + +  G+Y+  A ++  + T   +      P 
Sbjct: 9483  KDGVHDIPEDAQLETAENS-SVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPG 9541

Query: 167   VTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLC 226
               + L+   + +    +  K+P             DG + +     E +   G  +T++ 
Sbjct: 9542  PPKDLKVSDITRGSCRLSWKMPDD-----------DGGDRIKGYVIEKRTIDGKAWTKV- 9589

Query: 227   LPSAGRKDCG-------------QYSVTLRSEGG--------SVQAELTLQVIDKPDPPQ 265
                    DCG             QY   +R+E          ++Q       I  PDPP 
Sbjct: 9590  -----NPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPPI 9644

Query: 266   GPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVE-----RRQAGRSTWLKVGEAPADSTT 320
               +++    +  V L W+PP+++GG  V  Y+VE          +  W +  +   +   
Sbjct: 9645  -KLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQ 9703

Query: 321   FTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAI----------- 369
             FT   +  G +Y FRV+AV + G  +   +    V P    +    P+I           
Sbjct: 9704  FTVEDLVEGGEYEFRVKAVNAAGVSKPSAT----VGPCDCQRPDMPPSIDLKEFMEVEEG 9759

Query: 370   ----LSASSQGI---TLTW--TAPRGPGSAHILGYLIERRKKG-SNTWTAVNDQPVPERR 419
                 + A  +G+   TLTW    P+ P +   + Y     K    +T T V    +P+ R
Sbjct: 9760  TNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLV----IPQSR 9815

Query: 420   ------WTVADVRQ--GCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVT 471
                   +T+  V        E R+  +     G PGPP               V  ++  
Sbjct: 9816  RSDTGLYTITAVNNLGTASKEMRLNVL-----GRPGPP---------------VGPIKFE 9855

Query: 472   DRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVT-TYTAKGLRPGE 530
               S   +TLSW  P    G +   YV+E   ++   W+  HV + P   TYT   L  G 
Sbjct: 9856  SVSADQMTLSWFPPKDDGGSKITNYVIEKREANRKTWV--HVSSEPKECTYTIPKLLEGH 9913

Query: 531   GYFVRVTAVNEGGQSQP--SALDTLVQAMPVTVCP-KFLVDSSTKDLLTVKVGDTVRVPV 587
              Y  R+ A N+ G  +P  S  +T      V   P K  V S T++ +TV   +      
Sbjct: 9914  EYVFRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEP----- 9968

Query: 588   SFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVA----GLSDSGLYTVVLRTLQG 643
              ++        WL+      KR   V +D +  + + V+    GL +   Y   +  +  
Sbjct: 9969  EYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINA 10028

Query: 644   KEVAHSF------RIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTR 697
               V  +         R    P  P    + +    +   EW P   +       Y V  +
Sbjct: 10029 AGVGPASLPSDPATARDPIAPPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYK 10088

Query: 698   SSAHGPWHEAADR-IHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRD 756
                   W +  D+ +   +  + G+  G  Y FRV A N  G  +P + +    +   +D
Sbjct: 10089 EEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTD---VIEMKD 10145

Query: 757   RFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEG 816
             R          PDL         +  H    G    +   V G P P VTW  N+R+L  
Sbjct: 10146 RLV-------SPDLQLDASVRDRIVVHA---GGVIRIIAYVSGKPPPTVTWNMNERTLPQ 10195

Query: 817   NPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
                + +T +    S+ I +      G Y  +A+N  G+   T  + V++
Sbjct: 10196 EATIETTAISS--SMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLD 10242



 Score =  102 bits (255), Expect = 1e-21
 Identities = 154/678 (22%), Positives = 257/678 (37%), Gaps = 84/678 (12%)

Query: 228   PSAGRKDCGQYSV---TLRSEGGSVQAELTLQVIDK-PDPPQGPMEVQDCHRAGVCLRWR 283
             P AG  +  +YS     L   G S  ++ T  V  + P  P G  EV D  ++ V L W 
Sbjct: 12780 PCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIWA 12839

Query: 284   PPRDNGGRTVECYVVERRQAGRSTWLKVGEAPAD--STTFTDAHVEPGRKYTFRVRAVTS 341
              P+ +GG  +  Y VE  +     W++   AP       +T   +E   +Y FR  A T+
Sbjct: 12840 RPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTA 12899

Query: 342   EGAGEALE-SEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERR 400
                    E S+ + +  E +P     P I  + +    LT  A    G+   L   +  +
Sbjct: 12900 VNISPPSEPSDPVTILAENVP-----PRIDLSVAMKSLLTVKA----GTNVCLDATVFGK 12950

Query: 401   KKGSNTWTAVNDQPVPERRWTVADVRQGCQYE-----------FRVTAVAPSGPGEPGPP 449
                + +W        P     +A  R  C  E           + +TA   SG       
Sbjct: 12951 PMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGS------ 13004

Query: 450   SDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWL 509
               A      +  PG   ++++    +    LSW  P    G E   Y+V+   +    W 
Sbjct: 13005 KSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWA 13064

Query: 510   PCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTV---CPKFL 566
                  TVP+T+ + + L  G  Y  R+ A N+ G   P   +  +   P      C   +
Sbjct: 13065 QVSA-TVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDPPV 13123

Query: 567   VDSSTKDLLTVK---VGDTVRVPVS---FEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQ 620
             + + TKD +TV      D    P++    E      V W K           V +  + +
Sbjct: 13124 ISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTK-----------VNRKPIIE 13172

Query: 621   LLIPVAGLSDSGLY----TVVLRTLQGKEVAHSFRIRVAACPQ-APGPI---HLQENVPG 672
               +   GL +   Y    T + +   GK  + + +   A  PQ  PGP     + +    
Sbjct: 13173 RTLKATGLQEGTEYEFRVTAINKAGPGKP-SDASKAAYARDPQYPPGPPAFPKVYDTTRS 13231

Query: 673   TVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEA--ADRIHTNRFTLLGILPGHEYHF 729
             +V+  W +P+ D    + + Y V  + +    W        +   RF + G++   +Y F
Sbjct: 13232 SVSLSWGKPAYDGGSPI-IGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLMEDTQYQF 13290

Query: 730   RVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGC 789
             RV A N++G S PSD      +P +     +  P   E D   +       ++ +L  G 
Sbjct: 13291 RVYAVNKIGYSDPSD------VPDKHYPKDILIPPEGELDADLR-------KTLILRAGV 13337

Query: 790   ECCMSCAVQGSPRPHVTWFKNDRSLEGNPA--VYSTDLLGVCSLTIPSVSPKDSGEYKAV 847
                +   V+G P P +TW K + +L       + STD      L   +V+  D+G+Y   
Sbjct: 13338 TMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDF--DTFLRCENVNKYDAGKYILT 13395

Query: 848   AENTLGQAVSTATLIVIE 865
              EN+ G+   T  + V++
Sbjct: 13396 LENSCGKKEYTIVVKVLD 13413



 Score =  102 bits (253), Expect = 2e-21
 Identities = 167/782 (21%), Positives = 280/782 (35%), Gaps = 102/782 (13%)

Query: 128   SLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKI 187
             SL I +     +G+YT    +  S A+LT+       P     +    V K    +   +
Sbjct: 19869 SLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDV 19928

Query: 188   PFQSHLPIQAAWRKDGAEVVGS-------SDREAQVDLGDGYTRLCLPSAGRKDCGQYSV 240
             P             DG   V +       + ++A V + +   RL       ++   Y  
Sbjct: 19929 P-----------ENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYF 19977

Query: 241   TLRSE---GGSVQAELT--LQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVEC 295
              +  E   G  + AE    +++ +KP PP+  + V    +  V L W  P  +GG  +  
Sbjct: 19978 RVSGENEFGVGIPAETKEGVKITEKPSPPE-KLGVTSISKDSVSLTWLKPEHDGGSRIVH 20036

Query: 296   YVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALES----- 350
             YVVE  + G+  W+K   A A ST    + +    +Y FRV A    G  +  E      
Sbjct: 20037 YVVEALEKGQKNWVKC--AVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVL 20094

Query: 351   -EEILVAPEA-LPKAPSAPAILSASSQ-GITLTWTAPRGPGSAHILGYLIERRKKGSNTW 407
              +E L  PE  +   PS    + A S   + +  +    P        +  +     NT 
Sbjct: 20095 IKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTE 20154

Query: 408   TAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGE----------PGPPSDAVFARD 457
                 +  +  +    AD  +     + +TA   SG  +          PGPP+  V    
Sbjct: 20155 ITAENLTINLKESVTADAGR-----YEITAANSSGTTKAFINIVVLDRPGPPTGPVV--- 20206

Query: 458   PMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVP 517
                         ++D +  S+TL W  P    G +   Y++    + +  W      TV 
Sbjct: 20207 ------------ISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSA-TVA 20253

Query: 518   VTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVC---PKFLVDSSTKDL 574
              T      L  GE Y  R+ A N  G S       +   +P T         V + T++ 
Sbjct: 20254 RTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPPSTPWVTNVTRES 20313

Query: 575   LTV------KVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGL 628
             +TV        G +  V    E      + W K      K  +  T   +T +    AGL
Sbjct: 20314 ITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKAN----KLVIRTTHFKVTTIS---AGL 20366

Query: 629   SDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDV 688
                           GK    S  +      + P  + + +    +V+  W+    +    
Sbjct: 20367 IYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSK 20426

Query: 689   PLHYAVFTRSSAHGPWHEAA-DRIHTNRFTLLGILPGHEYHFRVVAKNELGA-SKPSDTS 746
                Y V  R    G W +A+   +   +F + G+    +Y FRV A+N +G+ S PS+  
Sbjct: 20427 ITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVV 20486

Query: 747   QP-WCIPRQRDRFTVKAPCYREP--DLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRP 803
              P  CI             Y  P  DL  +   +V  R+     G    +   + G P P
Sbjct: 20487 GPITCIDS-----------YGGPVIDLPLEYTEVVKYRA-----GTSVKLRAGISGKPAP 20530

Query: 804   HVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
              + W+K+D+ L+ N  V   +   + S+ I      +SG Y+    N +G A +T  + +
Sbjct: 20531 TIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQI 20590

Query: 864   IE 865
             ++
Sbjct: 20591 LD 20592



 Score =  101 bits (252), Expect = 3e-21
 Identities = 191/808 (23%), Positives = 287/808 (35%), Gaps = 99/808 (12%)

Query: 104   TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTV----QD 159
             TW K G+ L ++   I         L +  V    AG+YT  A +Q  + + TV     D
Sbjct: 23107 TWSKQGIDLASR--AIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYD 23164

Query: 160   SPTIAPDVTEK--LREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGS---SDREA 214
             +P   P V  K   R+ + +    P I                 DG   V +     REA
Sbjct: 23165 TPGPCPSVKVKEVSRDSVTITWEIPTI-----------------DGGAPVNNYIVEKREA 23207

Query: 215   QVDLGDGYTRLCLPS----AGRKDCGQYSVTLRSE-----GGSVQAELTLQVIDKPDPPQ 265
              +      T  C  +    +G  +   Y   +  E     G   +    + V + P  P 
Sbjct: 23208 AMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVP- 23266

Query: 266   GPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAH 325
               +EV D  ++ V L W  P  +GG  +  YV+E  +AG   W+KV          T   
Sbjct: 23267 AKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTS 23326

Query: 326   VEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPR 385
             +  G +Y FR+RA   +G  E  E+    V  + L   P+    LS   Q    T   P 
Sbjct: 23327 LNEGEQYLFRIRAQNEKGVSEPRET-VTAVTVQDLRVLPTID--LSTMPQ---KTIHVPA 23380

Query: 386   GPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSG--- 442
             G     ++   I  R   + +W     +     R TV    +  +   R T +  +G   
Sbjct: 23381 GRPVELVIP--IAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYT 23438

Query: 443   ------PGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGY 496
                    G        +    P  P G ++   + +   TSIT+SW  P+   G    GY
Sbjct: 23439 LELKNVTGTTSETIKVIILDKPGPPTGPIK---IDEIDATSITISWEPPELDGGAPLSGY 23495

Query: 497   VVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGG-----QSQPSALD 551
             VVE   +    WLP    +V  +T+    L  G  Y  RV A N  G     QS+     
Sbjct: 23496 VVEQRDAHRPGWLPVS-ESVTRSTFKFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIECR 23554

Query: 552   TLVQAM-PVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEV---TWLKDGLPLP 607
             + ++   P      F V      L      D     V+   +   EV    W++    + 
Sbjct: 23555 SSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVR----VN 23610

Query: 608   KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQ 667
             K  VT+T+   T L     GL      T +     GK    S  I VA  P AP      
Sbjct: 23611 KVPVTMTRYRSTGL---TEGLEYEHRVTAINARGSGKPSRPSKPI-VAMDPIAPPGKPQN 23666

Query: 668   ENVPGT----VTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEA-ADRIHTNRFTLLGIL 722
               V  T    V+  W    DE       Y +  +      W +          +TL  + 
Sbjct: 23667 PRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREYTLTHLP 23726

Query: 723   PGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYRE-PDLSQKPRFLVGLR 781
              G EY FRV+A N  G  +P++              TVK     E PD     R+  G+ 
Sbjct: 23727 QGAEYRFRVLACNAGGPGEPAEVPG-----------TVKVTEMLEYPDYELDERYQEGI- 23774

Query: 782   SHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDS 841
                + QG    ++  ++G P P   W K  + +     + +++      L I      DS
Sbjct: 23775 --FVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSET--HTELVIKEADRGDS 23830

Query: 842   GEYKAVAENTLG-QAVSTATLIVIEPST 868
             G Y  V EN  G +AV     ++  P++
Sbjct: 23831 GTYDLVLENKCGKKAVYIKVRVIGSPNS 23858



 Score =  100 bits (248), Expect = 8e-21
 Identities = 149/651 (22%), Positives = 247/651 (37%), Gaps = 79/651 (12%)

Query: 246   GGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGR 305
             G  V+    ++  + P PP G + + D  +    L W  P  +GG  V  YVVE +  G 
Sbjct: 17826 GVPVETVDAVKAAEPPSPP-GKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGT 17884

Query: 306   STWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGA------GEALESEEILVAPEA 359
               W  V E+   +   T   +  G++Y FRV+A   +G       G  + ++++ + P  
Sbjct: 17885 EKWSIVAESKVCNAVVTG--LSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSL 17942

Query: 360   LPKAP-SAPAILSASSQGITLTWTAPRGPGSAHIL-GYLIERRKKGSNTWTAVNDQPVPE 417
               K P +  +I +     I +       P  + +  G  +++  + +   TA +      
Sbjct: 17943 --KLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATS------ 17994

Query: 418   RRWTVADVRQGCQYEF-RVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNT 476
                TV  +++G + +F + T  A +  G        +    P  P G VR  +V   S  
Sbjct: 17995 ---TVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEV---SAD 18048

Query: 477   SITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHV--GTVPVTTYTAKGLRPGEGYFV 534
              + +SW  P    G +   Y+VE   + +  W   H+   TV  TT     L+ G  Y  
Sbjct: 18049 FVVISWEPPAYTGGCQISNYIVEKRDTTTTTW---HMVSATVARTTIKITKLKTGTEYQF 18105

Query: 535   RVTAVNEGGQSQPSALDTLVQAMPVTVC----PKFLVDSSTKDLLT-----VKVGDTVRV 585
             R+ A N  G+S P     ++   P          F+   S   +L      V  G T  +
Sbjct: 18106 RIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKII 18165

Query: 586   PVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGL---YTVVLRTLQ 642
                 E      + W+K    L K  +  TK   T L        D GL   + V    + 
Sbjct: 18166 GYHLEQKEKNSILWVK----LNKTPIQDTKFKTTGL--------DEGLEYEFKVSAENIV 18213

Query: 643   G----KEVAHSFRIRVAACPQA-PGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTR 697
             G     +V+  F  R    P   P  I +  N    VT +W+    +       Y V  +
Sbjct: 18214 GIGKPSKVSECFVARDPCDPPGRPEAIVITRN---NVTLKWKKPAYDGGSKITGYIVEKK 18270

Query: 698   SSAHGPWHEAA-DRIHTNRFTLLGILPGHEYHFRVVAKNELGA-SKPSDTSQPWCIPRQR 755
                 G W +A+   +    FT+ G++    Y FRV+A+N  G  S+PSD+S       + 
Sbjct: 18271 DLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEI 18330

Query: 756   DRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLE 815
             D           P+ S  P++   +  H    G    +   ++G P P V W K+ + LE
Sbjct: 18331 DA----------PNASLDPKYKDVIVVHA---GETFVLEADIRGKPIPDVVWSKDGKELE 18377

Query: 816   GNPA-VYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
                A +     +   +L +      D G+Y     N  G      T+ V++
Sbjct: 18378 ETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLD 18428



 Score = 99.8 bits (247), Expect = 1e-20
 Identities = 144/687 (20%), Positives = 255/687 (37%), Gaps = 87/687 (12%)

Query: 105   WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTV------Q 158
             W KDG  L     V       V SL I        G Y     +     T+ +      +
Sbjct: 19056 WRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDR 19115

Query: 159   DSPTIAPDVTEKLREPLVVKAGKP------VIVKIPFQSHLPIQAAWRKDGAEVVGSSDR 212
               P     + E   + + +    P       I     +        W      V  +S +
Sbjct: 19116 PGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSIK 19175

Query: 213   EAQVDLGDGYT-RLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQ 271
               ++  G  Y  R+C  +       +Y  +  SE  +V AE        P  P G  +V 
Sbjct: 19176 IVRLTTGSEYQFRVCAEN-------RYGKSSYSESSAVVAEYPF----SPPGPPGTPKVV 19224

Query: 272   DCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRK 331
                ++ + + W+ P ++GG  V  Y +E ++     W K  +     T    + ++ G  
Sbjct: 19225 HATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLM 19284

Query: 332   YTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAH 391
             Y +RV A    G G+  +S E + A +     P  P + + + + ++L W+ P   G A 
Sbjct: 19285 YEYRVYAENIAGIGKCSKSCEPVPARDPC-DPPGQPEVTNITRKSVSLKWSKPHYDGGAK 19343

Query: 392   ILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTA-VAPSGPGEPGPPS 450
             I GY++ERR+     W   N   + E  + V ++ +  +YEFRV A  A     EP   +
Sbjct: 19344 ITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSEST 19403

Query: 451   DAVFARDPMRPPGLVRNLQVTD----------RSNTSI------TLSWAGPDTQEGDEAQ 494
               +  +D + PP ++ +++  D          + N  I       +SWA    +  + A+
Sbjct: 19404 GPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERAR 19463

Query: 495   GYVVELCSSDSLQWLPCHVGTVPVTTYTAKG-LRPGEGYFVRVTAVNEGGQSQPSALDTL 553
                 E+ S+D+             T  T K  +R   G +V +T  N  G ++  A++  
Sbjct: 19464 ---TEIISTDN------------HTLLTVKDCIRRDTGQYV-LTLKNVAG-TRSVAVNCK 19506

Query: 554   VQAMPVTVCPKFLVDSSTKDLLTVKVG---DTVRVPVSFEAMPMPEVTWL-----KDGLP 605
             V   P        ++  T +  ++  G   +     + +  +   E + L     +  L 
Sbjct: 19507 VLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQ 19566

Query: 606   LPKRSVTVTKDGLTQLLIPVAGLSDSG----LYTVVLRTLQGKEVAHSFRIRVAACPQAP 661
             +    VT    G  + +  V G++  G    L +V ++ L    V           P  P
Sbjct: 19567 MTSCKVTKLLKG-NEYIFRVTGVNKYGVGEPLESVAIKALDPFTV-----------PSPP 19614

Query: 662   GPIHLQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADR-IHTNRFTLL 719
               + +      ++T  W  P  D   ++   Y +  R      W     + ++  R    
Sbjct: 19615 TSLEITSVTKESMTLCWSRPESDGGSEIS-GYIIERREKNSLRWVRVNKKPVYDLRVKST 19673

Query: 720   GILPGHEYHFRVVAKNELGASKPSDTS 746
             G+  G EY +RV A+N  G S PS+TS
Sbjct: 19674 GLREGCEYEYRVYAENAAGLSLPSETS 19700



 Score = 99.4 bits (246), Expect = 1e-20
 Identities = 86/303 (28%), Positives = 136/303 (44%), Gaps = 23/303 (7%)

Query: 74    HFSQGLADMEVQPGEAATLSCTLTSDLGP-GTWFKDGVKLTTQDGVIFKQD---GLVHSL 129
             HF + L ++ V+    ATL C +T    P   W++ G ++   DG+ ++     G  H L
Sbjct: 24557 HFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIA-DGLKYRIQEFKGGYHQL 24615

Query: 130   FITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKA--------GK 181
              I  V    A  Y   A +Q      +V  + ++  +V  K+  P  ++         G+
Sbjct: 24616 IIASVTDDDATVYQVRATNQGG----SVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGE 24671

Query: 182   PVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPS-AGRKDCGQYSV 240
              V +KIPF         W+K G +++  ++   QV +   +T L  P+   RKD G Y V
Sbjct: 24672 VVSIKIPFSGKPDPVITWQK-GQDLI-DNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVV 24729

Query: 241   TLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVER 300
               ++  G  Q  + L V D PDPP+G ++V D  R  V L W  P  +GG  +  Y+VE+
Sbjct: 24730 CAKNRFGIDQKTVELDVADVPDPPRG-VKVSDVSRDSVNLTWTEPASDGGSKITNYIVEK 24788

Query: 301   RQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEAL 360
                    WL+VG+  A  T +T  ++     Y FRV A    G  +  E  E  +  E  
Sbjct: 24789 CATTAERWLRVGQ--ARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDK 24846

Query: 361   PKA 363
              +A
Sbjct: 24847 TRA 24849



 Score = 98.6 bits (244), Expect = 2e-20
 Identities = 93/395 (23%), Positives = 157/395 (39%), Gaps = 28/395 (7%)

Query: 84    VQPGEAATLSCTLTSDLGPG-TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRY 142
             +Q GE   +   +     P  +W KDG  L     V  ++      L I        G+Y
Sbjct: 17951 IQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKY 18010

Query: 143   TFVAGDQQSEAT------LTVQDSPTIAPDVTEKLREPLVVKAGKP-------VIVKIPF 189
             T  A +    AT      +  +  P + P   +++    VV + +P        I     
Sbjct: 18011 TVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIV 18070

Query: 190   QSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYT-RLCLPSAGRKDCGQYSVTLRSEGGS 248
             +        W    A V  ++ +  ++  G  Y  R+   +   K     S  L S+   
Sbjct: 18071 EKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGK-----SAPLDSKAVI 18125

Query: 249   VQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTW 308
             VQ         +P PP  P  V    +  + ++W  P ++GG  +  Y +E+++     W
Sbjct: 18126 VQ-----YPFKEPGPPGTPF-VTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILW 18179

Query: 309   LKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPA 368
             +K+ + P   T F    ++ G +Y F+V A    G G+  +  E  VA +     P  P 
Sbjct: 18180 VKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPC-DPPGRPE 18238

Query: 369   ILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQG 428
              +  +   +TL W  P   G + I GY++E++      W   +   V E  +TV+ + + 
Sbjct: 18239 AIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVED 18298

Query: 429   CQYEFRVTAVAPSGP-GEPGPPSDAVFARDPMRPP 462
              +YEFRV A   +G   EP   S A+ ARD +  P
Sbjct: 18299 QRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAP 18333



 Score = 95.5 bits (236), Expect = 2e-19
 Identities = 148/634 (23%), Positives = 251/634 (39%), Gaps = 62/634 (9%)

Query: 259   DKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADS 318
             ++P PP+  ++V D  ++   L W  P  +GG  +  Y++E RQ G   W++ G      
Sbjct: 22172 EQPAPPRR-LDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHTK--Q 22228

Query: 319   TTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGIT 378
              TFT   +    +Y FRV+A    G  E  E+   ++  E  P+      +   ++Q IT
Sbjct: 22229 LTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKE--PQIEPTADLTGITNQLIT 22286

Query: 379   LTWTAP-------RGPGSAHILGYLIERRKKGSN--TWTAVNDQPVPERRWTVADVRQGC 429
                 +P        G  +  +   L E R K ++  + T   D+       TV D  +G 
Sbjct: 22287 CKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTT----LTVKDSMRGD 22342

Query: 430   QYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQE 489
                + +T          G  + +V      RP  +   ++V+  S  S  LSW  P    
Sbjct: 22343 SGRYFLTL-----ENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGG 22397

Query: 490   GDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSA 549
             G E   Y+VE   S +  W   +  +V  T      L     Y  RV++ N  G S+P  
Sbjct: 22398 GTEITNYIVEKRESGTTAWQLVN-SSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE 22456

Query: 550   LDTLVQA---MPVTVCPKFLVDSSTKDLLTVKV------GDTVRVPVSFEAMPMPEVTWL 600
                ++     +P +   +  V   + + ++++       G +  +    E      + W+
Sbjct: 22457 SAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWV 22516

Query: 601   KDG-LPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACP- 658
             K+  +P  + +  VT  GL + L       +    T  L      + + + R  +A  P 
Sbjct: 22517 KENKVPCLECNYKVT--GLVEGL-------EYQFRTYALNAAGVSKASEASRPIMAQNPV 22567

Query: 659   QAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAH---GPWHEAADRIHT-N 714
              APG   + +    TV+  W     +     + Y +  +  +    G W +    I + N
Sbjct: 22568 DAPGRPEVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDN 22627

Query: 715   RFTLLGILPGHEYHFRVVAKNELGA-SKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQK 773
              FT+  +  G  Y FRV+AKN  G  SK S+++ P      RD +   AP   E D ++ 
Sbjct: 22628 FFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTC---RDEY---APPKAELD-ARL 22680

Query: 774   PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTI 833
                LV +R+     G +  +  AV G P P + W K D+ L+    V         +  I
Sbjct: 22681 HGDLVTIRA-----GSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVI 22735

Query: 834   PSVSPKDSGEYKAVAENTLG-QAVSTATLIVIEP 866
                   DSG+Y    +N  G +AVS    ++  P
Sbjct: 22736 KFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSP 22769



 Score = 94.0 bits (232), Expect = 5e-19
 Identities = 147/632 (23%), Positives = 240/632 (37%), Gaps = 61/632 (9%)

Query: 259   DKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADS 318
             D  DPP  P  +    R  + L+W  P  +GG  +  Y+VE+R      W+K        
Sbjct: 17147 DPCDPPGTPEPIM-VKRNEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIE 17205

Query: 319   TTFTDAHVEPGRKYTFRVRAVTSEGA-GEALESEEILVAPEA--LPKAPSAPAILSAS-- 373
             T FT + +   ++Y FRV A  + GA  +  +S   + A +   LP+    P        
Sbjct: 17206 TQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVV 17265

Query: 374   SQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVR-QGCQYE 432
             + G T    A         + +L   ++   +    + +            +R  G QY 
Sbjct: 17266 NAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYI 17325

Query: 433   FRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDE 492
              R + VA    G    P +      P  P G V   QVT  ++   +L+W+ P    G +
Sbjct: 17326 LRASNVA----GSKSFPVNVKVLDRPGPPEGPV---QVTGVTSEKCSLTWSPPLQDGGSD 17378

Query: 493   AQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDT 552
                YVVE   +  L W       V  +    K L  G  Y  R+ AVN+ G  +P     
Sbjct: 17379 ISHYVVEKRETSRLAWTVVASEVVTNSLKVTK-LLEGNEYVFRIMAVNKYGVGEPLESAP 17437

Query: 553   LVQAMPVTVC--PKFL-VDSSTKDLLTV------KVGDTVRVPVSFEAMPMPEVTWLKDG 603
             ++   P  +   PK L V +  KD +TV        G +  +    E      + W+K  
Sbjct: 17438 VLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIK-- 17495

Query: 604   LPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYT--VVLRTLQGKEVAHSFRIRVAACPQA- 660
                        K  +T L + V GL++   Y   V      G        +   AC    
Sbjct: 17496 ---------CNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVF 17546

Query: 661   -PGP---IHLQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADR--IHT 713
              PGP    H+ +    ++T  W +P  D   ++ L Y V    +    W     +  +  
Sbjct: 17547 KPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEI-LGYVVEICKADEEEWQIVTPQTGLRV 17605

Query: 714   NRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQK 773
              RF +  +    EY  RV A N++G  +   TS P  + +  D+  ++AP   E DL  +
Sbjct: 17606 TRFEISKLTEHQEYKIRVCALNKVGLGEA--TSVPGTV-KPEDK--LEAP---ELDLDSE 17657

Query: 774   PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTI 833
              R  + +R+     G    +    +G P P +TW + +   E    V     +    L+I
Sbjct: 17658 LRKGIVVRA-----GGSARIHIPFKGRPTPEITWSREEG--EFTDKVQIEKGVNYTQLSI 17710

Query: 834   PSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
              +    D+G+Y    EN+ G   +  T+ V++
Sbjct: 17711 DNCDRNDAGKYILKLENSSGSKSAFVTVKVLD 17742



 Score = 94.0 bits (232), Expect = 5e-19
 Identities = 146/640 (22%), Positives = 231/640 (36%), Gaps = 76/640 (11%)

Query: 259   DKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADS 318
             D  DPP  P E     R  V L+W+ P  +GG  +  Y+VE++      W+K        
Sbjct: 18229 DPCDPPGRP-EAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLE 18287

Query: 319   TTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGIT 378
             T FT + +   ++Y FRV  +    AG   E  +   A  A  +  +  A L    + + 
Sbjct: 18288 TEFTVSGLVEDQRYEFRV--IARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVI 18345

Query: 379   LTWTAPRGPGSAHILGYLI------ERRKKGSNTWTAVNDQPVPERRWTVAD--VR-QGC 429
             +          A I G  I      +  K+   T   +  +   ++   V    +R  G 
Sbjct: 18346 VVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGG 18405

Query: 430   QYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQE 489
             QY  +++ V     G    P        P  P G    L+VT  +     L+W  P    
Sbjct: 18406 QYILKLSNVG----GTKSIPITVKVLDRPGPPEG---PLKVTGVTAEKCYLAWNPPLQDG 18458

Query: 490   GDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSA 549
             G     Y++E   +  L W       V    Y    L PG  Y  RV AVN+ G  +P  
Sbjct: 18459 GANISHYIIEKRETSRLSWTQVST-EVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEP-- 18515

Query: 550   LDTLVQAMPVTVCPKFL---------VDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWL 600
                 +++ PVT C  +          V + TKD + V             A P+ +    
Sbjct: 18516 ----LESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTW-----------ARPVDDGGTE 18560

Query: 601   KDGLPLPKRS------VTVTKDGLTQLLIPVAGLSDSGLYT--VVLRTLQGKEVAHSFRI 652
              +G  L KR           K  LT L + V GL++   Y   V      G        +
Sbjct: 18561 IEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSV 18620

Query: 653   RVAAC-----PQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEA 707
                AC     P  P    + +    +V+  W     +       Y V  + +A   W   
Sbjct: 18621 FYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTC 18680

Query: 708   ADR--IHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCY 765
                  +   +FT+  +    EY+FR+ A N  G  +P+  + P  +  Q     ++ P  
Sbjct: 18681 TPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPA--TLPGSVVAQE---RIEPP-- 18733

Query: 766   REPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDL 825
              E +L    R +V LR+    +     +   ++G P P V W K +  L     +  T  
Sbjct: 18734 -EIELDADLRKVVVLRASATLR-----LFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSS 18787

Query: 826   LGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
               +  L I +V+  DSG Y    EN  G   +   + V++
Sbjct: 18788 FTM--LVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLD 18825



 Score = 87.0 bits (214), Expect = 7e-17
 Identities = 146/659 (22%), Positives = 230/659 (34%), Gaps = 113/659 (17%)

Query: 258   IDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPAD 317
             +D  DPP  P+ + +  R  V L+W  P   GG  +  Y+VE+R      WLK   +   
Sbjct: 14982 LDPIDPPGKPVPL-NITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNIL 15040

Query: 318   STTFTDAHVEPGRKYTFRVRAVTSEGA-------GEALESEEILVAPE----------AL 360
                FT + +     Y FRV A  + GA        +A+   + + AP+           +
Sbjct: 15041 ENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVI 15100

Query: 361   PKAPSA-----------PAILSASSQGITLTWTAPRGPGSAHILGYLIE----RRKKGSN 405
              KA  A           P  +  S  G  L  TA      A     L+     RR  G+ 
Sbjct: 15101 LKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAY 15160

Query: 406   TWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLV 465
             T TA N     +  + V  + +                  PGPP                
Sbjct: 15161 TLTATNPGGFAKHIFNVKVLDR------------------PGPPEGP------------- 15189

Query: 466   RNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKG 525
               L VT+ ++    LSW  P    G +   Y+V+   +  L W       V VT      
Sbjct: 15190 --LAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNV-ASEVQVTKLKVTK 15246

Query: 526   LRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVC--PKFL-VDSSTKDLLTV----- 577
             L  G  Y  RV AVN+ G  +P   + ++   P      PK   V + TKD + V     
Sbjct: 15247 LLKGNEYIFRVMAVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHP 15306

Query: 578   -KVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYT- 635
                G +  +    E        W+K             K  LT L   V+GL++   Y  
Sbjct: 15307 DSDGGSEIINYIVERRDKAGQRWIK-----------CNKKTLTDLRYKVSGLTEGHEYEF 15355

Query: 636   -VVLRTLQGKEVAHSFRIRVAAC-----PQAPGPIHLQENVPGTVTAEW-EPSPDEAQDV 688
              ++     G            AC     P  PG   + +    +++  W +P  D   ++
Sbjct: 15356 RIMAENAAGISAPSPTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEI 15415

Query: 689   PLHYAVFTRSSAHGPWHEAADR--IHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS 746
                Y V         W        +    +T+ G+    EY  R+ A N  G  +P+   
Sbjct: 15416 T-GYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVP 15474

Query: 747   QPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVT 806
                  P+  DR         E +L    R +V +R+      C   +   ++G P P V 
Sbjct: 15475 GT---PKAEDRMLPP-----EIELDADLRKVVTIRAC-----CTLRLFVPIKGRPAPEVK 15521

Query: 807   WFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
             W ++        ++ ST    +  L + +V+  DSG+Y    EN+ G   +   + V++
Sbjct: 15522 WARDHGESLDKASIESTSSYTL--LIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLD 15578



 Score = 86.3 bits (212), Expect = 1e-16
 Identities = 145/654 (22%), Positives = 246/654 (37%), Gaps = 78/654 (11%)

Query: 258  IDKPDPPQGPMEVQDCHR--AGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAP 315
            +D   PP  P  +    R  + + L W+ PR NGG  ++ Y++E+R+  +  + +V +  
Sbjct: 8917 VDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRL 8976

Query: 316  ADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQ 375
              +T+F   +++  + Y FRV+AV   G  E      +++  + +P  P+    LS    
Sbjct: 8977 CPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVP--PTIKLRLSVRGD 9034

Query: 376  GITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADV-RQGCQYEFR 434
             I +    P     A + G  + + +   N    V ++P    + T  +V R   + E  
Sbjct: 9035 TIKVKAGEPVHI-PADVTGLPMPKIEWSKNE--TVIEKPTDALQITKEEVSRSEAKTELS 9091

Query: 435  VTAVAPSGPGEPGPPSD----AVFAR------DPMRPPGLVRNLQVTDRSNTSITLSWAG 484
            +        G     +     +VF        D   PP   RNL VTD    S  L+W  
Sbjct: 9092 IPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPP---RNLAVTDIKAESCYLTWDA 9148

Query: 485  PDTQEGDEAQGYVVEL--CSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEG 542
            P    G E   YV++    S    +W      T     Y    L P   Y  RV AVN+ 
Sbjct: 9149 PLDNGGSEITHYVIDKRDASRKKAEWEEV-TNTAVEKRYGIWKLIPNGQYEFRVRAVNKY 9207

Query: 543  GQSQPSALDTLVQAMPVTVC-----PKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEV 597
            G S     D +V   P  +      PK L  + TK  + V    +   P+     P+   
Sbjct: 9208 GISDECKSDKVVIQDPYRLPGPPGKPKVL--ARTKGSMLV----SWTPPLDNGGSPITGY 9261

Query: 598  TWLK---DGLPLPKR--SVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEV---AHS 649
             WL+   +G P   R     +TK GL  +   V  L +   Y      +    +   +  
Sbjct: 9262 -WLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEP 9320

Query: 650  FRIRVAACPQ-APGPI---HLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPW- 704
                VA  P   PGP     +++    +++  W+P   +       Y V  +      W 
Sbjct: 9321 SDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWK 9380

Query: 705  --HEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKA 762
              +E    I T    +  +    +Y FRV A NE G S+PSDT             T + 
Sbjct: 9381 RVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDT-------------TGEI 9427

Query: 763  PCYREPDLSQKPRFLVGLRSH---LLPQGCECCMSCAVQGSPRPHVTWFKNDRSL----E 815
            P     D+ ++P   + + +    +   G +  +   ++G P P  +W  + ++     +
Sbjct: 9428 PA---TDIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKD 9484

Query: 816  GNPAVYSTDLLGVCS----LTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
            G   +     L        + IP      +G+Y   A+N  GQ  +   + V++
Sbjct: 9485 GVHDIPEDAQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMD 9538



 Score = 84.7 bits (208), Expect = 3e-16
 Identities = 149/655 (22%), Positives = 232/655 (35%), Gaps = 88/655 (13%)

Query: 250   QAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWL 309
             +A +  + I  P+ P+  +EV++  +  V L W PP+ +GG  +  YV+E R  G   + 
Sbjct: 10334 EALVIREPITVPERPED-LEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFH 10392

Query: 310   KVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAI 369
             KV      S  +T   ++ G  Y +RV AV   G G+     + +   + L    + P +
Sbjct: 10393 KVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDEL----APPTL 10448

Query: 370   LSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGC 429
                    +T+        G A  L      + K   +W       + + R  +       
Sbjct: 10449 HLDFRDKLTIR------VGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATL 10502

Query: 430   QYEFRVTAVAPSGPG----EPGPPSDAVFARDPM--RPPGLVRNLQVTDRSNTSITLSWA 483
               E      + SG      E    S   F +  +  RP   V  +   + +   + +SW 
Sbjct: 10503 ALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWK 10562

Query: 484   GPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGG 543
              P    G +   Y++E        W+P    +   T   +K L  G+ Y  R+ A N  G
Sbjct: 10563 PPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSK-LLEGKDYIFRIHAENLYG 10621

Query: 544   QSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPE-VTWLKD 602
              S P                  LV  S K     +V D    P+  E       VTW K 
Sbjct: 10622 ISDP------------------LVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKP 10663

Query: 603   ---GLPLP-----------KRSVTVTKDGL---TQLLIPVAGLSDSGLYTVVLRTLQGKE 645
                G P+            KR   VTKD +   T+  +P   L +   Y    R     E
Sbjct: 10664 HDGGKPITNYILEKRETMSKRWARVTKDPIHPYTKFRVP--DLLEGCQYE--FRVSAENE 10719

Query: 646   VAHS---------FRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFT 696
             +            F     A P  P      +    +V   W+P   +     L Y V  
Sbjct: 10720 IGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEY 10779

Query: 697   RSSAHGPWHEA---ADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPR 753
             +      W  A    +     ++ + G+  G  Y FRV+A N  G S P+   +P  +  
Sbjct: 10780 QKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLV-- 10837

Query: 754   QRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRS 813
              +DR          P+L          R   +  G    +S  ++G P P VTW K DR 
Sbjct: 10838 -KDRL-------EPPELILDANMA---REQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRD 10886

Query: 814   LEGNPAVYSTDLLGVCS-LTIPSVSPKDSGEYKAVAENTLG-QAVSTATLIVIEP 866
                 P     D+  V S L I + + +D G Y    EN  G + VS   L++ +P
Sbjct: 10887 A---PTKARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKP 10938



 Score = 84.3 bits (207), Expect = 4e-16
 Identities = 179/804 (22%), Positives = 285/804 (35%), Gaps = 104/804 (12%)

Query: 79   LADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQ 138
            L D+E    ++ T  C +        W K+G ++   + V ++ D   H L I       
Sbjct: 6368 LKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPD 6427

Query: 139  AGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAA 198
             G Y   AG  +S A L + ++PT   +  E L +  V +    V     F   L  + A
Sbjct: 6428 EGEYIVTAGQDKSVAELLIIEAPT---EFVEHLEDQTVTEFDDAV-----FSCQLSREKA 6479

Query: 199  ---WRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTL 255
               W ++G E+     ++ + +      RL +      D  +Y+  +  E    +A L +
Sbjct: 6480 NVKWYRNGREI--KEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGV--EDRKSRARLFV 6535

Query: 256  QVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRD---NGGRTVECYVVERRQAGRSTWLKVG 312
            + I        P+E+            RPP+D     G  V       +      WL+  
Sbjct: 6536 EEI--------PVEI-----------IRPPQDILEAPGADVVFLAELNKDKVEVQWLRNN 6576

Query: 313  EAPADSTTFTDAH--VEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAIL 370
                      D H  +  G+ +  ++  +     GE     +   A   L  A +AP I 
Sbjct: 6577 MVVVQG----DKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELA-AAPKIK 6631

Query: 371  SASSQ-----GITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADV 425
            +A        G  LT   P          +  E     + T     D    +  + + + 
Sbjct: 6632 TADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKT----IDTTAEQTSFRILEA 6687

Query: 426  RQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGP 485
            ++G +  +++      G  E             +  PG VRNL+VT+  +  ++L+W  P
Sbjct: 6688 KKGDKGRYKIVLQNKHGKAE------GFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEP 6741

Query: 486  DTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGL-RPGEGYFVRVTAVNEGGQ 544
             T  G +  GYVVE        W+           +T  GL + G  Y  RV+A N  G 
Sbjct: 6742 LTDGGSKIIGYVVERRDIKRKTWV-LATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGT 6800

Query: 545  SQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPE-------- 596
             +P   D      PV    K+ V       L V + D  R  VS    P PE        
Sbjct: 6801 GEPVETDN-----PVEARSKYDVPGPP---LNVTITDVNRFGVSLTWEP-PEYDGGAEIT 6851

Query: 597  --VTWLKDGLPLP-KRSVTVTKDGLTQLLIPVA-GLSDSGLYTVVLRTLQGKEVAHSFRI 652
              V  L+D   +    ++TV  + L+  +  V  G   S       R   GK  A +  +
Sbjct: 6852 NYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFV 6911

Query: 653  RVAACPQAPGP---IHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAAD 709
            +VA   + P P   +   +    +V  +WEP   +     L Y +         W     
Sbjct: 6912 KVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNM 6971

Query: 710  RIHTN-RFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREP 768
            ++     + + G+  G++Y +RV A+N+ G S PS+   P                + EP
Sbjct: 6972 KLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGP----------LTADDAFVEP 7021

Query: 769  --DLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLL 826
              DLS    F  GL   ++P      +     G PRP  TW   D+ LE    V    L 
Sbjct: 7022 TMDLS---AFKDGLEV-IVPNPITILVPST--GYPRPTATWCFGDKVLETGDRVKMKTLS 7075

Query: 827  GVCSLTIPSVSPKDSGEYKAVAEN 850
                L I      D G Y    EN
Sbjct: 7076 AYAELVISPSERSDKGIYTLKLEN 7099



 Score = 84.0 bits (206), Expect = 6e-16
 Identities = 57/214 (26%), Positives = 94/214 (43%), Gaps = 17/214 (7%)

Query: 652   IRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRI 711
             I+VA  PQ PG I + +    +V+  W     +     + Y V  ++     W E A R+
Sbjct: 16753 IKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECA-RV 16811

Query: 712   HTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLS 771
              + +  +  +  G EY FRVVA NE G S P   + P           V      EPD+ 
Sbjct: 16812 KSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVP----------IVAKDLVIEPDV- 16860

Query: 772   QKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSL 831
              KP F     S+ +  G +  +   + G P+P +TW K+   L+    +  TD L + +L
Sbjct: 16861 -KPAF----SSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTL 16915

Query: 832   TIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
             +I      D G+Y     N +GQ  ++  ++ ++
Sbjct: 16916 SIKETHKDDGGQYGITVANVVGQKTASIEIVTLD 16949



 Score = 82.8 bits (203), Expect = 1e-15
 Identities = 142/640 (22%), Positives = 236/640 (36%), Gaps = 77/640 (12%)

Query: 259   DKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADS 318
             D  DPP  P E     R  V L+W+ P  +GG  +  Y+VE+++     W+K        
Sbjct: 16065 DPCDPPGRP-EAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASFTNIID 16123

Query: 319   TTFTDAHVEPGRKYTFRVRAVTSEGA-GEALESEEILVAPEALPKAPSAPAILSASSQGI 377
             T F    +    +Y FRV A  + G   E  ES   + A + +                 
Sbjct: 16124 THFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDP--------------- 16168

Query: 378   TLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVAD--VRQGCQYEFRV 435
                   PR          ++    +       +  +P+P  +W   D  +    + E + 
Sbjct: 16169 ------PRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKS 16222

Query: 436   TAVAPSGPGEPGPPSDA----VFARDPMRPPGLVRNLQVTDRSNT-------------SI 478
             T  A S   +     D+    + A++      +  N++V DR                  
Sbjct: 16223 TDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGVTAEKC 16282

Query: 479   TLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTA 538
             TL+W  P    G +   Y+VE   +  L W         ++    K L  G  Y  R+ A
Sbjct: 16283 TLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTK-LLEGNEYTFRIMA 16341

Query: 539   VNEGGQSQPSALDTLVQAMPVTV--CPKFL-VDSSTKDLLTVKVGDTVRVPVSFEAMPMP 595
             VN+ G  +P   + +V   P  V   PK   V + TKD + V V +        E +   
Sbjct: 16342 VNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIV-VWERPASDGGSEILGYV 16400

Query: 596   EVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYT--VVLRTLQGKEVAHSFRIR 653
                  K+G+    R     K  + +L + V GL ++  Y   V      G          
Sbjct: 16401 LEKRDKEGI----RWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAY 16456

Query: 654   VAACPQA--PGPIHLQENVPGT---VTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEA 707
               AC     PGP +  + +  T   V   W +P  D   ++   Y V     + G W   
Sbjct: 16457 QKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQ-GYIVEKCDVSVGEWTMC 16515

Query: 708   ADRIHTNRFTLL--GILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCY 765
                   N+  +    +L  HEY+FR+ A N+ G  + +D   P  +  +     ++AP  
Sbjct: 16516 TPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEK-----LEAP-- 16568

Query: 766   REPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDL 825
              + DL  + R ++ +R+     G    +   ++G P P V W K D  +     +  T  
Sbjct: 16569 -DIDLDLELRKIINIRA-----GGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTS- 16621

Query: 826   LGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
                 SL + +V+  DSG+Y    EN+ G   +  T+ V++
Sbjct: 16622 -SFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLD 16660



 Score = 67.8 bits (164), Expect = 4e-11
 Identities = 53/214 (24%), Positives = 86/214 (40%), Gaps = 17/214 (7%)

Query: 652   IRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRI 711
             ++V+  P  PG + L +    T T +WE    +       Y V  ++     W     ++
Sbjct: 18918 VKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKW-STCTQV 18976

Query: 712   HTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLS 771
              T   T+ G+  G EY FRV A NE G S P     P  I R               D+ 
Sbjct: 18977 KTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVP-VIAR---------------DIE 19020

Query: 772   QKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSL 831
              KP   +   +  +    +  +    +G P+  V W K+ ++L+    V  +    V SL
Sbjct: 19021 IKPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSL 19080

Query: 832   TIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
             +I   S +D G Y+    N+ G      T+IV++
Sbjct: 19081 SIKEASKEDVGTYELCVSNSAGSITVPITIIVLD 19114



 Score = 65.1 bits (157), Expect = 3e-10
 Identities = 72/324 (22%), Positives = 132/324 (40%), Gaps = 47/324 (14%)

Query: 75   FSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHV 134
            F + + D++V   + A   C ++       W KD  +L   D +  +++  VH L I   
Sbjct: 3014 FRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPST 3073

Query: 135  QGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQ-SHL 193
            + + AG+YT VAG   S A L V+        + ++++   V++  + V   + F+ +  
Sbjct: 3074 RMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQ---VIEKQRAV---VEFEVNED 3127

Query: 194  PIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAEL 253
             + A W KDG E+        +  +     R+ +    + D G+Y+       G  ++ +
Sbjct: 3128 DVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFV----AGRNRSSV 3183

Query: 254  TLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVE-CYVVERRQAGRSTWLKVG 312
            TL V + P+PPQ   E+Q            P     G+    C V+  R   + +W K  
Sbjct: 3184 TLYV-NAPEPPQVLQELQ------------PVTVQSGKPARFCAVISGRPQPKISWYK-- 3228

Query: 313  EAPADSTTFTDAHVEPGRKYTFRV------------------RAVTSEGAGEALESEEIL 354
            E    ST F    +  G++YT  +                    V +  A  ++E  E++
Sbjct: 3229 EEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVV 3288

Query: 355  VAPEALPKAPSAPAILSASSQGIT 378
               + +P  P  PAI++     +T
Sbjct: 3289 SPDQEMPVYP--PAIITPLQDTVT 3310



 Score = 61.6 bits (148), Expect = 3e-09
 Identities = 73/304 (24%), Positives = 120/304 (39%), Gaps = 57/304 (18%)

Query: 593  PMPEVTWLKDGLPLP---KRSVTVTKD-GLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAH 648
            P P V W K G+PL    +  V+  K  G  +L+I +    D+G YT+V+R   G+  A 
Sbjct: 1063 PKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSAS 1122

Query: 649  S-------------------FRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVP 689
            +                   ++ +V A  Q P    + E  PG V +E+E   ++ Q   
Sbjct: 1123 ASLLEEADYELLMKSQQEMLYQTQVTAFVQEP---KVGETAPGFVYSEYEKEYEKEQ--A 1177

Query: 690  LHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPW 749
            L      + +     +      H + F    I    E  +R++ K  L      D  +  
Sbjct: 1178 LIRKKMAKDTVVVRTYVEDQEFHISSFEERLI---KEIEYRII-KTTLEELLEEDGEEKM 1233

Query: 750  CIPRQRDRFTVKAPCYREPDLSQKPRFLVG----LRSHLLPQGCECCMSCAVQGSPRPHV 805
             +                 D+S+      G    ++++ + +G      C + G P P +
Sbjct: 1234 AV-----------------DISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKI 1276

Query: 806  TWFKNDRSLEGNPAVYSTDLL--GVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
             W+K+ + ++     Y  D L  G  SL IP V P+D G Y A A N  G A+ +  L V
Sbjct: 1277 AWYKDGKRIKHGER-YQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYV 1335

Query: 864  IEPS 867
             EP+
Sbjct: 1336 -EPA 1338



 Score = 61.6 bits (148), Expect = 3e-09
 Identities = 36/103 (34%), Positives = 54/103 (52%), Gaps = 4/103 (3%)

Query: 769   DLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGV 828
             +LS  P F+   RS  + +G     +C + G P P + WFKN+  +  +  V  +    V
Sbjct: 26757 ELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNV 26816

Query: 829   CSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVI----EPS 867
              SL I + S  DSG+Y   A+N  GQ  +TA+L+V+    EPS
Sbjct: 26817 YSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPS 26859



 Score = 59.7 bits (143), Expect = 1e-08
 Identities = 42/139 (30%), Positives = 66/139 (47%), Gaps = 5/139 (3%)

Query: 79   LADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQ 138
            L D+ V  GE AT  C L+ +  P  W+  G KL   D V+ + +G VH+L +  V+   
Sbjct: 5830 LKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLED 5889

Query: 139  AGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAA 198
            AG     A D ++ A L V++ P    + T+ L E   V+ G   +++    S    +  
Sbjct: 5890 AGEVQLTAKDFKTHANLFVKEPPV---EFTKPL-EDQTVEEGATAVLECEV-SRENAKVK 5944

Query: 199  WRKDGAEVVGSSDREAQVD 217
            W K+G E++ S   E   D
Sbjct: 5945 WFKNGTEILKSKKYEIVAD 5963



 Score = 59.3 bits (142), Expect = 1e-08
 Identities = 53/213 (24%), Positives = 87/213 (40%), Gaps = 17/213 (7%)

Query: 658   PQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAA-DRIHTNRF 716
             P APG   +      +    W+P   +      +Y +  R      W     + I    F
Sbjct: 24453 PGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVF 24512

Query: 717   TLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRF 776
             ++  ++ G EY FRV  +N  G S+ S+ S+P  I  + D   ++AP ++E         
Sbjct: 24513 SVKNLIEGLEYEFRVKCENLGGESEWSEISEP--ITPKSD-VPIQAPHFKEE-------- 24561

Query: 777   LVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLL--GVCSLTIP 834
                LR+  +       + C V G P+P V W++  + +  +   Y       G   L I 
Sbjct: 24562 ---LRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIA 24618

Query: 835   SVSPKDSGEYKAVAENTLGQAVSTATLIVIEPS 867
             SV+  D+  Y+  A N  G    TA+L V  P+
Sbjct: 24619 SVTDDDATVYQVRATNQGGSVSGTASLEVEVPA 24651



 Score = 58.5 bits (140), Expect = 3e-08
 Identities = 53/190 (27%), Positives = 81/190 (42%), Gaps = 12/190 (6%)

Query: 75   FSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHV 134
            F   L D  V+ GE AT  C L+ +     WFK+  KL T   V+   +G  H L +  V
Sbjct: 5204 FMSPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEV 5263

Query: 135  QGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLP 194
                  +      +  S A L V ++    P  T KL +   V+  + + +K      +P
Sbjct: 5264 TLDDISQIKAQVKELSSTAQLKVLEAD---PYFTVKLHDKTAVEKDE-ITLKCEVSKDVP 5319

Query: 195  IQAAWRKDGAEVVGSSDREAQVDLGDGYTR-LCLPSAGRKDCGQYSVTLRSE--GGSVQA 251
            ++  W KDG E+V S     +    DG  R L +  A  KD G+Y     ++    +V  
Sbjct: 5320 VK--WFKDGEEIVPSPKYSIK---ADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTV 5374

Query: 252  ELTLQVIDKP 261
            E  L  ++KP
Sbjct: 5375 EARLIKVEKP 5384



 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 33/94 (35%), Positives = 45/94 (47%)

Query: 770   LSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVC 829
             L   PR  + +RSH +P G        VQ  P   V W+ N   L+ +  ++ T+  GV 
Sbjct: 25998 LDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVL 26057

Query: 830   SLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
             +L I      DSG Y+AV  N  G+A   ATL V
Sbjct: 26058 TLEILDCHTDDSGTYRAVCTNYKGEASDYATLDV 26091



 Score = 55.8 bits (133), Expect = 2e-07
 Identities = 33/95 (34%), Positives = 50/95 (52%), Gaps = 2/95 (2%)

Query: 771 SQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGN--PAVYSTDLLGV 828
           +Q P F   L+S ++ +G        + G P P V+WF++ + +  +  P V  +   G 
Sbjct: 3   TQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR 62

Query: 829 CSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
             LTIP+V+  +SG Y   A N  GQA STA L+V
Sbjct: 63  AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLV 97



 Score = 55.5 bits (132), Expect = 2e-07
 Identities = 55/211 (26%), Positives = 81/211 (38%), Gaps = 14/211 (6%)

Query: 42   IYGERRDATRSSTSRYKPGTGSFSKDAQGPMGHFSQGLADMEVQP----GEAATLSCTLT 97
            I  ERR     S     P    F+   +     F + + D+ +      G +A   C ++
Sbjct: 4712 IEAERRKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIILTESEFVGSSAIFECLVS 4771

Query: 98   SDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVA----GDQQSEA 153
                  TW KDG  +       F  DG    L I  VQ + AG YT V      ++ S A
Sbjct: 4772 PSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTA 4831

Query: 154  TLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDRE 213
             L V++ P       + L E + V  G+P+ +         +   WRKDG  VV    R 
Sbjct: 4832 KLVVEELPV---RFVKTLEEEVTVVKGQPLYLSCELNKERDV--VWRKDGKIVVEKPGRI 4886

Query: 214  AQVDLGDGYTRLCLPSAGRKDCGQYSVTLRS 244
                +G     L +  A   D G Y+VT+ +
Sbjct: 4887 VPGVIG-LMRALTINDADDTDAGTYTVTVEN 4916



 Score = 52.8 bits (125), Expect = 1e-06
 Identities = 80/327 (24%), Positives = 120/327 (36%), Gaps = 46/327 (14%)

Query: 580  GDTVRVPVSFEAMPMPEVTWLKDGLPLPK---RSVTVTKDGLTQLLIPVAGLSDSGLYTV 636
            G T R  +     PMPE  W  DG  +       V + +DG   L+I  A  SDSG +TV
Sbjct: 1425 GQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTV 1484

Query: 637  VLRTLQGKEVAHSFRIRVAACPQAPGPIHLQE----------NVPGTVTAEWEPSPD--- 683
            V +   G+  + S  + V A      P+ +++           +   V A   P+PD   
Sbjct: 1485 VAQNRAGRS-SISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVW 1543

Query: 684  -EAQDVPLHYAVFTRSSAHGPWHEAADRIHTN------RFTLLGILPGHEYHFRVVAKNE 736
             +  D+ + +  + +    G   EAA +I +        +T   I        R     E
Sbjct: 1544 LKNSDIIVPHK-YPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVE 1602

Query: 737  LGASKPSDTSQPWCIPRQRDRFTVKAPCYREP------------------DLSQKPRFLV 778
            +  ++P +  +   IPR   R    A    EP                  +  QKP F  
Sbjct: 1603 VEFAEP-EPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKK 1661

Query: 779  GLRSHLLPQGCECCMSCAVQ--GSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSV 836
             L S  L +       C +   G P   V W  + + LE    +   +  G CSL     
Sbjct: 1662 KLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVA 1721

Query: 837  SPKDSGEYKAVAENTLGQAVSTATLIV 863
              +DSG     A N  G   ++ATLIV
Sbjct: 1722 YSRDSGIITCRATNKYGTDHTSATLIV 1748



 Score = 52.4 bits (124), Expect = 2e-06
 Identities = 35/133 (26%), Positives = 62/133 (46%), Gaps = 7/133 (5%)

Query: 74   HFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITH 133
            H ++ + ++EV   + A+  C ++    P  W K+GV++   +       G +H L I +
Sbjct: 2837 HITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMN 2896

Query: 134  VQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHL 193
                 +  YTFV G+ Q  ATLTV  +P +   +T  L++  +    K  I      ++ 
Sbjct: 2897 TSTEDSAEYTFVCGNDQVSATLTV--TPIM---ITSMLKD--INAEEKDTITFEVTVNYE 2949

Query: 194  PIQAAWRKDGAEV 206
             I   W K+G E+
Sbjct: 2950 GISYKWLKNGVEI 2962



 Score = 51.6 bits (122), Expect = 3e-06
 Identities = 70/295 (23%), Positives = 108/295 (36%), Gaps = 29/295 (9%)

Query: 577  VKVGDTVRVPVSFEAMPMP-EVTWLKDGLPL----PKRSVTVTKDGLTQLLIPVAGLSDS 631
            V+V +  R  V FE      +  W KDG+ +     +R   V +  + ++ I     SD+
Sbjct: 3110 VQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDA 3169

Query: 632  GLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIH-LQENVPGTVTAEWEPSPDEAQDVPL 690
            G YT V         A   R  V     AP P   LQE  P TV +         +    
Sbjct: 3170 GEYTFV---------AGRNRSSVTLYVNAPEPPQVLQELQPVTVQS--------GKPARF 3212

Query: 691  HYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVV-AKNELGASKPSDTSQPW 749
               +  R      W++    + T  F    +  G EY   ++ A  E  A    +    +
Sbjct: 3213 CAVISGRPQPKISWYKEEQLLSTG-FKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDY 3271

Query: 750  CIPRQRDRFTVKAPCYREPDLSQK---PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVT 806
             +       +V+ P    PD       P  +  L+  +  +G      C V G+    V+
Sbjct: 3272 GVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLK-VS 3330

Query: 807  WFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATL 861
            W+  D+ ++ +     T       L I    P+D G Y  VA N +GQ  STA L
Sbjct: 3331 WYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANL 3385



 Score = 51.2 bits (121), Expect = 4e-06
 Identities = 46/171 (26%), Positives = 78/171 (45%), Gaps = 10/171 (5%)

Query: 79   LADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQ 138
            L D+  +  +  T   T+  +     W K+GV++ + D    +   L HSL I +V    
Sbjct: 2929 LKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGD 2988

Query: 139  AGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAA 198
            A  YTFVAG   S ATL V+       +  + +++  V++  + +      +  + +Q  
Sbjct: 2989 AADYTFVAGKATSTATLYVEARHI---EFRKHIKDIKVLEKKRAMFECEVSEPDITVQ-- 3043

Query: 199  WRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSV 249
            W KD  E +  +DR  ++       RL +PS    D G+Y+V     GG+V
Sbjct: 3044 WMKDDQE-LQITDR-IKIQKEKYVHRLLIPSTRMSDAGKYTVV---AGGNV 3089



 Score = 50.1 bits (118), Expect = 9e-06
 Identities = 44/196 (22%), Positives = 84/196 (42%), Gaps = 9/196 (4%)

Query: 69   QGPMGHFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHS 128
            +G +  F + L D+EV    +  L C ++ +   G W+ + V+L +             +
Sbjct: 2217 EGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQN 2276

Query: 129  LFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAG-KPVIVKI 187
            L +  V     G Y+FV   +++   L ++  P     + + L +  V +     + VK+
Sbjct: 2277 LTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIA---ILQGLSDQKVCEGDIVQLEVKV 2333

Query: 188  PFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGG 247
              +S   ++  W KDG E V  SDR   + +      L +    ++D G YS T+ + G 
Sbjct: 2334 SLES---VEGVWMKDGQE-VQPSDR-VHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGL 2388

Query: 248  SVQAELTLQVIDKPDP 263
            S    +++  +D   P
Sbjct: 2389 STSGRVSVYSVDVITP 2404



 Score = 49.7 bits (117), Expect = 1e-05
 Identities = 64/317 (20%), Positives = 118/317 (37%), Gaps = 36/317 (11%)

Query: 575  LTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKR-SVTVTKDGLTQLLIPVAGL-SDSG 632
            +TV+ G   R        P P+++W K+   L          DG    L+ +     D+ 
Sbjct: 3202 VTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAA 3261

Query: 633  LYTVVLRTLQG---KEVAHSFRIRVAACPQAPGPIH---LQENVPGTVTAEWEPSPDEAQ 686
            +YT   +   G      + S  +     P    P++   +   +  TVT+E +P+  + +
Sbjct: 3262 VYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCR 3321

Query: 687  DVPLHYAVFTRSSAHGPWHEAADRIHTNRF------------TLLGILPGHEYHFRVVAK 734
                     + +     W+    +I  +RF             +    P  E  +  VA 
Sbjct: 3322 --------VSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVAS 3373

Query: 735  NELG-ASKPSDTSQPWCIPRQRDRFTVK-----APCYREPDLSQKPRFLVGLRSHLLPQG 788
            N +G  S  ++ S       + +    +     +  +++  L QKP F+  L S  +  G
Sbjct: 3374 NAVGQVSSTANLSLEGFSKFEENTSNSQWHVSLSVSFKKEPLGQKPSFIQPLSSLRVHNG 3433

Query: 789  CECCMSCAVQGSPRPHVTWFKNDRSLEGNPAV--YSTDLLGVCSLTIPSVSPKDSGEYKA 846
                    V G P+P + WF N + +     V  +  +  G+  + I     + +G+Y  
Sbjct: 3434 ETVRFHARVSGIPKPEIQWFHNQQLILPTKDVVFHFEESTGMALMLIVDAYSEHAGQYSC 3493

Query: 847  VAENTLGQAVSTATLIV 863
             A N+ G+A   ATL V
Sbjct: 3494 KAANSAGEATCAATLTV 3510



 Score = 49.3 bits (116), Expect = 2e-05
 Identities = 49/195 (25%), Positives = 75/195 (38%), Gaps = 13/195 (6%)

Query: 75    FSQGLADMEVQPGEAATLSCTLTSDLGPG-TWFKDGVKLTTQDG---VIFKQDGLVHSLF 130
             F+  L +     GE      T+T    P  TW+K G K+   D      F+ D  ++ L 
Sbjct: 25320 FTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLT 25379

Query: 131   ITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKA--------GKP 182
             I  V       YT VA ++  E +   + + T+ P  T+    P+  +         G+ 
Sbjct: 25380 INSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQS 25439

Query: 183   VIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTL 242
             V  +I      P    W KDG  +    + E  +  G  Y  L +     +D G Y VT 
Sbjct: 25440 VCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEI-IHEGLDYYALHIRDTLPEDTGYYRVTA 25498

Query: 243   RSEGGSVQAELTLQV 257
              +  GS   +  LQV
Sbjct: 25499 TNTAGSTSCQAHLQV 25513



 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 28/90 (31%), Positives = 47/90 (52%)

Query: 774 PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTI 833
           P F+  L+S  + QG +  +   V G P P V ++++   ++ +     +    + SL I
Sbjct: 104 PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLI 163

Query: 834 PSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
               P+DSG Y   A N++G+A STA L+V
Sbjct: 164 AEAYPEDSGTYSVNATNSVGRATSTAELLV 193



 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 1/94 (1%)

Query: 774 PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTI 833
           P  + GL++  + +G    + C + G P P VTW++ D  +E +     T   G+  L I
Sbjct: 897 PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMI 956

Query: 834 PSVSPKDSGEYKAVAENTLGQAVSTATLIVIEPS 867
                +DSG +   A N  G  VST+  + ++ S
Sbjct: 957 REAFAEDSGRFTCSAVNEAG-TVSTSCYLAVQVS 989



 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 46/166 (27%), Positives = 73/166 (43%), Gaps = 9/166 (5%)

Query: 75   FSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHV 134
            F   L D+  +  E+A  +  L+ D     WFK+  +L T   V  + +G  HS+    +
Sbjct: 5559 FLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDL 5618

Query: 135  QGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLP 194
                  +    A    SEA LTV +     P  T KL++   V+  + ++     ++  P
Sbjct: 5619 SIDDTSQIRVEAMGMSSEAKLTVLEGD---PYFTGKLQDYTGVEKDEVILQCEISKADAP 5675

Query: 195  IQAAWRKDGAEVVGSSDREAQVDLGDGYTR-LCLPSAGRKDCGQYS 239
            ++  W KDG E+  S +    V   DG  R L L  A + D GQY+
Sbjct: 5676 VK--WFKDGKEIKPSKN---AVIKADGKKRMLILKKALKSDIGQYT 5716



 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 51/215 (23%), Positives = 93/215 (43%), Gaps = 27/215 (12%)

Query: 658   PQAPGPIHLQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTN-- 714
             P  P    + +    +++  W +P  D   D+ + Y +  +      W+    R+HTN  
Sbjct: 22970 PGPPSAPRVVDTTKHSISLAWTKPMYDGGTDI-VGYVLEMQEKDTDQWY----RVHTNAT 23024

Query: 715   ----RFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDL 770
                  FT+  +  G +Y FRV A N  G S+ S++      P +R    ++ P   + +L
Sbjct: 23025 IRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAE-IEPVER----IEIP---DLEL 23076

Query: 771   SQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCS 830
             +   +  V +R+     G    +  +V G P P +TW K    L     + +T+   +  
Sbjct: 23077 ADDLKKTVTIRA-----GASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSL-- 23129

Query: 831   LTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
             L +  V+  D+G+Y   AEN  G+  +T  + V +
Sbjct: 23130 LIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYD 23164



 Score = 48.1 bits (113), Expect = 3e-05
 Identities = 61/279 (21%), Positives = 101/279 (36%), Gaps = 54/279 (19%)

Query: 593  PMPEVTWLKDGLPLP---KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHS 649
            P+P++ W KDG  +    +  +   +DG   L IPV    D G+YT     ++G  +  S
Sbjct: 1272 PLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAIC-S 1330

Query: 650  FRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAAD 709
             ++ V        P ++    P +      P                RS +  P   +  
Sbjct: 1331 GKLYVEPAAPLGAPTYIPTLEPVSRIRSLSP----------------RSVSRSPIRMSPA 1374

Query: 710  RIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPD 769
            R+   R +                        P+  S     P +R   T ++   R   
Sbjct: 1375 RMSPARMS------------------------PARMSPARMSPGRRLEETDESQLER--- 1407

Query: 770  LSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGN---PAVYSTDLL 826
               KP F++   S    +G        V G P P   WF + + +  +     V   D  
Sbjct: 1408 -LYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKED-- 1464

Query: 827  GVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
            G  SL I   +P DSGE+  VA+N  G++ S + ++ +E
Sbjct: 1465 GTQSLIIVPATPSDSGEWTVVAQNRAGRS-SISVILTVE 1502



 Score = 47.0 bits (110), Expect = 8e-05
 Identities = 33/98 (33%), Positives = 45/98 (45%), Gaps = 5/98 (5%)

Query: 774  PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDL---LGVCS 830
            P FL  L+     QG        V G P P VTWFK ++ L    +VY T +    G  +
Sbjct: 3700 PHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQL--CTSVYYTIIHNPNGSGT 3757

Query: 831  LTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIEPST 868
              +     +DSG Y   AEN LG++   A L+V+   T
Sbjct: 3758 FIVNDPQREDSGLYICKAENMLGESTCAAELLVLLEDT 3795



 Score = 46.2 bits (108), Expect = 1e-04
 Identities = 63/289 (21%), Positives = 96/289 (33%), Gaps = 25/289 (8%)

Query: 577   VKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVT--VTKDGLTQLLIPVAGLSDSGLY 634
             V  G   R  ++ ++ P  EV W  +G+ L + S        G+  L I      DSG Y
Sbjct: 26013 VPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTY 26072

Query: 635   TVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAV 694
               V    +G+   ++                  E VP +V  E   +  EA  V   +  
Sbjct: 26073 RAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRT--EAYAVS-SFKK 26129

Query: 695   FTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQ 754
              +   A     E   ++   R +L           +  A  E    + S T         
Sbjct: 26130 TSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTT--------- 26180

Query: 755   RDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSL 814
                        R+   +   R L   RS  + +G     SC   G P P VTW +  + L
Sbjct: 26181 -----------RKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVL 26229

Query: 815   EGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
               +     T      +  I SV   D G Y  V EN+ G+  +  TL +
Sbjct: 26230 STSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTI 26278



 Score = 45.4 bits (106), Expect = 2e-04
 Identities = 46/187 (24%), Positives = 71/187 (37%), Gaps = 13/187 (6%)

Query: 24   EPPGHLGSRRSGKDGRL---DIYGERRDATRSSTSRYKPGTGSFSKDAQGPMGHFSQGLA 80
            EP   +  R  GK   L   D+  E     + +   +K     F K+   P   F++ L 
Sbjct: 5864 EPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKE---PPVEFTKPLE 5920

Query: 81   DMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAG 140
            D  V+ G  A L C ++ +     WFK+G ++          DG V  L I         
Sbjct: 5921 DQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIK 5980

Query: 141  RYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQ-SHLPIQAAW 199
             YT  A D ++   L V       P   E LR    ++  +  + +   + S    +  W
Sbjct: 5981 TYTCDAKDFKTSCNLNV------VPPHVEFLRPLTDLQVREKEMARFECELSRENAKVKW 6034

Query: 200  RKDGAEV 206
             KDGAE+
Sbjct: 6035 FKDGAEI 6041



 Score = 45.1 bits (105), Expect = 3e-04
 Identities = 48/216 (22%), Positives = 77/216 (35%), Gaps = 32/216 (14%)

Query: 658   PQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADR------I 711
             P  P  + + E    + T  W P   +       Y    R        + ADR      +
Sbjct: 12427 PDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREE-----EQPADRWTEYSVV 12481

Query: 712   HTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLS 771
                   + G+  G +Y FRV A+N +G S P +                    Y   +  
Sbjct: 12482 KDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAE----------------GVYEAKEQL 12525

Query: 772   QKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSL--EGNPAVYSTDLLGVC 829
               P+ L+      +  G +  +   V G P P   W K +  +    + AV+  D   + 
Sbjct: 12526 LPPKILMP-EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSI- 12583

Query: 830   SLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
              L I  V+ KDSG Y   AEN+ G       ++V++
Sbjct: 12584 -LIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMD 12618



 Score = 44.7 bits (104), Expect = 4e-04
 Identities = 52/219 (23%), Positives = 94/219 (42%), Gaps = 17/219 (7%)

Query: 162 TIAPDVTEKLREPLVVKAGKPVIVKIPFQSHL---PI-QAAWRKDGAEVVGSSDREAQVD 217
           T AP  T+ L+  +V++          F++H+   P+ + +W +DG  +  S+    Q+ 
Sbjct: 3   TQAPTFTQPLQSVVVLEGSTAT-----FEAHISGFPVPEVSWFRDGQVISTSTLPGVQIS 57

Query: 218 LGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPD--PPQGPMEVQDCH- 274
             DG  +L +P+  + + G+YS  L++  GS QA  T +++ K +  PP     +Q    
Sbjct: 58  FSDGRAKLTIPAVTKANSGRYS--LKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTV 115

Query: 275 RAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTF 334
           R G  +R +         V  +  +  +   S   ++ +   D  +   A   P    T+
Sbjct: 116 RQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQ-EGDLYSLLIAEAYPEDSGTY 174

Query: 335 RVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSAS 373
            V A  S   G A  + E+LV  E    A     I+S +
Sbjct: 175 SVNATNS--VGRATSTAELLVQGEEEVPAKKTKTIVSTA 211



 Score = 44.7 bits (104), Expect = 4e-04
 Identities = 48/201 (23%), Positives = 76/201 (37%), Gaps = 24/201 (11%)

Query: 71   PMGHFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLF 130
            P   F + L D++V+  E A   C L+ +     WFKDG ++           G V  L 
Sbjct: 6000 PHVEFLRPLTDLQVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILV 6059

Query: 131  ITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAP------DVTEKLREPLVVKAGKPVI 184
            I          Y+      ++   LTV +   +        +V+E     LV +  KP  
Sbjct: 6060 INKCLLDDEAEYSCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKP-- 6117

Query: 185  VKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTR-LCLPSAGRKDCGQYSVTL- 242
                       +  W K   E++ +   E    L +G  R L + +A  +D G Y+  L 
Sbjct: 6118 ---------GAEVIWYKGDEEIIETGRYEI---LTEGRKRILVIQNAHLEDAGNYNCRLP 6165

Query: 243  --RSEGGSVQAELTLQVIDKP 261
              R++G     EL  + I KP
Sbjct: 6166 SSRTDGKVKVHELAAEFISKP 6186



 Score = 44.3 bits (103), Expect = 5e-04
 Identities = 44/191 (23%), Positives = 77/191 (40%), Gaps = 11/191 (5%)

Query: 73   GHFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFIT 132
            G  S+ L D  V   + A   C + +    G W +DG  L   + +  + DG    L I 
Sbjct: 2574 GAISKPLTDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIA 2633

Query: 133  HVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVI-VKIPFQS 191
              +    G YT+     ++ A L V+     A  + + L+   V +    V  V++   +
Sbjct: 2634 ATKLDDIGEYTYKVATSKTSAKLKVE-----AVKIKKTLKNLTVTETQDAVFTVELTHPN 2688

Query: 192  HLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQA 251
               +Q  W K+G  VV  S+ +  + +      L + +    D   Y   L   G S + 
Sbjct: 2689 VKGVQ--WIKNG--VVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARL 2744

Query: 252  EL-TLQVIDKP 261
             + T+++I KP
Sbjct: 2745 HVETVKIIKKP 2755



 Score = 44.3 bits (103), Expect = 5e-04
 Identities = 74/306 (24%), Positives = 122/306 (39%), Gaps = 47/306 (15%)

Query: 572  KDLLTVKVGDTVRVPVSFEAMPMPEVT--WLKDG--LPLPKRSVTVTKDGLTQLLIPVAG 627
            K +  +KV +  R     E    P++T  W+KD   L +  R     +  + +LLIP   
Sbjct: 3016 KHIKDIKVLEKKRAMFECEVSE-PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTR 3074

Query: 628  LSDSGLYTVVL--RTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEA 685
            +SD+G YTVV        K       +R+ +  +    I  Q  V      E+E + D  
Sbjct: 3075 MSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAV-----VEFEVNED-- 3127

Query: 686  QDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHF-RVVAKNELGASKPSD 744
             DV  H            W++  D I  N      +   H+Y   R + +  +  ++ SD
Sbjct: 3128 -DVDAH------------WYK--DGIEIN----FQVQERHKYVVERRIHRMFISETRQSD 3168

Query: 745  TSQ-PWCIPRQRDRFT--VKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSP 801
              +  +   R R   T  V AP        + P+ L  L+   +  G        + G P
Sbjct: 3169 AGEYTFVAGRNRSSVTLYVNAP--------EPPQVLQELQPVTVQSGKPARFCAVISGRP 3220

Query: 802  RPHVTWFKNDRSLE-GNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTAT 860
            +P ++W+K ++ L  G    +  D      L I +  P+D+  Y   A+N  G A ++A+
Sbjct: 3221 QPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAF-PEDAAVYTCEAKNDYGVATTSAS 3279

Query: 861  LIVIEP 866
            L V  P
Sbjct: 3280 LSVEVP 3285



 Score = 44.3 bits (103), Expect = 5e-04
 Identities = 30/97 (30%), Positives = 44/97 (45%), Gaps = 3/97 (3%)

Query: 770   LSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLE--GNPAVYSTDL-L 826
             L + P F + L +     G        +   P PHVTW+K+ + ++   N   Y+ +   
Sbjct: 25314 LERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDK 25373

Query: 827   GVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
             G+  LTI SV+  D  EY  VA N  G+    A L V
Sbjct: 25374 GLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 25410



 Score = 43.9 bits (102), Expect = 6e-04
 Identities = 28/95 (29%), Positives = 42/95 (44%), Gaps = 5/95 (5%)

Query: 772  QKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVY---STDLLGV 828
            + P+    ++S  + QG +      V G P P   W+KN   +E +  +Y     D   V
Sbjct: 2030 EAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPED--NV 2087

Query: 829  CSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
            C L I  V+ +DS      A N  G+  S A L+V
Sbjct: 2088 CELVIRDVTAEDSASIMVKAINIAGETSSHAFLLV 2122



 Score = 43.5 bits (101), Expect = 8e-04
 Identities = 28/91 (30%), Positives = 39/91 (42%), Gaps = 2/91 (2%)

Query: 774  PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEG--NPAVYSTDLLGVCSL 831
            P F+       L +G      C V G+P+PHV W K+   L       V      G C L
Sbjct: 1036 PYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKL 1095

Query: 832  TIPSVSPKDSGEYKAVAENTLGQAVSTATLI 862
             I      D+GEY  V  N  G+  ++A+L+
Sbjct: 1096 VISMTFADDAGEYTIVVRNKHGETSASASLL 1126



 Score = 42.0 bits (97), Expect = 0.002
 Identities = 81/402 (20%), Positives = 144/402 (35%), Gaps = 33/402 (8%)

Query: 477   SITLSWAGPDTQEGDEAQGYVVELCSS-DSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVR 535
             S  +SW  P    G     YVVE C + +  +W       + VTT     L    GY+ R
Sbjct: 24367 SAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVS-SAISVTTCRIVNLTENAGYYFR 24425

Query: 536   VTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRV---PVSFEAM 592
             V+A N  G S P  + ++V    +   P     +  K  +T    D+  V   P + +  
Sbjct: 24426 VSAQNTFGISDPLEVSSVV----IIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGG 24481

Query: 593   PMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRI 652
                   +L+       + ++VT + + + +  V  L +   Y   ++       +    I
Sbjct: 24482 AKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEI 24541

Query: 653   RVAACPQAPGPI---HLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAAD 709
                  P++  PI   H +E +   +   ++ +      V  H     +      W+    
Sbjct: 24542 SEPITPKSDVPIQAPHFKEELRN-LNVRYQSNATLVCKVTGHPKPIVK------WYRQGK 24594

Query: 710   RIHTN--RFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYRE 767
              I  +  ++ +     G  YH  ++A      S   D +  + +       +V      E
Sbjct: 24595 EIIADGLKYRIQEFKGG--YHQLIIA------SVTDDDATVYQVRATNQGGSVSGTASLE 24646

Query: 768   PDLSQK---PRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTD 824
              ++  K   P+ L G+ +    +G    +     G P P +TW K    ++ N       
Sbjct: 24647 VEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIV 24706

Query: 825   LLGVCSLTIPS-VSPKDSGEYKAVAENTLGQAVSTATLIVIE 865
                  SL  P+ V  KD+G Y   A+N  G    T  L V +
Sbjct: 24707 TRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVAD 24748



 Score = 41.6 bits (96), Expect = 0.003
 Identities = 21/86 (24%), Positives = 36/86 (41%)

Query: 74   HFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITH 133
            +F+  L D      +   L C ++    P  WFKDG ++      + K DG    L +  
Sbjct: 5647 YFTGKLQDYTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKK 5706

Query: 134  VQGTQAGRYTFVAGDQQSEATLTVQD 159
               +  G+YT   G  ++   L ++D
Sbjct: 5707 ALKSDIGQYTCDCGTDKTSGKLDIED 5732



 Score = 41.6 bits (96), Expect = 0.003
 Identities = 69/281 (24%), Positives = 108/281 (38%), Gaps = 72/281 (25%)

Query: 575   LTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPL---PKRSVTVTKDGLTQLLIPVAGLSDS 631
             +TV  G++ R     +  P+P VTWL+ G  L    +  VT TK   T  +  V   SD 
Sbjct: 26198 MTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQA-SDE 26256

Query: 632   GLYTVVLRTLQGKEVAH-SFRIRVAACPQ--APGPIHLQENVPGTVTAEWEPSPDEAQDV 688
             G Y+VV+   +GK+ A  +  I+ A   +     P  ++   P   + E   SP   +  
Sbjct: 26257 GNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSP 26316

Query: 689   PLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
                                               P H    + V+  E   +KP+ T + 
Sbjct: 26317 E---------------------------------PSHP---KAVSPTE---TKPTPTEKV 26337

Query: 749   WCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGS--PRPHVT 806
               +P       V AP    P ++Q   FL    S  + +     ++C V+ S      VT
Sbjct: 26338 QHLP-------VSAP----PKITQ---FLKAEASKEIAK-----LTCVVESSVLRAKEVT 26378

Query: 807   WFKNDRSLEGNPAV---YSTDLLGVCSLTIPSVSPKDSGEY 844
             W+K+ + L+ N      YS D  G   L I +++  D GEY
Sbjct: 26379 WYKDGKKLKENGHFQFHYSAD--GTYELKINNLTESDQGEY 26417



 Score = 40.8 bits (94), Expect = 0.005
 Identities = 31/117 (26%), Positives = 48/117 (41%), Gaps = 6/117 (5%)

Query: 77   QGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQG 136
            QGL+D +V  G+   L   ++ +   G W KDG ++   D V    D   H L I  +  
Sbjct: 2314 QGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTK 2373

Query: 137  TQAGRYTFV--AGDQQSEATLTVQDSPTIAP----DVTEKLREPLVVKAGKPVIVKI 187
              AG Y+F   A    +   ++V     I P    +V E  +  L  K   P +  +
Sbjct: 2374 EDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSV 2430



 Score = 40.8 bits (94), Expect = 0.005
 Identities = 36/178 (20%), Positives = 73/178 (41%), Gaps = 11/178 (6%)

Query: 81   DMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAG 140
            D+            +++ D  P  WF   V++   D      +  VH L + ++  + AG
Sbjct: 2757 DVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAG 2816

Query: 141  RYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWR 200
             YT V G  + +A L V+        +T+ ++  + V   K    +    SH  + + W 
Sbjct: 2817 EYTAVVGQLECKAKLFVE-----TLHITKTMKN-IEVPETKTASFECEV-SHFNVPSMWL 2869

Query: 201  KDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVI 258
            K+G E+      + ++ +     +L + +   +D  +Y+    ++   V A LT+  I
Sbjct: 2870 KNGVEI--EMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGND--QVSATLTVTPI 2923



 Score = 40.8 bits (94), Expect = 0.005
 Identities = 31/97 (31%), Positives = 45/97 (46%), Gaps = 3/97 (3%)

Query: 53   STSRYKPGTGSFSKDAQGPMGHFSQGLADMEVQPGEAATLSCTLTSDLGPGT-WFKDGVK 111
            S S   P      K+  GP+  F + +++ ++  G+ ATLS T+     P   WF +GV 
Sbjct: 3564 SESPVYPTKFDSEKEGTGPI--FIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVL 3621

Query: 112  LTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGD 148
            LT      F  DG  HSL I   +    G YT +A +
Sbjct: 3622 LTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASN 3658



 Score = 40.4 bits (93), Expect = 0.007
 Identities = 26/75 (34%), Positives = 33/75 (44%), Gaps = 5/75 (6%)

Query: 576   TVKVGDTVRVPVSFEAMPMPEVTWLKDGLPL-----PKRSVTVTKDGLTQLLIPVAGLSD 630
             T  VG+ VR  V+    P P VTW K G  +      K+    +  GL QL I      D
Sbjct: 25328 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDD 25387

Query: 631   SGLYTVVLRTLQGKE 645
                YTVV R   G++
Sbjct: 25388 DAEYTVVARNKYGED 25402



 Score = 39.3 bits (90), Expect = 0.016
 Identities = 23/73 (31%), Positives = 29/73 (39%)

Query: 794  SCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLG 853
            +C +Q +P     WFK  R +  +          + SL I      D GEY   A N  G
Sbjct: 4482 TCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYG 4541

Query: 854  QAVSTATLIVIEP 866
                TATL V  P
Sbjct: 4542 SVSCTATLTVTVP 4554



 Score = 38.9 bits (89), Expect = 0.021
 Identities = 97/439 (22%), Positives = 149/439 (33%), Gaps = 99/439 (22%)

Query: 458  PMRPPGLVRNLQVTDRSN------------TSITLSWAGPD-----------TQEGDEAQ 494
            P+ PP ++  LQ T  S             T + +SW   D           TQ  D  Q
Sbjct: 3295 PVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQ 3354

Query: 495  GYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLV 554
              + E    D   +       V   + TA     G   F   T+ ++   S    L    
Sbjct: 3355 LEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEGFSKFEENTSNSQWHVS----LSVSF 3410

Query: 555  QAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDG-LPLPKRSVTV 613
            +  P+   P F+   S+   L V  G+TVR       +P PE+ W  +  L LP + V  
Sbjct: 3411 KKEPLGQKPSFIQPLSS---LRVHNGETVRFHARVSGIPKPEIQWFHNQQLILPTKDVVF 3467

Query: 614  ---TKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENV 670
                  G+  +LI  A    +G Y+       G+    +    +   P+AP  I L E +
Sbjct: 3468 HFEESTGMALMLIVDAYSEHAGQYSCKAANSAGEATCAA---TLTVTPKAPESI-LHERI 3523

Query: 671  PGTVTAEWEPSPDE---AQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEY 727
               +  E +        A++  LH A                                  
Sbjct: 3524 EQEIEMEMKEFSSSFLSAEEEGLHSA---------------------------------- 3549

Query: 728  HFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQK----PRFLVGLRSH 783
                    EL  SK ++T +             ++P Y     S+K    P F+  + + 
Sbjct: 3550 --------ELQLSKINETLE----------LLSESPVYPTKFDSEKEGTGPIFIKEVSNA 3591

Query: 784  LLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVC-SLTIPSVSPKDSG 842
             +  G    +S  V G P+P + WF N   L  + A Y     G   SL I     +D G
Sbjct: 3592 DISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPS-ADYKFVFDGDDHSLIILFTKLEDEG 3650

Query: 843  EYKAVAENTLGQAVSTATL 861
            EY  +A N  G+ + +A L
Sbjct: 3651 EYTCMASNDYGKTICSAYL 3669



 Score = 38.9 bits (89), Expect = 0.021
 Identities = 58/212 (27%), Positives = 86/212 (40%), Gaps = 18/212 (8%)

Query: 53   STSRYKPGTGSFSKDAQGPMGHFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKL 112
            +T + +   G   K+  GPM H    L D   + G+   L+ ++T+      +F++  KL
Sbjct: 4351 ATVKIQEAEGGLIKE-DGPMIHTP--LVDTVSEEGDIVHLTTSITNAKEVNWYFEN--KL 4405

Query: 113  TTQDGVIFK--QDGLVHSLFITHVQGTQ-AGRYTFVA----GDQQSEATLTVQDSPTIAP 165
               D   FK  QD   ++L I  V      G Y   A    G   + A LTV      AP
Sbjct: 4406 VPSDEK-FKCLQDQNTYTLVIDKVNTEDHQGEYVCEALNDSGKTATSAKLTVVKRA--AP 4462

Query: 166  DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
             +  K+ EPL V  G         QS   ++  W K G E+  S   +  +      + L
Sbjct: 4463 VIKRKI-EPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESD--KCSIRSSKYISSL 4519

Query: 226  CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQV 257
             +      DCG+Y+    +E GSV    TL V
Sbjct: 4520 EILRTQVVDCGEYTCKASNEYGSVSCTATLTV 4551



 Score = 38.9 bits (89), Expect = 0.021
 Identities = 28/96 (29%), Positives = 41/96 (42%), Gaps = 1/96 (1%)

Query: 769   DLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAV-YSTDLLG 827
             D + +P F   L +    +G   C    V G P P + W K+ + L   P +    + L 
Sbjct: 25418 DSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLD 25477

Query: 828   VCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
               +L I    P+D+G Y+  A NT G     A L V
Sbjct: 25478 YYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 25513



 Score = 38.1 bits (87), Expect = 0.036
 Identities = 27/103 (26%), Positives = 42/103 (40%), Gaps = 4/103 (3%)

Query: 761   KAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAV 820
             KAP   EP +S KP  + GL+   +        +    G PRP   W K+ +++      
Sbjct: 26471 KAP---EP-ISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKY 26526

Query: 821   YSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
               ++  G   L I      DSG Y    +N+ G   S+  L +
Sbjct: 26527 KLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTI 26569



 Score = 37.0 bits (84), Expect = 0.079
 Identities = 26/85 (30%), Positives = 36/85 (42%)

Query: 79   LADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQ 138
            L  +EV  GE A     L+     G W   G  LT        +DG  H L + + Q   
Sbjct: 5385 LYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGM 5444

Query: 139  AGRYTFVAGDQQSEATLTVQDSPTI 163
             G  +F A + +S A L V++ P I
Sbjct: 5445 TGEVSFQAANAKSAANLKVKELPLI 5469



 Score = 37.0 bits (84), Expect = 0.079
 Identities = 27/106 (25%), Positives = 44/106 (41%), Gaps = 4/106 (3%)

Query: 75   FSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHV 134
            F   L+D++V   + A   C ++ +     W K   ++T  D     +DG  HS+ I   
Sbjct: 5470 FITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSA 5529

Query: 135  QGTQAGRYTFVAGDQQSEATLTVQDSP----TIAPDVTEKLREPLV 176
                  +Y F A D+ +   L ++       T   DVT K +E  V
Sbjct: 5530 AFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAV 5575



 Score = 37.0 bits (84), Expect = 0.079
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 2/70 (2%)

Query: 577   VKVGDTVRVPVSFEAMPMPEVTWLKDGLPLP-KRSVTVTKD-GLTQLLIPVAGLSDSGLY 634
             +  G  V         P PE+ W K+ LP+    +V++++   +  L I  A +SDSG Y
Sbjct: 26773 INEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKY 26832

Query: 635   TVVLRTLQGK 644
             T+  +  +G+
Sbjct: 26833 TIKAKNFRGQ 26842



 Score = 36.6 bits (83), Expect = 0.10
 Identities = 33/101 (32%), Positives = 51/101 (50%), Gaps = 8/101 (7%)

Query: 538 AVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEV 597
           A N  GQ+  +A + LV+A   T  P F+    +   +TV+ G  VR+ V    +P P V
Sbjct: 82  ATNGSGQATSTA-ELLVKAE--TAPPNFVQRLQS---MTVRQGSQVRLQVRVTGIPTPVV 135

Query: 598 TWLKDGLPLPKR-SVTVTKDG-LTQLLIPVAGLSDSGLYTV 636
            + +DG  +       ++++G L  LLI  A   DSG Y+V
Sbjct: 136 KFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSV 176



 Score = 36.6 bits (83), Expect = 0.10
 Identities = 23/98 (23%), Positives = 47/98 (47%), Gaps = 3/98 (3%)

Query: 84    VQPGEAATLSCTLTSDLGPGT-WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRY 142
             +  G+    +C ++ +  P   WFK+ + ++    V   +   V+SL I +   + +G+Y
Sbjct: 26773 INEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKY 26832

Query: 143   TFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAG 180
             T  A + + + + T   S  + P V E  RE ++  +G
Sbjct: 26833 TIKAKNFRGQCSATA--SLMVLPLVEEPSREVVLRTSG 26868



 Score = 35.8 bits (81), Expect = 0.18
 Identities = 35/147 (23%), Positives = 58/147 (39%), Gaps = 16/147 (10%)

Query: 720   GILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVG 779
             G+  G  Y FRV A+N +G   P  T     IP +     V       P +    + + G
Sbjct: 11099 GLQQGKTYRFRVKAENIVGLGLPDTT-----IPIECQEKLVP------PSVELDVKLIEG 11147

Query: 780   LRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCS-LTIPSVSP 838
             L   ++  G        ++G P P   W  +   ++ +   Y+ +     S LTI +   
Sbjct: 11148 L---VVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEH-YTVETDNFSSVLTIKNCLR 11203

Query: 839   KDSGEYKAVAENTLGQAVSTATLIVIE 865
             +D+GEY+    N  G       L V++
Sbjct: 11204 RDTGEYQITVSNAAGSKTVAVHLTVLD 11230



 Score = 35.0 bits (79), Expect = 0.30
 Identities = 66/318 (20%), Positives = 113/318 (35%), Gaps = 41/318 (12%)

Query: 541  EGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWL 600
            EG  + P+     ++  P    PK      ++   TV  G      V     P PE  W 
Sbjct: 2010 EGKITIPTFKPDKIELSPSMEAPKIFERIQSQ---TVGQGSDAHFRVRVVGKPDPECEWY 2066

Query: 601  KDGLPLPKRSVTV----TKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAA 656
            K+G+ + +RS  +     +D + +L+I      DS    V    + G+  +H+F +    
Sbjct: 2067 KNGVKI-ERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLL---- 2121

Query: 657  CPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSS-AHGPWHEAADRIHTNR 715
                     +Q     T T E +    + +D    +   T        W++    +H   
Sbjct: 2122 ---------VQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHE-- 2170

Query: 716  FTLLGILPGHEYHFRVVAKNELGASKPSDTSQPW---CIPRQRDRFTVKAPCYREPDLSQ 772
                    G +Y      K    +    DTS      C+  + +     A    E  + +
Sbjct: 2171 --------GDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVE 2222

Query: 773  KPRFLVGLRSHLLPQGCECCMSCAVQGSPRP-HVTWFKNDRSLEGNPAVYSTDLLGVCSL 831
               F+  L+   +P+     + C V  SP      W+ ND  L+ N     T   G  +L
Sbjct: 2223 ---FVKELQDIEVPESYSGELECIV--SPENIEGKWYHNDVELKSNGKYTITSRRGRQNL 2277

Query: 832  TIPSVSPKDSGEYKAVAE 849
            T+  V+ +D GEY  V +
Sbjct: 2278 TVKDVTKEDQGEYSFVID 2295



 Score = 34.7 bits (78), Expect = 0.39
 Identities = 47/225 (20%), Positives = 81/225 (36%), Gaps = 48/225 (21%)

Query: 78   GLADMEVQPGEAATLSCTLTSDLGPG-TWFKDGVKLTTQ-DGVIFKQDGLVHSLFITHVQ 135
            GL ++ V  GE+ TL C ++    P  TW+++  ++ +  D  I  Q G+   L I    
Sbjct: 902  GLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIAR-LMIREAF 960

Query: 136  GTQAGRYTF----VAGDQQSEATLTVQDSPTIAPD---VTEK------------------ 170
               +GR+T      AG   +   L VQ S     +   VTEK                  
Sbjct: 961  AEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTD 1020

Query: 171  ------------------LREPLVVK--AGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSS 210
                              + +P+V K   G  V+       +      W+K G  +    
Sbjct: 1021 TSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGY 1080

Query: 211  DREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTL 255
              +   +   G  +L +      D G+Y++ +R++ G   A  +L
Sbjct: 1081 RYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1125



 Score = 34.7 bits (78), Expect = 0.39
 Identities = 47/213 (22%), Positives = 81/213 (38%), Gaps = 19/213 (8%)

Query: 79   LADMEVQPGEAATLSCTLT-SDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGT 137
            L D+ V  G  A L C ++  D+    W+ +  ++   D V     G    L I     +
Sbjct: 2405 LKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHAS 2464

Query: 138  QAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQA 197
              G Y  + G  ++   L+V+    I       LR+ L     + V+ ++   SH  I  
Sbjct: 2465 DEGPYKLIVGRVETNCNLSVEKIKII-----RGLRD-LTCTETQNVVFEVEL-SHSGIDV 2517

Query: 198  AWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQY---------SVTLRSEGGS 248
             W     E+  SS  + +++      +L + +  + D G+Y         S  L   GG+
Sbjct: 2518 LWNFKDKEIKPSS--KYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGA 2575

Query: 249  VQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLR 281
            +   LT Q + +        EV +    G  LR
Sbjct: 2576 ISKPLTDQTVAESQEAVFECEVANPDSKGEWLR 2608



 Score = 34.7 bits (78), Expect = 0.39
 Identities = 27/104 (25%), Positives = 44/104 (42%), Gaps = 6/104 (5%)

Query: 82   MEVQPGEAATLSCTLTSDLGPGT---WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQ 138
            +EV  G  A  +C + S   P     WFK G ++   D    +    + SL I   Q   
Sbjct: 4471 LEVALGHLAKFTCEIQS--APNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVD 4528

Query: 139  AGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKP 182
             G YT  A ++    + T   + T+ P   +K+R+ L  +  +P
Sbjct: 4529 CGEYTCKASNEYGSVSCTATLTVTV-PGGEKKVRKLLPERKPEP 4571



 Score = 34.7 bits (78), Expect = 0.39
 Identities = 55/236 (23%), Positives = 86/236 (36%), Gaps = 29/236 (12%)

Query: 79   LADMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQ 138
            L  +EV   E A     ++ D     W   G  L        K++G +HSL + + +  Q
Sbjct: 5741 LHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQ 5800

Query: 139  AGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLR--EPLVVKAGKPVIVKIPFQSHLPIQ 196
             G   F A + +S A L V+      P V   LR  + + V AG+         S+  I 
Sbjct: 5801 TGGVDFQAANVKSSAHLRVK------PRVIGLLRPLKDVTVTAGETATFDCEL-SYEDIP 5853

Query: 197  AAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQ 256
              W   G + +  SD+      G  +T L L     +D G+  +T +      +    L 
Sbjct: 5854 VEWYLKGKK-LEPSDKVVPRSEGKVHT-LTLRDVKLEDAGEVQLTAK----DFKTHANLF 5907

Query: 257  VIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVG 312
            V + P     P+E Q        +            +EC V   R+  +  W K G
Sbjct: 5908 VKEPPVEFTKPLEDQTVEEGATAV------------LECEV--SRENAKVKWFKNG 5949



 Score = 34.7 bits (78), Expect = 0.39
 Identities = 52/213 (24%), Positives = 82/213 (38%), Gaps = 36/213 (16%)

Query: 648   HSFRIRVAACPQAPGPIHLQENVPGTVTAEWE-PSPDEAQDVP-LHYAVFTRSSAHGPWH 705
             H FRI     P  PG   +       ++  W+ P  D   +V   H     R+S    W 
Sbjct: 21380 HQFRI-----PGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSIL--WQ 21432

Query: 706   EA-ADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPC 764
             +     I    +   G++ G +Y FRV A+N  G S PSD S          +FT+    
Sbjct: 21433 KVNTSPISGREYRATGLVEGLDYQFRVYAENSAGLSSPSDPS----------KFTLAVSP 21482

Query: 765   Y---REPDLSQKPRFLVGLR-SHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAV 820
                   PD     R  + L+ +  L  G    +  +++           N+R +  N   
Sbjct: 21483 VDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVGYSIEKRQ-------GNERWVRCN--- 21532

Query: 821   YSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLG 853
               TD +  C  T+  +SP D  E++ +A N +G
Sbjct: 21533 -FTD-VSECQYTVTGLSPGDRYEFRIIARNAVG 21563



 Score = 34.3 bits (77), Expect = 0.51
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 6/67 (8%)

Query: 575 LTVKVGDTVRVPVSFEAMPMPEVTWLKDG-----LPLPKRSVTVTKDGLTQLLIPVAGLS 629
           + V  G T          P+PEV+W +DG       LP   ++ + DG  +L IP    +
Sbjct: 15  VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFS-DGRAKLTIPAVTKA 73

Query: 630 DSGLYTV 636
           +SG Y++
Sbjct: 74  NSGRYSL 80



 Score = 34.3 bits (77), Expect = 0.51
 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 1/82 (1%)

Query: 772  QKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNPAVYSTDLLGVCSL 831
            QKP  ++      + +G      C V G P+P V W+ N + +  +   +     G+  L
Sbjct: 1793 QKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKR-FRVRYDGIHYL 1851

Query: 832  TIPSVSPKDSGEYKAVAENTLG 853
             I      D+GE K  AEN  G
Sbjct: 1852 DIVDCKSYDTGEVKVTAENPEG 1873



 Score = 34.3 bits (77), Expect = 0.51
 Identities = 46/183 (25%), Positives = 75/183 (40%), Gaps = 24/183 (13%)

Query: 105  WFKDGVKLTTQDGVI-FKQDGLVHSLFITHVQGTQAG----RYTFVAGDQQSEATLTVQD 159
            W+K+GVK+   D +  +  +  V  L I  V    +     +   +AG+  S A L VQ 
Sbjct: 2065 WYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQA 2124

Query: 160  SPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLP-IQAAWRKDGAEVVGS------SDR 212
               I    T++L++  VV   K  +     ++  P ++  W KDG EV         SDR
Sbjct: 2125 KQLIT--FTQELQD--VVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDR 2180

Query: 213  EAQ------VDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQG 266
            +        +D  D     C+      +  + +  L  EG  V+    LQ I+ P+   G
Sbjct: 2181 KVHFLSILTIDTSDAEDYSCV--LVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSG 2238

Query: 267  PME 269
             +E
Sbjct: 2239 ELE 2241



 Score = 34.3 bits (77), Expect = 0.51
 Identities = 20/93 (21%), Positives = 38/93 (40%)

Query: 165   PDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTR 224
             P   E L   + +  GK + V   F      +  W   G ++         ++  D  T 
Sbjct: 26956 PPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTT 27015

Query: 225   LCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQV 257
             L +    ++D G Y+++L +E GS  A + + +
Sbjct: 27016 LIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 27048



 Score = 34.3 bits (77), Expect = 0.51
 Identities = 24/77 (31%), Positives = 33/77 (42%), Gaps = 4/77 (5%)

Query: 575   LTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPK----RSVTVTKDGLTQLLIPVAGLSD 630
             +++  G  + V  +F   P PEVTW   G  +      R      D LT L+I      D
Sbjct: 26966 ISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQD 27025

Query: 631   SGLYTVVLRTLQGKEVA 647
              GLYT+ L    G + A
Sbjct: 27026 GGLYTLSLGNEFGSDSA 27042



 Score = 33.9 bits (76), Expect = 0.67
 Identities = 40/189 (21%), Positives = 69/189 (36%), Gaps = 22/189 (11%)

Query: 81   DMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAG 140
            ++E+  GE A   C+++ +  P  W +D   L + D      DG    L +        G
Sbjct: 6188 NLEILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMG 6247

Query: 141  RYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWR 200
             Y  + G  ++ A LT          V EKLR  + +K       ++  Q  +       
Sbjct: 6248 TYVVMVGAARAAAHLT----------VIEKLRIVVPLKD-----TRVKEQQEVVFNCEVN 6292

Query: 201  KDGAEVVGSSDREAQVDLG-------DGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAEL 253
             +GA+     + EA  D         D    L +  A   D   Y+V+L +  G      
Sbjct: 6293 TEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSA 6352

Query: 254  TLQVIDKPD 262
               ++++ D
Sbjct: 6353 ANLIVEEED 6361



 Score = 33.5 bits (75), Expect = 0.88
 Identities = 22/81 (27%), Positives = 35/81 (43%), Gaps = 6/81 (7%)

Query: 785   LPQGCECCMSCAVQGSPRPHVTWFKNDRSL----EGNPAVYSTDLLGVCSLTIPSVSPKD 840
             + +G    ++CA  G P P VTW    R +    +G   + +TD   + +L I  V  +D
Sbjct: 26968 IDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTD--DLTTLIIMDVQKQD 27025

Query: 841   SGEYKAVAENTLGQAVSTATL 861
              G Y     N  G   +T  +
Sbjct: 27026 GGLYTLSLGNEFGSDSATVNI 27046



 Score = 33.1 bits (74), Expect = 1.1
 Identities = 34/169 (20%), Positives = 69/169 (40%), Gaps = 5/169 (2%)

Query: 75   FSQGLADMEVQPGEA-ATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITH 133
            F+Q L D+  +  +  AT  C  +       W+KDG+++   D      D  VH L I  
Sbjct: 2130 FTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILT 2189

Query: 134  VQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHL 193
            +  + A  Y+ V  + ++  T           +  ++L++  V ++    +  I    + 
Sbjct: 2190 IDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPEN- 2248

Query: 194  PIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTL 242
             I+  W  +  E+   S+ +  +    G   L +    ++D G+YS  +
Sbjct: 2249 -IEGKWYHNDVEL--KSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVI 2294



 Score = 32.7 bits (73), Expect = 1.5
 Identities = 33/115 (28%), Positives = 49/115 (42%), Gaps = 10/115 (8%)

Query: 536  VTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMP 595
            V A N  G+S  S + T V+A+   V P F+        + +K G  + + V     P P
Sbjct: 1484 VVAQNRAGRSSISVILT-VEAVEHQVKPMFVEKLKN---VNIKEGSRLEMKVRATGNPNP 1539

Query: 596  EVTWLKDG---LP--LPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKE 645
            ++ WLK+    +P   PK  +  TK G   L I      DS  YT       G++
Sbjct: 1540 DIVWLKNSDIIVPHKYPKIRIEGTK-GEAALKIDSTVSQDSAWYTATAINKAGRD 1593



 Score = 32.3 bits (72), Expect = 2.0
 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 1/86 (1%)

Query: 74  HFSQGLADMEVQPGEAATLSCTLTSDLGPGT-WFKDGVKLTTQDGVIFKQDGLVHSLFIT 132
           +F Q L  M V+ G    L   +T    P   +++DG ++ +       Q+G ++SL I 
Sbjct: 105 NFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIA 164

Query: 133 HVQGTQAGRYTFVAGDQQSEATLTVQ 158
                 +G Y+  A +    AT T +
Sbjct: 165 EAYPEDSGTYSVNATNSVGRATSTAE 190



 Score = 31.6 bits (70), Expect = 3.3
 Identities = 29/112 (25%), Positives = 46/112 (41%), Gaps = 5/112 (4%)

Query: 63   SFSKDAQGPMGHFSQGLADMEVQPGEAATLSCTLTSDLGPG-TWF-KDGVKLTTQDGVI- 119
            SF K+  G    F Q L+ + V  GE       ++    P   WF    + L T+D V  
Sbjct: 3409 SFKKEPLGQKPSFIQPLSSLRVHNGETVRFHARVSGIPKPEIQWFHNQQLILPTKDVVFH 3468

Query: 120  FKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKL 171
            F++   +  + I       AG+Y+  A +   EAT     + T+ P   E +
Sbjct: 3469 FEESTGMALMLIVDAYSEHAGQYSCKAANSAGEATCAA--TLTVTPKAPESI 3518



 Score = 31.6 bits (70), Expect = 3.3
 Identities = 19/59 (32%), Positives = 26/59 (44%)

Query: 805   VTWFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIV 863
             VTW+   R LE +     T   GV  L +  ++  D G Y+    N  G+  S A L V
Sbjct: 25228 VTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFV 25286



 Score = 31.6 bits (70), Expect = 3.3
 Identities = 32/130 (24%), Positives = 54/130 (41%), Gaps = 11/130 (8%)

Query: 535   RVTAVNEGGQSQPSALDTLVQAM-----PVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSF 589
             +V+ ++E  +S     ++ V        P  +  K ++ +  +D  TV      +  V  
Sbjct: 26445 KVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDT-TVSSDSVAKFAVKA 26503

Query: 590   EAMPMPEVTWLKDGLPLP---KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEV 646
                P P   W KDG  +    K  ++  K G   L I     SDSGLYT  ++   G  V
Sbjct: 26504 TGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFF-LEIHKTDTSDSGLYTCTVKNSAG-SV 26561

Query: 647   AHSFRIRVAA 656
             + S ++ + A
Sbjct: 26562 SSSCKLTIKA 26571



 Score = 31.2 bits (69), Expect = 4.3
 Identities = 21/97 (21%), Positives = 42/97 (43%), Gaps = 3/97 (3%)

Query: 161 PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGD 220
           P   P +   L+   V++ G+ V ++     +      W ++  ++  S D   Q+    
Sbjct: 893 PVTPPTLVSGLKNVTVIE-GESVTLECHISGYPSPTVTWYREDYQIESSID--FQITFQS 949

Query: 221 GYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQV 257
           G  RL +  A  +D G+++ +  +E G+V     L V
Sbjct: 950 GIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 986



 Score = 31.2 bits (69), Expect = 4.3
 Identities = 31/153 (20%), Positives = 66/153 (43%), Gaps = 17/153 (11%)

Query: 124  GLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPV 183
            G ++ L + ++     G+YTF AG+  +   LTV         +++ L +  V ++ + V
Sbjct: 2538 GKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGA-----ISKPLTDQTVAESQEAV 2592

Query: 184  IVKIPFQSHL---PIQAAWRKDGAEVVGSSDREAQVDLGDGY-TRLCLPSAGRKDCGQYS 239
                 F+  +     +  W +DG  +  +++  ++    DG+  RL + +    D G+Y+
Sbjct: 2593 -----FECEVANPDSKGEWLRDGKHLPLTNNIRSE---SDGHKRRLIIAATKLDDIGEYT 2644

Query: 240  VTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQD 272
              + +   S + ++    I K        E QD
Sbjct: 2645 YKVATSKTSAKLKVEAVKIKKTLKNLTVTETQD 2677



 Score = 31.2 bits (69), Expect = 4.3
 Identities = 39/124 (31%), Positives = 56/124 (45%), Gaps = 15/124 (12%)

Query: 542  GGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEV---T 598
            GG+  P       Q   V +  KF+ +   KD++  +  + V     FE +  P     T
Sbjct: 4724 GGEKPPDEAPFTYQLKAVPL--KFVKE--IKDIILTE-SEFVGSSAIFECLVSPSTAITT 4778

Query: 599  WLKDGLPL---PK-RSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRV 654
            W+KDG  +   PK R +   KD   +L I    LSD+G YT VLR L  KE   + ++ V
Sbjct: 4779 WMKDGSNIRESPKHRFIADGKD--RKLHIIDVQLSDAGEYTCVLR-LGNKEKTSTAKLVV 4835

Query: 655  AACP 658
               P
Sbjct: 4836 EELP 4839



 Score = 30.8 bits (68), Expect = 5.7
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 4/79 (5%)

Query: 559 VTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKR-SVTVT-KD 616
           + V P  LV S  K++ TV  G++V +       P P VTW ++   +       +T + 
Sbjct: 892 IPVTPPTLV-SGLKNV-TVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQS 949

Query: 617 GLTQLLIPVAGLSDSGLYT 635
           G+ +L+I  A   DSG +T
Sbjct: 950 GIARLMIREAFAEDSGRFT 968


>gi|110349715 titin isoform N2-B [Homo sapiens]
          Length = 26926

 Score =  332 bits (851), Expect = 9e-91
 Identities = 188/609 (30%), Positives = 306/609 (50%), Gaps = 11/609 (1%)

Query: 145   VAGDQQSEATLTVQDS---PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRK 201
             V+  +++   +TVQD    PTI  D++   ++ + V AG+PV + IP     P  A+W  
Sbjct: 23220 VSEPRETVTAVTVQDLRVLPTI--DLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFF 23277

Query: 202   DGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKP 261
              G+++  S      V+      +L +     +D G+Y++ L++  G+    + + ++DKP
Sbjct: 23278 AGSKLRESE--RVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKP 23335

Query: 262   DPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTF 321
              PP GP+++ +     + + W PP  +GG  +  YVVE+R A R  WL V E+   ST F
Sbjct: 23336 GPPTGPIKIDEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRST-F 23394

Query: 322   TDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEA-LPKAPSAPAILSASSQGITLT 380
                 +  G +Y FRV A    G G  L+SE I       +P  P    I   S  G+TLT
Sbjct: 23395 KFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIECRSSIRIPGPPETLQIFDVSRDGMTLT 23454

Query: 381   WTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAP 440
             W  P   G + + GY++ER++  ++ W  VN  PV   R+    + +G +YE RVTA+  
Sbjct: 23455 WYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINA 23514

Query: 441   SGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVEL 500
              G G+P  PS  + A DP+ PPG  +N +VTD + TS++L+W+ P+ + G +  GY++E+
Sbjct: 23515 RGSGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEM 23574

Query: 501   CSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVT 560
                D  +W  C+     +  YT   L  G  Y  RV A N GG  +P+ +   V+   + 
Sbjct: 23575 QKVDQHEWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEML 23634

Query: 561   VCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQ 620
               P + +D   ++ + V+ G  +R+ +  +  P P   W K+G  + KR++  T +  T+
Sbjct: 23635 EYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTE 23694

Query: 621   LLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWE 679
             L+I  A   DSG Y +VL    GK+  +  ++RV   P +P GP+   +    +V   W 
Sbjct: 23695 LVIKEADRGDSGTYDLVLENKCGKKAVY-IKVRVIGSPNSPEGPLEYDDIQVRSVRVSWR 23753

Query: 680   PSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGA 739
             P  D+     L Y +  R      W+    R+      + G+    EYHFRV A+N+ G 
Sbjct: 23754 PPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGI 23813

Query: 740   SKPSDTSQP 748
             SKP  + +P
Sbjct: 23814 SKPLKSEEP 23822



 Score =  295 bits (755), Expect = 1e-79
 Identities = 176/588 (29%), Positives = 283/588 (48%), Gaps = 9/588 (1%)

Query: 166   DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
             D+  +  E +  +AG  V ++            W KD  E+   ++    V+       +
Sbjct: 20376 DLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKEL--QTNALVCVENTTDLASI 20433

Query: 226   CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPP 285
              +  A R + G Y + LR+  GS  A + +Q++DKP PP GP+E +      + L WRPP
Sbjct: 20434 LIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPP 20493

Query: 286   RDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAG 345
              D+GG  +  Y+VE+R+  R  W  V E   +    T   +  G +Y FRVRAV   G G
Sbjct: 20494 ADDGGAKITHYIVEKRETSRVVWSMVSEH-LEECIITTTKIIKGNEYIFRVRAVNKYGIG 20552

Query: 346   EALESEEILVAPEAL--PKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKG 403
             E LES+ + VA  A   P  P  P +   +   +T+ W+ P   G + I GY +E+R K 
Sbjct: 20553 EPLESDSV-VAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKK 20611

Query: 404   SNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPG 463
             S  W  V  + + + R  V  + +   Y++RV AV  +G G    PS+   A DP+ PPG
Sbjct: 20612 SLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPG 20671

Query: 464   LVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHV-GTVPVTTYT 522
                 +++ D + +SITL W+ P    G    GYVVE+   +  +W      G V  T Y 
Sbjct: 20672 PPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYV 20731

Query: 523   AKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDT 582
                L+PG  Y+ RV+AVN  GQ +P  ++  VQA  +   P+  +D + +  +  K G+ 
Sbjct: 20732 VSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGED 20791

Query: 583   VRVPVSFEAMPMPEVTWLKD--GLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRT 640
             V+V + F+  P P VTW KD   L    R      D  + L IP    +D+G Y + +  
Sbjct: 20792 VQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIEN 20851

Query: 641   LQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSA 700
               G+  + +  ++V   P A   + ++    GTVT  W+P   +     ++Y +  R + 
Sbjct: 20852 GVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDAT 20911

Query: 701   HGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
                W   + +  +  F L+ +     + FRV+A+NE+G  +P +T++P
Sbjct: 20912 KRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEP 20959



 Score =  286 bits (733), Expect = 4e-77
 Identities = 183/608 (30%), Positives = 287/608 (47%), Gaps = 13/608 (2%)

Query: 145   VAGDQQSEATLTVQDS---PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSH-LPIQAAWR 200
             V+   +S   + V+D    P +  DV  K R+ +VVKAG+ + +        LP+  +W 
Sbjct: 19271 VSEPSESTGPIIVKDDVEPPRVMMDV--KFRDVIVVKAGEVLKINADIAGRPLPV-ISWA 19327

Query: 201   KDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDK 260
             KDG E+        ++   D +T L +    R+D GQY +TL++  G+    +  +V+DK
Sbjct: 19328 KDGIEI--EERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDK 19385

Query: 261   PDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTT 320
             P PP GP+E+         L W  P+++GG  ++ Y+VE+R+     W  + E     T+
Sbjct: 19386 PGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWT-ICEGELQMTS 19444

Query: 321   FTDAHVEPGRKYTFRVRAVTSEGAGEALESEEI-LVAPEALPKAPSAPAILSASSQGITL 379
                  +  G +Y FRV  V   G GE LES  I  + P  +P  P++  I S + + +TL
Sbjct: 19445 CKVTKLLKGNEYIFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLEITSVTKESMTL 19504

Query: 380   TWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVA 439
              W+ P   G + I GY+IERR+K S  W  VN +PV + R     +R+GC+YE+RV A  
Sbjct: 19505 CWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAEN 19564

Query: 440   PSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVE 499
              +G   P   S  + A DP+  P      ++ D   T+IT++W  P    G    GY VE
Sbjct: 19565 AAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVE 19624

Query: 500   LCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPV 559
                SD   W    + ++  T YT  GL  G  Y  RV +VN+ G S PS       A   
Sbjct: 19625 YKKSDDTDW-KTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKER 19683

Query: 560   TVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLT 619
                P F +DS  +  L VK G +  + V F   P+P V W K    L  R+   T D  T
Sbjct: 19684 EEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRT 19743

Query: 620   QLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWE 679
              L I  A  +DSG YT+ ++ +     + +  ++V   P  P  I +Q+    +    W+
Sbjct: 19744 SLTIENANRNDSGKYTLTIQNVL-SAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWD 19802

Query: 680   PSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGA 739
                ++      +Y +  R ++   W    +  +   + +  +  G  Y+FRV  +NE G 
Sbjct: 19803 VPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGV 19862

Query: 740   SKPSDTSQ 747
               P++T +
Sbjct: 19863 GIPAETKE 19870



 Score =  284 bits (727), Expect = 2e-76
 Identities = 189/655 (28%), Positives = 304/655 (46%), Gaps = 13/655 (1%)

Query: 99    DLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITH--VQGTQAGRYTFVAGDQQSEATLT 156
             DL  G W K     T      F   GLV         +    AG ++  +    +     
Sbjct: 18146 DLPDGRWMK--ASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARD 18203

Query: 157   VQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQV 216
               D+P  + D   K ++ +VV AG+  +++   +        W KDG E+  ++ R  ++
Sbjct: 18204 EIDAPNASLD--PKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAAR-MEI 18260

Query: 217   DLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRA 276
                   T L +    R D GQY + L + GG+    +T++V+D+P PP+GP++V      
Sbjct: 18261 KSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAE 18320

Query: 277   GVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRV 336
                L W PP  +GG  +  Y++E+R+  R +W +V      +  +    + PG +Y FRV
Sbjct: 18321 KCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVS-TEVQALNYKVTKLLPGNEYIFRV 18379

Query: 337   RAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGY 395
              AV   G GE LES  +    P   P  PS P + + +   + +TW  P   G   I GY
Sbjct: 18380 MAVNKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGY 18439

Query: 396   LIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFA 455
             ++E+R K    WT  N + + + R  V  + +G  YEFRV A   +G GEP  PS    A
Sbjct: 18440 ILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRA 18499

Query: 456   RDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGT 515
              D + PPG   N +VTD S +S++L+W+ P    G   +GYVVE+  + + +W  C   T
Sbjct: 18500 CDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPT 18559

Query: 516   -VPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDL 574
              +    +T   L+    Y  R+ A+N  G  +P+ L   V A      P+  +D+  + +
Sbjct: 18560 GLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKV 18619

Query: 575   LTVKVGDTVRVPVSFEAMPMPEVTWLK-DGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGL 633
             + ++   T+R+ V+ +  P PEV W K +G+   +  + VT    T L+I      DSG 
Sbjct: 18620 VVLRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVT-SSFTMLVIDNVTRFDSGR 18678

Query: 634   YTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYA 693
             Y + L    G + A    +RV   P AP  + ++E    +VT  WEP   +      +Y 
Sbjct: 18679 YNLTLENNSGSKTAF-VNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYI 18737

Query: 694   VFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             V  R +    +    +      F +  +  G  Y+FRV+A NE G   P++T++P
Sbjct: 18738 VEKRETTRKAYATITNNCTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEP 18792



 Score =  284 bits (726), Expect = 3e-76
 Identities = 190/641 (29%), Positives = 304/641 (47%), Gaps = 26/641 (4%)

Query: 137   TQAGRYTF-VAGDQQ------SEATLTVQDSPTIAPDVTEKLREPL--VVKAGKPVIVKI 187
             T+   YTF V+ + +      SE T+  +D   +APD+  K    L  + K      +KI
Sbjct: 13449 TEGKEYTFRVSAENENGEGTPSEITVVARDD-VVAPDLDLKGLPDLCYLAKENSNFRLKI 13507

Query: 188   PFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGG 247
             P +       +W+K   E   ++D    V+     T L +    + D G+Y++TL++  G
Sbjct: 13508 PIKGKPAPSVSWKK--GEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAG 13565

Query: 248   SVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRST 307
             + +  ++++V+ KP  P GP++  +     + L+W PP+D+GG  +  Y++E+R +  + 
Sbjct: 13566 TKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNK 13625

Query: 308   WLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA-PEALPKAPSA 366
             W+    A    TTF    +  G +YTFRV A    G GE L+SE I+   P  +P AP  
Sbjct: 13626 WVTCASA-VQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPP 13684

Query: 367   PAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVR 426
             P I+      ++LTWT P+  G + I GY +E +++ S  W   N  P+  R + V  + 
Sbjct: 13685 PNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLT 13744

Query: 427   QGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPD 486
             +G +YEFRV A+  +G G+P  PS+ V A DP+ PPG    + +T     S+TL W  P 
Sbjct: 13745 EGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINIT---RNSVTLIWTEPK 13801

Query: 487   TQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ-S 545
                G +  GY+VE     S  W+  +   VP   +T   L  G  Y  R+ A N  G  S
Sbjct: 13802 YDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAIS 13861

Query: 546   QPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRV-PVSFEAMPMPEVTWLKDGL 604
              PS     +        P  ++D + KD LT+K GDT+ +  +S    P+P+ +W K G 
Sbjct: 13862 APSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGK 13921

Query: 605   PLPKRSVT-VTKDGLTQLL-IPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPG 662
              +    +T +T    + +L I  A   D+G YT+      G +V H  ++ V   P  PG
Sbjct: 13922 DIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEH-VKVTVLDVPGPPG 13980

Query: 663   PIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGIL 722
             P+ +        T  W P  ++       Y +  R ++   W   ++ I + R     ++
Sbjct: 13981 PVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKLI 14040

Query: 723   PGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAP 763
              G+EY FRV A N  G  +P   S+P    +  DRF    P
Sbjct: 14041 QGNEYIFRVSAVNHYGKGEPVQ-SEP---VKMVDRFGPPGP 14077



 Score =  284 bits (726), Expect = 3e-76
 Identities = 173/592 (29%), Positives = 290/592 (48%), Gaps = 10/592 (1%)

Query: 159   DSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDL 218
             ++P I  DV  K ++ +++KAG+   ++       P    W KDG E+ G++  E  + +
Sbjct: 14960 EAPKIKVDV--KFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLE--IKI 15015

Query: 219   GDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGV 278
              D  T L    + R+D G Y++T  + GG  +    ++V+D+P PP+GP+ V +      
Sbjct: 15016 ADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKC 15075

Query: 279   CLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRA 338
              L W PP D+GG  ++ Y+V++R+  R  W  V  +    T      +  G +Y FRV A
Sbjct: 15076 VLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVA-SEVQVTKLKVTKLLKGNEYIFRVMA 15134

Query: 339   VTSEGAGEALESEEIL-VAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLI 397
             V   G GE LESE +L V P   P  P  P + + +   + + W  P   G + I+ Y++
Sbjct: 15135 VNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIV 15194

Query: 398   ERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARD 457
             ERR K    W   N + + + R+ V+ + +G +YEFR+ A   +G   P P S    A D
Sbjct: 15195 ERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACD 15254

Query: 458   PMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQW-LPCHVGTV 516
              +  PG   N +V D S +SI+++W  P    G E  GY+VE+   +  +W +      +
Sbjct: 15255 TVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGL 15314

Query: 517   PVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLT 576
               T+YT  GL   + Y +R+ A+N  G  +P+ +    +A    + P+  +D+  + ++T
Sbjct: 15315 KATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVT 15374

Query: 577   VKVGDTVRVPVSFEAMPMPEVTWLKD-GLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYT 635
             ++   T+R+ V  +  P PEV W +D G  L K S+  T    T L++      DSG Y 
Sbjct: 15375 IRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIEST-SSYTLLIVGNVNRFDSGKYI 15433

Query: 636   VVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVF 695
             + +    G + A    +RV   P  P  + ++E    +VT  W+P   +      +Y V 
Sbjct: 15434 LTVENSSGSKSAF-VNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVE 15492

Query: 696   TRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQ 747
              R S    +   A   H   + +  +  G  Y+FRV+A+NE G   P++T++
Sbjct: 15493 KRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAE 15544



 Score =  281 bits (719), Expect = 2e-75
 Identities = 181/627 (28%), Positives = 302/627 (48%), Gaps = 24/627 (3%)

Query: 138   QAGRYTF----------VAGDQQSEATLTVQD---SPTIAPDVTEKLREPLVVKAGKPVI 184
             + G+Y F          ++   +S  T+  +D   +PTI  D T  +++ L +KAG  ++
Sbjct: 13843 EGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIVLDPT--IKDGLTIKAGDTIV 13900

Query: 185   VKIPFQSHLPI-QAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLR 243
             +        P+ +++W K G ++  S     Q+      + L +  A RKD G+Y++T  
Sbjct: 13901 LNAISILGKPLPKSSWSKAGKDIRPSDI--TQITSTPTSSMLTIKYATRKDAGEYTITAT 13958

Query: 244   SEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQA 303
             +  G+    + + V+D P PP GP+E+ +       L W PP ++GG  ++ Y++E+R+ 
Sbjct: 13959 NPFGTKVEHVKVTVLDVPGPP-GPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRET 14017

Query: 304   GRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEI-LVAPEALPK 362
              R  W  V E    S       +  G +Y FRV AV   G GE ++SE + +V     P 
Sbjct: 14018 SRLLWTVVSE-DIQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQSEPVKMVDRFGPPG 14076

Query: 363   APSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTV 422
              P  P + + +    T++W  P   G + I GY +ERR+K S  W      PV + R  V
Sbjct: 14077 PPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDLRCKV 14136

Query: 423   ADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSW 482
               +++G  YEFRV+A   +G G P   SD+V  +D   PPG   N  VTD +  S +L+W
Sbjct: 14137 TGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSASLAW 14196

Query: 483   AGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGT-VPVTTYTAKGLRPGEGYFVRVTAVNE 541
               P    G E  GYVVE        W+    GT + +T +    L+  E Y  R++A+N+
Sbjct: 14197 GKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAIND 14256

Query: 542   GGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLK 601
              G  +P+ +   V+ +   + P F +D+  +  L V+ G ++R+ V  +  P PEVTW K
Sbjct: 14257 AGVGEPAVIPD-VEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTK 14315

Query: 602   DGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP 661
             D + L  R+     +  T L+IP     D+G + + +    GK+ +    +RV   P   
Sbjct: 14316 DNINLKNRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKK-SGFVNVRVLDTPGPV 14374

Query: 662   GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGI 721
               +   +    +VT  W+    +      +Y V  R +    +  A  + H   + + G+
Sbjct: 14375 LNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTATTKCHKCTYKVTGL 14434

Query: 722   LPGHEYHFRVVAKNELGASKPSDTSQP 748
               G EY FRV+A+NE G  +P++T++P
Sbjct: 14435 SEGCEYFFRVMAENEYGIGEPTETTEP 14461



 Score =  279 bits (714), Expect = 7e-75
 Identities = 165/576 (28%), Positives = 281/576 (48%), Gaps = 6/576 (1%)

Query: 175   LVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKD 234
             L++K+G+ + +K   Q     +  W KDG E+    + E    LG   T L +  A R  
Sbjct: 21471 LIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGS--TSLFVRDATRDH 21528

Query: 235   CGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVE 294
              G Y+V  ++  GS +AE+ ++V D P    GP+   +     + L W  P ++G   + 
Sbjct: 21529 RGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPIT 21588

Query: 295   CYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEIL 354
              Y++E+R+  R  W  + E   ++ ++T   +  G +Y FRV AV   G G  L+S+ ++
Sbjct: 21589 HYIIEKRETSRLAWALI-EDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVV 21647

Query: 355   VAPE-ALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAV-ND 412
                +  +P AP  P   + +   ITLTW  P   G + I  Y++ERR+K S  W  V + 
Sbjct: 21648 AQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISK 21707

Query: 413   QPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTD 472
             +P+ E R+ V  + +G +YEF V A   +G G     S  +  R+P+ PPG    ++VTD
Sbjct: 21708 RPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTD 21767

Query: 473   RSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGY 532
              S T+++L W+ P    G E  GY++E+C +D   W   +      T YT   L+ GE Y
Sbjct: 21768 TSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEY 21827

Query: 533   FVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAM 592
               RV+A+N  G+     +   ++A+     P+  +D++ K    V+ G ++R+ ++++  
Sbjct: 21828 KFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGR 21887

Query: 593   PMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRI 652
             P P   W K    L  R+   T D  + L +     +D+G YT+ +    G + + +F +
Sbjct: 21888 PTPTAVWSKPDSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSK-SITFTV 21946

Query: 653   RVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIH 712
             +V   P  PGPI  ++   G+ T  W+    +      HY V  R ++   W   +++  
Sbjct: 21947 KVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISEKCT 22006

Query: 713   TNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
                F +  +  G  Y+FRV A NE G  +P +  +P
Sbjct: 22007 RQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEP 22042



 Score =  277 bits (708), Expect = 3e-74
 Identities = 194/673 (28%), Positives = 302/673 (44%), Gaps = 19/673 (2%)

Query: 81   DMEVQPGEAATLSCTLTSDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAG 140
            D+   PG        L  D     W ++ + +   D      +G +H L I  ++    G
Sbjct: 6423 DILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQG 6482

Query: 141  RYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWR 200
             Y F+A D+++ A L +  +P I     +   + LVV  GKP+ + +P+ ++   +A W 
Sbjct: 6483 EYRFIAKDKEARAKLELAAAPKI-----KTADQDLVVDVGKPLTMVVPYDAYPKAEAEWF 6537

Query: 201  KDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDK 260
            K+   +   +     +D     T   +  A + D G+Y + L+++ G  +  + L+VID 
Sbjct: 6538 KENEPLSTKT-----IDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDV 6592

Query: 261  PDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTT 320
            P P +  +EV +     V L W  P  +GG  +  YVVERR   R TW+   +  A+S  
Sbjct: 6593 PGPVRN-LEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDR-AESCE 6650

Query: 321  FTDAHVEPGR-KYTFRVRAVTSEGAGEALESEEILVAPEA--LPKAPSAPAILSASSQGI 377
            FT   ++ G  +Y FRV A    G GE +E++  + A     +P  P    I   +  G+
Sbjct: 6651 FTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGV 6710

Query: 378  TLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTA 437
            +LTW  P   G A I  Y+IE R K S  W         +   TV DV +G +Y FRV A
Sbjct: 6711 SLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRA 6770

Query: 438  VAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYV 497
                G G+P   +  V   DP+  P    NL  +D++ +S+ L W  P    G    GY+
Sbjct: 6771 QNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYI 6830

Query: 498  VELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAM 557
            +E C      W+ C++  VP  TY   GL  G  Y  RV+A N+ G S PS +   + A 
Sbjct: 6831 IERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTAD 6890

Query: 558  PVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWL--KDGLPLPKRSVTVTK 615
               V P   + S+ KD L V V + + + V     P P  TW      L    R    T 
Sbjct: 6891 DAFVEPTMDL-SAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTL 6949

Query: 616  DGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVT 675
                +L+I  +  SD G+YT+ L   + K ++    + V A P AP  +   +    +V 
Sbjct: 6950 SAYAELVISPSERSDKGIYTLKLEN-RVKTISGEIDVNVIARPSAPKELKFGDITKDSVH 7008

Query: 676  AEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKN 735
              WEP  D+       Y V  R  +   W +  D +    FT+  ++ G EY F+V A+N
Sbjct: 7009 LTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARN 7068

Query: 736  ELGASKPSDTSQP 748
            + G  +P+   +P
Sbjct: 7069 KCGPGEPAYVDEP 7081



 Score =  266 bits (679), Expect = 8e-71
 Identities = 174/592 (29%), Positives = 269/592 (45%), Gaps = 11/592 (1%)

Query: 165   PDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTR 224
             P +  KL   L VKAG  + ++   +     + AW KD      +     ++D     ++
Sbjct: 11704 PVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSK 11763

Query: 225   LCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRP 284
               L  A R D G+Y VT  +  GS  A  T+ V+DKP P +  +++ D       + W P
Sbjct: 11764 FSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRN-LKIVDVSSDRCTVCWDP 11822

Query: 285   PRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGA 344
             P D+GG  ++ Y++E+ +  R  W           T     +E G +Y FRVRA    G 
Sbjct: 11823 PEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIE-GNEYIFRVRAENKIGT 11881

Query: 345   GEALESEEILVAPEA-LPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKG 403
             G   ES+ ++   +   P  P  P +   S + +T+ W  P   G   I GY +E+++K 
Sbjct: 11882 GPPTESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKH 11941

Query: 404   SNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPG 463
             S  W  VN   +PERR  V ++    +Y+FRV A    G GEP  PS  V A+DP+ PPG
Sbjct: 11942 STRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPG 12001

Query: 464   LVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVEL-----CSSDSLQWLPCHVGTVPV 518
                N +V D +  SITL W  P    G    GYVVE+      +S    W  C+     V
Sbjct: 12002 PPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLV 12061

Query: 519   -TTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTV 577
                +T   L   + Y  RV A N+ G  +P+ L   ++   +   P+  +D+S + L+ V
Sbjct: 12062 RKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVIV 12121

Query: 578   KVGDTVRVPVSFEAMPMPEVTWLKDGLP-LPKRSVTVTKDGLTQLLIPVAGLSDSGLYTV 636
             + G  +R+       P P+VTW K G+  + ++      D +  L+IP +   DSG Y++
Sbjct: 12122 RAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSL 12181

Query: 637   VLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFT 696
              L    G E A    +RV   P     + + +    +    W P  ++      HY V  
Sbjct: 12182 TLVNPAG-EKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEK 12240

Query: 697   RSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             R +    W      +    F +  ++PG+EY+FRV A NE G   P+D  +P
Sbjct: 12241 READRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKP 12292



 Score =  266 bits (679), Expect = 8e-71
 Identities = 184/657 (28%), Positives = 293/657 (44%), Gaps = 18/657 (2%)

Query: 99    DLGPGTWFKDGVKLTTQDGVIFKQDGLV--HSLFITHVQGTQAGRYTFVAGDQQSEATLT 156
             +L  G W K     T      F+  GLV  H      +    AG ++      +S   +T
Sbjct: 15982 ELPEGRWMK--ASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFS---EPSESTGAIT 16036

Query: 157   VQDS---PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDRE 213
              +D    P I+ D   K ++ +VV AG+   V             W K   E+  S+   
Sbjct: 16037 ARDEVDPPRISMD--PKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL--SNTAR 16092

Query: 214   AQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDC 273
              ++   D  T L +  A R D G Y +  ++  G     + ++V+D+P PP+GP+ +   
Sbjct: 16093 LEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGV 16152

Query: 274   HRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYT 333
                   L W+PP  +GG  +  Y+VERR+  R  W  V +A   + +     +  G +YT
Sbjct: 16153 TAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVV-DANVQTLSCKVTKLLEGNEYT 16211

Query: 334   FRVRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHI 392
             FR+ AV   G GE LESE ++   P  +P AP AP + + +   + + W  P   G + I
Sbjct: 16212 FRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEI 16271

Query: 393   LGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDA 452
             LGY++E+R K    WT  + + + E R  V  + +   YEFRV+A   +G  EP PPS  
Sbjct: 16272 LGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAY 16331

Query: 453   VFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCH 512
               A DP+  PG   N +V D + +S+ LSW+ P    G E QGY+VE C     +W  C 
Sbjct: 16332 QKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCT 16391

Query: 513   VGT-VPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSST 571
               T +  T    + L     Y  R+ A+N+ G  + + +   +        P   +D   
Sbjct: 16392 PPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLEL 16451

Query: 572   KDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDS 631
             + ++ ++ G ++R+ V  +  P PEV W K    +   ++       T L++      DS
Sbjct: 16452 RKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTSLVLDNVNRYDS 16511

Query: 632   GLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLH 691
             G YT+ L    G + A    +RV   P  P  + + E    +V+  WEP   +      +
Sbjct: 16512 GKYTLTLENSSGTKSAF-VTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKN 16570

Query: 692   YAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             Y V  R +    +       H N + +  +  G  Y+FRV A+NE G   P+ T+ P
Sbjct: 16571 YIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADP 16627



 Score =  264 bits (674), Expect = 3e-70
 Identities = 169/584 (28%), Positives = 277/584 (47%), Gaps = 9/584 (1%)

Query: 166   DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
             D++  ++  L VKAG  V +            +W+KDG  +  +     ++ +      L
Sbjct: 12799 DLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEG--IKMAMQRNLCTL 12856

Query: 226   CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPP 285
              L S  RKD G Y++T  +  GS  A + L+V+DKP PP   +++   +     L W PP
Sbjct: 12857 ELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPAS-VKINKMYSDRAMLSWEPP 12915

Query: 286   RDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAG 345
              ++GG  +  Y+V++R+  R  W +V      ++   +  +E G +Y FR+ A    G G
Sbjct: 12916 LEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIE-GHEYQFRICAENKYGVG 12974

Query: 346   EALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGS 404
             + + +E  +   P   P     P I + +   +T++W  P   G + I GYL+E+R+  +
Sbjct: 12975 DPVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQA 13034

Query: 405   NTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGL 464
               WT VN +P+ ER      +++G +YEFRVTA+  +GPG+P   S A +ARDP  PPG 
Sbjct: 13035 VNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGP 13094

Query: 465   VRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHV-GTVPVTTYTA 523
                 +V D + +S++LSW  P    G    GY+VE+  +DS  W+ C++   +  T +  
Sbjct: 13095 PAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEV 13154

Query: 524   KGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTV 583
              GL     Y  RV AVN+ G S PS +        + + P+  +D+  +  L ++ G T+
Sbjct: 13155 TGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTM 13214

Query: 584   RVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTK--DGLTQLLIPVAGLSDSGLYTVVLRTL 641
             R+ V  +  P P++TW K  + L  R     K  D  T L        D+G Y + L   
Sbjct: 13215 RLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENS 13274

Query: 642   QGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAH 701
              GK+  ++  ++V   P  P  + ++E    +    WEP   +     ++Y V  R +  
Sbjct: 13275 CGKK-EYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAER 13333

Query: 702   GPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
               W           F +  +  G  Y FRV A+NE G   P +T
Sbjct: 13334 KSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGET 13377



 Score =  263 bits (673), Expect = 4e-70
 Identities = 167/589 (28%), Positives = 274/589 (46%), Gaps = 11/589 (1%)

Query: 165   PDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTR 224
             P +    R+ L ++ G+   +   +      + +W KD A+V+   D    +        
Sbjct: 10321 PTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVL--EDDRTHIKTTPATLA 10378

Query: 225   LCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRP 284
             L    A R D G+Y V + +  GS +    + V+D+P PP GP+   +  +  + + W+P
Sbjct: 10379 LEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKP 10438

Query: 285   PRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGA 344
             P D+GG  +  Y++E+++ G+  W+ V  A A +T      +E G+ Y FR+ A    G 
Sbjct: 10439 PLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLE-GKDYIFRIHAENLYGI 10497

Query: 345   GEALESEEILVAPE-ALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKG 403
              + L S+ +       +P AP  P +   +     +TW  P   G   I  Y++E+R+  
Sbjct: 10498 SDPLVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKPHDGGKP-ITNYILEKRETM 10556

Query: 404   SNTWTAVNDQPV-PERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP 462
             S  W  V   P+ P  ++ V D+ +GCQYEFRV+A    G G+P PPS  VFA+DP+  P
Sbjct: 10557 SKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKP 10616

Query: 463   GLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCH--VGTVPVTT 520
                 N +  D +  S+ L+W  P    G +  GY+VE       +W   +    + P T 
Sbjct: 10617 SPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETK 10676

Query: 521   YTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVG 580
             Y   GLR G+ Y  RV AVN  G+S P+ +   V        P+ ++D++      +KVG
Sbjct: 10677 YKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVG 10736

Query: 581   DTVRVPVSFEAMPMPEVTWLKDGLPLP-KRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLR 639
             DT+R+    + +P P+VTW K+    P K  + VT  G ++L I  A   D G+Y++ + 
Sbjct: 10737 DTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVG-SKLEIRNAAHEDGGIYSLTVE 10795

Query: 640   TLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSS 699
                G +   S ++ V   P  P  + + E    +    W+   D+   V  +Y V  R  
Sbjct: 10796 NPAGSKTV-SVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDV 10854

Query: 700   AHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             A   W   +            +  G++Y FRV A+N+ G     +T +P
Sbjct: 10855 ASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKP 10903



 Score =  263 bits (672), Expect = 5e-70
 Identities = 187/652 (28%), Positives = 297/652 (45%), Gaps = 30/652 (4%)

Query: 114   TQDGVIFKQDGLVHSLFITHVQGTQAGR-YTF------VAGDQQSEATLTVQDSPTIAPD 166
             TQD + FK    +  +    V G Q G+ Y F      + G    + T+ ++    + P 
Sbjct: 10956 TQDWIKFKTVTNLECV----VTGLQQGKTYRFRVKAENIVGLGLPDTTIPIECQEKLVPP 11011

Query: 167   VTE---KLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYT 223
               E   KL E LVVKAG  V      +      A W  DG+E+   +D    V+  +  +
Sbjct: 11012 SVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEI--KTDEHYTVETDNFSS 11069

Query: 224   RLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWR 283
              L + +  R+D G+Y +T+ +  GS    + L V+D P PP GP+ + D     + + W+
Sbjct: 11070 VLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTISWQ 11129

Query: 284   PPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEG 343
             PP+D+GG  V  Y+VE++   + TW  V    +  T     H++ G +Y FRVRA    G
Sbjct: 11130 PPKDDGGSPVINYIVEKQDTRKDTWGVVSSG-SSKTKLKIPHLQKGCEYVFRVRAENKIG 11188

Query: 344   AGEALESEEILVAPE-ALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKK 402
              G  L+S   +   + + P  P  P +   +    T++WT P+  G + I GY +ERR+ 
Sbjct: 11189 VGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREV 11248

Query: 403   GSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP 462
              +  W  VN  P+ + ++ V  + +G  YEFRV A   +G  +P P SD + A  P++PP
Sbjct: 11249 -TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKPP 11307

Query: 463   GLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVG-TVPVTTY 521
             G   N ++ D+S  +  L W  P +  G    GYVVE     + QW   +    +    +
Sbjct: 11308 GPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQCAF 11367

Query: 522   TAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGD 581
                GL  G  Y  R+ A N  G+ +P  L   V A  +   P+  +D + +D++TV+VG 
Sbjct: 11368 RVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQ 11427

Query: 582   TVRVPVSFEAMPMPEVTWLKDG--LPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLR 639
             T+R+    +  P P++TW K+G  L   KR   +      +L I  A  +D G Y +  +
Sbjct: 11428 TIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAK 11487

Query: 640   TLQGKEVAHSFRIRVAACPQAPGP---IHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFT 696
                G    H+    +      PGP   + +        T  WE   D       ++ V  
Sbjct: 11488 NSSG----HAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEY 11543

Query: 697   RSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
             R      W   A  + T R     +L  +EY+FRV A+N++G     +T  P
Sbjct: 11544 RKPNQKGWSIVASDV-TKRLIKANLLANNEYYFRVCAENKVGVGPTIETKTP 11594



 Score =  259 bits (661), Expect = 1e-68
 Identities = 166/575 (28%), Positives = 261/575 (45%), Gaps = 12/575 (2%)

Query: 173   EPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGR 232
             E + +KAGK + ++            W+K   EVV SS     V   D  + L +    R
Sbjct: 12409 EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSS--HLAVHKADSSSILIIKDVTR 12466

Query: 233   KDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRT 292
             KD G YS+T  +  G+   ++ + V+D P PPQ P ++ D       L W  P ++GG  
Sbjct: 12467 KDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHIPLEDGGSN 12526

Query: 293   VECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEE 352
             +  Y+VE+    R  W+    A    T+     + PG++Y FRVRA    G  E L S +
Sbjct: 12527 ITNYIVEKCDVSRGDWV-TALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPLTSPK 12585

Query: 353   ILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVN 411
             ++   P  +P  P    +   +   I + W  P   G + I+GYLIER+++ S  W   N
Sbjct: 12586 MVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVKAN 12645

Query: 412   DQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVT 471
             D  V    +  A + +G +Y FR+ A+  +G   P  P++ V AR P+ PPG     +V 
Sbjct: 12646 DTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPG---KPEVI 12702

Query: 472   DRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVG--TVPVTTYTAKGLRPG 529
             D + ++++L WA P    G +  GY VE C     +W+ C+     +P   YTA GL   
Sbjct: 12703 DVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEEK 12762

Query: 530   EGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSF 589
               Y  R  A      S PS     V  +   V P+  +  + K LLTVK G  V +  + 
Sbjct: 12763 AQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCLDATV 12822

Query: 590   EAMPMPEVTWLKDGLPL-PKRSVTVT-KDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVA 647
                PMP V+W KDG  L P   + +  +  L  L +      DSG YT+      G + A
Sbjct: 12823 FGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSA 12882

Query: 648   HSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEA 707
              + +++V   P  P  + + +         WEP  ++      +Y V  R ++   W + 
Sbjct: 12883 -TIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQV 12941

Query: 708   ADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKP 742
             +  +     ++  ++ GHEY FR+ A+N+ G   P
Sbjct: 12942 SATVPITSCSVEKLIEGHEYQFRICAENKYGVGDP 12976



 Score =  258 bits (658), Expect = 2e-68
 Identities = 170/617 (27%), Positives = 289/617 (46%), Gaps = 36/617 (5%)

Query: 173  EPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDR----EAQVDLGDGYTRLCLP 228
            + + VKAG+PV +          +  W K+   +   +D     + +V   +  T L +P
Sbjct: 8909 DTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIP 8968

Query: 229  SAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDN 288
             A R+D G Y+VT  +  GSV   + ++V D+P PP+  + V D       L W  P DN
Sbjct: 8969 KAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRN-LAVTDIKAESCYLTWDAPLDN 9027

Query: 289  GGRTVECYVVERRQAGR--STWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGE 346
            GG  +  YV+++R A R  + W +V     +   +    + P  +Y FRVRAV   G  +
Sbjct: 9028 GGSEITHYVIDKRDASRKKAEWEEVTNTAVEKR-YGIWKLIPNGQYEFRVRAVNKYGISD 9086

Query: 347  ALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSN 405
              +S+++++  P  LP  P  P +L+ +   + ++WT P   G + I GY +E+R++GS 
Sbjct: 9087 ECKSDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSP 9146

Query: 406  TWTAVNDQPVPER-----RWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMR 460
             W+ V+  P+ +       + V  + +G +Y+FR  A+  +G G P  PSD   A DP+ 
Sbjct: 9147 YWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIF 9206

Query: 461  PPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTT 520
            PPG     +V D++ +SI+L W  P    G   +GY+VE+    +  W   +     +TT
Sbjct: 9207 PPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITT 9266

Query: 521  --YTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVK 578
                   L+    Y  RV AVNE G+S+PS     + A  +   P+  +D   +D L  K
Sbjct: 9267 CECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCK 9326

Query: 579  VGDTVRVPVSFEAMPMPEVTW---------LKDGL-PLPKRSVTVTKDGLTQLLIPVAGL 628
             G  +R+P   +  P P+ +W         +KDG+  +P+ +   T +  + ++IP    
Sbjct: 9327 AGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKR 9386

Query: 629  SDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDV 688
            S +G Y++  +   G++ A+  R++V   P  P  + + +   G+    W+   D+  D 
Sbjct: 9387 SHTGKYSITAKNKAGQKTANC-RVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDR 9445

Query: 689  PLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQP 748
               Y +  R+     W +      +  F +  +L   +Y FRV A+N  G   P +T Q 
Sbjct: 9446 IKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQ- 9504

Query: 749  WCIPRQRDRFTVKAPCY 765
                    R T + P Y
Sbjct: 9505 --------RTTARDPIY 9513



 Score =  257 bits (656), Expect = 4e-68
 Identities = 167/606 (27%), Positives = 278/606 (45%), Gaps = 11/606 (1%)

Query: 145   VAGDQQSEATLTVQDS---PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRK 201
             ++    S   +T +D    P I+ D   K R+ +VV AG+   ++            W +
Sbjct: 17107 ISKPSDSTGPITAKDEVELPRISMD--PKFRDTIVVNAGETFRLEADVHGKPLPTIEWLR 17164

Query: 202   DGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKP 261
                E+  S+    ++   D    L +  A R D GQY +   +  GS    + ++V+D+P
Sbjct: 17165 GDKEIEESA--RCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRP 17222

Query: 262   DPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTF 321
              PP+GP++V         L W PP  +GG  +  YVVE+R+  R  W  V      ++  
Sbjct: 17223 GPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLK 17282

Query: 322   TDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLT 380
                 +E G +Y FR+ AV   G GE LES  +L+  P  LP  P +  + + +   +T+ 
Sbjct: 17283 VTKLLE-GNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVC 17341

Query: 381   WTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAP 440
             W  P   G + I+GY++E+R +    W   N + + + R  V  + +  +YEFRV+A   
Sbjct: 17342 WNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENA 17401

Query: 441   SGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVEL 500
             +G GEP P +    A DP+  PG   N  + D +  SITL+W  P    G E  GYVVE+
Sbjct: 17402 AGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEI 17461

Query: 501   CSSDSLQWLPCHVGT-VPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPV 559
             C +D  +W      T + VT +    L   + Y +RV A+N+ G  + +++   V+    
Sbjct: 17462 CKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDK 17521

Query: 560   TVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLT 619
                P+  +DS  +  + V+ G + R+ + F+  P PE+TW ++      +         T
Sbjct: 17522 LEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTDKVQIEKGVNYT 17581

Query: 620   QLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWE 679
             QL I     +D+G Y + L    G + A    ++V   P  P  + ++E    +    WE
Sbjct: 17582 QLSIDNCDRNDAGKYILKLENSSGSKSAF-VTVKVLDTPGPPQNLAVKEVRKDSAFLVWE 17640

Query: 680   PSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGA 739
             P   +      +Y +  R S    +   + +     F +  +  G  Y+FRV+A+NE G 
Sbjct: 17641 PPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGV 17700

Query: 740   SKPSDT 745
               P +T
Sbjct: 17701 GVPVET 17706



 Score =  256 bits (655), Expect = 5e-68
 Identities = 185/660 (28%), Positives = 300/660 (45%), Gaps = 39/660 (5%)

Query: 101   GPGTWFKDGVKLTTQDGV--IFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQ 158
             G  TW   G+  T +  V  + +Q  L   +F  + +G           D  +   +TV+
Sbjct: 21008 GEQTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLS---------DPVTIGPITVK 21058

Query: 159   DSPTIAP--DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDG-----AEVVGSSD 211
             +   I P  D+++     + V+ G  V +++P++       +W KDG     +E V  S 
Sbjct: 21059 EL-IITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSK 21117

Query: 212   REAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQ 271
              E ++ L        + +A ++  G+Y+V L +    +   +T+  +  P  P+GP+   
Sbjct: 21118 TENKITLS-------IKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKGPIRFD 21170

Query: 272   DCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRK 331
             +     V L W  P DNGG  + CY +E+R+  ++ W  V  + A  TTF   ++    +
Sbjct: 21171 EIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCSSVA-RTTFKVPNLVKDAE 21229

Query: 332   YTFRVRAVTSEGAGEALESEEILVAPE-ALPKAPSAPAILSASSQGITLTWTAPRGPGSA 390
             Y FRVRA    G  + L S  I+   +  +P  P  P I + +S G++LTW AP   G +
Sbjct: 21230 YQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGS 21289

Query: 391   HILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPS 450
              + G+ +E++++ S  W  VN  P+  R +    + +G  Y+FRV A   +G   P  PS
Sbjct: 21290 EVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGLSSPSDPS 21349

Query: 451   DAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLP 510
                 A  P+ PPG    + VT     +ITL W  P    G +  GY +E    +  +W+ 
Sbjct: 21350 KFTLAVSPVDPPGTPDYIDVT---RETITLKWNPPLRDGGSKIVGYSIEKRQGNE-RWVR 21405

Query: 511   CHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ-SQPSALDTLVQAMPVTVCPKFLVDS 569
             C+   V    YT  GL PG+ Y  R+ A N  G  S PS    ++      V P      
Sbjct: 21406 CNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGP 21465

Query: 570   STKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKD--GLTQLLIPVAG 627
                D L +K G+++R+    +  P+P VTW KDG+ + KR      D  G T L +  A 
Sbjct: 21466 EYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDAT 21525

Query: 628   LSDSGLYTVVLRTLQGKEVAHSFRIRVAACP-QAPGPIHLQENVPGTVTAEWEPSPDEAQ 686
                 G+YTV  +   G   A   +++V   P +  GPI    N+ G     W  +P    
Sbjct: 21526 RDHRGVYTVEAKNASGSAKA-EIKVKVQDTPGKVVGPIRF-TNITGEKMTLWWDAPLNDG 21583

Query: 687   DVPL-HYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
               P+ HY +  R ++   W    D+     +T + ++ G+EY FRV A N+ G  +P D+
Sbjct: 21584 CAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDS 21643



 Score =  254 bits (650), Expect = 2e-67
 Identities = 170/576 (29%), Positives = 260/576 (45%), Gaps = 12/576 (2%)

Query: 175   LVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKD 234
             ++ KAG  + V+IP          W+K G +++  + R    +     T L +    R D
Sbjct: 14578 VIAKAGDNIKVEIPVLGRPKPTVTWKK-GDQILKQTQR-VNFETTATSTILNINECVRSD 14635

Query: 235   CGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVE 294
              G Y +T R+  G V   +T+QV D P PP GP++  +     V   W PP ++GG  + 
Sbjct: 14636 SGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPIS 14695

Query: 295   CYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEIL 354
              YVVE RQ   +TW+++       TT+    +  G +Y FRV+A    G G  + S  I+
Sbjct: 14696 NYVVEMRQTDSTTWVELATTVI-RTTYKATRLTTGLEYQFRVKAQNRYGVGPGITSACIV 14754

Query: 355   VA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQ 413
                P  +P  P  P + + +   +T++W  P   G + ILGY +ER+++    W  V+  
Sbjct: 14755 ANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKA 14814

Query: 414   PVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDR 473
              VP   +  + +  G  YEFRV A   +G  +P  PS+ + A DP+ PPG    L +T  
Sbjct: 14815 LVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNIT-- 14872

Query: 474   SNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYF 533
                ++TL WA P+   G +   Y+VE     + +WL  +   +    +T  GL     Y 
Sbjct: 14873 -RHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYE 14931

Query: 534   VRVTAVNEGGQ-SQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAM 592
              RV A N  G  S PS     +        PK  VD   KD + +K G+  R+       
Sbjct: 14932 FRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGR 14991

Query: 593   PMPEVTWLKDGLPLPKRSVTVTK--DGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSF 650
             P P + W KDG  L   +    K  D  T L+   +   DSG YT+   T  G    H F
Sbjct: 14992 PPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLT-ATNPGGFAKHIF 15050

Query: 651   RIRVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAAD 709
              ++V   P  P GP+ + E         W P  D+      HY V  R ++   W   A 
Sbjct: 15051 NVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVAS 15110

Query: 710   RIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
              +   +  +  +L G+EY FRV+A N+ G  +P ++
Sbjct: 15111 EVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLES 15146



 Score =  254 bits (650), Expect = 2e-67
 Identities = 189/666 (28%), Positives = 307/666 (46%), Gaps = 37/666 (5%)

Query: 98    SDLGPGTWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTF------VAG--DQ 149
             S++G G W K    + + +             F T    ++   Y F       AG   +
Sbjct: 22484 SEVGDGRWLKCNYTIVSDN-------------FFTVTALSEGDTYEFRVLAKNAAGVISK 22530

Query: 150   QSEATLTVQDSPTIAPDVTE---KLREPLV-VKAGKPVIVKIPFQSHLPIQAAWRKDGAE 205
              SE+T  V      AP   E   +L   LV ++AG  +++          +  W K G +
Sbjct: 22531 GSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTK-GDK 22589

Query: 206   VVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQ 265
              +   ++ +    G   T + +    R D G+Y++T+++  G+    + ++V+D P P  
Sbjct: 22590 ELDLCEKVSLQYTGKRATAV-IKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPC- 22647

Query: 266   GPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKV-GEAPADSTTFTDA 324
             G + V    +    L W  P+++GG  +  Y+VERR+  R  W+ V GE P  S   T  
Sbjct: 22648 GKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYVVT-- 22705

Query: 325   HVEPGRKYTFRVRAVTSEGAGEALESEEILVAPE-ALPKAPSAPAILSASSQGITLTWTA 383
              +    +Y FRVRAV   G G  +ESE I+      +P  P  P  +    + I + WT 
Sbjct: 22706 RLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTK 22765

Query: 384   PRGPGSAHILGYLIERRKKGSNTWTAVN-DQPVPERRWTVADVRQGCQYEFRVTAVAPSG 442
             P   G   I  YL+++R+K S  WT VN D  V + R  V  + +GC Y+FRVTAV  +G
Sbjct: 22766 PESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAG 22825

Query: 443   PGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCS 502
               EP   S+ +  R+P   PG     +V D +  SI+L+W  P    G +  GYV+E+  
Sbjct: 22826 NSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQE 22885

Query: 503   SDSLQWLPCHV-GTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTV 561
              D+ QW   H   T+  T +T   L+ G+ Y  RV AVN  G S+ S     ++ +    
Sbjct: 22886 KDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIE 22945

Query: 562   CPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQL 621
              P   +    K  +T++ G ++R+ VS    P P +TW K G+ L  R++  T +  + L
Sbjct: 22946 IPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSLL 23005

Query: 622   LIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWE-P 680
             ++      D+G YT+      GK+ A +  ++V   P     + ++E    +VT  WE P
Sbjct: 23006 IVDKVNRYDAGKYTIEAENQSGKKSA-TVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIP 23064

Query: 681   SPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGAS 740
             + D    V  +Y V  R +A   +     +     + + G++ G  Y+FRV+ +N  G  
Sbjct: 23065 TIDGGAPVN-NYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIG 23123

Query: 741   KPSDTS 746
             +P +TS
Sbjct: 23124 EPCETS 23129



 Score =  251 bits (640), Expect = 3e-66
 Identities = 182/661 (27%), Positives = 289/661 (43%), Gaps = 30/661 (4%)

Query: 126   VHSLFITHVQGTQAGRYTF------VAGDQQSEATLTVQDS--PTIAPDVTEKLREPLVV 177
             V  L  T     + G Y F       AG  +  AT+   D   P + P +   L+E + V
Sbjct: 9574  VEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQRPDMPPSID--LKEFMEV 9631

Query: 178   KAGKPV-----IVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGR 232
             + G  V     I  +PF +    +A  +K   +     D      + D    L +P + R
Sbjct: 9632  EEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRR 9691

Query: 233   KDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRT 292
              D G Y++T  +  G+   E+ L V+ +P PP GP++ +      + L W PP+D+GG  
Sbjct: 9692  SDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSK 9751

Query: 293   VECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESE- 351
             +  YV+E+R+A R TW+ V   P +  T+T   +  G +Y FR+ A    G GE L+SE 
Sbjct: 9752  ITNYVIEKREANRKTWVHVSSEPKE-CTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEP 9810

Query: 352   EILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVN 411
             E      ++P AP  P + S +   +T+ W  P   G + + GY +E +   S  W  VN
Sbjct: 9811  ETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVN 9870

Query: 412   DQPVPER----RWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRN 467
               P+        + V  + +G  Y+FRV A+  +G G    PSD   ARDP+ PPG    
Sbjct: 9871  RDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPG-PPF 9929

Query: 468   LQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLR 527
              +VTD + +S  L W+ P    G +  GY+VE       +W       V  T     GL+
Sbjct: 9930  PKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTGLK 9989

Query: 528   PGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPV 587
              G  Y  RV AVN  G  +P  +  +++     V P   +D+S +D + V  G  +R+  
Sbjct: 9990  EGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRIIA 10049

Query: 588   SFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVA 647
                  P P VTW  +   LP+ +   T    + ++I     S  G+Y+++ +   G E  
Sbjct: 10050 YVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAG-ERK 10108

Query: 648   HSFRIRVAACPQAPGPIHLQENVPG-TVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHE 706
              +  + V   P   G   L  N+   +    W    D+      +Y +  R S    W  
Sbjct: 10109 KTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTP 10168

Query: 707   AADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS------QPWCIPRQRDRFTV 760
                 +     T+ G++ G  Y FR+ A+N +G     +TS      +P  +P + +   V
Sbjct: 10169 VTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPERPEDLEV 10228

Query: 761   K 761
             K
Sbjct: 10229 K 10229



 Score =  250 bits (639), Expect = 3e-66
 Identities = 163/600 (27%), Positives = 269/600 (44%), Gaps = 17/600 (2%)

Query: 163   IAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGY 222
             + P   + L     V AG+ + V +PF         W KD   +  ++   A+    +  
Sbjct: 15648 VIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAEST--ENN 15705

Query: 223   TRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRW 282
             + L +  A R+D G Y V L +  G     L + V+DKP PP GP+++ +     + L W
Sbjct: 15706 SLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTADSITLSW 15765

Query: 283   RPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSE 342
              PP+ +GG ++  Y+VE+R    +TW ++  A    TT     ++ G +Y FR+ A    
Sbjct: 15766 GPPKYDGGSSINNYIVEKRDTSTTTW-QIVSATVARTTIKACRLKTGCEYQFRIAAENRY 15824

Query: 343   GAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRK 401
             G    L SE  +   P  +P  P  P +  +S   + + W  P   G + ++GY +ER++
Sbjct: 15825 GKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKE 15884

Query: 402   KGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRP 461
             + S  W  +N  P+P+ ++    + +G +YEFRV+A    G G+P   S+   ARDP  P
Sbjct: 15885 RNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDP 15944

Query: 462   PGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTY 521
             PG    + VT     S+TL W  P    G +  GY+VE       +W+      +  T +
Sbjct: 15945 PGRPEAIIVT---RNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASFTNIIDTHF 16001

Query: 522   TAKGLRPGEGYFVRVTAVNEGGQ-SQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVG 580
                GL     Y  RV A N  G  S+PS     + A      P+  +D   KD + V  G
Sbjct: 16002 EVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVVHAG 16061

Query: 581   DTVRVPVSFEAMPMPEVTWLKDGLPLPK--RSVTVTKDGLTQLLIPVAGLSDSGLYTVVL 638
             ++ +V       P+P + W+K    L    R    + D  T L +  A   DSG Y +  
Sbjct: 16062 ESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKA 16121

Query: 639   RTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTR 697
             + + G E + +  ++V   P  P GP+ +        T  W+P   +     ++Y V  R
Sbjct: 16122 KNVAG-ERSVTVNVKVLDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERR 16180

Query: 698   SSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT-----SQPWCIP 752
              ++   W      + T    +  +L G+EY FR++A N+ G  +P ++       P+ +P
Sbjct: 16181 ETSRLVWTVVDANVQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVP 16240



 Score =  249 bits (635), Expect = 1e-65
 Identities = 176/633 (27%), Positives = 288/633 (45%), Gaps = 32/633 (5%)

Query: 131   ITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVT--EKLREPL---VVKAGKPVIV 185
             +T +   Q  ++   A +++ ++   V   P IA D+T    L+ P     ++AG+ + +
Sbjct: 17775 VTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKI 17834

Query: 186   KIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSE 245
             +IP         +W KDG  +  ++     V+     T L +    + D G+Y+VT  + 
Sbjct: 17835 EIPVIGRPRPNISWVKDGEPLKQTT--RVNVEETATSTVLHIKEGNKDDFGKYTVTATNS 17892

Query: 246   GGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGR 305
              G+    L++ V++KP PP GP+   +     V + W PP   GG  +  Y+VE+R    
Sbjct: 17893 AGTATENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTT 17952

Query: 306   STWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA-PEALPKAP 364
             +TW  V    A  TT     ++ G +Y FR+ A    G    L+S+ ++V  P   P  P
Sbjct: 17953 TTWHMVSATVA-RTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPGPP 18011

Query: 365   SAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVAD 424
               P + S S   + + W  P   G   I+GY +E+++K S  W  +N  P+ + ++    
Sbjct: 18012 GTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTG 18071

Query: 425   VRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAG 484
             + +G +YEF+V+A    G G+P   S+   ARDP  PPG    + +T     ++TL W  
Sbjct: 18072 LDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVIT---RNNVTLKWKK 18128

Query: 485   PDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ 544
             P    G +  GY+VE       +W+      V  T +T  GL   + Y  RV A N  G 
Sbjct: 18129 PAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGN 18188

Query: 545   -SQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDG 603
              S+PS     + A      P   +D   KD++ V  G+T  +       P+P+V W KDG
Sbjct: 18189 FSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDG 18248

Query: 604   LPLPKRSV------TVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAAC 657
               L + +       T+ K   T L++     +D G Y + L  + G +   S  I V   
Sbjct: 18249 KELEETAARMEIKSTIQK---TTLVVKDCIRTDGGQYILKLSNVGGTK---SIPITVKVL 18302

Query: 658   PQAPGPIHLQENVPGTVTAE-----WEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIH 712
              + PGP      V G VTAE     W P   +      HY +  R ++   W + +  + 
Sbjct: 18303 DR-PGPPEGPLKVTG-VTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQ 18360

Query: 713   TNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
                + +  +LPG+EY FRV+A N+ G  +P ++
Sbjct: 18361 ALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLES 18393



 Score =  246 bits (627), Expect = 9e-65
 Identities = 164/614 (26%), Positives = 286/614 (46%), Gaps = 24/614 (3%)

Query: 161   PTIAPDVTEKLREPLV-----VKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQ 215
             P IA D+  K    L      VKA + + + +PF+        WRKDG  +  ++     
Sbjct: 18888 PVIARDIEIKPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETT--RVN 18945

Query: 216   VDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHR 275
             V      T L +  A ++D G Y + + +  GS+   +T+ V+D+P PP GP+ + +   
Sbjct: 18946 VSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPP-GPIRIDEVSC 19004

Query: 276   AGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFR 335
               + + W PP  +GG  +  Y+VE+++   +TW  V +A A  T+     +  G +Y FR
Sbjct: 19005 DSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVA-RTSIKIVRLTTGSEYQFR 19063

Query: 336   VRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILG 394
             V A    G     ES  ++   P + P  P  P ++ A+   + +TW  P   G + ++G
Sbjct: 19064 VCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIG 19123

Query: 395   YLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVF 454
             Y +E +++ S  W+  N   + + +  V+ + +G  YE+RV A   +G G+     + V 
Sbjct: 19124 YHLEYKERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVP 19183

Query: 455   ARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVG 514
             ARDP  PPG     +VT+ +  S++L W+ P    G +  GY+VE       +WL C+  
Sbjct: 19184 ARDPCDPPG---QPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYT 19240

Query: 515   TVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ-SQPSALDTLVQAMPVTVCPKFLVDSSTKD 573
              +  T +    L   + Y  RV A N     S+PS     +        P+ ++D   +D
Sbjct: 19241 NIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRD 19300

Query: 574   LLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVT--VTKDGLTQLLIPVAGLSDS 631
             ++ VK G+ +++       P+P ++W KDG+ + +R+ T  ++ D  T L +      D+
Sbjct: 19301 VIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDT 19360

Query: 632   GLYTVVLRTLQG-KEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEW-EPSPDEAQDVP 689
             G Y + L+ + G + VA + ++     P A GP+ +        +  W  P  D   D+ 
Sbjct: 19361 GQYVLTLKNVAGTRSVAVNCKVLDKPGPPA-GPLEINGLTAEKCSLSWGRPQEDGGADID 19419

Query: 690   LHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPW 749
              +Y V  R ++H  W      +      +  +L G+EY FRV   N+ G  +P ++    
Sbjct: 19420 -YYIVEKRETSHLAWTICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLES---- 19474

Query: 750   CIPRQRDRFTVKAP 763
                +  D FTV +P
Sbjct: 19475 VAIKALDPFTVPSP 19488



 Score =  244 bits (624), Expect = 2e-64
 Identities = 172/644 (26%), Positives = 276/644 (42%), Gaps = 35/644 (5%)

Query: 148   DQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVV 207
             D +S A   V     I PDV         V+ G+ + +++P          W KDG  + 
Sbjct: 16716 DPRSLAVPIVAKDLVIEPDVKPAFSS-YSVQVGQDLKIEVPISGRPKPTITWTKDGLPL- 16773

Query: 208   GSSDREAQVDLGDGY--TRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQ 265
                 +  ++++ D    T L +    + D GQY +T+ +  G   A + +  +DKPDPP+
Sbjct: 16774 ---KQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPK 16830

Query: 266   GPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAH 325
             GP++  D     + L W PP   GG  +  Y+V++R    + W  V  A    TT     
Sbjct: 16831 GPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVW-DVVSATVARTTLKVTK 16889

Query: 326   VEPGRKYTFRVRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAP 384
             ++ G +Y FR+ A    G   ALES+ I+   P   P  P  P   + S   + + W  P
Sbjct: 16890 LKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEP 16949

Query: 385   RGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPG 444
                G + ++GY +ER+++ S  WT VN   + + ++   ++ +G +YEFRV A    G G
Sbjct: 16950 VNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVG 17009

Query: 445   EPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSD 504
             +    S+   ARDP  PPG    + V       ITL W  P    G    GY+VE     
Sbjct: 17010 KASKNSECYVARDPCDPPGTPEPIMV---KRNEITLQWTKPVYDGGSMITGYIVEKRDLP 17066

Query: 505   SLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ-SQPSALDTLVQAMPVTVCP 563
               +W+      V  T +T  GL   + Y  RV A N  G  S+PS     + A      P
Sbjct: 17067 DGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELP 17126

Query: 564   KFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPK--RSVTVTKDGLTQL 621
             +  +D   +D + V  G+T R+       P+P + WL+    + +  R      D    L
Sbjct: 17127 RISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALL 17186

Query: 622   LIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTVTAEWEP 680
             ++  A   D G Y +    + G + +    ++V   P  P GP+ +        +  W P
Sbjct: 17187 IVKDAIRIDGGQYILRASNVAGSK-SFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSP 17245

Query: 681   SPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGAS 740
                +      HY V  R ++   W   A  + TN   +  +L G+EY FR++A N+ G  
Sbjct: 17246 PLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVG 17305

Query: 741   KPSDTS-----QPWCIPR----------QRDRFTVKAPCYREPD 769
             +P +++      P+ +P            +D  TV   C+  PD
Sbjct: 17306 EPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTV---CWNRPD 17346



 Score =  235 bits (600), Expect = 1e-61
 Identities = 155/574 (27%), Positives = 257/574 (44%), Gaps = 12/574 (2%)

Query: 177   VKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCG 236
             V+AG  + V IP       +    +DG  +  +     ++   +    + L  +   D G
Sbjct: 19991 VRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAEN--LTINLKESVTADAG 20048

Query: 237   QYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECY 296
             +Y +T  +  G+ +A + + V+D+P PP GP+ + D     V L+W PP+ +GG  V  Y
Sbjct: 20049 RYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNY 20108

Query: 297   VVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVA 356
             ++ +R+   + W +V    A  T      +  G +Y FR++A    G  + ++S  + V 
Sbjct: 20109 ILLKRETSTAVWTEVSATVA-RTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVK 20167

Query: 357   -PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPV 415
              P   P  PS P + + + + IT+ W  P   G + ++GY +E + + S  W   N   +
Sbjct: 20168 LPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVI 20227

Query: 416   PERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSN 475
                 + V  +  G  YEFRV A   +G G+P  PS+ V A D   PP   RN+++TD S 
Sbjct: 20228 RTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPP---RNVRITDISK 20284

Query: 476   TSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVR 535
              S++LSW  P    G +  GY+VE       +W       V  T +   GL     Y  R
Sbjct: 20285 NSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFR 20344

Query: 536   VTAVNE-GGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPM 594
             V A N  G  S PS +   +  +     P   +     +++  + G +V++       P 
Sbjct: 20345 VFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPA 20404

Query: 595   PEVTWLKDGLPLPKRSVTVTKD--GLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRI 652
             P + W KD   L   ++   ++   L  +LI  A   +SG Y + LR   G   A + R+
Sbjct: 20405 PTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASA-TIRV 20463

Query: 653   RVAACPQAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRI 711
             ++   P  P GPI  +      +T  W P  D+      HY V  R ++   W   ++ +
Sbjct: 20464 QILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHL 20523

Query: 712   HTNRFTLLGILPGHEYHFRVVAKNELGASKPSDT 745
                  T   I+ G+EY FRV A N+ G  +P ++
Sbjct: 20524 EECIITTTKIIKGNEYIFRVRAVNKYGIGEPLES 20557



 Score =  225 bits (574), Expect = 1e-58
 Identities = 172/598 (28%), Positives = 266/598 (44%), Gaps = 43/598 (7%)

Query: 157  VQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQV 216
            ++D   I P+  +K   PLV +    V  + PF   LP+      D ++           
Sbjct: 8217 IKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFV--LPLTQRLSIDNSK----------- 8263

Query: 217  DLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRA 276
                G ++L +  + R D G Y + + ++ G  +A  T+ V+D P PP      +D  + 
Sbjct: 8264 ---KGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPIN-FVFEDIRKT 8319

Query: 277  GVCLRWRPPRDNGGRTVECYVVERRQAGR--STWLKVGEAPADSTTFTDAHVEPGRKYTF 334
             V  +W PP D+GG  +  Y +E++   +  S W+ V              +E G++Y F
Sbjct: 8320 SVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIE-GKEYLF 8378

Query: 335  RVRAVTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHIL 393
            RVRA    G G    S+ ++   P   P AP  P +   +S  + + W  P+  GS  IL
Sbjct: 8379 RVRAENRFGPGPPCVSKPLVAKDPFGPPDAPDKPIVEDVTSNSMLVKWNEPKDNGSP-IL 8437

Query: 394  GYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAV 453
            GY +E+R+  S  W+ VN   +   +  V  + +G  Y FRV A   +GPG+  PPSD  
Sbjct: 8438 GYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPK 8497

Query: 454  FARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHV 513
             A DP+ PPG     +VTD S+T+I L W  P    G E  GY V+     + +W  C  
Sbjct: 8498 TAHDPISPPGPPIP-RVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTE 8556

Query: 514  GTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVC-----PKFLVD 568
              + V  YT K +R G  Y +RV+AVN  G+  P       +  PVTV      P   +D
Sbjct: 8557 KMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPG------ETQPVTVAEPQEPPAVELD 8610

Query: 569  SSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGL-TQLLIPVAG 627
             S K  + +  G T+R+P      P+P   W K+   L K  V +   G  ++L+I  A 
Sbjct: 8611 VSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSELIIKDAL 8670

Query: 628  LSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPI-HLQENVPG--TVTAEWEPSPDE 684
              D G Y +      G + A + R+ V      PGP+  L+  V         W    D+
Sbjct: 8671 RKDHGRYVITATNSCGSKFA-AARVEVF---DVPGPVLDLKPVVTNRKMCLLNWSDPEDD 8726

Query: 685  AQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKP 742
                   + +  + +    W +  +    ++  + G+L G EY FRV+AKN+ G   P
Sbjct: 8727 GGSEITGFIIERKDAKMHTWRQPIE-TERSKCDITGLLEGQEYKFRVIAKNKFGCGPP 8783



 Score =  219 bits (559), Expect = 7e-57
 Identities = 163/614 (26%), Positives = 274/614 (44%), Gaps = 23/614 (3%)

Query: 161   PTIAP--DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDL 218
             P I P  D+T    + +  KAG P  + +P       +  W+ +   +   +DR +    
Sbjct: 22144 PQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLK-ETDRVSITTT 22202

Query: 219   GDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGV 278
              D  T L +  + R D G+Y +TL +  G     +T+ VI +P P  GP+EV        
Sbjct: 22203 KDR-TTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESC 22261

Query: 279   CLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRA 338
              L W  P+D GG  +  Y+VE+R++G + W  V  +    T     H+    +Y+FRV +
Sbjct: 22262 VLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSS-VKRTQIKVTHLTKYMEYSFRVSS 22320

Query: 339   VTSEGAGEALESEEILVA-PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLI 397
                 G  + LES  I+   P   P AP+ P +   S+  +++ W  P   G + I+GY +
Sbjct: 22321 ENRFGVSKPLESAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWV 22380

Query: 398   ERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARD 457
             E++++ +  W   N  P  E  + V  + +G +Y+FR  A+  +G  +    S  + A++
Sbjct: 22381 EKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQN 22440

Query: 458   PMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVE---LCSSDSLQWLPCHVG 514
             P+  PG     +VTD + ++++L W+ P    G +  GY++E   +      +WL C+  
Sbjct: 22441 PVDAPG---RPEVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYT 22497

Query: 515   TVPVTTYTAKGLRPGEGYFVRVTAVNEGGQ-SQPSALDTLVQAMPVTVCPKFLVDSSTK- 572
              V    +T   L  G+ Y  RV A N  G  S+ S     V        PK  +D+    
Sbjct: 22498 IVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHG 22557

Query: 573   DLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPL---PKRSVTVTKDGLTQLLIPVAGLS 629
             DL+T++ G  + +  +    P P++ W K    L    K S+  T    T  +I     S
Sbjct: 22558 DLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRAT-AVIKFCDRS 22616

Query: 630   DSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVP 689
             DSG YT+ ++   G + A S  ++V   P   G + +        T  W    ++     
Sbjct: 22617 DSGKYTLTVKNASGTK-AVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEI 22675

Query: 690   LHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPW 749
              HY V  R ++   W        T  + +  ++  +EY FRV A N+ G   P + S+P 
Sbjct: 22676 THYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVE-SEPI 22734

Query: 750   CIPRQRDRFTVKAP 763
                  R+ FT+ +P
Sbjct: 22735 V---ARNSFTIPSP 22745



 Score =  213 bits (543), Expect = 5e-55
 Identities = 165/619 (26%), Positives = 276/619 (44%), Gaps = 48/619 (7%)

Query: 165  PDVTEKLREPLVVK--------AGKPVIVKIPFQSHLPIQAAWRK---DGAEVVGS---- 209
            P    K  EP+++K         GKP +  +   S   ++  W K   DG   + S    
Sbjct: 7468 PGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTS---VRLNWTKPEHDGGAKIESYVIE 7524

Query: 210  -----SDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAE--------LTLQ 256
                 +D   +V  G   T+  LP  G  +  +YS  +R+   + ++E        L  +
Sbjct: 7525 MLKTGTDEWVRVAEGVPTTQHLLP--GLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCRE 7582

Query: 257  VIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPA 316
             +  P PP+  +EV +  +    L+W  P  +GG  +  Y+VE+R   R  W  V     
Sbjct: 7583 KLYPPSPPRW-LEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVK 7641

Query: 317  DSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEAL--PKAPSAPAILSASS 374
            D T  T   +  G  Y FRV A  + G  +  E E+ ++A +    P  P A A++  + 
Sbjct: 7642 D-TKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTK 7700

Query: 375  QGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFR 434
            + + L W  P+  G   I  Y+IE++++    W        P+  + V DV +G + +F+
Sbjct: 7701 RHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQ 7760

Query: 435  VTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQ 494
            V A   +G G P  P++ +   DP  PP    +L VTD     I ++W  P+   G    
Sbjct: 7761 VRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPII 7820

Query: 495  GYVVELCSSDSLQWLPCHVGTVPVTTYTAK---GLRPGEGYFVRVTAVNEGGQSQPSALD 551
            GY VE+C   + +W+   V + P+     K   G+ P + Y +RV AVN  G S+PS + 
Sbjct: 7821 GYHVEMCPVGTEKWM--RVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEIS 7878

Query: 552  TLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRS- 610
              V A      P   +D  T D++ ++ G+ + +PV F A+P+P V+W KDG  +     
Sbjct: 7879 ENVVAKDPDCKP--TIDLETHDIIVIE-GEKLSIPVPFRAVPVPTVSWHKDGKEVKASDR 7935

Query: 611  VTVTKDGLT-QLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQEN 669
            +T+  D ++  L +P +  +D+G+YT+ L    G   A S  ++V   P     I   + 
Sbjct: 7936 LTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATA-SINVKVIGLPGPCKDIKASDI 7994

Query: 670  VPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHF 729
               +    WEP   +     LHY +  R +    +       +   +T+  ++P  EY F
Sbjct: 7995 TKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFF 8054

Query: 730  RVVAKNELGASKPSDTSQP 748
            RV A N++G  +  +   P
Sbjct: 8055 RVKAVNKVGGGEYIELKNP 8073



 Score =  213 bits (542), Expect = 6e-55
 Identities = 140/514 (27%), Positives = 236/514 (45%), Gaps = 13/514 (2%)

Query: 166   DVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRL 225
             ++ E+ +E + V+ G  + + IP +        W K+G ++     + A +   + +T L
Sbjct: 23640 ELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDI----SKRAMIATSETHTEL 23695

Query: 226   CLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPP 285
              +  A R D G Y + L ++ G     + ++VI  P+ P+GP+E  D     V + WRPP
Sbjct: 23696 VIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPP 23755

Query: 286   RDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAG 345
              D+GG  +  Y++ERR+  ++ W  + ++    T+     ++   +Y FRV A    G  
Sbjct: 23756 ADDGGADILGYILERREVPKAAWYTI-DSRVRGTSLVVKGLKENVEYHFRVSAENQFGIS 23814

Query: 346   EALESEEILVAPEAL--PKAPS-APAILSASSQGITLTWTAPRGPGSAHILGYLIERRKK 402
             + L+SEE +     L  P+ PS  P +L  +   ++L+W+ P+  G + + GY IER++ 
Sbjct: 23815 KPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKET 23874

Query: 403   GSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPP 462
              ++ W   N   +    +TV  +    +Y+FR+ A    G  E  P S+ V  +DP   P
Sbjct: 23875 STDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKP 23934

Query: 463   GLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYT 522
                  L++   S  S+TL W  P+   G E  GY VE   S    W   +   +    +T
Sbjct: 23935 SQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFT 23994

Query: 523   AKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDT 582
               GL     Y  RV A NE G S+P      ++   +T      +    KD +T K+G+ 
Sbjct: 23995 IGGLLEATEYEFRVFAENETGLSRPRRTAMSIKT-KLTSGEAPGIRKEMKD-VTTKLGEA 24052

Query: 583   VRVPVSFEAMPMPEVTWLKDGLPL-PKRSVTVTKDGLTQ-LLIPVAGLSDSGLYTVVLRT 640
              ++       P+P++ W + G  L   R   ++ DG T  L +      D G+YT +   
Sbjct: 24053 AQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATN 24112

Query: 641   LQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTV 674
               G EV  S ++ + A PQ      L+E   G V
Sbjct: 24113 EVG-EVETSSKLLLQATPQFHPGYPLKEKYYGAV 24145



 Score =  203 bits (517), Expect = 5e-52
 Identities = 159/606 (26%), Positives = 257/606 (42%), Gaps = 32/606 (5%)

Query: 158  QDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVD 217
            Q++P I  DV  KL   L VKAG  + +          +  W K  A+++   D+   ++
Sbjct: 7188 QEAPEIFLDV--KLLAGLTVKAGTKIELPATVTGKPEPKITWTK--ADMILKQDKRITIE 7243

Query: 218  LGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAG 277
                 + + +  + R D G Y +   +  G   A + + V+DKP PP    ++ D     
Sbjct: 7244 NVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAA-FDITDVTNES 7302

Query: 278  VCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVR 337
              L W PPRD+GG  +  YVVERR      W K+     D T F    + P ++Y FRV 
Sbjct: 7303 CLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKD-TNFKATKLIPNKEYIFRVA 7361

Query: 338  AVTSEGAGEALESEEILVAPEALPKAPSAPAILSASS---QGITLTWTAPRGPGSAHILG 394
            A    G GE +++  I    +  P  P  P  L  S      +TLTW  P   G + I G
Sbjct: 7362 AENMYGVGEPVQASPITAKYQFDPPGP--PTRLEPSDITKDAVTLTWCEPDDDGGSPITG 7419

Query: 395  YLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVF 454
            Y +ER    ++ W   N  PV +  + V  +    +Y FRV A   +GPG+P   ++ + 
Sbjct: 7420 YWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPIL 7479

Query: 455  ARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVG 514
             +DP+ PP       V D   TS+ L+W  P+   G + + YV+E+  + + +W+    G
Sbjct: 7480 IKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEG 7539

Query: 515  TVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDL 574
             VP T +   GL  G+ Y  RV AVN+ G+S+PS       + PV    K    S  + L
Sbjct: 7540 -VPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSE-----PSDPVLCREKLYPPSPPRWL 7593

Query: 575  LTVKVGDT---VRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDS 631
              + +      ++  V  +    P   ++ +   + ++        +      V  L++ 
Sbjct: 7594 EVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEG 7653

Query: 632  GLYTVVLRTLQGKEVAHSFRIRVAACPQA------PGPIHLQENVPGT---VTAEWEPSP 682
             LY  V R      +  S    +     A      PGP +    V  T   V  +WEP  
Sbjct: 7654 SLY--VFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPK 7711

Query: 683  DEAQDVPLHYAVFTRSSAHGPWHEAADRIHTN-RFTLLGILPGHEYHFRVVAKNELGASK 741
            ++       Y +  +      W +A      +  F +  ++ G E  F+V A+NE G   
Sbjct: 7712 NDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGH 7771

Query: 742  PSDTSQ 747
            PS+ ++
Sbjct: 7772 PSEPTE 7777



 Score =  199 bits (506), Expect = 9e-51
 Identities = 178/707 (25%), Positives = 304/707 (42%), Gaps = 53/707 (7%)

Query: 79    LADMEVQPGEAATLSCTLTSDLGPGT-WFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGT 137
             + D+  + GEAA LSC +     P   W++ G +L          DG  H+L +   +  
Sbjct: 24042 MKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQE 24101

Query: 138   QAGRYTFVA----GDQQSEATLTVQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHL 193
               G YT +A    G+ ++ + L +Q +P   P     L+E      G  + + + +    
Sbjct: 24102 DEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYP--LKEKYYGAVGSTLRLHVMYIGR- 24158

Query: 194   PIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKD-CGQYSVTLRSEGGSVQAE 252
             P+ A     G +++ +S+    ++  + YT L + +  RK   G+Y V L +  G+V A 
Sbjct: 24159 PVPAMTWFHGQKLLQNSEN-ITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAI 24217

Query: 253   LTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVG 312
             L +++ DKPD P GP+ ++   +    + W+PP D+GG  +  YVVE+ +A      ++ 
Sbjct: 24218 LDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLV 24277

Query: 313   EAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILV--APEALPKAPSAPAIL 370
              +    TT    ++     Y FRV A  + G  + LE   +++  +P   P AP  P I 
Sbjct: 24278 SSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTIT 24337

Query: 371   SASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQ 430
             + +     + W  P   G A I  Y +E+R+K  N W +V  + + E  ++V ++ +G +
Sbjct: 24338 AVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLE 24397

Query: 431   YEFRVTAVAPSGPGEPGPPSDAVFARD--PMRPPGL---VRNLQVTDRSNTSITLSWAGP 485
             YEFRV      G  E    S+ +  +   P++ P     +RNL V  +SN ++     G 
Sbjct: 24398 YEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGH 24457

Query: 486   DT------QEGDE--AQG--YVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVR 535
                     ++G E  A G  Y ++       Q +   V     T Y             +
Sbjct: 24458 PKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVY-------------Q 24504

Query: 536   VTAVNEGGQSQPSALDTLVQAMPVTV-CPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPM 594
             V A N+GG    +A  +L   +P  +  PK L        L    G+ V + + F   P 
Sbjct: 24505 VRATNQGGSVSGTA--SLEVEVPAKIHLPKTLEGMGAVHALR---GEVVSIKIPFSGKPD 24559

Query: 595   PEVTWLK--DGLPLPKRSVTVTKDGLTQLLIP-VAGLSDSGLYTVVLRTLQGKEVAHSFR 651
             P +TW K  D +        +     T L+ P      D+G Y V  +   G +   +  
Sbjct: 24560 PVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGID-QKTVE 24618

Query: 652   IRVAACPQAPGPIHLQENVPGTVTAEW-EPSPDEAQDVPLHYAVFTRSSAHGPWHEAADR 710
             + VA  P  P  + + +    +V   W EP+ D    +  +Y V   ++    W      
Sbjct: 24619 LDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKI-TNYIVEKCATTAERWLRVGQA 24677

Query: 711   IHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDR 757
               T R+T++ +     Y FRV+A+N+ G SKPS+ S+P      + R
Sbjct: 24678 RET-RYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTR 24723



 Score =  179 bits (453), Expect = 1e-44
 Identities = 119/400 (29%), Positives = 180/400 (45%), Gaps = 7/400 (1%)

Query: 350  SEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTA 409
            S EI V   A P AP        +   + LTW  P   G + + GY++E+R+    TWT 
Sbjct: 6980 SGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTK 7039

Query: 410  VNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQ 469
            V D  V +  +TV D+ QG +Y F+V A    GPGEP    + V    P   P    N++
Sbjct: 7040 VMDF-VTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVK 7098

Query: 470  VTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPG 529
              DR+  SI L+W  P    G   +GY+VE C   S +W+ C    V  T     GL  G
Sbjct: 7099 WRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACG-EPVAETKMEVTGLEEG 7157

Query: 530  EGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSF 589
            + Y  RV A+N  G S+PS     +QA+     P+  +D      LTVK G  + +P + 
Sbjct: 7158 KWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATV 7217

Query: 590  EAMPMPEVTWLKDGLPLPKRSVTVTKDGL---TQLLIPVAGLSDSGLYTVVLRTLQGKEV 646
               P P++TW K  + L K+   +T + +   + + I  +  SD+G Y +    + G+  
Sbjct: 7218 TGKPEPKITWTKADMIL-KQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRAT 7276

Query: 647  AHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHE 706
            A    + V   P  P    + +    +    W P  D+      +Y V  R++    WH+
Sbjct: 7277 A-VVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHK 7335

Query: 707  AADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS 746
             +  +    F    ++P  EY FRV A+N  G  +P   S
Sbjct: 7336 LSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQAS 7375



 Score =  168 bits (426), Expect = 2e-41
 Identities = 155/598 (25%), Positives = 246/598 (41%), Gaps = 56/598 (9%)

Query: 180   GKPVIVKIPFQSHLPIQAAWRK---DGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCG 236
             G P   K+   S   +  AW K   DG   V     E +    D +T  C P  G +   
Sbjct: 18507 GPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTT-CTPPTGLQG-K 18564

Query: 237   QYSVT--------------LRSEGGSVQAELTLQVI--DKPDPPQGPMEVQDCHRAGVCL 280
             Q++VT              + SEG    A L   V+  ++ +PP+  +E+    R  V L
Sbjct: 18565 QFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPE--IELDADLRKVVVL 18622

Query: 281   RWRPPRDNGGRTVECYV-VERRQAGRSTWLKVGEAPAD------STTFTDAHVEPGRKYT 333
             R          T+  +V ++ R      W K      D      +++FT   ++   ++ 
Sbjct: 18623 R-------ASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTMLVIDNVTRFD 18675

Query: 334   ---FRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSA 390
                + +    + G+  A  +  +L +P A    P    I       +TL+W  P   G A
Sbjct: 18676 SGRYNLTLENNSGSKTAFVNVRVLDSPSA----PVNLTIREVKKDSVTLSWEPPLIDGGA 18731

Query: 391   HILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPS 450
              I  Y++E+R+     +  + +    +  + + ++++GC Y FRV A    G G P   +
Sbjct: 18732 KITNYIVEKRETTRKAYATITNN-CTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETT 18790

Query: 451   DAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLP 510
             + V   +P  PPG V  + VT     + T+ W  P++  G +  GYVVE+ +  S +W  
Sbjct: 18791 EPVKVSEPPLPPGRVTLVDVT---RNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWST 18847

Query: 511   CHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSS 570
             C    V     T  GL  GE Y  RV AVNE G+S P  L   V A  + + P   +   
Sbjct: 18848 C--TQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFH 18905

Query: 571   TKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPK--RSVTVTKDGLTQLLIPVAGL 628
             T     VK  + +++ V F+  P   V W KDG  L +  R    +   +T L I  A  
Sbjct: 18906 T---FNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASK 18962

Query: 629   SDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDV 688
              D G Y + +    G  +     I V   P  PGPI + E    ++T  W P   +    
Sbjct: 18963 EDVGTYELCVSNSAG-SITVPITIIVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQ 19021

Query: 689   PLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTS 746
               +Y V  + +    WH  +  +      ++ +  G EY FRV A+N  G S  S++S
Sbjct: 19022 ISNYIVEKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESS 19079



 Score =  166 bits (421), Expect = 7e-41
 Identities = 120/400 (30%), Positives = 179/400 (44%), Gaps = 18/400 (4%)

Query: 361   PKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRW 420
             P  P    +   +   +TLTW  P   G + I  Y++E+R+     ++ V      +  W
Sbjct: 15455 PGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATN-CHKTSW 15513

Query: 421   TVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITL 480
              V  +++GC Y FRV A    G G P   +++V A +   PPG +  + VT     S++L
Sbjct: 15514 KVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITLMDVT---RNSVSL 15570

Query: 481   SWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVN 540
             SW  P+   G    GY+VE+ +  S +W  C   TV VT  T  GL  GE Y  RV+A N
Sbjct: 15571 SWEKPEHDGGSRILGYIVEMQTKGSDKWATC--ATVKVTEATITGLIQGEEYSFRVSAQN 15628

Query: 541   EGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWL 600
             E G S P  L   V A  + + P F +  +T    TV  G+ ++V V F   P P VTW 
Sbjct: 15629 EKGISDPRQLSVPVIAKDLVIPPAFKLLFNT---FTVLAGEDLKVDVPFIGRPTPAVTWH 15685

Query: 601   KDGLPLPK--RSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACP 658
             KD +PL +  R    + +  + L I  A   D G Y V L    G E   +  + V   P
Sbjct: 15686 KDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAG-EAIETLNVIVLDKP 15744

Query: 659   QAP-GPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFT 717
               P GP+ + E    ++T  W P   +      +Y V  R ++   W   +  +      
Sbjct: 15745 GPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIK 15804

Query: 718   LLGILPGHEYHFRVVAKNELGA-----SKPSDTSQPWCIP 752
                +  G EY FR+ A+N  G      S+P+    P+ +P
Sbjct: 15805 ACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVP 15844



 Score =  160 bits (404), Expect = 6e-39
 Identities = 152/602 (25%), Positives = 240/602 (39%), Gaps = 42/602 (6%)

Query: 170   KLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKD----GAEVVGSSDREAQVDLGDG---- 221
             K REP V   G P +VK+   S   +   W K     G E++G      + DLGD     
Sbjct: 21749 KCREP-VNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVN 21807

Query: 222   --------YTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEV--Q 271
                     YT   L +         ++    +G S +   T++ +D+   P+  ++   +
Sbjct: 21808 AEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFK 21867

Query: 272   DCH--RAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADST-TFTDAHVEP 328
               H  RAG  +R        GR     V  +  +  S    +    + ST T  + +   
Sbjct: 21868 QTHVVRAGASIRLFIAYQ--GRPTPTAVWSKPDSNLSLRADIHTTDSFSTLTVENCNRND 21925

Query: 329   GRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQG-ITLTWTAPRGP 387
               KYT  V    + G+     + ++L  P      P  P      ++G  TL W AP   
Sbjct: 21926 AGKYTLTVE--NNSGSKSITFTVKVLDTP-----GPPGPITFKDVTRGSATLMWDAPLLD 21978

Query: 388   GSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPG 447
             G A I  Y++E+R+    +W  ++++    + + V D+ +G  Y FRV+AV   G GEP 
Sbjct: 21979 GGARIHHYVVEKREASRRSWQVISEK-CTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPY 22037

Query: 448   PPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQ 507
                + + A +   PP   R L V D S +S  L+W  PD   G    GY++E+    S  
Sbjct: 22038 EMPEPIVATEQPAPP---RRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDF 22094

Query: 508   WLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLV 567
             W+    G     T+T + L     Y  RV A N+ G S+P    + V      + P   +
Sbjct: 22095 WV--EAGHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADL 22152

Query: 568   DSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKR---SVTVTKDGLTQLLIP 624
                T  L+T K G    + V     P P+VTW  + + L +    S+T TKD  T L + 
Sbjct: 22153 TGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKD-RTTLTVK 22211

Query: 625   VAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDE 684
              +   DSG Y + L    G +      + +       GPI +      +    W    D 
Sbjct: 22212 DSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDG 22271

Query: 685   AQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSD 744
                   +Y V  R S    W      +   +  +  +    EY FRV ++N  G SKP +
Sbjct: 22272 GGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE 22331

Query: 745   TS 746
             ++
Sbjct: 22332 SA 22333



 Score =  158 bits (399), Expect = 2e-38
 Identities = 187/767 (24%), Positives = 303/767 (39%), Gaps = 57/767 (7%)

Query: 103   GTWFKDGVK--LTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDS 160
             G W K   +  + T+  V   Q G  +   ++ + G   G    V G  ++   LT  + 
Sbjct: 21801 GDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPEL 21860

Query: 161   PTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGD 220
                  D+    ++  VV+AG  + + I +Q      A W K  + +       A +   D
Sbjct: 21861 -----DIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNL----SLRADIHTTD 21911

Query: 221   GYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCL 280
              ++ L + +  R D G+Y++T+ +  GS     T++V+D P PP GP+  +D  R    L
Sbjct: 21912 SFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPP-GPITFKDVTRGSATL 21970

Query: 281   RWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVT 340
              W  P  +GG  +  YVVE+R+A R +W  + E       F    +  G  Y FRV AV 
Sbjct: 21971 MWDAPLLDGGARIHHYVVEKREASRRSWQVISE-KCTRQIFKVNDLAEGVPYYFRVSAVN 22029

Query: 341   SEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERR 400
               G GE  E  E +VA E  P  P    ++  S     L W  P   G + I GYL+E R
Sbjct: 22030 EYGVGEPYEMPEPIVATEQ-PAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMR 22088

Query: 401   KKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMR 460
             +KGS+ W  V      +  +TV  + +  +YEFRV A   +G  EP     +V  ++P  
Sbjct: 22089 QKGSDFW--VEAGHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQI 22146

Query: 461   PPGLVRNLQVTDRSNTSITLSWAGPDTQE----GDEAQGYVVELCSSDSLQWLPCHVGTV 516
              P       +T  +N  IT     P T +    G  A     +L      +     + T 
Sbjct: 22147 EP----TADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTT 22202

Query: 517   -PVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLL 575
                TT T K    G+     +T  N  G  +  ++  +V   P  V     V S + +  
Sbjct: 22203 KDRTTLTVKDSMRGDSGRYFLTLENTAG-VKTFSVTVVVIGRPGPVTGPIEVSSVSAESC 22261

Query: 576   TVKVGD------TVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLS 629
              +  G+      T       E        W      + +  + VT   LT+ +     +S
Sbjct: 22262 VLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTH--LTKYMEYSFRVS 22319

Query: 630   DSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVP 689
                 +  V + L+   +         + P  P   H+  N    ++  WE    +     
Sbjct: 22320 SENRFG-VSKPLESAPIIAEHPFVPPSAPTRPEVYHVSAN---AMSIRWEEPYHDGGSKI 22375

Query: 690   LHYAVFTRSSAHGPW--HEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGASKPSDTSQ 747
             + Y V  +      W        +  N + + G++ G EY FR  A N  G SK S+ S+
Sbjct: 22376 IGYWVEKKERNTILWVKENKVPCLECN-YKVTGLVEGLEYQFRTYALNAAGVSKASEASR 22434

Query: 748   PWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGL-RSHLLPQGCECCMSCAVQGSPRPHVT 806
             P  I  Q     V AP    P+++   R  V L  S     G    +   ++  P   V+
Sbjct: 22435 P--IMAQN---PVDAP--GRPEVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKP---VS 22484

Query: 807   WFKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLG 853
                + R L+ N  + S +       T+ ++S  D+ E++ +A+N  G
Sbjct: 22485 EVGDGRWLKCNYTIVSDNF-----FTVTALSEGDTYEFRVLAKNAAG 22526



 Score =  157 bits (397), Expect = 4e-38
 Identities = 114/426 (26%), Positives = 187/426 (43%), Gaps = 14/426 (3%)

Query: 318   STTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGI 377
             +++FT   ++   +Y      +T E +    +S  + V     P  P    +   +   +
Sbjct: 16495 TSSFTSLVLDNVNRYDSGKYTLTLENSS-GTKSAFVTVRVLDTPSPPVNLKVTEITKDSV 16553

Query: 378   TLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTA 437
             ++TW  P   G + I  Y++E+R+    ++ AV      +  W +  +++GC Y FRVTA
Sbjct: 16554 SITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTN-CHKNSWKIDQLQEGCSYYFRVTA 16612

Query: 438   VAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYV 497
                 G G P   +D +   +  +PPG    + V D +  S++LSW  P+   G +   Y+
Sbjct: 16613 ENEYGIGLPAQTADPIKVAEVPQPPG---KITVDDVTRNSVSLSWTKPEHDGGSKIIQYI 16669

Query: 498   VELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAM 557
             VE+ +  S +W  C    V         L  GE Y  RV AVNE G+S P +L   + A 
Sbjct: 16670 VEMQAKHSEKWSEC--ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAK 16727

Query: 558   PVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRS-VTVTKD 616
              + + P      S+    +V+VG  +++ V     P P +TW KDGLPL + + + VT  
Sbjct: 16728 DLVIEPDVKPAFSS---YSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDS 16784

Query: 617   -GLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGTV 674
               LT L I      D G Y + +  + G++ A S  I     P  P GP+   +    ++
Sbjct: 16785 LDLTTLSIKETHKDDGGQYGITVANVVGQKTA-SIEIVTLDKPDPPKGPVKFDDVSAESI 16843

Query: 675   TAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAK 734
             T  W P          +Y V  R +    W   +  +      +  +  G EY FR+ A+
Sbjct: 16844 TLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFAE 16903

Query: 735   NELGAS 740
             N  G S
Sbjct: 16904 NRYGQS 16909



 Score =  155 bits (393), Expect = 1e-37
 Identities = 118/417 (28%), Positives = 184/417 (44%), Gaps = 44/417 (10%)

Query: 379  LTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAV 438
            LTW  P   G   IL Y++ERR+ G  T+  V      +  WTV D+    +Y FRV AV
Sbjct: 8001 LTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGE-NKLSWTVKDLIPNGEYFFRVKAV 8059

Query: 439  APSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVV 498
               G GE     + V A+DP +PP    +++V + +  ++T++W  P    G +  GY++
Sbjct: 8060 NKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYII 8119

Query: 499  ELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMP 558
            E  +    +W  C+   VP+ TYTAKGL  G+ Y  RV A N  G S+PS      +A+ 
Sbjct: 8120 EKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVD 8179

Query: 559  VTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDG--------------- 603
                PK ++ +S    L VK GD + +  S    P P +TW+KD                
Sbjct: 8180 PIDAPKVILRTS----LEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPL 8235

Query: 604  ---------------LPLPKR-SVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVA 647
                           LPL +R S+  +K G +QL +  +   D GLY + +    G   A
Sbjct: 8236 VRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKA 8295

Query: 648  HSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAV--FTRSSAHGPWH 705
                + V   P  P     ++    +V  +WEP  D+     ++Y +    ++     W 
Sbjct: 8296 -PCTVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWI 8354

Query: 706  EAADRIHTNRFTLLGILPGHEYHFRVVAKNELG-----ASKPSDTSQPWCIPRQRDR 757
                 +   ++++  ++ G EY FRV A+N  G      SKP     P+  P   D+
Sbjct: 8355 VVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDPFGPPDAPDK 8411



 Score =  155 bits (391), Expect = 2e-37
 Identities = 119/424 (28%), Positives = 186/424 (43%), Gaps = 39/424 (9%)

Query: 379  LTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERR--WTVADVRQGCQYEFRVT 436
            L W+ P   G + I G++IER+    +TW     QP+   R    +  + +G +Y+FRV 
Sbjct: 8718 LNWSDPEDDGGSEITGFIIERKDAKMHTWR----QPIETERSKCDITGLLEGQEYKFRVI 8773

Query: 437  AVAPSGPGEP---GPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEA 493
            A    G G P   GP    + A DP+ PP     L  T+R+ ++ITL W  P +  G   
Sbjct: 8774 AKNKFGCGPPVEIGP----ILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPI 8829

Query: 494  QGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPS-ALDT 552
            QGY++E    D   +   +    P T++  + L   + Y  RV AVNE G+S+PS  L+ 
Sbjct: 8830 QGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNV 8889

Query: 553  LVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLK---------DG 603
            ++Q   V    K  + S   D + VK G+ V +P     +PMP++ W K         D 
Sbjct: 8890 VIQDDEVPPTIKLRL-SVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDA 8948

Query: 604  LPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGP 663
            L + K  V+   +  T+L IP A   D G YTV      G  V  +  + V   P  P  
Sbjct: 8949 LQITKEEVS-RSEAKTELSIPKAVREDKGTYTVTASNRLG-SVFRNVHVEVYDRPSPPRN 9006

Query: 664  IHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAH--GPWHEAADRIHTNRFTLLGI 721
            + + +    +    W+   D       HY +  R ++     W E  +     R+ +  +
Sbjct: 9007 LAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKRYGIWKL 9066

Query: 722  LPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLR 781
            +P  +Y FRV A N+ G S             + D+  ++ P YR P    KP+ L   +
Sbjct: 9067 IPNGQYEFRVRAVNKYGISDEC----------KSDKVVIQDP-YRLPGPPGKPKVLARTK 9115

Query: 782  SHLL 785
              +L
Sbjct: 9116 GSML 9119



 Score =  152 bits (385), Expect = 1e-36
 Identities = 95/326 (29%), Positives = 165/326 (50%), Gaps = 7/326 (2%)

Query: 157  VQDSPTIAPDVTEKLREPLVVKAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQV 216
            V   P   P +  +  + +V++ G+ + + +PF++      +W KDG EV  S     + 
Sbjct: 7882 VAKDPDCKPTIDLETHDIIVIE-GEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKN 7940

Query: 217  DLGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRA 276
            D    +  L +P + R D G Y++TL ++ GS  A + ++VI  P P +  ++  D  ++
Sbjct: 7941 DHISAH--LEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKD-IKASDITKS 7997

Query: 277  GVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPGRKYTFRV 336
               L W PP  +GG  +  YV+ERR+AGR T++ V     +  ++T   + P  +Y FRV
Sbjct: 7998 SCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGE-NKLSWTVKDLIPNGEYFFRV 8056

Query: 337  RAVTSEGAGEALESEEILVA--PEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILG 394
            +AV   G GE +E +  ++A  P+  P  P    + + +++ +T+TW  P   G + I+G
Sbjct: 8057 KAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMG 8116

Query: 395  YLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVF 454
            Y+IE+  KG   W   N+  VP   +T   + +G +Y+FRV A   +G  EP   +    
Sbjct: 8117 YIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTK 8176

Query: 455  ARDPMRPPGLVRNLQVTDRSNTSITL 480
            A DP+  P ++    +  +    I L
Sbjct: 8177 AVDPIDAPKVILRTSLEVKRGDEIAL 8202



 Score =  152 bits (384), Expect = 1e-36
 Identities = 117/462 (25%), Positives = 188/462 (40%), Gaps = 33/462 (7%)

Query: 318   STTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGI 377
             S T  +A+     KYT  ++ V S        S  ++V     P  P+   +   + +  
Sbjct: 19744 SLTIENANRNDSGKYTLTIQNVLSAA------SLTLVVKVLDTPGPPTNITVQDVTKESA 19797

Query: 378   TLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTA 437
              L+W  P   G A +  Y IE+R+     W +V +       + V ++++G  Y FRV+ 
Sbjct: 19798 VLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNN-CNRLSYKVTNLQEGAIYYFRVSG 19856

Query: 438   VAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYV 497
                 G G P    + V   +   PP     L VT  S  S++L+W  P+   G     YV
Sbjct: 19857 ENEFGVGIPAETKEGVKITEKPSPP---EKLGVTSISKDSVSLTWLKPEHDGGSRIVHYV 19913

Query: 498   VELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAM 557
             VE        W+ C V     T +   GLR    YF RV A N+ G S P  L   V   
Sbjct: 19914 VEALEKGQKNWVKCAVAKS--THHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIK 19971

Query: 558   PVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDGLPLP---KRSVTVT 614
                  P+  + +     + V+ G  ++V +     P+P+VT  +DG+PL    + +  +T
Sbjct: 19972 EQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEIT 20031

Query: 615   KDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAP-GPIHLQENVPGT 673
              + LT + +  +  +D+G Y +      G   A    I V   P  P GP+ + +    +
Sbjct: 20032 AENLT-INLKESVTADAGRYEITAANSSGTTKAF-INIVVLDRPGPPTGPVVISDITEES 20089

Query: 674   VTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVA 733
             VT +WEP   +      +Y +  R ++   W E +  +      ++ +  G EY FR+ A
Sbjct: 20090 VTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKA 20149

Query: 734   KNELGAS---------------KPSDTSQPWCIPRQRDRFTV 760
             +N  G S                P   S PW     R+  TV
Sbjct: 20150 ENRFGISDHIDSACVTVKLPYTTPGPPSTPWVTNVTRESITV 20191



 Score =  150 bits (379), Expect = 5e-36
 Identities = 119/443 (26%), Positives = 184/443 (41%), Gaps = 32/443 (7%)

Query: 321   FTD-AHVEPGRKYT--------------FRVRAVTSEGAGEALESEEILVAPEALPKAPS 365
             FTD   +E G  YT              + ++   S G+  A  + ++L  P      P 
Sbjct: 17568 FTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGP----PQ 17623

Query: 366   APAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADV 425
               A+         L W  P   G A +  Y+I++R+     +  V+ +   +  + V ++
Sbjct: 17624 NLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSK-CSKTSFKVENL 17682

Query: 426   RQGCQYEFRVTAVAPSGPGEPGPPSDAVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGP 485
              +G  Y FRV A